4TW7A

The fk1 domain of fkbp51 in complex with ifit4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 29
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw7A00
1FJDA 4ODPA 4LAVA 3TDBA 2OFNA 3O5MA 4J4OA 3O5PA 4ODMA 3UF8A 1JNTA 4DIPA 5B8IC 2F21A 5DIVA 4FN2A 2MNTA 4U84A 1FKRA 1FD9A 1Q6IA 2PV1A 3IK8A 3UQAA 1B6CA 2VCDA 4TW7A 4DRPA 4ODQA 4ODRA 5HUAA 1FKTA 3WH0A 1FKIA 3UI6A 2KR7A 1TCOC 4DRQA 1EYMA 1T11A 4DRHA 1QZ2A 2ITKA 3KABA 3UQIA 5I98A 5J6EA 5DITA 1EQ3A 1P5QA 1FKLA 3O5GA 3UI5A 1FAPA 2F4EA 2PV2A 3VAWA 1JVWA 1FKBA 3PRBA 4ODLA 3FAPA 4TW6A 5HT1A 1ZK6A 4U85A 1FKDA 2KO7A 2XP5A 4U86A 3KAGA 3O5OA 1FKFA 5D75A 2MLZA 2VN1A 1D7JA 3NI6A 2ZQUA 2M08A 3KCEA 4DRIA 2LJ4A 4FAPA 1NMWA 2IF4A 1PINA 1QPLA 3RFWA 4TW8A 1A7XA 4DRKA 1HXVA 4JFJA 2RUCA 4DH0A 2KE0A 1FKSA 1KT0A 2DG3A 2XP4A 1BL4A 3O5EA 4LAWA 5HWCA 2N87A 2Y78A 4JYSA 1C9HA 4IPXA 2Q5AA 1BKFA 3KADA 2ZR4A 4TX0A 2XPBA 1L1PA 4DRNA 4LAYA 4O2TA 3CGNA 5HKGA 3JXVA 2RUDA 3KAIA 1YW5A 4IQCA 3IKDA 3O5FA 2XP7A 4JFKA 2KI3A 3O5IA 4QT3A 2RSEA 3MDYB 5HW6A 2DG4A 4MSPA 4W9PA 1M5YA 1ROTA 4ODNA 3B7XA 4DROA 4JFMA 1ROUA 4R0XA 4C02B 3IHZA 2PV3A 4JFLA 1FKJA 5BXJA 3O5RA 3O5DA 2XP9A 1D7HA 3H9RB 4J4NA 3CGMA 3JYJA 2JZVA 3O5KA 1FKGA 1PBKA 2L2SA 1Q1CA 2D9FA 2MLYA 2ZQVA 2PBCA 2K8IA 2AWGA 5HW8A 4GGQA 2FAPA 4G50A 3TC5A 1J4RA 4TNSA 4W9QA 1D6OA 1J6YA 2PPPA 2XP8A 1FKKA 2MLXA 2DG9A 2M1IA 1N1AA 3O5LA 4TYOA 4ODOA 4QT2A 1J4HA 4N19A 2MPHA 3TCZA 2PPNA 5HTGA 3NTPA 2ZR6A 1FKHA 5GPGA 4JFIA 2KFWA 1Q6UA 1U79A 3LUOA 3NRKA 3UI4A 1F40A 3KAFA 2RUQA 3O5QA 4ODKA 2M2AA 2MF9A 1R9HA 1F8AB 4DRJA 2RURA 3KACA 3PRDA 5DIUA 4ITZA 2F2DA 3EY6A 1Y0OA 4LAXA 4BF8A 2XP3A 3KAHA 4G2PA 1NMVA 2LKNA 2LGOA 2XP6A 1D7IA 1KT1A 2PPOA 2ZR5A 3IKGA 3O5JA 4DRMA 2LPVA 4DT4A 3I6CA 4GIVA 2FKEA 2ZQTA 3ODKA 1J4IA 1QPFA 3OOBA 5HW7A 4MGVA 4QIBA 3UQBA 2XPAA 1NSGA 2ZQSA 3GPKA 3PA7A 4IQ2A 4NNRA 3RGCA 1JNSA 1ZCNA 2RQSA 4DZ3A 5HWBA 1Q6HA 2KGJA 2UZ5A 3JYMA 4DZ2A 1YATA 3KZ7A 4W9OA 1W26A
chains in the Genus database with same CATH superfamily
1FFRA 4R5EA 4L72B 3TDBA 4J4OA 3UF8A 3WL1A 3ALFA 1HJXA 1E44A 3RM8A 3AS2A 3IK8A 3UQAA 4DRPA 5HUAA 2KR7A 1TCOC 4DRQA 3ARSA 3KABA 4P8XA 1FKLA 4KQZA 1XHGA 2PV2A 3VAWA 1JVWA 1FKBA 4MAVA 5HT1A 1ZK6A 1ZB5A 3CHDA 1FKFA 5D75A 1XRVA 4MNMA 1EIBA 4Q22A 3RFWA 1QPLA 2A3BA 2DSZA 2PI6A 4DRKA 4DH0A 2KE0A 2O9OA 1FKSA 2DG3A 2WLYA 1BL4A 3WD4A 2B31A 2A3EA 1JNEA 2ZR4A 1L1PA 4LAYA 4ZS6A 1E6RA 3CGNA 5HKGA 2G41A 3KAIA 4JFKA 2KI3A 3MDYB 4Z2IA 1GRJA 3WL0A 2DG4A 5HW6A 4W9PA 1M5YA 3G6MA 4DROA 2IUZA 4JFMA 4C02B 3IHZA 1FKJA 3O5DA 2XP9A 3H9RB 4J4NA 4HBOA 1FKGA 4MNJA 4GGQA 3TC5A 4G50A 3G6LA 4TNSA 1E6ZA 4DWSD 2MLXA 4PTMA 4Z2LA 4ODOA 4N19A 2PPNA 5HTGA 4P8UA 2DT1A 3UI4A 1H0GA 2RUQA 4ODKA 1W1YA 2M2AA 2DSVA 2MF9A 1OWQA 4DRJA 2RURA 1GOIA 1ZU8A 4ITZA 4Z2HA 4LAXA 1Y0OA 2B5UB 2XP3A 1LG2A 1NWRA 4G2PA 1NMVA 2LKNA 4WKFA 1D7IA 4DT4A 3ARXA 1HKMA 1W9VA 2DPEA 3I6CA 3AS0A 3GTYX 3GPKA 3ARUA 1ZL1A 4MTVA 2KGJA 4S3KA 2DSUA 2DT3A 1W26A 1Q6UA 2EULA 1HKJA 5GPRA 3WD3A 3AS3A 2OFNA 4ODMA 5B8IC 1HJVA 1E9LA 2MNTA 1IX5A 1Q6IA 4TW7A 1ZBCA 4ODQA 1FKIA 3UI6A 1EYMA 3WD1A 1OGGA 4WKHA 2PN0A 4ZPVR 5J6EA 1LL6A 3UI5A 5GQBA 3PRBA 3FAPA 4UDMA 1ZBVA 2VN1A 3RM9A 2ZQUA 2IF4A 1HXVA 2RUCA 4LAWA 4MPKA 2Y78A 2Q5AA 1UR9A 4WKAA 3KADA 4DRNA 3B8SA 4O2TA 1H0IA 3JXVA 4WK9A 4HBEA 1CTNA 4MSPA 1LL7A 1ROTA 4ODNA 4MNKA 3AROA 4ZPWR 1UR8A 1ZBWA 1JCHB 1D7HA 1WAWA 3ARZA 1Q1CA 2D9FA 2WK2A 2K8IA 5HW8A 5DEZA 2FAPA 1D6OA 2DG9A 2M1IA 1X6NA 2OLHA 1J4HA 3NTPA 2ZR6A 1FKHA 3B9DA 5GPGA 4JFIA 3LUOA 1F40A 3KAFA 4Z2KA 3O5QA 3ARWA 2G8ZA 1F8AB 4Z2GA 4BF8A 3OA5A 1W1VA 2LGOA 1W1PA 2XP6A 4ML4A 2WM0A 2ZR5A 3CHEA 1NWUA 1J4IA 1QPFA 4QIBA 3UQBA 1NSGA 4IQ2A 1WNOA 2RQSA 3JYMA 1YATA 1SR0A 3ARYA 4NSBA 3WQVA 4ODPA 4LAVA 3WKZA 3RMEA 3O5MA 3O5PA 2F21A 5DIVA 1FD9A 3BMBA 2YBUA 1B6CA 2VCDA 4ODRA 3WH0A 1QZ2A 5I98A 1NWSA 5DITA 1EQ3A 1P5QA 3O5GA 1JNDA 2F4EA 4ODLA 2FDMA 4U85A 4ZPTR 1FKDA 2F23A 2WLZA 2KO7A 1ITXA 4U86A 3KAGA 3O5OA 3WQWA 3NI6A 1OGBA 3ARQA 2M08A 2LJ4A 1NMWA 1PINA 4Z2JA 4JFJA 1KT0A 1LL4A 2N87A 4JYSA 5DO2A 1C9HA 3WD0A 2XPBA 1W9PA 1SYTA 1YW5A 3IKDA 2XP7A 3O5IA 2RSEA 2A3AA 3B9AA 3B7XA 2A3CA 4JFLA 5BXJA 3O5RA 1HJWA 3PR9A 2JZVA 3O5KA 1FFQA 2PBCA 2AWGA 1J4RA 1HKIA 4W9QA 1J6YA 2PPPA 1EDQA 4TYOA 4NZCA 2DT0A 3CHCA 3QOKA 1U79A 1VF8A 1K9TA 1TFVA 1R9HA 3W4RA 4DWSB 1W1TA 4S3JA 2PPOA 1KT1A 3O5JA 4DRMA 1E15A 2LPVA 3ARVA 1LG1A 3ODKA 3OOBA 3GU0A 2AOSA 3PA7A 4NNRA 1E6NA 1JNSA 4DZ3A 1Q6HA 2UZ5A 3KZ7A 4W9OA 1FJDA 4KR0B 4DIPA 1JNTA 2ETNA 3CZ8A 1KFWA 4FN2A 1LJYA 4U84A 1FKRA 2PV1A 1NH6A 1WB0A 2DSWA 4P8WA 1FKTA 2DT2A 4DRHA 3FXYA 1T11A 4HARA 4DWSA 2ITKA 3UQIA 1RD6A 3WIJA 4Q7NA 1FAPA 4TW6A 1LQ0A 4WJXA 4WIWA 1GUVA 3ALGA 2XP5A 2MLZA 1D7JA 3FY1A 3KCEA 2P4VA 3CHFA 4DRIA 4FAPA 4TW8A 1A7XA 2XP4A 3O5EA 5HWCA 4MNLA 3WD2A 4P8VA 4IPXA 1BKFA 4TX0A 5DF0A 3B9EA 2ESCA 3AS1A 4AY1A 2RUDA 4IQCA 3O5FA 1E6PA 4QT3A 4L3NA 5HBFA 1ZBKA 1ROUA 4R0XA 2PV3A 1EHNA 1O6IA 3ARTA 3CGMA 1PBKA 2MLYA 2L2SA 3CH9A 2ZQVA 4XAKA 2XP8A 1FKKA 1N1AA 3O5LA 4QT2A 3TCZA 2MPHA 4IT6A 4W5UA 4IT4A 1X6LA 2KFWA 1D2KA 3NRKA 3ARPA 3AQUA 1NWTA 4DWSC 5JH8A 3KACA 4URIA 3PRDA 5DIUA 2F2DA 2QF8A 3EY6A 2YBTA 3KAHA 4QZVB 3IKGA 2O92A 3EIPA 1HKKA 4GIVA 2FKEA 2ZQTA 5HW7A 4MGVA 3ARRA 2XPAA 2ZQSA 4LGXA 3RGCA 3BXWA 3RM4A 3PRAA 1ZCNA 5HWBA 4DZ2A 1GPFA 3JYJA 1W9UA
chains in the Genus database with same CATH topology
1FFRA 4R5EA 4L72B 3TDBA 4J4OA 3UF8A 3WL1A 3ALFA 1HJXA 3RM8A 3AS2A 3IK8A 3UQAA 4DRPA 5HUAA 2KR7A 1TCOC 4DRQA 3ARSA 3KABA 4P8XA 1FKLA 4KQZA 1XHGA 2PV2A 3VAWA 1JVWA 1FKBA 4MAVA 5HT1A 1ZK6A 1ZB5A 3CHDA 1FKFA 5D75A 1XRVA 4MNMA 1EIBA 4Q22A 3RFWA 1QPLA 2A3BA 2DSZA 2PI6A 4DRKA 4DH0A 2KE0A 2O9OA 1FKSA 2DG3A 2WLYA 1BL4A 3WD4A 2B31A 2A3EA 1JNEA 2ZR4A 1L1PA 4LAYA 4ZS6A 1E6RA 3CGNA 5HKGA 2G41A 3KAIA 4JFKA 2KI3A 3MDYB 4Z2IA 3WL0A 2DG4A 5HW6A 4W9PA 1M5YA 3G6MA 4DROA 2IUZA 4JFMA 4C02B 3IHZA 1FKJA 3O5DA 2XP9A 3H9RB 4J4NA 4HBOA 1FKGA 4MNJA 4GGQA 3TC5A 4G50A 3G6LA 4TNSA 1E6ZA 4DWSD 2MLXA 4PTMA 4Z2LA 4ODOA 4N19A 2PPNA 5HTGA 4P8UA 2DT1A 3UI4A 1H0GA 2RUQA 4ODKA 1W1YA 2M2AA 2DSVA 2MF9A 1OWQA 4DRJA 2RURA 1GOIA 1ZU8A 4ITZA 4Z2HA 4LAXA 1Y0OA 2XP3A 1LG2A 1NWRA 4G2PA 1NMVA 2LKNA 4WKFA 1D7IA 4DT4A 3ARXA 1HKMA 1W9VA 2DPEA 3I6CA 3AS0A 3GPKA 3ARUA 1ZL1A 4MTVA 2KGJA 4S3KA 2DSUA 2DT3A 1W26A 1Q6UA 1HKJA 5GPRA 3WD3A 3AS3A 2OFNA 4ODMA 5B8IC 1HJVA 1E9LA 2MNTA 1IX5A 1Q6IA 4TW7A 1ZBCA 4ODQA 1FKIA 3UI6A 1EYMA 3WD1A 1OGGA 4WKHA 4ZPVR 5J6EA 1LL6A 3UI5A 5GQBA 3PRBA 3FAPA 1ZBVA 2VN1A 3RM9A 2ZQUA 2IF4A 1HXVA 2RUCA 4LAWA 4MPKA 2Y78A 2Q5AA 1UR9A 4WKAA 3KADA 4DRNA 3B8SA 4O2TA 1H0IA 3JXVA 4WK9A 4HBEA 1CTNA 4MSPA 1LL7A 1ROTA 4ODNA 4MNKA 3AROA 4ZPWR 1UR8A 1ZBWA 1D7HA 1WAWA 3ARZA 1Q1CA 2D9FA 2WK2A 2K8IA 5HW8A 5DEZA 2FAPA 1D6OA 2DG9A 2M1IA 1X6NA 2OLHA 1J4HA 3NTPA 2ZR6A 1FKHA 3B9DA 5GPGA 4JFIA 3LUOA 1F40A 3KAFA 4Z2KA 3O5QA 3ARWA 2G8ZA 1F8AB 4Z2GA 4BF8A 3OA5A 1W1VA 2LGOA 1W1PA 2XP6A 4ML4A 2WM0A 2ZR5A 3CHEA 1NWUA 1J4IA 1QPFA 4QIBA 3UQBA 1NSGA 4IQ2A 1WNOA 2RQSA 3JYMA 1YATA 1SR0A 3ARYA 4NSBA 3WQVA 4ODPA 4LAVA 3WKZA 3RMEA 3O5MA 3O5PA 2F21A 5DIVA 1FD9A 2YBUA 1B6CA 2VCDA 4ODRA 3WH0A 1QZ2A 5I98A 1NWSA 5DITA 1EQ3A 1P5QA 3O5GA 1JNDA 2F4EA 4ODLA 2FDMA 4U85A 4ZPTR 1FKDA 2WLZA 2KO7A 1ITXA 4U86A 3KAGA 3O5OA 3WQWA 3NI6A 1OGBA 3ARQA 2M08A 2LJ4A 1NMWA 1PINA 4Z2JA 4JFJA 1KT0A 1LL4A 2N87A 4JYSA 5DO2A 1C9HA 3WD0A 2XPBA 1W9PA 1SYTA 1YW5A 3IKDA 2XP7A 3O5IA 2RSEA 2A3AA 3B9AA 3B7XA 2A3CA 4JFLA 5BXJA 3O5RA 1HJWA 3PR9A 2JZVA 3O5KA 1FFQA 2PBCA 2AWGA 1J4RA 1HKIA 4W9QA 1J6YA 2PPPA 1EDQA 4TYOA 4NZCA 2DT0A 3CHCA 3QOKA 1U79A 1VF8A 1K9TA 1TFVA 1R9HA 3W4RA 4DWSB 1W1TA 4S3JA 2PPOA 1KT1A 3O5JA 4DRMA 1E15A 2LPVA 3ARVA 1LG1A 3ODKA 3OOBA 2AOSA 3PA7A 4NNRA 1E6NA 1JNSA 4DZ3A 1Q6HA 2UZ5A 3KZ7A 4W9OA 1FJDA 4KR0B 4DIPA 1JNTA 3CZ8A 1KFWA 4FN2A 1LJYA 4U84A 1FKRA 2PV1A 1NH6A 1WB0A 2DSWA 4P8WA 1FKTA 2DT2A 4DRHA 3FXYA 1T11A 4HARA 4DWSA 2ITKA 3UQIA 1RD6A 3WIJA 4Q7NA 1FAPA 4TW6A 1LQ0A 4WJXA 4WIWA 1GUVA 3ALGA 2XP5A 2MLZA 1D7JA 3FY1A 3KCEA 3CHFA 4DRIA 4FAPA 4TW8A 1A7XA 2XP4A 3O5EA 5HWCA 4MNLA 3WD2A 4P8VA 4IPXA 1BKFA 4TX0A 5DF0A 3B9EA 2ESCA 3AS1A 4AY1A 2RUDA 4IQCA 3O5FA 1E6PA 4QT3A 4L3NA 5HBFA 1ZBKA 1ROUA 4R0XA 2PV3A 1EHNA 1O6IA 3ARTA 3CGMA 1PBKA 2MLYA 2L2SA 3CH9A 2ZQVA 4XAKA 2XP8A 1FKKA 1N1AA 3O5LA 4QT2A 3TCZA 2MPHA 4IT6A 4W5UA 4IT4A 1X6LA 2KFWA 1D2KA 3NRKA 3ARPA 3AQUA 1NWTA 4DWSC 5JH8A 3KACA 4URIA 3PRDA 5DIUA 2F2DA 2QF8A 3EY6A 2YBTA 3KAHA 4QZVB 3IKGA 2O92A 1HKKA 4GIVA 2FKEA 2ZQTA 5HW7A 4MGVA 3ARRA 2XPAA 2ZQSA 4LGXA 3RGCA 3BXWA 3RM4A 3PRAA 1ZCNA 5HWBA 4DZ2A 1GPFA 3JYJA 1W9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJD A;  4ODP A;  4LAV A;  3TDB A;  2OFN A;  3O5M A;  4J4O A;  3O5P A;  4ODM A;  3UF8 A;  1JNT A;  4DIP A;  5B8I C;  2F21 A;  5DIV A;  4FN2 A;  2MNT A;  4U84 A;  1FKR A;  1FD9 A;  1Q6I A;  2PV1 A;  3IK8 A;  3UQA A;  1B6C A;  2VCD A;  4TW7 A;  4DRP A;  4ODQ A;  4ODR A;  5HUA A;  1FKT A;  3WH0 A;  1FKI A;  3UI6 A;  2KR7 A;  1TCO C;  4DRQ A;  1EYM A;  1T11 A;  4DRH A;  1QZ2 A;  2ITK A;  3KAB A;  3UQI A;  5I98 A;  5J6E A;  5DIT A;  1EQ3 A;  1P5Q A;  1FKL A;  3O5G A;  3UI5 A;  1FAP A;  2F4E A;  2PV2 A;  3VAW A;  1JVW A;  1FKB A;  3PRB A;  4ODL A;  3FAP A;  4TW6 A;  5HT1 A;  1ZK6 A;  4U85 A;  1FKD A;  2KO7 A;  2XP5 A;  4U86 A;  3KAG A;  3O5O A;  1FKF A;  5D75 A;  2MLZ A;  2VN1 A;  1D7J A;  3NI6 A;  2ZQU A;  2M08 A;  3KCE A;  4DRI A;  2LJ4 A;  4FAP A;  1NMW A;  2IF4 A;  1PIN A;  1QPL A;  3RFW A;  4TW8 A;  1A7X A;  4DRK A;  1HXV A;  4JFJ A;  2RUC A;  4DH0 A;  2KE0 A;  1FKS A;  1KT0 A;  2DG3 A;  2XP4 A;  1BL4 A;  3O5E A;  4LAW A;  5HWC A;  2N87 A;  2Y78 A;  4JYS A;  1C9H A;  4IPX A;  2Q5A A;  1BKF A;  3KAD A;  2ZR4 A;  4TX0 A;  2XPB A;  1L1P A;  4DRN A;  4LAY A;  4O2T A;  3CGN A;  5HKG A;  3JXV A;  2RUD A;  3KAI A;  1YW5 A;  4IQC A;  3IKD A;  3O5F A;  2XP7 A;  4JFK A;  2KI3 A;  3O5I A;  4QT3 A;  2RSE A;  3MDY B;  5HW6 A;  2DG4 A;  4MSP A;  4W9P A;  1M5Y A;  1ROT A;  4ODN A;  3B7X A;  4DRO A;  4JFM A;  1ROU A;  4R0X A;  4C02 B;  3IHZ A;  2PV3 A;  4JFL A;  1FKJ A;  5BXJ A;  3O5R A;  3O5D A;  2XP9 A;  1D7H A;  3H9R B;  4J4N A;  3CGM A;  3JYJ A;  2JZV A;  3O5K A;  1FKG A;  1PBK A;  2L2S A;  1Q1C A;  2D9F A;  2MLY A;  2ZQV A;  2PBC A;  2K8I A;  2AWG A;  5HW8 A;  4GGQ A;  2FAP A;  4G50 A;  3TC5 A;  1J4R A;  4TNS A;  4W9Q A;  1D6O A;  1J6Y A;  2PPP A;  2XP8 A;  1FKK A;  2MLX A;  2DG9 A;  2M1I A;  1N1A A;  3O5L A;  4TYO A;  4ODO A;  4QT2 A;  1J4H A;  4N19 A;  2MPH A;  3TCZ A;  2PPN A;  5HTG A;  3NTP A;  2ZR6 A;  1FKH A;  5GPG A;  4JFI A;  2KFW A;  1Q6U A;  1U79 A;  3LUO A;  3NRK A;  3UI4 A;  1F40 A;  3KAF A;  2RUQ A;  3O5Q A;  4ODK A;  2M2A A;  2MF9 A;  1R9H A;  1F8A B;  4DRJ A;  2RUR A;  3KAC A;  3PRD A;  5DIU A;  4ITZ A;  2F2D A;  3EY6 A;  1Y0O A;  4LAX A;  4BF8 A;  2XP3 A;  3KAH A;  4G2P A;  1NMV A;  2LKN A;  2LGO A;  2XP6 A;  1D7I A;  1KT1 A;  2PPO A;  2ZR5 A;  3IKG A;  3O5J A;  4DRM A;  2LPV A;  4DT4 A;  3I6C A;  4GIV A;  2FKE A;  2ZQT A;  3ODK A;  1J4I A;  1QPF A;  3OOB A;  5HW7 A;  4MGV A;  4QIB A;  3UQB A;  2XPA A;  1NSG A;  2ZQS A;  3GPK A;  3PA7 A;  4IQ2 A;  4NNR A;  3RGC A;  1JNS A;  1ZCN A;  2RQS A;  4DZ3 A;  5HWB A;  1Q6H A;  2KGJ A;  2UZ5 A;  3JYM A;  4DZ2 A;  1YAT A;  3KZ7 A;  4W9O A;  1W26 A; 
#chains in the Genus database with same CATH topology
 1FFR A;  4R5E A;  4L72 B;  3TDB A;  4J4O A;  3UF8 A;  3WL1 A;  3ALF A;  1HJX A;  1E44 A;  3RM8 A;  3AS2 A;  3IK8 A;  3UQA A;  4DRP A;  5HUA A;  2KR7 A;  1TCO C;  4DRQ A;  3ARS A;  3KAB A;  4P8X A;  1FKL A;  4KQZ A;  1XHG A;  2PV2 A;  3VAW A;  1JVW A;  1FKB A;  4MAV A;  5HT1 A;  1ZK6 A;  1ZB5 A;  3CHD A;  1FKF A;  5D75 A;  1XRV A;  4MNM A;  1EIB A;  4Q22 A;  3RFW A;  1QPL A;  2A3B A;  2DSZ A;  2PI6 A;  4DRK A;  4DH0 A;  2KE0 A;  2O9O A;  1FKS A;  2DG3 A;  2WLY A;  1BL4 A;  3WD4 A;  2B31 A;  2A3E A;  1JNE A;  2ZR4 A;  1L1P A;  4LAY A;  4ZS6 A;  1E6R A;  3CGN A;  5HKG A;  2G41 A;  3KAI A;  4JFK A;  2KI3 A;  3MDY B;  4Z2I A;  1GRJ A;  3WL0 A;  2DG4 A;  5HW6 A;  4W9P A;  1M5Y A;  3G6M A;  4DRO A;  2IUZ A;  4JFM A;  4C02 B;  3IHZ A;  1FKJ A;  3O5D A;  2XP9 A;  3H9R B;  4J4N A;  4HBO A;  1FKG A;  4MNJ A;  4GGQ A;  3TC5 A;  4G50 A;  3G6L A;  4TNS A;  1E6Z A;  4DWS D;  2MLX A;  4PTM A;  4Z2L A;  4ODO A;  4N19 A;  2PPN A;  5HTG A;  4P8U A;  2DT1 A;  3UI4 A;  1H0G A;  2RUQ A;  4ODK A;  1W1Y A;  2M2A A;  2DSV A;  2MF9 A;  1OWQ A;  4DRJ A;  2RUR A;  1GOI A;  1ZU8 A;  4ITZ A;  4Z2H A;  4LAX A;  1Y0O A;  2B5U B;  2XP3 A;  1LG2 A;  1NWR A;  4G2P A;  1NMV A;  2LKN A;  4WKF A;  1D7I A;  4DT4 A;  3ARX A;  1HKM A;  1W9V A;  2DPE A;  3I6C A;  3AS0 A;  3GTY X;  3GPK A;  3ARU A;  1ZL1 A;  4MTV A;  2KGJ A;  4S3K A;  2DSU A;  2DT3 A;  1W26 A;  1Q6U A;  2EUL A;  1HKJ A;  5GPR A;  3WD3 A;  3AS3 A;  2OFN A;  4ODM A;  5B8I C;  1HJV A;  1E9L A;  2MNT A;  1IX5 A;  1Q6I A;  4TW7 A;  1ZBC A;  4ODQ A;  1FKI A;  3UI6 A;  1EYM A;  3WD1 A;  1OGG A;  4WKH A;  2PN0 A;  4ZPV R;  5J6E A;  1LL6 A;  3UI5 A;  5GQB A;  3PRB A;  3FAP A;  4UDM A;  1ZBV A;  2VN1 A;  3RM9 A;  2ZQU A;  2IF4 A;  1HXV A;  2RUC A;  4LAW A;  4MPK A;  2Y78 A;  2Q5A A;  1UR9 A;  4WKA A;  3KAD A;  4DRN A;  3B8S A;  4O2T A;  1H0I A;  3JXV A;  4WK9 A;  4HBE A;  1CTN A;  4MSP A;  1LL7 A;  1ROT A;  4ODN A;  4MNK A;  3ARO A;  4ZPW R;  1UR8 A;  1ZBW A;  1JCH B;  1D7H A;  1WAW A;  3ARZ A;  1Q1C A;  2D9F A;  2WK2 A;  2K8I A;  5HW8 A;  5DEZ A;  2FAP A;  1D6O A;  2DG9 A;  2M1I A;  1X6N A;  2OLH A;  1J4H A;  3NTP A;  2ZR6 A;  1FKH A;  3B9D A;  5GPG A;  4JFI A;  3LUO A;  1F40 A;  3KAF A;  4Z2K A;  3O5Q A;  3ARW A;  2G8Z A;  1F8A B;  4Z2G A;  4BF8 A;  3OA5 A;  1W1V A;  2LGO A;  1W1P A;  2XP6 A;  4ML4 A;  2WM0 A;  2ZR5 A;  3CHE A;  1NWU A;  1J4I A;  1QPF A;  4QIB A;  3UQB A;  1NSG A;  4IQ2 A;  1WNO A;  2RQS A;  3JYM A;  1YAT A;  1SR0 A;  3ARY A;  4NSB A;  3WQV A;  4ODP A;  4LAV A;  3WKZ A;  3RME A;  3O5M A;  3O5P A;  2F21 A;  5DIV A;  1FD9 A;  3BMB A;  2YBU A;  1B6C A;  2VCD A;  4ODR A;  3WH0 A;  1QZ2 A;  5I98 A;  1NWS A;  5DIT A;  1EQ3 A;  1P5Q A;  3O5G A;  1JND A;  2F4E A;  4ODL A;  2FDM A;  4U85 A;  4ZPT R;  1FKD A;  2F23 A;  2WLZ A;  2KO7 A;  1ITX A;  4U86 A;  3KAG A;  3O5O A;  3WQW A;  3NI6 A;  1OGB A;  3ARQ A;  2M08 A;  2LJ4 A;  1NMW A;  1PIN A;  4Z2J A;  4JFJ A;  1KT0 A;  1LL4 A;  2N87 A;  4JYS A;  5DO2 A;  1C9H A;  3WD0 A;  2XPB A;  1W9P A;  1SYT A;  1YW5 A;  3IKD A;  2XP7 A;  3O5I A;  2RSE A;  2A3A A;  3B9A A;  3B7X A;  2A3C A;  4JFL A;  5BXJ A;  3O5R A;  1HJW A;  3PR9 A;  2JZV A;  3O5K A;  1FFQ A;  2PBC A;  2AWG A;  1J4R A;  1HKI A;  4W9Q A;  1J6Y A;  2PPP A;  1EDQ A;  4TYO A;  4NZC A;  2DT0 A;  3CHC A;  3QOK A;  1U79 A;  1VF8 A;  1K9T A;  1TFV A;  1R9H A;  3W4R A;  4DWS B;  1W1T A;  4S3J A;  2PPO A;  1KT1 A;  3O5J A;  4DRM A;  1E15 A;  2LPV A;  3ARV A;  1LG1 A;  3ODK A;  3OOB A;  3GU0 A;  2AOS A;  3PA7 A;  4NNR A;  1E6N A;  1JNS A;  4DZ3 A;  1Q6H A;  2UZ5 A;  3KZ7 A;  4W9O A;  1FJD A;  4KR0 B;  4DIP A;  1JNT A;  2ETN A;  3CZ8 A;  1KFW A;  4FN2 A;  1LJY A;  4U84 A;  1FKR A;  2PV1 A;  1NH6 A;  1WB0 A;  2DSW A;  4P8W A;  1FKT A;  2DT2 A;  4DRH A;  3FXY A;  1T11 A;  4HAR A;  4DWS A;  2ITK A;  3UQI A;  1RD6 A;  3WIJ A;  4Q7N A;  1FAP A;  4TW6 A;  1LQ0 A;  4WJX A;  4WIW A;  1GUV A;  3ALG A;  2XP5 A;  2MLZ A;  1D7J A;  3FY1 A;  3KCE A;  2P4V A;  3CHF A;  4DRI A;  4FAP A;  4TW8 A;  1A7X A;  2XP4 A;  3O5E A;  5HWC A;  4MNL A;  3WD2 A;  4P8V A;  4IPX A;  1BKF A;  4TX0 A;  5DF0 A;  3B9E A;  2ESC A;  3AS1 A;  4AY1 A;  2RUD A;  4IQC A;  3O5F A;  1E6P A;  4QT3 A;  4L3N A;  5HBF A;  1ZBK A;  1ROU A;  4R0X A;  2PV3 A;  1EHN A;  1O6I A;  3ART A;  3CGM A;  1PBK A;  2MLY A;  2L2S A;  3CH9 A;  2ZQV A;  4XAK A;  2XP8 A;  1FKK A;  1N1A A;  3O5L A;  4QT2 A;  3TCZ A;  2MPH A;  4IT6 A;  4W5U A;  4IT4 A;  1X6L A;  2KFW A;  1D2K A;  3NRK A;  3ARP A;  3AQU A;  1NWT A;  4DWS C;  5JH8 A;  3KAC A;  4URI A;  3PRD A;  5DIU A;  2F2D A;  2QF8 A;  3EY6 A;  2YBT A;  3KAH A;  4QZV B;  3IKG A;  2O92 A;  3EIP A;  1HKK A;  4GIV A;  2FKE A;  2ZQT A;  5HW7 A;  4MGV A;  3ARR A;  2XPA A;  2ZQS A;  4LGX A;  3RGC A;  3BXW A;  3RM4 A;  3PRA A;  1ZCN A;  5HWB A;  4DZ2 A;  1GPF A;  3JYJ A;  1W9U A; 
#chains in the Genus database with same CATH homology
 1FFR A;  4R5E A;  4L72 B;  3TDB A;  4J4O A;  3UF8 A;  3WL1 A;  3ALF A;  1HJX A;  3RM8 A;  3AS2 A;  3IK8 A;  3UQA A;  4DRP A;  5HUA A;  2KR7 A;  1TCO C;  4DRQ A;  3ARS A;  3KAB A;  4P8X A;  1FKL A;  4KQZ A;  1XHG A;  2PV2 A;  3VAW A;  1JVW A;  1FKB A;  4MAV A;  5HT1 A;  1ZK6 A;  1ZB5 A;  3CHD A;  1FKF A;  5D75 A;  1XRV A;  4MNM A;  1EIB A;  4Q22 A;  3RFW A;  1QPL A;  2A3B A;  2DSZ A;  2PI6 A;  4DRK A;  4DH0 A;  2KE0 A;  2O9O A;  1FKS A;  2DG3 A;  2WLY A;  1BL4 A;  3WD4 A;  2B31 A;  2A3E A;  1JNE A;  2ZR4 A;  1L1P A;  4LAY A;  4ZS6 A;  1E6R A;  3CGN A;  5HKG A;  2G41 A;  3KAI A;  4JFK A;  2KI3 A;  3MDY B;  4Z2I A;  3WL0 A;  2DG4 A;  5HW6 A;  4W9P A;  1M5Y A;  3G6M A;  4DRO A;  2IUZ A;  4JFM A;  4C02 B;  3IHZ A;  1FKJ A;  3O5D A;  2XP9 A;  3H9R B;  4J4N A;  4HBO A;  1FKG A;  4MNJ A;  4GGQ A;  3TC5 A;  4G50 A;  3G6L A;  4TNS A;  1E6Z A;  4DWS D;  2MLX A;  4PTM A;  4Z2L A;  4ODO A;  4N19 A;  2PPN A;  5HTG A;  4P8U A;  2DT1 A;  3UI4 A;  1H0G A;  2RUQ A;  4ODK A;  1W1Y A;  2M2A A;  2DSV A;  2MF9 A;  1OWQ A;  4DRJ A;  2RUR A;  1GOI A;  1ZU8 A;  4ITZ A;  4Z2H A;  4LAX A;  1Y0O A;  2XP3 A;  1LG2 A;  1NWR A;  4G2P A;  1NMV A;  2LKN A;  4WKF A;  1D7I A;  4DT4 A;  3ARX A;  1HKM A;  1W9V A;  2DPE A;  3I6C A;  3AS0 A;  3GPK A;  3ARU A;  1ZL1 A;  4MTV A;  2KGJ A;  4S3K A;  2DSU A;  2DT3 A;  1W26 A;  1Q6U A;  1HKJ A;  5GPR A;  3WD3 A;  3AS3 A;  2OFN A;  4ODM A;  5B8I C;  1HJV A;  1E9L A;  2MNT A;  1IX5 A;  1Q6I A;  4TW7 A;  1ZBC A;  4ODQ A;  1FKI A;  3UI6 A;  1EYM A;  3WD1 A;  1OGG A;  4WKH A;  4ZPV R;  5J6E A;  1LL6 A;  3UI5 A;  5GQB A;  3PRB A;  3FAP A;  1ZBV A;  2VN1 A;  3RM9 A;  2ZQU A;  2IF4 A;  1HXV A;  2RUC A;  4LAW A;  4MPK A;  2Y78 A;  2Q5A A;  1UR9 A;  4WKA A;  3KAD A;  4DRN A;  3B8S A;  4O2T A;  1H0I A;  3JXV A;  4WK9 A;  4HBE A;  1CTN A;  4MSP A;  1LL7 A;  1ROT A;  4ODN A;  4MNK A;  3ARO A;  4ZPW R;  1UR8 A;  1ZBW A;  1D7H A;  1WAW A;  3ARZ A;  1Q1C A;  2D9F A;  2WK2 A;  2K8I A;  5HW8 A;  5DEZ A;  2FAP A;  1D6O A;  2DG9 A;  2M1I A;  1X6N A;  2OLH A;  1J4H A;  3NTP A;  2ZR6 A;  1FKH A;  3B9D A;  5GPG A;  4JFI A;  3LUO A;  1F40 A;  3KAF A;  4Z2K A;  3O5Q A;  3ARW A;  2G8Z A;  1F8A B;  4Z2G A;  4BF8 A;  3OA5 A;  1W1V A;  2LGO A;  1W1P A;  2XP6 A;  4ML4 A;  2WM0 A;  2ZR5 A;  3CHE A;  1NWU A;  1J4I A;  1QPF A;  4QIB A;  3UQB A;  1NSG A;  4IQ2 A;  1WNO A;  2RQS A;  3JYM A;  1YAT A;  1SR0 A;  3ARY A;  4NSB A;  3WQV A;  4ODP A;  4LAV A;  3WKZ A;  3RME A;  3O5M A;  3O5P A;  2F21 A;  5DIV A;  1FD9 A;  2YBU A;  1B6C A;  2VCD A;  4ODR A;  3WH0 A;  1QZ2 A;  5I98 A;  1NWS A;  5DIT A;  1EQ3 A;  1P5Q A;  3O5G A;  1JND A;  2F4E A;  4ODL A;  2FDM A;  4U85 A;  4ZPT R;  1FKD A;  2WLZ A;  2KO7 A;  1ITX A;  4U86 A;  3KAG A;  3O5O A;  3WQW A;  3NI6 A;  1OGB A;  3ARQ A;  2M08 A;  2LJ4 A;  1NMW A;  1PIN A;  4Z2J A;  4JFJ A;  1KT0 A;  1LL4 A;  2N87 A;  4JYS A;  5DO2 A;  1C9H A;  3WD0 A;  2XPB A;  1W9P A;  1SYT A;  1YW5 A;  3IKD A;  2XP7 A;  3O5I A;  2RSE A;  2A3A A;  3B9A A;  3B7X A;  2A3C A;  4JFL A;  5BXJ A;  3O5R A;  1HJW A;  3PR9 A;  2JZV A;  3O5K A;  1FFQ A;  2PBC A;  2AWG A;  1J4R A;  1HKI A;  4W9Q A;  1J6Y A;  2PPP A;  1EDQ A;  4TYO A;  4NZC A;  2DT0 A;  3CHC A;  3QOK A;  1U79 A;  1VF8 A;  1K9T A;  1TFV A;  1R9H A;  3W4R A;  4DWS B;  1W1T A;  4S3J A;  2PPO A;  1KT1 A;  3O5J A;  4DRM A;  1E15 A;  2LPV A;  3ARV A;  1LG1 A;  3ODK A;  3OOB A;  2AOS A;  3PA7 A;  4NNR A;  1E6N A;  1JNS A;  4DZ3 A;  1Q6H A;  2UZ5 A;  3KZ7 A;  4W9O A;  1FJD A;  4KR0 B;  4DIP A;  1JNT A;  3CZ8 A;  1KFW A;  4FN2 A;  1LJY A;  4U84 A;  1FKR A;  2PV1 A;  1NH6 A;  1WB0 A;  2DSW A;  4P8W A;  1FKT A;  2DT2 A;  4DRH A;  3FXY A;  1T11 A;  4HAR A;  4DWS A;  2ITK A;  3UQI A;  1RD6 A;  3WIJ A;  4Q7N A;  1FAP A;  4TW6 A;  1LQ0 A;  4WJX A;  4WIW A;  1GUV A;  3ALG A;  2XP5 A;  2MLZ A;  1D7J A;  3FY1 A;  3KCE A;  3CHF A;  4DRI A;  4FAP A;  4TW8 A;  1A7X A;  2XP4 A;  3O5E A;  5HWC A;  4MNL A;  3WD2 A;  4P8V A;  4IPX A;  1BKF A;  4TX0 A;  5DF0 A;  3B9E A;  2ESC A;  3AS1 A;  4AY1 A;  2RUD A;  4IQC A;  3O5F A;  1E6P A;  4QT3 A;  4L3N A;  5HBF A;  1ZBK A;  1ROU A;  4R0X A;  2PV3 A;  1EHN A;  1O6I A;  3ART A;  3CGM A;  1PBK A;  2MLY A;  2L2S A;  3CH9 A;  2ZQV A;  4XAK A;  2XP8 A;  1FKK A;  1N1A A;  3O5L A;  4QT2 A;  3TCZ A;  2MPH A;  4IT6 A;  4W5U A;  4IT4 A;  1X6L A;  2KFW A;  1D2K A;  3NRK A;  3ARP A;  3AQU A;  1NWT A;  4DWS C;  5JH8 A;  3KAC A;  4URI A;  3PRD A;  5DIU A;  2F2D A;  2QF8 A;  3EY6 A;  2YBT A;  3KAH A;  4QZV B;  3IKG A;  2O92 A;  1HKK A;  4GIV A;  2FKE A;  2ZQT A;  5HW7 A;  4MGV A;  3ARR A;  2XPA A;  2ZQS A;  4LGX A;  3RGC A;  3BXW A;  3RM4 A;  3PRA A;  1ZCN A;  5HWB A;  4DZ2 A;  1GPF A;  3JYJ A;  1W9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...