4TW7A

The fk1 domain of fkbp51 in complex with ifit4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 29
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw7A00
4W9QA 2LGOA 4C02B 1JNSA 1Q1CA 2LKNA 3O5DA 1T11A 1FKKA 2F4EA 1ROUA 4N19A 4FAPA 1FKDA 2N87A 3O5IA 2ZQVA 2XP7A 2MLXA 2XP4A 1NMVA 2LPVA 3EY6A 3PRBA 4J4OA 4G50A 4FN2A 5HWCA 2KFWA 3O5GA 2K8IA 1Q6HA 1KT0A 2RUCA 4LAXA 4ODKA 1Q6IA 5HKGA 4ODLA 3KADA 5HW6A 2Q5AA 1J6YA 3KAFA 2DG9A 3O5LA 3O5PA 2F2DA 2RSEA 3O5KA 3ODKA 2XP3A 4GIVA 1FKGA 2JZVA 4R0XA 4DROA 1YATA 1YW5A 2ZQUA 4LAVA 1FKBA 1F40A 1L1PA 2UZ5A 3CGMA 2FAPA 5I98A 3O5EA 2XP5A 4JFLA 1FKHA 4ODRA 5HT1A 2MLYA 4IQ2A 4DRKA 2PPNA 3H9RB 4NNRA 3UF8A 5BXJA 1N1AA 1A7XA 3IK8A 2F21A 2XPBA 1C9HA 1FJDA 1FKLA 1FKFA 1NMWA 3KZ7A 5D75A 4ODPA 3KAIA 2KE0A 2L2SA 2KO7A 1QZ2A 1F8AB 3PA7A 1FKRA 1FKJA 3TDBA 3NI6A 4DRQA 3UQAA 2ZQSA 3O5FA 2MF9A 4JFMA 3KCEA 4DRIA 2MNTA 3KAHA 3FAPA 2ITKA 4J4NA 4JYSA 1FKTA 1Y0OA 1ZK6A 2VCDA 3UI4A 2RUDA 2M08A 4TW8A 4ODQA 4O2TA 1QPLA 1P5QA 5HTGA 2DG4A 1J4RA 4QT2A 2KR7A 4TW7A 1W26A 2IF4A 3JYMA 3NRKA 1HXVA 4GGQA 3TC5A 1PINA 2PPOA 4TYOA 2XP8A 5DITA 4DRPA 3I6CA 4MGVA 2M2AA 2KGJA 2ZR6A 3TCZA 2RUQA 2VN1A 1FKIA 2Y78A 3KAGA 2OFNA 3LUOA 4TNSA 2PBCA 2RQSA 5B8IC 3WH0A 4DIPA 5GPGA 3NTPA 4MSPA 1BL4A 3JXVA 1JVWA 1ZCNA 3IKGA 2D9FA 4QT3A 2PV3A 2FKEA 5DIUA 2XP6A 4JFKA 1Q6UA 1KT1A 2XPAA 4W9PA 1FKSA 3IKDA 2M1IA 4JFIA 3VAWA 4TX0A 5HW8A 3UI6A 1J4IA 3O5MA 4W9OA 4ODNA 1TCOC 1QPFA 4U85A 3B7XA 2ZQTA 1M5YA 4DH0A 3KABA 5DIVA 4JFJA 3RFWA 1FD9A 4IQCA 1J4HA 1U79A 1R9HA 2PPPA 4DZ3A 1EQ3A 3MDYB 2MLZA 2KI3A 4ITZA 3IHZA 3O5JA 4DRHA 3UQBA 2MPHA 2RURA 3RGCA 3O5QA 1PBKA 2LJ4A 4ODMA 1B6CA 4QIBA 2AWGA 4G2PA 5HWBA 1FAPA 2ZR4A 2PV2A 4LAWA 1D6OA 3KACA 3UQIA 4IPXA 1JNTA 3OOBA 4U84A 1ROTA 3JYJA 3GPKA 1D7JA 2PV1A 4DT4A 5HUAA 4TW6A 5J6EA 1D7IA 1D7HA 2DG3A 4LAYA 3PRDA 4DZ2A 5HW7A 2XP9A 4U86A 4DRJA 1EYMA 4DRNA 2ZR5A 1NSGA 4BF8A 3O5RA 1BKFA 3CGNA 3O5OA 4ODOA 4DRMA 3UI5A
chains in the Genus database with same CATH superfamily
1ZL1A 4R5EA 4C02B 1ZBCA 2LKNA 1E6NA 1WAWA 2F4EA 1LQ0A 3WD4A 3ARPA 2FDMA 5DF0A 2XP7A 2MLXA 3G6MA 1NMVA 2LPVA 4J4OA 1GUVA 5HWCA 2K8IA 4HARA 4IT6A 1KT0A 1Q6IA 2A3BA 5HKGA 5HW6A 1E6PA 2Q5AA 3O5KA 4GIVA 2RSEA 4DROA 1FKBA 1L1PA 5HBFA 3O5EA 1NWSA 2XP5A 4PTMA 1ZBKA 4JFLA 1FKHA 2ESCA 2PPNA 2DT2A 4NNRA 4Z2LA 1D2KA 3IK8A 1SR0A 1FKLA 1NMWA 3KZ7A 3CHEA 3WL1A 2KE0A 1RD6A 2KO7A 1X6LA 3TDBA 4DRQA 3O5FA 2MF9A 3QOKA 4KR0B 3AQUA 3ARRA 3CZ8A 4QT2A 2IF4A 1HXVA 4GGQA 3WD1A 5JH8A 4QZVB 1ITXA 4MGVA 2M2AA 3TCZA 2RUQA 4TNSA 1FKIA 2G41A 2PBCA 2RQSA 5B8IC 2A3CA 4MSPA 1OGGA 3JXVA 3FY1A 4MNLA 2PV3A 1JCHB 1E9LA 1KT1A 2XPAA 2A3EA 3WD3A 1FKSA 4WK9A 1W1YA 3VAWA 4P8XA 4TX0A 3WL0A 5HW8A 3O5MA 4W9OA 2DT0A 3B7XA 3KABA 1FD9A 1R9HA 1UR9A 4S3JA 3ARZA 1NWRA 3UQBA 1LL6A 2MPHA 4ZPWR 4ODMA 3PRAA 1GPFA 2B5UB 4LAWA 2PV2A 4IPXA 1CTNA 3JYJA 1D7JA 4WIWA 3ARVA 1UR8A 4LAYA 2YBUA 3PRDA 4DZ2A 5HW7A 2PI6A 1W9VA 4Z2GA 2ZR5A 2WK2A 3O5RA 3CGNA 4ODOA 5HWBA 3UI5A 2N87A 4HBOA 3AS2A 1H0IA 2DPEA 4L72B 2KFWA 1Q6HA 2RUCA 1NWUA 2WM0A 2B31A 3KADA 1LL4A 1J6YA 2DG9A 3O5PA 2XP3A 4NSBA 4R0XA 2DT1A 4URIA 2UZ5A 3CGMA 1E6RA 3WQVA 4MPKA 4ODRA 4NZCA 3UF8A 2F21A 4Z2IA 5D75A 3ARUA 3KAIA 3WD0A 2L2SA 1QZ2A 3W4RA 3NI6A 4Q7NA 3UQAA 4JFMA 1X6NA 2ITKA 2G8ZA 4JYSA 1FKTA 4WKAA 4ODQA 4O2TA 3ARTA 3B8SA 1P5QA 1W26A 4MAVA 2DSWA 2EULA 4Z2HA 2PPOA 3I6CA 2KGJA 2VN1A 3ARQA 3B9AA 5GPGA 3NTPA 4DIPA 1BL4A 1EHNA 3CHCA 3FXYA 3ARYA 1FFRA 1SYTA 4JFIA 3PR9A 3UI6A 3RFWA 1XRVA 2YBTA 1U79A 1XHGA 4ITZA 2KI3A 1HKKA 3IHZA 3O5JA 4DWSD 4L3NA 3RGCA 2LJ4A 3WKZA 1B6CA 4QIBA 3CH9A 2ZR4A 1JNTA 4U84A 2DT3A 1D7HA 3B9DA 1HKIA 1K9TA 2PN0A 1EYMA 1NSGA 4BF8A 4DRMA 3O5OA 1FKRA 3GTYX 3ARWA 4W9QA 2LGOA 5GQBA 1Q1CA 3O5DA 4FAPA 1NWTA 3O5IA 4ML4A 2XP4A 1HKJA 4IT4A 4G50A 3O5GA 1E6ZA 4LAXA 2WLZA 4MTVA 4ODLA 4MNJA 1W1PA 3O5LA 3RMEA 4P8WA 1E15A 3ODKA 4Z2JA 2JZVA 1HJVA 1YW5A 2ZQUA 1EDQA 2FAPA 1EIBA 3WD2A 4W5UA 2IUZA 3H9RB 3WQWA 2XPBA 1FJDA 4MNKA 1TFVA 1FKFA 5DO2A 3B9EA 4LGXA 1W1VA 3PA7A 1F8AB 1FKJA 4Q22A 3AROA 3KCEA 2MNTA 3KAHA 1Y0OA 1ZK6A 2VCDA 2M08A 3GU0A 1LJYA 4ZPVR 2DG4A 2KR7A 3JYMA 2P4VA 4MNMA 3TC5A 2DSZA 4TYOA 2XP8A 2ZR6A 3LUOA 3KAGA 2OFNA 3ALGA 1JVWA 1ZCNA 1WB0A 3IKGA 4QT3A 4JFKA 1Q6UA 1E44A 4P8VA 2M1IA 1J4IA 1W9PA 4ODNA 1TCOC 1QPFA 1OWQA 2OLHA 1M5YA 3BMBA 5DIVA 4IQCA 1J4HA 2F23A 1O6IA 1EQ3A 4P8UA 3MDYB 2MLZA 4UDMA 3ARXA 1WNOA 2RURA 1LG2A 4ZPTR 1ZBWA 2AWGA 2DSVA 4G2PA 1FAPA 3KACA 3OOBA 1HKMA 1ROTA 5DEZA 2PV1A 1OGBA 5HUAA 5J6EA 1D7IA 1H0GA 2DG3A 1HJXA 2XP9A 1W1TA 4KQZA 1BKFA 1ZU8A 1GRJA 1JNSA 1T11A 1FKKA 1ROUA 4N19A 1FKDA 2ZQVA 3EY6A 3RM4A 3PRBA 4FN2A 4ODKA 1LL7A 4WJXA 3KAFA 1F40A 2F2DA 1FKGA 2ETNA 1YATA 4LAVA 3EIPA 3G6LA 5I98A 1FFQA 3ALFA 4HBEA 4ZS6A 5HT1A 2MLYA 4IQ2A 4DRKA 5BXJA 1N1AA 1A7XA 3WIJA 1C9HA 1ZBVA 3AS0A 4ODPA 1ZB5A 1VF8A 1KFWA 2A3AA 3AS3A 2AOSA 2ZQSA 5GPRA 4DRIA 3CHFA 3FAPA 4J4NA 3UI4A 1JNEA 2RUDA 1IX5A 4TW8A 3RM8A 1QPLA 5HTGA 2O9OA 1J4RA 4TW7A 4DWSC 3NRKA 1PINA 5DITA 3AS1A 4DRPA 4DWSA 4DWSB 2Y78A 3WH0A 2D9FA 5DIUA 2FKEA 2XP6A 4S3KA 4W9PA 1JNDA 3IKDA 1W9UA 4XAKA 4WKFA 4U85A 1HJWA 4Z2KA 2ZQTA 3OA5A 4DH0A 4JFJA 2PPPA 4DZ3A 2WLYA 3CHDA 4AY1A 4DRHA 1NH6A 1LG1A 2DSUA 3RM9A 3O5QA 1PBKA 1D6OA 3UQIA 1GOIA 3GPKA 3ARSA 4DT4A 2O92A 4TW6A 4WKHA 2QF8A 4U86A 4DRJA 4DRNA 3BXWA
chains in the Genus database with same CATH topology
1ZL1A 4R5EA 4C02B 1ZBCA 2LKNA 1E6NA 1WAWA 2F4EA 1LQ0A 3WD4A 3ARPA 2FDMA 5DF0A 2XP7A 2MLXA 3G6MA 1NMVA 2LPVA 4J4OA 1GUVA 5HWCA 2K8IA 4HARA 4IT6A 1KT0A 1Q6IA 2A3BA 5HKGA 5HW6A 1E6PA 2Q5AA 3O5KA 4GIVA 2RSEA 4DROA 1FKBA 1L1PA 5HBFA 3O5EA 1NWSA 2XP5A 4PTMA 1ZBKA 4JFLA 1FKHA 2ESCA 2PPNA 2DT2A 4NNRA 4Z2LA 1D2KA 3IK8A 1SR0A 1FKLA 1NMWA 3KZ7A 3CHEA 3WL1A 2KE0A 1RD6A 2KO7A 1X6LA 3TDBA 4DRQA 3O5FA 2MF9A 3QOKA 4KR0B 3AQUA 3ARRA 3CZ8A 4QT2A 2IF4A 1HXVA 4GGQA 3WD1A 5JH8A 4QZVB 1ITXA 4MGVA 2M2AA 3TCZA 2RUQA 4TNSA 1FKIA 2G41A 2PBCA 2RQSA 5B8IC 2A3CA 4MSPA 1OGGA 3JXVA 3FY1A 4MNLA 2PV3A 1E9LA 1KT1A 2XPAA 2A3EA 3WD3A 1FKSA 4WK9A 1W1YA 3VAWA 4P8XA 4TX0A 3WL0A 5HW8A 3O5MA 4W9OA 2DT0A 3B7XA 3KABA 1FD9A 1R9HA 1UR9A 4S3JA 3ARZA 1NWRA 3UQBA 1LL6A 2MPHA 4ZPWR 4ODMA 3PRAA 1GPFA 4LAWA 2PV2A 4IPXA 1CTNA 3JYJA 1D7JA 4WIWA 3ARVA 1UR8A 4LAYA 2YBUA 3PRDA 4DZ2A 5HW7A 2PI6A 1W9VA 4Z2GA 2ZR5A 2WK2A 3O5RA 3CGNA 4ODOA 5HWBA 3UI5A 2N87A 4HBOA 3AS2A 1H0IA 2DPEA 4L72B 2KFWA 1Q6HA 2RUCA 1NWUA 2WM0A 2B31A 3KADA 1LL4A 1J6YA 2DG9A 3O5PA 2XP3A 4NSBA 4R0XA 2DT1A 4URIA 2UZ5A 3CGMA 1E6RA 3WQVA 4MPKA 4ODRA 4NZCA 3UF8A 2F21A 4Z2IA 5D75A 3ARUA 3KAIA 3WD0A 2L2SA 1QZ2A 3W4RA 3NI6A 4Q7NA 3UQAA 4JFMA 1X6NA 2ITKA 2G8ZA 4JYSA 1FKTA 4WKAA 4ODQA 4O2TA 3ARTA 3B8SA 1P5QA 1W26A 4MAVA 2DSWA 4Z2HA 2PPOA 3I6CA 2KGJA 2VN1A 3ARQA 3B9AA 5GPGA 3NTPA 4DIPA 1BL4A 1EHNA 3CHCA 3FXYA 3ARYA 1FFRA 1SYTA 4JFIA 3PR9A 3UI6A 3RFWA 1XRVA 2YBTA 1U79A 1XHGA 4ITZA 2KI3A 1HKKA 3IHZA 3O5JA 4DWSD 4L3NA 3RGCA 2LJ4A 3WKZA 1B6CA 4QIBA 3CH9A 2ZR4A 1JNTA 4U84A 2DT3A 1D7HA 3B9DA 1HKIA 1K9TA 1EYMA 1NSGA 4BF8A 4DRMA 3O5OA 1FKRA 3ARWA 4W9QA 2LGOA 5GQBA 1Q1CA 3O5DA 4FAPA 1NWTA 3O5IA 4ML4A 2XP4A 1HKJA 4IT4A 4G50A 3O5GA 1E6ZA 4LAXA 2WLZA 4MTVA 4ODLA 4MNJA 1W1PA 3O5LA 3RMEA 4P8WA 1E15A 3ODKA 4Z2JA 2JZVA 1HJVA 1YW5A 2ZQUA 1EDQA 2FAPA 1EIBA 3WD2A 4W5UA 2IUZA 3H9RB 3WQWA 2XPBA 1FJDA 4MNKA 1TFVA 1FKFA 5DO2A 3B9EA 4LGXA 1W1VA 3PA7A 1F8AB 1FKJA 4Q22A 3AROA 3KCEA 2MNTA 3KAHA 1Y0OA 1ZK6A 2VCDA 2M08A 1LJYA 4ZPVR 2DG4A 2KR7A 3JYMA 4MNMA 3TC5A 2DSZA 4TYOA 2XP8A 2ZR6A 3LUOA 3KAGA 2OFNA 3ALGA 1JVWA 1ZCNA 1WB0A 3IKGA 4QT3A 4JFKA 1Q6UA 4P8VA 2M1IA 1J4IA 1W9PA 4ODNA 1TCOC 1QPFA 1OWQA 2OLHA 1M5YA 5DIVA 4IQCA 1J4HA 1O6IA 1EQ3A 4P8UA 3MDYB 2MLZA 3ARXA 1WNOA 2RURA 1LG2A 4ZPTR 1ZBWA 2AWGA 2DSVA 4G2PA 1FAPA 3KACA 3OOBA 1HKMA 1ROTA 5DEZA 2PV1A 1OGBA 5HUAA 5J6EA 1D7IA 1H0GA 2DG3A 1HJXA 2XP9A 1W1TA 4KQZA 1BKFA 1ZU8A 1JNSA 1T11A 1FKKA 1ROUA 4N19A 1FKDA 2ZQVA 3EY6A 3RM4A 3PRBA 4FN2A 4ODKA 1LL7A 4WJXA 3KAFA 1F40A 2F2DA 1FKGA 1YATA 4LAVA 3G6LA 5I98A 1FFQA 3ALFA 4HBEA 4ZS6A 5HT1A 2MLYA 4IQ2A 4DRKA 5BXJA 1N1AA 1A7XA 3WIJA 1C9HA 1ZBVA 3AS0A 4ODPA 1ZB5A 1VF8A 1KFWA 2A3AA 3AS3A 2AOSA 2ZQSA 5GPRA 4DRIA 3CHFA 3FAPA 4J4NA 3UI4A 1JNEA 2RUDA 1IX5A 4TW8A 3RM8A 1QPLA 5HTGA 2O9OA 1J4RA 4TW7A 4DWSC 3NRKA 1PINA 5DITA 3AS1A 4DRPA 4DWSA 4DWSB 2Y78A 3WH0A 2D9FA 5DIUA 2FKEA 2XP6A 4S3KA 4W9PA 1JNDA 3IKDA 1W9UA 4XAKA 4WKFA 4U85A 1HJWA 4Z2KA 2ZQTA 3OA5A 4DH0A 4JFJA 2PPPA 4DZ3A 2WLYA 3CHDA 4AY1A 4DRHA 1NH6A 1LG1A 2DSUA 3RM9A 3O5QA 1PBKA 1D6OA 3UQIA 1GOIA 3GPKA 3ARSA 4DT4A 2O92A 4TW6A 4WKHA 2QF8A 4U86A 4DRJA 4DRNA 3BXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  2LGO A;  4C02 B;  1JNS A;  1Q1C A;  2LKN A;  3O5D A;  1T11 A;  1FKK A;  2F4E A;  1ROU A;  4N19 A;  4FAP A;  1FKD A;  2N87 A;  3O5I A;  2ZQV A;  2XP7 A;  2MLX A;  2XP4 A;  1NMV A;  2LPV A;  3EY6 A;  3PRB A;  4J4O A;  4G50 A;  4FN2 A;  5HWC A;  2KFW A;  3O5G A;  2K8I A;  1Q6H A;  1KT0 A;  2RUC A;  4LAX A;  4ODK A;  1Q6I A;  5HKG A;  4ODL A;  3KAD A;  5HW6 A;  2Q5A A;  1J6Y A;  3KAF A;  2DG9 A;  3O5L A;  3O5P A;  2F2D A;  2RSE A;  3O5K A;  3ODK A;  2XP3 A;  4GIV A;  1FKG A;  2JZV A;  4R0X A;  4DRO A;  1YAT A;  1YW5 A;  2ZQU A;  4LAV A;  1FKB A;  1F40 A;  1L1P A;  2UZ5 A;  3CGM A;  2FAP A;  5I98 A;  3O5E A;  2XP5 A;  4JFL A;  1FKH A;  4ODR A;  5HT1 A;  2MLY A;  4IQ2 A;  4DRK A;  2PPN A;  3H9R B;  4NNR A;  3UF8 A;  5BXJ A;  1N1A A;  1A7X A;  3IK8 A;  2F21 A;  2XPB A;  1C9H A;  1FJD A;  1FKL A;  1FKF A;  1NMW A;  3KZ7 A;  5D75 A;  4ODP A;  3KAI A;  2KE0 A;  2L2S A;  2KO7 A;  1QZ2 A;  1F8A B;  3PA7 A;  1FKR A;  1FKJ A;  3TDB A;  3NI6 A;  4DRQ A;  3UQA A;  2ZQS A;  3O5F A;  2MF9 A;  4JFM A;  3KCE A;  4DRI A;  2MNT A;  3KAH A;  3FAP A;  2ITK A;  4J4N A;  4JYS A;  1FKT A;  1Y0O A;  1ZK6 A;  2VCD A;  3UI4 A;  2RUD A;  2M08 A;  4TW8 A;  4ODQ A;  4O2T A;  1QPL A;  1P5Q A;  5HTG A;  2DG4 A;  1J4R A;  4QT2 A;  2KR7 A;  4TW7 A;  1W26 A;  2IF4 A;  3JYM A;  3NRK A;  1HXV A;  4GGQ A;  3TC5 A;  1PIN A;  2PPO A;  4TYO A;  2XP8 A;  5DIT A;  4DRP A;  3I6C A;  4MGV A;  2M2A A;  2KGJ A;  2ZR6 A;  3TCZ A;  2RUQ A;  2VN1 A;  1FKI A;  2Y78 A;  3KAG A;  2OFN A;  3LUO A;  4TNS A;  2PBC A;  2RQS A;  5B8I C;  3WH0 A;  4DIP A;  5GPG A;  3NTP A;  4MSP A;  1BL4 A;  3JXV A;  1JVW A;  1ZCN A;  3IKG A;  2D9F A;  4QT3 A;  2PV3 A;  2FKE A;  5DIU A;  2XP6 A;  4JFK A;  1Q6U A;  1KT1 A;  2XPA A;  4W9P A;  1FKS A;  3IKD A;  2M1I A;  4JFI A;  3VAW A;  4TX0 A;  5HW8 A;  3UI6 A;  1J4I A;  3O5M A;  4W9O A;  4ODN A;  1TCO C;  1QPF A;  4U85 A;  3B7X A;  2ZQT A;  1M5Y A;  4DH0 A;  3KAB A;  5DIV A;  4JFJ A;  3RFW A;  1FD9 A;  4IQC A;  1J4H A;  1U79 A;  1R9H A;  2PPP A;  4DZ3 A;  1EQ3 A;  3MDY B;  2MLZ A;  2KI3 A;  4ITZ A;  3IHZ A;  3O5J A;  4DRH A;  3UQB A;  2MPH A;  2RUR A;  3RGC A;  3O5Q A;  1PBK A;  2LJ4 A;  4ODM A;  1B6C A;  4QIB A;  2AWG A;  4G2P A;  5HWB A;  1FAP A;  2ZR4 A;  2PV2 A;  4LAW A;  1D6O A;  3KAC A;  3UQI A;  4IPX A;  1JNT A;  3OOB A;  4U84 A;  1ROT A;  3JYJ A;  3GPK A;  1D7J A;  2PV1 A;  4DT4 A;  5HUA A;  4TW6 A;  5J6E A;  1D7I A;  1D7H A;  2DG3 A;  4LAY A;  3PRD A;  4DZ2 A;  5HW7 A;  2XP9 A;  4U86 A;  4DRJ A;  1EYM A;  4DRN A;  2ZR5 A;  1NSG A;  4BF8 A;  3O5R A;  1BKF A;  3CGN A;  3O5O A;  4ODO A;  4DRM A;  3UI5 A; 
#chains in the Genus database with same CATH topology
 1ZL1 A;  4R5E A;  4C02 B;  1ZBC A;  2LKN A;  1E6N A;  1WAW A;  2F4E A;  1LQ0 A;  3WD4 A;  3ARP A;  2FDM A;  5DF0 A;  2XP7 A;  2MLX A;  3G6M A;  1NMV A;  2LPV A;  4J4O A;  1GUV A;  5HWC A;  2K8I A;  4HAR A;  4IT6 A;  1KT0 A;  1Q6I A;  2A3B A;  5HKG A;  5HW6 A;  1E6P A;  2Q5A A;  3O5K A;  4GIV A;  2RSE A;  4DRO A;  1FKB A;  1L1P A;  5HBF A;  3O5E A;  1NWS A;  2XP5 A;  4PTM A;  1ZBK A;  4JFL A;  1FKH A;  2ESC A;  2PPN A;  2DT2 A;  4NNR A;  4Z2L A;  1D2K A;  3IK8 A;  1SR0 A;  1FKL A;  1NMW A;  3KZ7 A;  3CHE A;  3WL1 A;  2KE0 A;  1RD6 A;  2KO7 A;  1X6L A;  3TDB A;  4DRQ A;  3O5F A;  2MF9 A;  3QOK A;  4KR0 B;  3AQU A;  3ARR A;  3CZ8 A;  4QT2 A;  2IF4 A;  1HXV A;  4GGQ A;  3WD1 A;  5JH8 A;  4QZV B;  1ITX A;  4MGV A;  2M2A A;  3TCZ A;  2RUQ A;  4TNS A;  1FKI A;  2G41 A;  2PBC A;  2RQS A;  5B8I C;  2A3C A;  4MSP A;  1OGG A;  3JXV A;  3FY1 A;  4MNL A;  2PV3 A;  1JCH B;  1E9L A;  1KT1 A;  2XPA A;  2A3E A;  3WD3 A;  1FKS A;  4WK9 A;  1W1Y A;  3VAW A;  4P8X A;  4TX0 A;  3WL0 A;  5HW8 A;  3O5M A;  4W9O A;  2DT0 A;  3B7X A;  3KAB A;  1FD9 A;  1R9H A;  1UR9 A;  4S3J A;  3ARZ A;  1NWR A;  3UQB A;  1LL6 A;  2MPH A;  4ZPW R;  4ODM A;  3PRA A;  1GPF A;  2B5U B;  4LAW A;  2PV2 A;  4IPX A;  1CTN A;  3JYJ A;  1D7J A;  4WIW A;  3ARV A;  1UR8 A;  4LAY A;  2YBU A;  3PRD A;  4DZ2 A;  5HW7 A;  2PI6 A;  1W9V A;  4Z2G A;  2ZR5 A;  2WK2 A;  3O5R A;  3CGN A;  4ODO A;  5HWB A;  3UI5 A;  2N87 A;  4HBO A;  3AS2 A;  1H0I A;  2DPE A;  4L72 B;  2KFW A;  1Q6H A;  2RUC A;  1NWU A;  2WM0 A;  2B31 A;  3KAD A;  1LL4 A;  1J6Y A;  2DG9 A;  3O5P A;  2XP3 A;  4NSB A;  4R0X A;  2DT1 A;  4URI A;  2UZ5 A;  3CGM A;  1E6R A;  3WQV A;  4MPK A;  4ODR A;  4NZC A;  3UF8 A;  2F21 A;  4Z2I A;  5D75 A;  3ARU A;  3KAI A;  3WD0 A;  2L2S A;  1QZ2 A;  3W4R A;  3NI6 A;  4Q7N A;  3UQA A;  4JFM A;  1X6N A;  2ITK A;  2G8Z A;  4JYS A;  1FKT A;  4WKA A;  4ODQ A;  4O2T A;  3ART A;  3B8S A;  1P5Q A;  1W26 A;  4MAV A;  2DSW A;  2EUL A;  4Z2H A;  2PPO A;  3I6C A;  2KGJ A;  2VN1 A;  3ARQ A;  3B9A A;  5GPG A;  3NTP A;  4DIP A;  1BL4 A;  1EHN A;  3CHC A;  3FXY A;  3ARY A;  1FFR A;  1SYT A;  4JFI A;  3PR9 A;  3UI6 A;  3RFW A;  1XRV A;  2YBT A;  1U79 A;  1XHG A;  4ITZ A;  2KI3 A;  1HKK A;  3IHZ A;  3O5J A;  4DWS D;  4L3N A;  3RGC A;  2LJ4 A;  3WKZ A;  1B6C A;  4QIB A;  3CH9 A;  2ZR4 A;  1JNT A;  4U84 A;  2DT3 A;  1D7H A;  3B9D A;  1HKI A;  1K9T A;  2PN0 A;  1EYM A;  1NSG A;  4BF8 A;  4DRM A;  3O5O A;  1FKR A;  3GTY X;  3ARW A;  4W9Q A;  2LGO A;  5GQB A;  1Q1C A;  3O5D A;  4FAP A;  1NWT A;  3O5I A;  4ML4 A;  2XP4 A;  1HKJ A;  4IT4 A;  4G50 A;  3O5G A;  1E6Z A;  4LAX A;  2WLZ A;  4MTV A;  4ODL A;  4MNJ A;  1W1P A;  3O5L A;  3RME A;  4P8W A;  1E15 A;  3ODK A;  4Z2J A;  2JZV A;  1HJV A;  1YW5 A;  2ZQU A;  1EDQ A;  2FAP A;  1EIB A;  3WD2 A;  4W5U A;  2IUZ A;  3H9R B;  3WQW A;  2XPB A;  1FJD A;  4MNK A;  1TFV A;  1FKF A;  5DO2 A;  3B9E A;  4LGX A;  1W1V A;  3PA7 A;  1F8A B;  1FKJ A;  4Q22 A;  3ARO A;  3KCE A;  2MNT A;  3KAH A;  1Y0O A;  1ZK6 A;  2VCD A;  2M08 A;  3GU0 A;  1LJY A;  4ZPV R;  2DG4 A;  2KR7 A;  3JYM A;  2P4V A;  4MNM A;  3TC5 A;  2DSZ A;  4TYO A;  2XP8 A;  2ZR6 A;  3LUO A;  3KAG A;  2OFN A;  3ALG A;  1JVW A;  1ZCN A;  1WB0 A;  3IKG A;  4QT3 A;  4JFK A;  1Q6U A;  1E44 A;  4P8V A;  2M1I A;  1J4I A;  1W9P A;  4ODN A;  1TCO C;  1QPF A;  1OWQ A;  2OLH A;  1M5Y A;  3BMB A;  5DIV A;  4IQC A;  1J4H A;  2F23 A;  1O6I A;  1EQ3 A;  4P8U A;  3MDY B;  2MLZ A;  4UDM A;  3ARX A;  1WNO A;  2RUR A;  1LG2 A;  4ZPT R;  1ZBW A;  2AWG A;  2DSV A;  4G2P A;  1FAP A;  3KAC A;  3OOB A;  1HKM A;  1ROT A;  5DEZ A;  2PV1 A;  1OGB A;  5HUA A;  5J6E A;  1D7I A;  1H0G A;  2DG3 A;  1HJX A;  2XP9 A;  1W1T A;  4KQZ A;  1BKF A;  1ZU8 A;  1GRJ A;  1JNS A;  1T11 A;  1FKK A;  1ROU A;  4N19 A;  1FKD A;  2ZQV A;  3EY6 A;  3RM4 A;  3PRB A;  4FN2 A;  4ODK A;  1LL7 A;  4WJX A;  3KAF A;  1F40 A;  2F2D A;  1FKG A;  2ETN A;  1YAT A;  4LAV A;  3EIP A;  3G6L A;  5I98 A;  1FFQ A;  3ALF A;  4HBE A;  4ZS6 A;  5HT1 A;  2MLY A;  4IQ2 A;  4DRK A;  5BXJ A;  1N1A A;  1A7X A;  3WIJ A;  1C9H A;  1ZBV A;  3AS0 A;  4ODP A;  1ZB5 A;  1VF8 A;  1KFW A;  2A3A A;  3AS3 A;  2AOS A;  2ZQS A;  5GPR A;  4DRI A;  3CHF A;  3FAP A;  4J4N A;  3UI4 A;  1JNE A;  2RUD A;  1IX5 A;  4TW8 A;  3RM8 A;  1QPL A;  5HTG A;  2O9O A;  1J4R A;  4TW7 A;  4DWS C;  3NRK A;  1PIN A;  5DIT A;  3AS1 A;  4DRP A;  4DWS A;  4DWS B;  2Y78 A;  3WH0 A;  2D9F A;  5DIU A;  2FKE A;  2XP6 A;  4S3K A;  4W9P A;  1JND A;  3IKD A;  1W9U A;  4XAK A;  4WKF A;  4U85 A;  1HJW A;  4Z2K A;  2ZQT A;  3OA5 A;  4DH0 A;  4JFJ A;  2PPP A;  4DZ3 A;  2WLY A;  3CHD A;  4AY1 A;  4DRH A;  1NH6 A;  1LG1 A;  2DSU A;  3RM9 A;  3O5Q A;  1PBK A;  1D6O A;  3UQI A;  1GOI A;  3GPK A;  3ARS A;  4DT4 A;  2O92 A;  4TW6 A;  4WKH A;  2QF8 A;  4U86 A;  4DRJ A;  4DRN A;  3BXW A; 
#chains in the Genus database with same CATH homology
 1ZL1 A;  4R5E A;  4C02 B;  1ZBC A;  2LKN A;  1E6N A;  1WAW A;  2F4E A;  1LQ0 A;  3WD4 A;  3ARP A;  2FDM A;  5DF0 A;  2XP7 A;  2MLX A;  3G6M A;  1NMV A;  2LPV A;  4J4O A;  1GUV A;  5HWC A;  2K8I A;  4HAR A;  4IT6 A;  1KT0 A;  1Q6I A;  2A3B A;  5HKG A;  5HW6 A;  1E6P A;  2Q5A A;  3O5K A;  4GIV A;  2RSE A;  4DRO A;  1FKB A;  1L1P A;  5HBF A;  3O5E A;  1NWS A;  2XP5 A;  4PTM A;  1ZBK A;  4JFL A;  1FKH A;  2ESC A;  2PPN A;  2DT2 A;  4NNR A;  4Z2L A;  1D2K A;  3IK8 A;  1SR0 A;  1FKL A;  1NMW A;  3KZ7 A;  3CHE A;  3WL1 A;  2KE0 A;  1RD6 A;  2KO7 A;  1X6L A;  3TDB A;  4DRQ A;  3O5F A;  2MF9 A;  3QOK A;  4KR0 B;  3AQU A;  3ARR A;  3CZ8 A;  4QT2 A;  2IF4 A;  1HXV A;  4GGQ A;  3WD1 A;  5JH8 A;  4QZV B;  1ITX A;  4MGV A;  2M2A A;  3TCZ A;  2RUQ A;  4TNS A;  1FKI A;  2G41 A;  2PBC A;  2RQS A;  5B8I C;  2A3C A;  4MSP A;  1OGG A;  3JXV A;  3FY1 A;  4MNL A;  2PV3 A;  1E9L A;  1KT1 A;  2XPA A;  2A3E A;  3WD3 A;  1FKS A;  4WK9 A;  1W1Y A;  3VAW A;  4P8X A;  4TX0 A;  3WL0 A;  5HW8 A;  3O5M A;  4W9O A;  2DT0 A;  3B7X A;  3KAB A;  1FD9 A;  1R9H A;  1UR9 A;  4S3J A;  3ARZ A;  1NWR A;  3UQB A;  1LL6 A;  2MPH A;  4ZPW R;  4ODM A;  3PRA A;  1GPF A;  4LAW A;  2PV2 A;  4IPX A;  1CTN A;  3JYJ A;  1D7J A;  4WIW A;  3ARV A;  1UR8 A;  4LAY A;  2YBU A;  3PRD A;  4DZ2 A;  5HW7 A;  2PI6 A;  1W9V A;  4Z2G A;  2ZR5 A;  2WK2 A;  3O5R A;  3CGN A;  4ODO A;  5HWB A;  3UI5 A;  2N87 A;  4HBO A;  3AS2 A;  1H0I A;  2DPE A;  4L72 B;  2KFW A;  1Q6H A;  2RUC A;  1NWU A;  2WM0 A;  2B31 A;  3KAD A;  1LL4 A;  1J6Y A;  2DG9 A;  3O5P A;  2XP3 A;  4NSB A;  4R0X A;  2DT1 A;  4URI A;  2UZ5 A;  3CGM A;  1E6R A;  3WQV A;  4MPK A;  4ODR A;  4NZC A;  3UF8 A;  2F21 A;  4Z2I A;  5D75 A;  3ARU A;  3KAI A;  3WD0 A;  2L2S A;  1QZ2 A;  3W4R A;  3NI6 A;  4Q7N A;  3UQA A;  4JFM A;  1X6N A;  2ITK A;  2G8Z A;  4JYS A;  1FKT A;  4WKA A;  4ODQ A;  4O2T A;  3ART A;  3B8S A;  1P5Q A;  1W26 A;  4MAV A;  2DSW A;  4Z2H A;  2PPO A;  3I6C A;  2KGJ A;  2VN1 A;  3ARQ A;  3B9A A;  5GPG A;  3NTP A;  4DIP A;  1BL4 A;  1EHN A;  3CHC A;  3FXY A;  3ARY A;  1FFR A;  1SYT A;  4JFI A;  3PR9 A;  3UI6 A;  3RFW A;  1XRV A;  2YBT A;  1U79 A;  1XHG A;  4ITZ A;  2KI3 A;  1HKK A;  3IHZ A;  3O5J A;  4DWS D;  4L3N A;  3RGC A;  2LJ4 A;  3WKZ A;  1B6C A;  4QIB A;  3CH9 A;  2ZR4 A;  1JNT A;  4U84 A;  2DT3 A;  1D7H A;  3B9D A;  1HKI A;  1K9T A;  1EYM A;  1NSG A;  4BF8 A;  4DRM A;  3O5O A;  1FKR A;  3ARW A;  4W9Q A;  2LGO A;  5GQB A;  1Q1C A;  3O5D A;  4FAP A;  1NWT A;  3O5I A;  4ML4 A;  2XP4 A;  1HKJ A;  4IT4 A;  4G50 A;  3O5G A;  1E6Z A;  4LAX A;  2WLZ A;  4MTV A;  4ODL A;  4MNJ A;  1W1P A;  3O5L A;  3RME A;  4P8W A;  1E15 A;  3ODK A;  4Z2J A;  2JZV A;  1HJV A;  1YW5 A;  2ZQU A;  1EDQ A;  2FAP A;  1EIB A;  3WD2 A;  4W5U A;  2IUZ A;  3H9R B;  3WQW A;  2XPB A;  1FJD A;  4MNK A;  1TFV A;  1FKF A;  5DO2 A;  3B9E A;  4LGX A;  1W1V A;  3PA7 A;  1F8A B;  1FKJ A;  4Q22 A;  3ARO A;  3KCE A;  2MNT A;  3KAH A;  1Y0O A;  1ZK6 A;  2VCD A;  2M08 A;  1LJY A;  4ZPV R;  2DG4 A;  2KR7 A;  3JYM A;  4MNM A;  3TC5 A;  2DSZ A;  4TYO A;  2XP8 A;  2ZR6 A;  3LUO A;  3KAG A;  2OFN A;  3ALG A;  1JVW A;  1ZCN A;  1WB0 A;  3IKG A;  4QT3 A;  4JFK A;  1Q6U A;  4P8V A;  2M1I A;  1J4I A;  1W9P A;  4ODN A;  1TCO C;  1QPF A;  1OWQ A;  2OLH A;  1M5Y A;  5DIV A;  4IQC A;  1J4H A;  1O6I A;  1EQ3 A;  4P8U A;  3MDY B;  2MLZ A;  3ARX A;  1WNO A;  2RUR A;  1LG2 A;  4ZPT R;  1ZBW A;  2AWG A;  2DSV A;  4G2P A;  1FAP A;  3KAC A;  3OOB A;  1HKM A;  1ROT A;  5DEZ A;  2PV1 A;  1OGB A;  5HUA A;  5J6E A;  1D7I A;  1H0G A;  2DG3 A;  1HJX A;  2XP9 A;  1W1T A;  4KQZ A;  1BKF A;  1ZU8 A;  1JNS A;  1T11 A;  1FKK A;  1ROU A;  4N19 A;  1FKD A;  2ZQV A;  3EY6 A;  3RM4 A;  3PRB A;  4FN2 A;  4ODK A;  1LL7 A;  4WJX A;  3KAF A;  1F40 A;  2F2D A;  1FKG A;  1YAT A;  4LAV A;  3G6L A;  5I98 A;  1FFQ A;  3ALF A;  4HBE A;  4ZS6 A;  5HT1 A;  2MLY A;  4IQ2 A;  4DRK A;  5BXJ A;  1N1A A;  1A7X A;  3WIJ A;  1C9H A;  1ZBV A;  3AS0 A;  4ODP A;  1ZB5 A;  1VF8 A;  1KFW A;  2A3A A;  3AS3 A;  2AOS A;  2ZQS A;  5GPR A;  4DRI A;  3CHF A;  3FAP A;  4J4N A;  3UI4 A;  1JNE A;  2RUD A;  1IX5 A;  4TW8 A;  3RM8 A;  1QPL A;  5HTG A;  2O9O A;  1J4R A;  4TW7 A;  4DWS C;  3NRK A;  1PIN A;  5DIT A;  3AS1 A;  4DRP A;  4DWS A;  4DWS B;  2Y78 A;  3WH0 A;  2D9F A;  5DIU A;  2FKE A;  2XP6 A;  4S3K A;  4W9P A;  1JND A;  3IKD A;  1W9U A;  4XAK A;  4WKF A;  4U85 A;  1HJW A;  4Z2K A;  2ZQT A;  3OA5 A;  4DH0 A;  4JFJ A;  2PPP A;  4DZ3 A;  2WLY A;  3CHD A;  4AY1 A;  4DRH A;  1NH6 A;  1LG1 A;  2DSU A;  3RM9 A;  3O5Q A;  1PBK A;  1D6O A;  3UQI A;  1GOI A;  3GPK A;  3ARS A;  4DT4 A;  2O92 A;  4TW6 A;  4WKH A;  2QF8 A;  4U86 A;  4DRJ A;  4DRN A;  3BXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...