4TW8A

The fk1-fk2 domains of fkbp52 in complex with ifit-fl
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
235
structure length
235
Chain Sequence
EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 53
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw8A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw8A02
4TW8A 1Q6UA 2RQSA 3LUOA 2MLXA 5D75A 3O5RA 4DROA 3IKDA 5HKGA 4FN2A 4MSPA 5HW6A 3O5DA 1FKHA 1J6YA 1Q1CA 3O5QA 4JFMA 1ROUA 2IF4A 2LGOA 4JFLA 1B6CA 4QIBA 4TNSA 1TCOC 3KACA 4JYSA 4G50A 4O2TA 2XP3A 2DG4A 3I6CA 2FKEA 1FKRA 2LJ4A 3O5PA 4J4OA 2N87A 4DIPA 4DH0A 5GPGA 2LPVA 2K8IA 4LAXA 3FAPA 5BXJA 1PBKA 2XP5A 2KO7A 2RUQA 3H9RB 3KAIA 3O5KA 3UF8A 1BL4A 3UQBA 1YATA 1M5YA 2ZR5A 2F4EA 1J4RA 2KFWA 4DRQA 4IQCA 1FJDA 3IK8A 2XP6A 3KZ7A 4GGQA 5HWCA 5J6EA 1PINA 1NSGA 4TX0A 1Y0OA 5HW8A 4GIVA 1FKJA 4U85A 1C9HA 3TCZA 3GPKA 2RURA 2VCDA 4IPXA 3PRBA 2XPBA 4W9OA 5HWBA 3O5GA 2M1IA 3JYMA 4C02B 1JNSA 2FAPA 3EY6A 3KAGA 3PRDA 3UI5A 2KE0A 4BF8A 4ODPA 2XPAA 1L1PA 1F8AB 1FKGA 4MGVA 3UQIA 2ITKA 2ZQTA 4ODOA 3O5OA 2MPHA 4IQ2A 3TC5A 3WH0A 1J4IA 4J4NA 4W9PA 5DIUA 4NNRA 3KABA 1HXVA 1FKBA 1ROTA 3PA7A 5HW7A 4DT4A 1FAPA 2AWGA 4DZ2A 1NMWA 3CGMA 4LAYA 3UI6A 4JFJA 4R0XA 4DRHA 3O5EA 1A7XA 1F40A 5HUAA 1YW5A 3MDYB 1ZCNA 2RSEA 2OFNA 4W9QA 2F21A 1FKSA 1NMVA 2KI3A 2PV1A 2MLZA 2DG3A 4ODQA 4QT3A 2M2AA 4DRNA 1KT0A 1QZ2A 1Q6IA 2DG9A 3KAHA 2PBCA 5I98A 2MF9A 3O5JA 1T11A 3IHZA 1EQ3A 4DRIA 2ZQUA 4TW7A 3UI4A 2PV2A 2ZR6A 1EYMA 1U79A 3B7XA 1FKTA 4ITZA 2PPPA 2RUDA 2VN1A 1KT1A 3IKGA 3NRKA 3ODKA 2D9FA 3KCEA 5DITA 4JFIA 5HTGA 4LAVA 1FKIA 2ZQVA 2ZQSA 5HT1A 3O5LA 3UQAA 2M08A 3TDBA 3RGCA 2XP8A 1D7JA 4DRJA 2UZ5A 1JVWA 4TW6A 4ODNA 1D7HA 1FKLA 4QT2A 1ZK6A 3O5MA 1P5QA 2PV3A 4DRKA 1JNTA 4N19A 5DIVA 3NTPA 4TYOA 1FD9A 1D6OA 2PPOA 2PPNA 2ZR4A 1Q6HA 3JYJA 2F2DA 4DZ3A 1FKKA 2LKNA 4U84A 4U86A 2KR7A 4G2PA 2Q5AA 1BKFA 1W26A 3NI6A 3JXVA 3O5FA 3KADA 1QPFA 2KGJA 2MLYA 2XP4A 3O5IA 3VAWA 5B8IC 3CGNA 1N1AA 3KAFA 4ODLA 4DRMA 2RUCA 1R9HA 2L2SA 1QPLA 2MNTA 2JZVA 2XP7A 2Y78A 3OOBA 4LAWA 4ODKA 4ODMA 3RFWA 4JFKA 1FKFA 1D7IA 1FKDA 4ODRA 2XP9A 4DRPA 1J4HA 4FAPA
chains in the Genus database with same CATH superfamily
3ARXA 4TW8A 4HBEA 4Q7NA 3LUOA 1NWRA 3G6LA 3ARPA 5HKGA 1E6ZA 4NZCA 4MSPA 3O5QA 1D2KA 4JFMA 1ROUA 2IF4A 4JFLA 4DRMA 5HW6A 5I98A 4O2TA 4G50A 2B5UB 2XP3A 4L3NA 2FKEA 4J4OA 2N87A 2LPVA 3PR9A 1FFRA 1SR0A 1PBKA 1BL4A 3WIJA 3UQBA 3ARRA 2F4EA 4IQCA 1ZBWA 3IK8A 3KZ7A 1PINA 1JNDA 1FKJA 3TCZA 3WL0A 3GPKA 5HWCA 1XHGA 3O5GA 1LQ0A 1JNSA 1E6NA 3UI5A 3RMEA 2YBTA 2KE0A 4ODPA 2XPAA 1ZBCA 4MGVA 1FKGA 1W1VA 2A3AA 3O5OA 1FKBA 1ZBKA 2ESCA 1O6IA 1XRVA 1HKMA 1HKKA 2IUZA 1A7XA 3O5EA 3QOKA 4LGXA 1ZCNA 4ZPTR 4ODQA 2M2AA 2YBUA 2WM0A 3KAHA 1T11A 3IHZA 1E9LA 4R5EA 4MAVA 2ZR6A 1EYMA 1LL7A 3ARTA 2RUDA 4Z2KA 4JFIA 4LAVA 2ETNA 1FKIA 2ZQVA 3O5LA 3RGCA 1W1YA 4TW6A 2WLYA 1JCHB 3CHCA 1X6LA 1HKIA 3AS2A 4WIWA 2DT1A 4DZ3A 3FXYA 2A3BA 1E44A 3GTYX 2MLYA 3CGNA 1N1AA 1QPLA 4ODKA 2JZVA 2WK2A 2XP7A 2DT2A 4KR0B 1SYTA 1NWTA 5JH8A 1D7IA 2XP9A 1J4HA 2MLXA 5D75A 2PI6A 3O5RA 4DROA 3IKDA 3AQUA 1Q1CA 4QIBA 1B6CA 4TNSA 3KACA 5GQBA 1ZU8A 2DG4A 3B9AA 4DIPA 2A3EA 2AOSA 3FAPA 5BXJA 2XP5A 2KO7A 2RUQA 3GU0A 3RM8A 1YATA 1M5YA 2B31A 2ZR5A 1J4RA 2KFWA 4DRQA 3PRAA 1FJDA 2XP6A 1NSGA 4TX0A 1Y0OA 3ARYA 5HWBA 2M1IA 4MNMA 1CTNA 1ZBVA 1L1PA 4WKAA 4Z2LA 1F8AB 4MNJA 3WKZA 2ZQTA 4IQ2A 3WH0A 4J4NA 3WL1A 4NNRA 3KABA 1HXVA 2O9OA 1ROTA 3G6MA 3CZ8A 1HKJA 3B8SA 4DZ2A 1NMWA 3UI6A 3RM4A 1F40A 4IT4A 4QT3A 2KI3A 1Q6IA 2G41A 2DSZA 1K9TA 2MF9A 3CHDA 1E6PA 3UI4A 3BXWA 3ARSA 3CHFA 4Q22A 2PPPA 2VN1A 1WAWA 3NRKA 1H0IA 5HTGA 3OA5A 3CH9A 4W5UA 4P8XA 2M08A 3TDBA 4DRJA 1D7JA 2UZ5A 4MNLA 1JNEA 1JVWA 4QT2A 2QF8A 1FFQA 5DIVA 1D6OA 2PPNA 2F2DA 2LKNA 4U84A 4ZS6A 4U86A 2KR7A 2Q5AA 4C02B 3JXVA 1QPFA 2KGJA 1H0GA 5B8IC 3VAWA 3KAFA 2RUCA 2L2SA 3WD3A 2Y78A 5DO2A 2F23A 4JFKA 1KFWA 1FKFA 4AY1A 3JYJA 2OLHA 1Q6UA 3O5DA 1FKHA 2P4VA 2LGOA 1X6NA 4JYSA 1FKRA 2LJ4A 3O5PA 4HBOA 4S3JA 4DH0A 3WD4A 5GPGA 1LG1A 1EHNA 3H9RB 2WLZA 4DWSB 1LL4A 1UR9A 4P8WA 4GGQA 5J6EA 5DF0A 4L72B 1W1PA 5GPRA 1GPFA 4W9OA 3PRBA 2XPBA 4MTVA 3JYMA 3ARQA 3EY6A 3KAGA 1W1TA 1LJYA 3UQIA 4ODOA 3ARZA 2MPHA 3TC5A 4W9PA 5DIUA 2DSWA 1FAPA 4Z2IA 4LAYA 1UR8A 1HJVA 4DRHA 5HUAA 1YW5A 3MDYB 1OGBA 2RSEA 2F21A 1NMVA 2MLZA 2DG3A 4DRNA 1IX5A 1KT0A 2DG9A 1NWUA 1OGGA 1EQ3A 4MNKA 4S3KA 1NWSA 3AROA 3WQVA 2PV2A 3WD1A 1U79A 2DT0A 4UDMA 2DT3A 1ZB5A 2D9FA 3KCEA 5DITA 1GUVA 3BMBA 4P8VA 4HARA 4WKFA 1E6RA 3ARUA 4ODNA 1D7HA 1FKLA 1ITXA 1P5QA 1VF8A 2PV3A 4DRKA 4N19A 3NTPA 4TYOA 2ZR4A 2G8ZA 3NI6A 3KADA 3WQWA 4QZVB 1EDQA 1R9HA 3OOBA 4DWSD 3RFWA 3RM9A 1FKDA 2A3CA 1HJXA 2DSVA 2RQSA 4NSBA 4FN2A 4KQZA 1LL6A 1TCOC 3AS0A 3I6CA 4P8UA 1RD6A 2K8IA 4MPKA 4LAXA 3KAIA 2DPEA 1LG2A 3UF8A 3O5KA 3FY1A 1GRJA 1HJWA 2EULA 5HW8A 4GIVA 1W9UA 4U85A 1C9HA 2RURA 2VCDA 4IPXA 2FAPA 3PRDA 3W4RA 4BF8A 2ITKA 3ARVA 4URIA 1J4IA 4Z2GA 1OWQA 4PTMA 3PA7A 5HW7A 4DT4A 4ZPWR 1EIBA 2AWGA 3CGMA 1GOIA 4JFJA 4R0XA 2FDMA 4WK9A 1WNOA 1W9PA 4W9QA 2OFNA 2PV1A 1FKSA 1QZ2A 4DWSC 2PBCA 3WD0A 3O5JA 4WJXA 1W9VA 4WKHA 4DRIA 2ZQUA 4TW7A 3EIPA 4DWSA 3AS1A 4Z2HA 3B7XA 1FKTA 4ITZA 1KT1A 3IKGA 2PN0A 3ODKA 1NH6A 2ZQSA 5HT1A 3WD2A 1WB0A 3UQAA 2XP8A 1ZK6A 3O5MA 3CHEA 4ZPVR 1JNTA 1ZL1A 1FD9A 1E15A 2PPOA 1Q6HA 3ALGA 4Z2JA 1FKKA 4XAKA 3B9DA 3AS3A 4G2PA 3ARWA 1BKFA 1W26A 3O5IA 3O5FA 3B9EA 2XP4A 4IT6A 4ODLA 2O92A 4LAWA 2DSUA 2MNTA 3ALFA 4ODMA 5DEZA 5HBFA 1J6YA 1TFVA 4DRPA 4ODRA 4ML4A 4FAPA
chains in the Genus database with same CATH topology
3ARXA 4TW8A 4HBEA 4Q7NA 3LUOA 1NWRA 3G6LA 3ARPA 5HKGA 1E6ZA 4NZCA 4MSPA 3O5QA 1D2KA 4JFMA 1ROUA 2IF4A 4JFLA 4DRMA 5HW6A 5I98A 4O2TA 4G50A 2XP3A 4L3NA 2FKEA 4J4OA 2N87A 2LPVA 3PR9A 1FFRA 1SR0A 1PBKA 1BL4A 3WIJA 3UQBA 3ARRA 2F4EA 4IQCA 1ZBWA 3IK8A 3KZ7A 1PINA 1JNDA 1FKJA 3TCZA 3WL0A 3GPKA 5HWCA 1XHGA 3O5GA 1LQ0A 1JNSA 1E6NA 3UI5A 3RMEA 2YBTA 2KE0A 4ODPA 2XPAA 1ZBCA 4MGVA 1FKGA 1W1VA 2A3AA 3O5OA 1FKBA 1ZBKA 2ESCA 1O6IA 1XRVA 1HKMA 1HKKA 2IUZA 1A7XA 3O5EA 3QOKA 4LGXA 1ZCNA 4ZPTR 4ODQA 2M2AA 2YBUA 2WM0A 3KAHA 1T11A 3IHZA 1E9LA 4R5EA 4MAVA 2ZR6A 1EYMA 1LL7A 3ARTA 2RUDA 4Z2KA 4JFIA 4LAVA 1FKIA 2ZQVA 3O5LA 3RGCA 1W1YA 4TW6A 2WLYA 3CHCA 1X6LA 1HKIA 3AS2A 4WIWA 2DT1A 4DZ3A 3FXYA 2A3BA 2MLYA 3CGNA 1N1AA 1QPLA 4ODKA 2JZVA 2WK2A 2XP7A 2DT2A 4KR0B 1SYTA 1NWTA 5JH8A 1D7IA 2XP9A 1J4HA 2MLXA 5D75A 2PI6A 3O5RA 4DROA 3IKDA 3AQUA 1Q1CA 4QIBA 1B6CA 4TNSA 3KACA 5GQBA 1ZU8A 2DG4A 3B9AA 4DIPA 2A3EA 2AOSA 3FAPA 5BXJA 2XP5A 2KO7A 2RUQA 3RM8A 1YATA 1M5YA 2B31A 2ZR5A 1J4RA 2KFWA 4DRQA 3PRAA 1FJDA 2XP6A 1NSGA 4TX0A 1Y0OA 3ARYA 5HWBA 2M1IA 4MNMA 1CTNA 1ZBVA 1L1PA 4WKAA 4Z2LA 1F8AB 4MNJA 3WKZA 2ZQTA 4IQ2A 3WH0A 4J4NA 3WL1A 4NNRA 3KABA 1HXVA 2O9OA 1ROTA 3G6MA 3CZ8A 1HKJA 3B8SA 4DZ2A 1NMWA 3UI6A 3RM4A 1F40A 4IT4A 4QT3A 2KI3A 1Q6IA 2G41A 2DSZA 1K9TA 2MF9A 3CHDA 1E6PA 3UI4A 3BXWA 3ARSA 3CHFA 4Q22A 2PPPA 2VN1A 1WAWA 3NRKA 1H0IA 5HTGA 3OA5A 3CH9A 4W5UA 4P8XA 2M08A 3TDBA 4DRJA 1D7JA 2UZ5A 4MNLA 1JNEA 1JVWA 4QT2A 2QF8A 1FFQA 5DIVA 1D6OA 2PPNA 2F2DA 2LKNA 4U84A 4ZS6A 4U86A 2KR7A 2Q5AA 4C02B 3JXVA 1QPFA 2KGJA 1H0GA 5B8IC 3VAWA 3KAFA 2RUCA 2L2SA 3WD3A 2Y78A 5DO2A 4JFKA 1KFWA 1FKFA 4AY1A 3JYJA 2OLHA 1Q6UA 3O5DA 1FKHA 2LGOA 1X6NA 4JYSA 1FKRA 2LJ4A 3O5PA 4HBOA 4S3JA 4DH0A 3WD4A 5GPGA 1LG1A 1EHNA 3H9RB 2WLZA 4DWSB 1LL4A 1UR9A 4P8WA 4GGQA 5J6EA 5DF0A 4L72B 1W1PA 5GPRA 1GPFA 4W9OA 3PRBA 2XPBA 4MTVA 3JYMA 3ARQA 3EY6A 3KAGA 1W1TA 1LJYA 3UQIA 4ODOA 3ARZA 2MPHA 3TC5A 4W9PA 5DIUA 2DSWA 1FAPA 4Z2IA 4LAYA 1UR8A 1HJVA 4DRHA 5HUAA 1YW5A 3MDYB 1OGBA 2RSEA 2F21A 1NMVA 2MLZA 2DG3A 4DRNA 1IX5A 1KT0A 2DG9A 1NWUA 1OGGA 1EQ3A 4MNKA 4S3KA 1NWSA 3AROA 3WQVA 2PV2A 3WD1A 1U79A 2DT0A 2DT3A 1ZB5A 2D9FA 3KCEA 5DITA 1GUVA 4P8VA 4HARA 4WKFA 1E6RA 3ARUA 4ODNA 1D7HA 1FKLA 1ITXA 1P5QA 1VF8A 2PV3A 4DRKA 4N19A 3NTPA 4TYOA 2ZR4A 2G8ZA 3NI6A 3KADA 3WQWA 4QZVB 1EDQA 1R9HA 3OOBA 4DWSD 3RFWA 3RM9A 1FKDA 2A3CA 1HJXA 2DSVA 2RQSA 4NSBA 4FN2A 4KQZA 1LL6A 1TCOC 3AS0A 3I6CA 4P8UA 1RD6A 2K8IA 4MPKA 4LAXA 3KAIA 2DPEA 1LG2A 3UF8A 3O5KA 3FY1A 1HJWA 5HW8A 4GIVA 1W9UA 4U85A 1C9HA 2RURA 2VCDA 4IPXA 2FAPA 3PRDA 3W4RA 4BF8A 2ITKA 3ARVA 4URIA 1J4IA 4Z2GA 1OWQA 4PTMA 3PA7A 5HW7A 4DT4A 4ZPWR 1EIBA 2AWGA 3CGMA 1GOIA 4JFJA 4R0XA 2FDMA 4WK9A 1WNOA 1W9PA 4W9QA 2OFNA 2PV1A 1FKSA 1QZ2A 4DWSC 2PBCA 3WD0A 3O5JA 4WJXA 1W9VA 4WKHA 4DRIA 2ZQUA 4TW7A 4DWSA 3AS1A 4Z2HA 3B7XA 1FKTA 4ITZA 1KT1A 3IKGA 3ODKA 1NH6A 2ZQSA 5HT1A 3WD2A 1WB0A 3UQAA 2XP8A 1ZK6A 3O5MA 3CHEA 4ZPVR 1JNTA 1ZL1A 1FD9A 1E15A 2PPOA 1Q6HA 3ALGA 4Z2JA 1FKKA 4XAKA 3B9DA 3AS3A 4G2PA 3ARWA 1BKFA 1W26A 3O5IA 3O5FA 3B9EA 2XP4A 4IT6A 4ODLA 2O92A 4LAWA 2DSUA 2MNTA 3ALFA 4ODMA 5DEZA 5HBFA 1J6YA 1TFVA 4DRPA 4ODRA 4ML4A 4FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW8 A;  1Q6U A;  2RQS A;  3LUO A;  2MLX A;  5D75 A;  3O5R A;  4DRO A;  3IKD A;  5HKG A;  4FN2 A;  4MSP A;  5HW6 A;  3O5D A;  1FKH A;  1J6Y A;  1Q1C A;  3O5Q A;  4JFM A;  1ROU A;  2IF4 A;  2LGO A;  4JFL A;  1B6C A;  4QIB A;  4TNS A;  1TCO C;  3KAC A;  4JYS A;  4G50 A;  4O2T A;  2XP3 A;  2DG4 A;  3I6C A;  2FKE A;  1FKR A;  2LJ4 A;  3O5P A;  4J4O A;  2N87 A;  4DIP A;  4DH0 A;  5GPG A;  2LPV A;  2K8I A;  4LAX A;  3FAP A;  5BXJ A;  1PBK A;  2XP5 A;  2KO7 A;  2RUQ A;  3H9R B;  3KAI A;  3O5K A;  3UF8 A;  1BL4 A;  3UQB A;  1YAT A;  1M5Y A;  2ZR5 A;  2F4E A;  1J4R A;  2KFW A;  4DRQ A;  4IQC A;  1FJD A;  3IK8 A;  2XP6 A;  3KZ7 A;  4GGQ A;  5HWC A;  5J6E A;  1PIN A;  1NSG A;  4TX0 A;  1Y0O A;  5HW8 A;  4GIV A;  1FKJ A;  4U85 A;  1C9H A;  3TCZ A;  3GPK A;  2RUR A;  2VCD A;  4IPX A;  3PRB A;  2XPB A;  4W9O A;  5HWB A;  3O5G A;  2M1I A;  3JYM A;  4C02 B;  1JNS A;  2FAP A;  3EY6 A;  3KAG A;  3PRD A;  3UI5 A;  2KE0 A;  4BF8 A;  4ODP A;  2XPA A;  1L1P A;  1F8A B;  1FKG A;  4MGV A;  3UQI A;  2ITK A;  2ZQT A;  4ODO A;  3O5O A;  2MPH A;  4IQ2 A;  3TC5 A;  3WH0 A;  1J4I A;  4J4N A;  4W9P A;  5DIU A;  4NNR A;  3KAB A;  1HXV A;  1FKB A;  1ROT A;  3PA7 A;  5HW7 A;  4DT4 A;  1FAP A;  2AWG A;  4DZ2 A;  1NMW A;  3CGM A;  4LAY A;  3UI6 A;  4JFJ A;  4R0X A;  4DRH A;  3O5E A;  1A7X A;  1F40 A;  5HUA A;  1YW5 A;  3MDY B;  1ZCN A;  2RSE A;  2OFN A;  4W9Q A;  2F21 A;  1FKS A;  1NMV A;  2KI3 A;  2PV1 A;  2MLZ A;  2DG3 A;  4ODQ A;  4QT3 A;  2M2A A;  4DRN A;  1KT0 A;  1QZ2 A;  1Q6I A;  2DG9 A;  3KAH A;  2PBC A;  5I98 A;  2MF9 A;  3O5J A;  1T11 A;  3IHZ A;  1EQ3 A;  4DRI A;  2ZQU A;  4TW7 A;  3UI4 A;  2PV2 A;  2ZR6 A;  1EYM A;  1U79 A;  3B7X A;  1FKT A;  4ITZ A;  2PPP A;  2RUD A;  2VN1 A;  1KT1 A;  3IKG A;  3NRK A;  3ODK A;  2D9F A;  3KCE A;  5DIT A;  4JFI A;  5HTG A;  4LAV A;  1FKI A;  2ZQV A;  2ZQS A;  5HT1 A;  3O5L A;  3UQA A;  2M08 A;  3TDB A;  3RGC A;  2XP8 A;  1D7J A;  4DRJ A;  2UZ5 A;  1JVW A;  4TW6 A;  4ODN A;  1D7H A;  1FKL A;  4QT2 A;  1ZK6 A;  3O5M A;  1P5Q A;  2PV3 A;  4DRK A;  1JNT A;  4N19 A;  5DIV A;  3NTP A;  4TYO A;  1FD9 A;  1D6O A;  2PPO A;  2PPN A;  2ZR4 A;  1Q6H A;  3JYJ A;  2F2D A;  4DZ3 A;  1FKK A;  2LKN A;  4U84 A;  4U86 A;  2KR7 A;  4G2P A;  2Q5A A;  1BKF A;  1W26 A;  3NI6 A;  3JXV A;  3O5F A;  3KAD A;  1QPF A;  2KGJ A;  2MLY A;  2XP4 A;  3O5I A;  3VAW A;  5B8I C;  3CGN A;  1N1A A;  3KAF A;  4ODL A;  4DRM A;  2RUC A;  1R9H A;  2L2S A;  1QPL A;  2MNT A;  2JZV A;  2XP7 A;  2Y78 A;  3OOB A;  4LAW A;  4ODK A;  4ODM A;  3RFW A;  4JFK A;  1FKF A;  1D7I A;  1FKD A;  4ODR A;  2XP9 A;  4DRP A;  1J4H A;  4FAP A; 
#chains in the Genus database with same CATH topology
 3ARX A;  4TW8 A;  4HBE A;  4Q7N A;  3LUO A;  1NWR A;  3G6L A;  3ARP A;  5HKG A;  1E6Z A;  4NZC A;  4MSP A;  3O5Q A;  1D2K A;  4JFM A;  1ROU A;  2IF4 A;  4JFL A;  4DRM A;  5HW6 A;  5I98 A;  4O2T A;  4G50 A;  2B5U B;  2XP3 A;  4L3N A;  2FKE A;  4J4O A;  2N87 A;  2LPV A;  3PR9 A;  1FFR A;  1SR0 A;  1PBK A;  1BL4 A;  3WIJ A;  3UQB A;  3ARR A;  2F4E A;  4IQC A;  1ZBW A;  3IK8 A;  3KZ7 A;  1PIN A;  1JND A;  1FKJ A;  3TCZ A;  3WL0 A;  3GPK A;  5HWC A;  1XHG A;  3O5G A;  1LQ0 A;  1JNS A;  1E6N A;  3UI5 A;  3RME A;  2YBT A;  2KE0 A;  4ODP A;  2XPA A;  1ZBC A;  4MGV A;  1FKG A;  1W1V A;  2A3A A;  3O5O A;  1FKB A;  1ZBK A;  2ESC A;  1O6I A;  1XRV A;  1HKM A;  1HKK A;  2IUZ A;  1A7X A;  3O5E A;  3QOK A;  4LGX A;  1ZCN A;  4ZPT R;  4ODQ A;  2M2A A;  2YBU A;  2WM0 A;  3KAH A;  1T11 A;  3IHZ A;  1E9L A;  4R5E A;  4MAV A;  2ZR6 A;  1EYM A;  1LL7 A;  3ART A;  2RUD A;  4Z2K A;  4JFI A;  4LAV A;  2ETN A;  1FKI A;  2ZQV A;  3O5L A;  3RGC A;  1W1Y A;  4TW6 A;  2WLY A;  1JCH B;  3CHC A;  1X6L A;  1HKI A;  3AS2 A;  4WIW A;  2DT1 A;  4DZ3 A;  3FXY A;  2A3B A;  1E44 A;  3GTY X;  2MLY A;  3CGN A;  1N1A A;  1QPL A;  4ODK A;  2JZV A;  2WK2 A;  2XP7 A;  2DT2 A;  4KR0 B;  1SYT A;  1NWT A;  5JH8 A;  1D7I A;  2XP9 A;  1J4H A;  2MLX A;  5D75 A;  2PI6 A;  3O5R A;  4DRO A;  3IKD A;  3AQU A;  1Q1C A;  4QIB A;  1B6C A;  4TNS A;  3KAC A;  5GQB A;  1ZU8 A;  2DG4 A;  3B9A A;  4DIP A;  2A3E A;  2AOS A;  3FAP A;  5BXJ A;  2XP5 A;  2KO7 A;  2RUQ A;  3GU0 A;  3RM8 A;  1YAT A;  1M5Y A;  2B31 A;  2ZR5 A;  1J4R A;  2KFW A;  4DRQ A;  3PRA A;  1FJD A;  2XP6 A;  1NSG A;  4TX0 A;  1Y0O A;  3ARY A;  5HWB A;  2M1I A;  4MNM A;  1CTN A;  1ZBV A;  1L1P A;  4WKA A;  4Z2L A;  1F8A B;  4MNJ A;  3WKZ A;  2ZQT A;  4IQ2 A;  3WH0 A;  4J4N A;  3WL1 A;  4NNR A;  3KAB A;  1HXV A;  2O9O A;  1ROT A;  3G6M A;  3CZ8 A;  1HKJ A;  3B8S A;  4DZ2 A;  1NMW A;  3UI6 A;  3RM4 A;  1F40 A;  4IT4 A;  4QT3 A;  2KI3 A;  1Q6I A;  2G41 A;  2DSZ A;  1K9T A;  2MF9 A;  3CHD A;  1E6P A;  3UI4 A;  3BXW A;  3ARS A;  3CHF A;  4Q22 A;  2PPP A;  2VN1 A;  1WAW A;  3NRK A;  1H0I A;  5HTG A;  3OA5 A;  3CH9 A;  4W5U A;  4P8X A;  2M08 A;  3TDB A;  4DRJ A;  1D7J A;  2UZ5 A;  4MNL A;  1JNE A;  1JVW A;  4QT2 A;  2QF8 A;  1FFQ A;  5DIV A;  1D6O A;  2PPN A;  2F2D A;  2LKN A;  4U84 A;  4ZS6 A;  4U86 A;  2KR7 A;  2Q5A A;  4C02 B;  3JXV A;  1QPF A;  2KGJ A;  1H0G A;  5B8I C;  3VAW A;  3KAF A;  2RUC A;  2L2S A;  3WD3 A;  2Y78 A;  5DO2 A;  2F23 A;  4JFK A;  1KFW A;  1FKF A;  4AY1 A;  3JYJ A;  2OLH A;  1Q6U A;  3O5D A;  1FKH A;  2P4V A;  2LGO A;  1X6N A;  4JYS A;  1FKR A;  2LJ4 A;  3O5P A;  4HBO A;  4S3J A;  4DH0 A;  3WD4 A;  5GPG A;  1LG1 A;  1EHN A;  3H9R B;  2WLZ A;  4DWS B;  1LL4 A;  1UR9 A;  4P8W A;  4GGQ A;  5J6E A;  5DF0 A;  4L72 B;  1W1P A;  5GPR A;  1GPF A;  4W9O A;  3PRB A;  2XPB A;  4MTV A;  3JYM A;  3ARQ A;  3EY6 A;  3KAG A;  1W1T A;  1LJY A;  3UQI A;  4ODO A;  3ARZ A;  2MPH A;  3TC5 A;  4W9P A;  5DIU A;  2DSW A;  1FAP A;  4Z2I A;  4LAY A;  1UR8 A;  1HJV A;  4DRH A;  5HUA A;  1YW5 A;  3MDY B;  1OGB A;  2RSE A;  2F21 A;  1NMV A;  2MLZ A;  2DG3 A;  4DRN A;  1IX5 A;  1KT0 A;  2DG9 A;  1NWU A;  1OGG A;  1EQ3 A;  4MNK A;  4S3K A;  1NWS A;  3ARO A;  3WQV A;  2PV2 A;  3WD1 A;  1U79 A;  2DT0 A;  4UDM A;  2DT3 A;  1ZB5 A;  2D9F A;  3KCE A;  5DIT A;  1GUV A;  3BMB A;  4P8V A;  4HAR A;  4WKF A;  1E6R A;  3ARU A;  4ODN A;  1D7H A;  1FKL A;  1ITX A;  1P5Q A;  1VF8 A;  2PV3 A;  4DRK A;  4N19 A;  3NTP A;  4TYO A;  2ZR4 A;  2G8Z A;  3NI6 A;  3KAD A;  3WQW A;  4QZV B;  1EDQ A;  1R9H A;  3OOB A;  4DWS D;  3RFW A;  3RM9 A;  1FKD A;  2A3C A;  1HJX A;  2DSV A;  2RQS A;  4NSB A;  4FN2 A;  4KQZ A;  1LL6 A;  1TCO C;  3AS0 A;  3I6C A;  4P8U A;  1RD6 A;  2K8I A;  4MPK A;  4LAX A;  3KAI A;  2DPE A;  1LG2 A;  3UF8 A;  3O5K A;  3FY1 A;  1GRJ A;  1HJW A;  2EUL A;  5HW8 A;  4GIV A;  1W9U A;  4U85 A;  1C9H A;  2RUR A;  2VCD A;  4IPX A;  2FAP A;  3PRD A;  3W4R A;  4BF8 A;  2ITK A;  3ARV A;  4URI A;  1J4I A;  4Z2G A;  1OWQ A;  4PTM A;  3PA7 A;  5HW7 A;  4DT4 A;  4ZPW R;  1EIB A;  2AWG A;  3CGM A;  1GOI A;  4JFJ A;  4R0X A;  2FDM A;  4WK9 A;  1WNO A;  1W9P A;  4W9Q A;  2OFN A;  2PV1 A;  1FKS A;  1QZ2 A;  4DWS C;  2PBC A;  3WD0 A;  3O5J A;  4WJX A;  1W9V A;  4WKH A;  4DRI A;  2ZQU A;  4TW7 A;  3EIP A;  4DWS A;  3AS1 A;  4Z2H A;  3B7X A;  1FKT A;  4ITZ A;  1KT1 A;  3IKG A;  2PN0 A;  3ODK A;  1NH6 A;  2ZQS A;  5HT1 A;  3WD2 A;  1WB0 A;  3UQA A;  2XP8 A;  1ZK6 A;  3O5M A;  3CHE A;  4ZPV R;  1JNT A;  1ZL1 A;  1FD9 A;  1E15 A;  2PPO A;  1Q6H A;  3ALG A;  4Z2J A;  1FKK A;  4XAK A;  3B9D A;  3AS3 A;  4G2P A;  3ARW A;  1BKF A;  1W26 A;  3O5I A;  3O5F A;  3B9E A;  2XP4 A;  4IT6 A;  4ODL A;  2O92 A;  4LAW A;  2DSU A;  2MNT A;  3ALF A;  4ODM A;  5DEZ A;  5HBF A;  1J6Y A;  1TFV A;  4DRP A;  4ODR A;  4ML4 A;  4FAP A; 
#chains in the Genus database with same CATH homology
 3ARX A;  4TW8 A;  4HBE A;  4Q7N A;  3LUO A;  1NWR A;  3G6L A;  3ARP A;  5HKG A;  1E6Z A;  4NZC A;  4MSP A;  3O5Q A;  1D2K A;  4JFM A;  1ROU A;  2IF4 A;  4JFL A;  4DRM A;  5HW6 A;  5I98 A;  4O2T A;  4G50 A;  2XP3 A;  4L3N A;  2FKE A;  4J4O A;  2N87 A;  2LPV A;  3PR9 A;  1FFR A;  1SR0 A;  1PBK A;  1BL4 A;  3WIJ A;  3UQB A;  3ARR A;  2F4E A;  4IQC A;  1ZBW A;  3IK8 A;  3KZ7 A;  1PIN A;  1JND A;  1FKJ A;  3TCZ A;  3WL0 A;  3GPK A;  5HWC A;  1XHG A;  3O5G A;  1LQ0 A;  1JNS A;  1E6N A;  3UI5 A;  3RME A;  2YBT A;  2KE0 A;  4ODP A;  2XPA A;  1ZBC A;  4MGV A;  1FKG A;  1W1V A;  2A3A A;  3O5O A;  1FKB A;  1ZBK A;  2ESC A;  1O6I A;  1XRV A;  1HKM A;  1HKK A;  2IUZ A;  1A7X A;  3O5E A;  3QOK A;  4LGX A;  1ZCN A;  4ZPT R;  4ODQ A;  2M2A A;  2YBU A;  2WM0 A;  3KAH A;  1T11 A;  3IHZ A;  1E9L A;  4R5E A;  4MAV A;  2ZR6 A;  1EYM A;  1LL7 A;  3ART A;  2RUD A;  4Z2K A;  4JFI A;  4LAV A;  1FKI A;  2ZQV A;  3O5L A;  3RGC A;  1W1Y A;  4TW6 A;  2WLY A;  3CHC A;  1X6L A;  1HKI A;  3AS2 A;  4WIW A;  2DT1 A;  4DZ3 A;  3FXY A;  2A3B A;  2MLY A;  3CGN A;  1N1A A;  1QPL A;  4ODK A;  2JZV A;  2WK2 A;  2XP7 A;  2DT2 A;  4KR0 B;  1SYT A;  1NWT A;  5JH8 A;  1D7I A;  2XP9 A;  1J4H A;  2MLX A;  5D75 A;  2PI6 A;  3O5R A;  4DRO A;  3IKD A;  3AQU A;  1Q1C A;  4QIB A;  1B6C A;  4TNS A;  3KAC A;  5GQB A;  1ZU8 A;  2DG4 A;  3B9A A;  4DIP A;  2A3E A;  2AOS A;  3FAP A;  5BXJ A;  2XP5 A;  2KO7 A;  2RUQ A;  3RM8 A;  1YAT A;  1M5Y A;  2B31 A;  2ZR5 A;  1J4R A;  2KFW A;  4DRQ A;  3PRA A;  1FJD A;  2XP6 A;  1NSG A;  4TX0 A;  1Y0O A;  3ARY A;  5HWB A;  2M1I A;  4MNM A;  1CTN A;  1ZBV A;  1L1P A;  4WKA A;  4Z2L A;  1F8A B;  4MNJ A;  3WKZ A;  2ZQT A;  4IQ2 A;  3WH0 A;  4J4N A;  3WL1 A;  4NNR A;  3KAB A;  1HXV A;  2O9O A;  1ROT A;  3G6M A;  3CZ8 A;  1HKJ A;  3B8S A;  4DZ2 A;  1NMW A;  3UI6 A;  3RM4 A;  1F40 A;  4IT4 A;  4QT3 A;  2KI3 A;  1Q6I A;  2G41 A;  2DSZ A;  1K9T A;  2MF9 A;  3CHD A;  1E6P A;  3UI4 A;  3BXW A;  3ARS A;  3CHF A;  4Q22 A;  2PPP A;  2VN1 A;  1WAW A;  3NRK A;  1H0I A;  5HTG A;  3OA5 A;  3CH9 A;  4W5U A;  4P8X A;  2M08 A;  3TDB A;  4DRJ A;  1D7J A;  2UZ5 A;  4MNL A;  1JNE A;  1JVW A;  4QT2 A;  2QF8 A;  1FFQ A;  5DIV A;  1D6O A;  2PPN A;  2F2D A;  2LKN A;  4U84 A;  4ZS6 A;  4U86 A;  2KR7 A;  2Q5A A;  4C02 B;  3JXV A;  1QPF A;  2KGJ A;  1H0G A;  5B8I C;  3VAW A;  3KAF A;  2RUC A;  2L2S A;  3WD3 A;  2Y78 A;  5DO2 A;  4JFK A;  1KFW A;  1FKF A;  4AY1 A;  3JYJ A;  2OLH A;  1Q6U A;  3O5D A;  1FKH A;  2LGO A;  1X6N A;  4JYS A;  1FKR A;  2LJ4 A;  3O5P A;  4HBO A;  4S3J A;  4DH0 A;  3WD4 A;  5GPG A;  1LG1 A;  1EHN A;  3H9R B;  2WLZ A;  4DWS B;  1LL4 A;  1UR9 A;  4P8W A;  4GGQ A;  5J6E A;  5DF0 A;  4L72 B;  1W1P A;  5GPR A;  1GPF A;  4W9O A;  3PRB A;  2XPB A;  4MTV A;  3JYM A;  3ARQ A;  3EY6 A;  3KAG A;  1W1T A;  1LJY A;  3UQI A;  4ODO A;  3ARZ A;  2MPH A;  3TC5 A;  4W9P A;  5DIU A;  2DSW A;  1FAP A;  4Z2I A;  4LAY A;  1UR8 A;  1HJV A;  4DRH A;  5HUA A;  1YW5 A;  3MDY B;  1OGB A;  2RSE A;  2F21 A;  1NMV A;  2MLZ A;  2DG3 A;  4DRN A;  1IX5 A;  1KT0 A;  2DG9 A;  1NWU A;  1OGG A;  1EQ3 A;  4MNK A;  4S3K A;  1NWS A;  3ARO A;  3WQV A;  2PV2 A;  3WD1 A;  1U79 A;  2DT0 A;  2DT3 A;  1ZB5 A;  2D9F A;  3KCE A;  5DIT A;  1GUV A;  4P8V A;  4HAR A;  4WKF A;  1E6R A;  3ARU A;  4ODN A;  1D7H A;  1FKL A;  1ITX A;  1P5Q A;  1VF8 A;  2PV3 A;  4DRK A;  4N19 A;  3NTP A;  4TYO A;  2ZR4 A;  2G8Z A;  3NI6 A;  3KAD A;  3WQW A;  4QZV B;  1EDQ A;  1R9H A;  3OOB A;  4DWS D;  3RFW A;  3RM9 A;  1FKD A;  2A3C A;  1HJX A;  2DSV A;  2RQS A;  4NSB A;  4FN2 A;  4KQZ A;  1LL6 A;  1TCO C;  3AS0 A;  3I6C A;  4P8U A;  1RD6 A;  2K8I A;  4MPK A;  4LAX A;  3KAI A;  2DPE A;  1LG2 A;  3UF8 A;  3O5K A;  3FY1 A;  1HJW A;  5HW8 A;  4GIV A;  1W9U A;  4U85 A;  1C9H A;  2RUR A;  2VCD A;  4IPX A;  2FAP A;  3PRD A;  3W4R A;  4BF8 A;  2ITK A;  3ARV A;  4URI A;  1J4I A;  4Z2G A;  1OWQ A;  4PTM A;  3PA7 A;  5HW7 A;  4DT4 A;  4ZPW R;  1EIB A;  2AWG A;  3CGM A;  1GOI A;  4JFJ A;  4R0X A;  2FDM A;  4WK9 A;  1WNO A;  1W9P A;  4W9Q A;  2OFN A;  2PV1 A;  1FKS A;  1QZ2 A;  4DWS C;  2PBC A;  3WD0 A;  3O5J A;  4WJX A;  1W9V A;  4WKH A;  4DRI A;  2ZQU A;  4TW7 A;  4DWS A;  3AS1 A;  4Z2H A;  3B7X A;  1FKT A;  4ITZ A;  1KT1 A;  3IKG A;  3ODK A;  1NH6 A;  2ZQS A;  5HT1 A;  3WD2 A;  1WB0 A;  3UQA A;  2XP8 A;  1ZK6 A;  3O5M A;  3CHE A;  4ZPV R;  1JNT A;  1ZL1 A;  1FD9 A;  1E15 A;  2PPO A;  1Q6H A;  3ALG A;  4Z2J A;  1FKK A;  4XAK A;  3B9D A;  3AS3 A;  4G2P A;  3ARW A;  1BKF A;  1W26 A;  3O5I A;  3O5F A;  3B9E A;  2XP4 A;  4IT6 A;  4ODL A;  2O92 A;  4LAW A;  2DSU A;  2MNT A;  3ALF A;  4ODM A;  5DEZ A;  5HBF A;  1J6Y A;  1TFV A;  4DRP A;  4ODR A;  4ML4 A;  4FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...