4TW8A

The fk1-fk2 domains of fkbp52 in complex with ifit-fl
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
235
structure length
235
Chain Sequence
b'EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 53
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw8A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw8A02
2F2DA 1FKIA 3JYJA 3UI4A 4G2PA 1FJDA 2XP9A 3TC5A 1JVWA 4QT2A 4R0XA 4W9PA 2ZR6A 1EQ3A 3LUOA 2RURA 4JFKA 2L2SA 4DRJA 2N87A 2KR7A 1W26A 2LKNA 2XP3A 4JFMA 4O2TA 2DG3A 4ODLA 1FKRA 2AWGA 2XP6A 4G50A 1QPFA 4TX0A 3UF8A 1YW5A 1U79A 3O5DA 1J4HA 2XP8A 2FAPA 4TNSA 4U86A 3KAIA 3RGCA 3O5MA 1D7JA 4JFJA 2IF4A 3O5OA 4JFLA 4ODOA 4DH0A 1L1PA 1B6CA 3WH0A 3NRKA 2MPHA 4DRMA 1ZK6A 2ZR5A 4MSPA 2MLXA 3O5LA 3EY6A 4DRQA 4LAYA 3O5RA 2ZQUA 1Q6IA 1A7XA 5D75A 3KAGA 1Q6HA 4J4OA 1BKFA 3CGNA 1FKDA 1FKJA 1M5YA 2ITKA 4ODMA 3IKDA 3KADA 2DG4A 1D7HA 4JFIA 4DT4A 2PPPA 3NI6A 3VAWA 1HXVA 2MNTA 3KZ7A 1N1AA 3FAPA 4DRPA 1FKTA 2XPBA 4MGVA 3PRDA 4TW7A 4U85A 4W9QA 1F8AB 4DRIA 3JYMA 4IPXA 4QT3A 5HWBA 5I98A 5HWCA 4TW8A 3GPKA 1FKHA 1FAPA 4ODPA 4J4NA 4LAVA 3B7XA 2ZQSA 4JYSA 3UQBA 3MDYB 2RUQA 4ODRA 1FKKA 3H9RB 1J4RA 2PV2A 2XP4A 4GGQA 1FKBA 1BL4A 3O5EA 4GIVA 4ODKA 4C02B 2OFNA 5HTGA 2JZVA 5B8IC 3ODKA 4LAWA 3UI5A 4NNRA 1D6OA 1QZ2A 1NMWA 1ROTA 2RSEA 2XPAA 3I6CA 4TYOA 2PPOA 5J6EA 2D9FA 1J4IA 3O5GA 5HW7A 3O5KA 3O5QA 1JNTA 4LAXA 3PA7A 5DITA 3KCEA 2PBCA 5HW6A 4DZ2A 3OOBA 2MLZA 2FKEA 3UQIA 1YATA 2Q5AA 2M2AA 4BF8A 1NSGA 3KAHA 2Y78A 4IQ2A 4ODQA 4DRHA 1KT0A 2XP7A 1Q6UA 1ROUA 2F21A 1FKGA 2MLYA 2RQSA 2VCDA 3JXVA 4FAPA 2K8IA 2LGOA 2RUCA 2KFWA 4W9OA 2M1IA 5HKGA 2RUDA 4TW6A 1JNSA 3IK8A 3O5FA 2ZR4A 2ZQTA 5HUAA 1FKLA 1F40A 1TCOC 3TDBA 5BXJA 1FD9A 2KE0A 1PINA 4FN2A 4ITZA 3KACA 4N19A 3RFWA 1NMVA 3NTPA 2MF9A 2KGJA 3IHZA 2VN1A 3KAFA 1FKFA 1P5QA 4QIBA 1EYMA 5GPGA 2PV3A 1T11A 1ZCNA 2M08A 5DIVA 3PRBA 4DROA 2DG9A 1R9HA 1Y0OA 2LJ4A 2KI3A 3O5PA 2F4EA 4IQCA 1J6YA 5DIUA 3O5JA 2PPNA 2LPVA 1QPLA 1FKSA 1KT1A 2PV1A 3O5IA 5HT1A 3UI6A 4DIPA 1D7IA 3UQAA 4DRKA 4U84A 1PBKA 4ODNA 4DRNA 2XP5A 5HW8A 2UZ5A 1C9HA 3TCZA 4DZ3A 3CGMA 2KO7A 3IKGA 2ZQVA 3KABA 1Q1CA
chains in the Genus database with same CATH superfamily
2F2DA 4WIWA 3UI4A 4R0XA 3WL1A 1EQ3A 1ZU8A 1OWQA 2RURA 1E6RA 4JFMA 3GTYX 1UR8A 1ZBWA 2XP6A 3ARUA 1U79A 1J4HA 4PTMA 2FAPA 4TNSA 4U86A 4Z2JA 4MNKA 3ARPA 3AROA 2IF4A 1LL4A 4HARA 1E6NA 3PR9A 2B31A 3EY6A 4IT4A 4Z2IA 1A7XA 1UR9A 1Q6HA 4J4OA 1BKFA 1FKDA 1CTNA 4MAVA 4DT4A 1EIBA 2MNTA 3CHCA 3GU0A 4MGVA 5HWBA 3JYMA 4QT3A 5I98A 1JNDA 4ODRA 3H9RB 3B8SA 1J4RA 5DO2A 2XP4A 4ODKA 1ZBCA 2OFNA 1OGBA 1QZ2A 2XPAA 4L3NA 3O5QA 1HJVA 3G6LA 4P8VA 5DITA 4ML4A 1ZB5A 3EIPA 3OOBA 2FKEA 2M2AA 4IQ2A 4DRHA 2LGOA 1O6IA 2RUDA 3IK8A 2G8ZA 3ARWA 1FKLA 4FN2A 3CHFA 2P4VA 3NTPA 3IHZA 2KGJA 2VN1A 3KAFA 3FXYA 1ZCNA 4DROA 2DG9A 4MNJA 1RD6A 3O5JA 4LGXA 1QPLA 3UQAA 1XRVA 4DWSD 4DRKA 2XP5A 3CHEA 2WLYA 4DZ3A 3IKGA 3G6MA 1Q1CA 4G2PA 1FJDA 2XP9A 3TC5A 4R5EA 5GQBA 1WB0A 2G41A 5HBFA 2DT3A 2DPEA 3FY1A 2KR7A 4O2TA 4ODLA 1FKRA 1X6NA 2AWGA 2B5UB 1QPFA 4TX0A 3UF8A 1YW5A 3AQUA 3WIJA 3KAIA 4JFJA 3O5OA 4DH0A 4ODOA 3WH0A 3NRKA 4DRMA 1ZK6A 2ZR5A 1XHGA 2MLXA 3O5LA 1OGGA 3O5RA 4Z2HA 2WM0A 5D75A 3KAGA 3RMEA 1JCHB 3WD1A 3CGNA 2ETNA 2ITKA 4WK9A 1HJWA 3IKDA 3KADA 1D7HA 3KZ7A 2WK2A 4DRPA 1X6LA 4TW7A 3PRDA 4U85A 1F8AB 1NWSA 2PN0A 1HKMA 4ODPA 4J4NA 4LAVA 4MNMA 2FDMA 1W1YA 2IUZA 2PV2A 1FKBA 1BL4A 3O5EA 4GIVA 4C02B 4Q22A 1ZBKA 4NNRA 1ROTA 5J6EA 1ZL1A 1J4IA 4MPKA 3O5KA 1JNTA 3PA7A 3BMBA 3UQIA 1HKKA 1YATA 2Q5AA 4WKHA 3KAHA 2Y78A 4ZS6A 3ARXA 1ROUA 2F21A 2RQSA 4IT6A 2YBTA 4W9OA 3CZ8A 4DWSC 4DWSB 5HKGA 3AS0A 3O5FA 5BXJA 3TDBA 1FD9A 2KE0A 4N19A 1W1TA 4QIBA 4WKAA 5GPGA 3RM4A 4HBOA 2DSUA 1LQ0A 2PPNA 2A3EA 5HT1A 3UI6A 4L72B 1PBKA 2UZ5A 4KQZA 2KO7A 4HBEA 1IX5A 3JYJA 4MNLA 5JH8A 4W9PA 3PRAA 4UDMA 3LUOA 4DRJA 2L2SA 2N87A 2LKNA 3WD4A 2F23A 2XP3A 3AS3A 1HJXA 1NWRA 3B9AA 3O5DA 2XP8A 1LG2A 4URIA 3RGCA 1L1PA 4JFLA 4NSBA 2ESCA 2MPHA 4MSPA 4DRQA 4ZPTR 4LAYA 2ZQUA 1Q6IA 2O9OA 3CHDA 2A3AA 1FKJA 1TFVA 3ARSA 4ODMA 3ALGA 2PPPA 3NI6A 1HXVA 1E15A 1N1AA 2XPBA 4W9QA 1NWUA 1JNEA 4DRIA 4IPXA 4MTVA 4TW8A 3GPKA 1FKHA 4Z2GA 4JYSA 3MDYB 1K9TA 2RUQA 4GGQA 3ARZA 5HTGA 2JZVA 3UI5A 1D6OA 1VF8A 1NMWA 1WAWA 2RSEA 4W5UA 4TYOA 3WQVA 2D9FA 3O5GA 3OA5A 1D2KA 4LAXA 4QZVB 3KCEA 2PBCA 5HW6A 4DZ2A 4Z2KA 4BF8A 2YBUA 4WKFA 1KT0A 2QF8A 2WLZA 3ARQA 2VCDA 2K8IA 3B9EA 5GPRA 2M1IA 1NH6A 3ALFA 1PINA 3KACA 4ZPVR 3W4RA 1WNOA 1GOIA 3RFWA 3ARYA 2MF9A 3WD0A 1FKFA 3WL0A 1EYMA 4Q7NA 1E6PA 3WQWA 1Y0OA 1HKJA 2KI3A 2LJ4A 3O5PA 3QOKA 1J6YA 5DIUA 2DSVA 1GUVA 2LPVA 2PV1A 3WD3A 4U84A 4ODNA 4DRNA 5HW8A 3TCZA 1H0GA 3CGMA 1FKTA 4ODQA 4KR0B 1FKIA 1LL7A 1JVWA 4QT2A 3CH9A 2DSZA 1FFRA 2ZR6A 4XAKA 1E44A 4S3JA 4JFKA 1SYTA 2DT0A 4P8UA 1W26A 1HKIA 1W1VA 1NWTA 2DG3A 4G50A 3ARTA 3O5MA 1D7JA 3RM8A 4DWSA 1B6CA 2DT1A 2EULA 3ARVA 2AOSA 1KFWA 4Z2LA 1M5YA 1EHNA 4JFIA 4ZPWR 2DG4A 1EDQA 3VAWA 1FFQA 3FAPA 1ITXA 2A3CA 5HWCA 1FAPA 1GPFA 2PI6A 4AY1A 3B7XA 2ZQSA 3WD2A 3UQBA 3WKZA 1FKKA 1W9UA 1ZBVA 5B8IC 3ODKA 4LAWA 3I6CA 2PPOA 5HW7A 4P8XA 4WJXA 4S3KA 1GRJA 2MLZA 1NSGA 1LJYA 1LL6A 1LG1A 2XP7A 4NZCA 1Q6UA 1FKGA 2MLYA 3JXVA 4FAPA 2RUCA 2KFWA 5DF0A 4TW6A 1JNSA 2DSWA 3BXWA 2ZQTA 2ZR4A 5HUAA 1F40A 1TCOC 2DT2A 4ITZA 1W9VA 1H0IA 4P8WA 1NMVA 3B9DA 3AS2A 3ARRA 3RM9A 1P5QA 2PV3A 1T11A 2M08A 1E6ZA 3PRBA 5DIVA 2O92A 1R9HA 2F4EA 3AS1A 4IQCA 1FKSA 1KT1A 3O5IA 1W1PA 4DIPA 1D7IA 5DEZA 1SR0A 1E9LA 1C9HA 2A3BA 2OLHA 2ZQVA 1W9PA 3KABA
chains in the Genus database with same CATH topology
2F2DA 4WIWA 3UI4A 4R0XA 3WL1A 1EQ3A 1ZU8A 1OWQA 2RURA 1E6RA 4JFMA 1UR8A 1ZBWA 2XP6A 3ARUA 1U79A 1J4HA 4PTMA 2FAPA 4TNSA 4U86A 4Z2JA 4MNKA 3ARPA 3AROA 2IF4A 1LL4A 4HARA 1E6NA 3PR9A 2B31A 3EY6A 4IT4A 4Z2IA 1A7XA 1UR9A 1Q6HA 4J4OA 1BKFA 1FKDA 1CTNA 4MAVA 4DT4A 1EIBA 2MNTA 3CHCA 4MGVA 5HWBA 3JYMA 4QT3A 5I98A 1JNDA 4ODRA 3H9RB 3B8SA 1J4RA 5DO2A 2XP4A 4ODKA 1ZBCA 2OFNA 1OGBA 1QZ2A 2XPAA 4L3NA 3O5QA 1HJVA 3G6LA 4P8VA 5DITA 4ML4A 1ZB5A 3OOBA 2FKEA 2M2AA 4IQ2A 4DRHA 2LGOA 1O6IA 2RUDA 3IK8A 2G8ZA 3ARWA 1FKLA 4FN2A 3CHFA 3NTPA 3IHZA 2KGJA 2VN1A 3KAFA 3FXYA 1ZCNA 4DROA 2DG9A 4MNJA 1RD6A 3O5JA 4LGXA 1QPLA 3UQAA 1XRVA 4DWSD 4DRKA 2XP5A 3CHEA 2WLYA 4DZ3A 3IKGA 3G6MA 1Q1CA 4G2PA 1FJDA 2XP9A 3TC5A 4R5EA 5GQBA 1WB0A 2G41A 5HBFA 2DT3A 2DPEA 3FY1A 2KR7A 4O2TA 4ODLA 1FKRA 1X6NA 2AWGA 1QPFA 4TX0A 3UF8A 1YW5A 3AQUA 3WIJA 3KAIA 4JFJA 3O5OA 4DH0A 4ODOA 3WH0A 3NRKA 4DRMA 1ZK6A 2ZR5A 1XHGA 2MLXA 3O5LA 1OGGA 3O5RA 4Z2HA 2WM0A 5D75A 3KAGA 3RMEA 3WD1A 3CGNA 2ITKA 4WK9A 1HJWA 3IKDA 3KADA 1D7HA 3KZ7A 2WK2A 4DRPA 1X6LA 4TW7A 3PRDA 4U85A 1F8AB 1NWSA 1HKMA 4ODPA 4J4NA 4LAVA 4MNMA 2FDMA 1W1YA 2IUZA 2PV2A 1FKBA 1BL4A 3O5EA 4GIVA 4C02B 4Q22A 1ZBKA 4NNRA 1ROTA 5J6EA 1ZL1A 1J4IA 4MPKA 3O5KA 1JNTA 3PA7A 3UQIA 1HKKA 1YATA 2Q5AA 4WKHA 3KAHA 2Y78A 4ZS6A 3ARXA 1ROUA 2F21A 2RQSA 4IT6A 2YBTA 4W9OA 3CZ8A 4DWSC 4DWSB 5HKGA 3AS0A 3O5FA 5BXJA 3TDBA 1FD9A 2KE0A 4N19A 1W1TA 4QIBA 4WKAA 5GPGA 3RM4A 4HBOA 2DSUA 1LQ0A 2PPNA 2A3EA 5HT1A 3UI6A 4L72B 1PBKA 2UZ5A 4KQZA 2KO7A 4HBEA 1IX5A 3JYJA 4MNLA 5JH8A 4W9PA 3PRAA 3LUOA 4DRJA 2L2SA 2N87A 2LKNA 3WD4A 2XP3A 3AS3A 1HJXA 1NWRA 3B9AA 3O5DA 2XP8A 1LG2A 4URIA 3RGCA 1L1PA 4JFLA 4NSBA 2ESCA 2MPHA 4MSPA 4DRQA 4ZPTR 4LAYA 2ZQUA 1Q6IA 2O9OA 3CHDA 2A3AA 1FKJA 1TFVA 3ARSA 4ODMA 3ALGA 2PPPA 3NI6A 1HXVA 1E15A 1N1AA 2XPBA 4W9QA 1NWUA 1JNEA 4DRIA 4IPXA 4MTVA 4TW8A 3GPKA 1FKHA 4Z2GA 4JYSA 3MDYB 1K9TA 2RUQA 4GGQA 3ARZA 5HTGA 2JZVA 3UI5A 1D6OA 1VF8A 1NMWA 1WAWA 2RSEA 4W5UA 4TYOA 3WQVA 2D9FA 3O5GA 3OA5A 1D2KA 4LAXA 4QZVB 3KCEA 2PBCA 5HW6A 4DZ2A 4Z2KA 4BF8A 2YBUA 4WKFA 1KT0A 2QF8A 2WLZA 3ARQA 2VCDA 2K8IA 3B9EA 5GPRA 2M1IA 1NH6A 3ALFA 1PINA 3KACA 4ZPVR 3W4RA 1WNOA 1GOIA 3RFWA 3ARYA 2MF9A 3WD0A 1FKFA 3WL0A 1EYMA 4Q7NA 1E6PA 3WQWA 1Y0OA 1HKJA 3O5PA 2KI3A 2LJ4A 3QOKA 1J6YA 5DIUA 2DSVA 1GUVA 2LPVA 2PV1A 3WD3A 4U84A 4ODNA 4DRNA 5HW8A 3TCZA 1H0GA 3CGMA 1FKTA 4ODQA 4KR0B 1FKIA 1LL7A 1JVWA 4QT2A 3CH9A 2DSZA 1FFRA 2ZR6A 4XAKA 4S3JA 4JFKA 1SYTA 2DT0A 4P8UA 1W26A 1HKIA 1W1VA 1NWTA 2DG3A 4G50A 3ARTA 3O5MA 1D7JA 3RM8A 4DWSA 1B6CA 2DT1A 3ARVA 2AOSA 1KFWA 4Z2LA 1M5YA 1EHNA 4JFIA 4ZPWR 2DG4A 1EDQA 3VAWA 1FFQA 3FAPA 1ITXA 2A3CA 5HWCA 1FAPA 1GPFA 2PI6A 4AY1A 3B7XA 2ZQSA 3WD2A 3UQBA 3WKZA 1FKKA 1W9UA 1ZBVA 5B8IC 3ODKA 4LAWA 3I6CA 2PPOA 5HW7A 4P8XA 4WJXA 4S3KA 2MLZA 1NSGA 1LJYA 1LL6A 1LG1A 2XP7A 4NZCA 1Q6UA 1FKGA 2MLYA 3JXVA 4FAPA 2RUCA 2KFWA 5DF0A 4TW6A 1JNSA 2DSWA 3BXWA 2ZQTA 2ZR4A 5HUAA 1F40A 1TCOC 2DT2A 4ITZA 1W9VA 1H0IA 4P8WA 1NMVA 3B9DA 3AS2A 3ARRA 3RM9A 1P5QA 2PV3A 1T11A 2M08A 1E6ZA 3PRBA 5DIVA 2O92A 1R9HA 2F4EA 3AS1A 4IQCA 1FKSA 1KT1A 3O5IA 1W1PA 4DIPA 1D7IA 5DEZA 1SR0A 1E9LA 1C9HA 2A3BA 2OLHA 2ZQVA 1W9PA 3KABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2D A;  1FKI A;  3JYJ A;  3UI4 A;  4G2P A;  1FJD A;  2XP9 A;  3TC5 A;  1JVW A;  4QT2 A;  4R0X A;  4W9P A;  2ZR6 A;  1EQ3 A;  3LUO A;  2RUR A;  4JFK A;  2L2S A;  4DRJ A;  2N87 A;  2KR7 A;  1W26 A;  2LKN A;  2XP3 A;  4JFM A;  4O2T A;  2DG3 A;  4ODL A;  1FKR A;  2AWG A;  2XP6 A;  4G50 A;  1QPF A;  4TX0 A;  3UF8 A;  1YW5 A;  1U79 A;  3O5D A;  1J4H A;  2XP8 A;  2FAP A;  4TNS A;  4U86 A;  3KAI A;  3RGC A;  3O5M A;  1D7J A;  4JFJ A;  2IF4 A;  3O5O A;  4JFL A;  4ODO A;  4DH0 A;  1L1P A;  1B6C A;  3WH0 A;  3NRK A;  2MPH A;  4DRM A;  1ZK6 A;  2ZR5 A;  4MSP A;  2MLX A;  3O5L A;  3EY6 A;  4DRQ A;  4LAY A;  3O5R A;  2ZQU A;  1Q6I A;  1A7X A;  5D75 A;  3KAG A;  1Q6H A;  4J4O A;  1BKF A;  3CGN A;  1FKD A;  1FKJ A;  1M5Y A;  2ITK A;  4ODM A;  3IKD A;  3KAD A;  2DG4 A;  1D7H A;  4JFI A;  4DT4 A;  2PPP A;  3NI6 A;  3VAW A;  1HXV A;  2MNT A;  3KZ7 A;  1N1A A;  3FAP A;  4DRP A;  1FKT A;  2XPB A;  4MGV A;  3PRD A;  4TW7 A;  4U85 A;  4W9Q A;  1F8A B;  4DRI A;  3JYM A;  4IPX A;  4QT3 A;  5HWB A;  5I98 A;  5HWC A;  4TW8 A;  3GPK A;  1FKH A;  1FAP A;  4ODP A;  4J4N A;  4LAV A;  3B7X A;  2ZQS A;  4JYS A;  3UQB A;  3MDY B;  2RUQ A;  4ODR A;  1FKK A;  3H9R B;  1J4R A;  2PV2 A;  2XP4 A;  4GGQ A;  1FKB A;  1BL4 A;  3O5E A;  4GIV A;  4ODK A;  4C02 B;  2OFN A;  5HTG A;  2JZV A;  5B8I C;  3ODK A;  4LAW A;  3UI5 A;  4NNR A;  1D6O A;  1QZ2 A;  1NMW A;  1ROT A;  2RSE A;  2XPA A;  3I6C A;  4TYO A;  2PPO A;  5J6E A;  2D9F A;  1J4I A;  3O5G A;  5HW7 A;  3O5K A;  3O5Q A;  1JNT A;  4LAX A;  3PA7 A;  5DIT A;  3KCE A;  2PBC A;  5HW6 A;  4DZ2 A;  3OOB A;  2MLZ A;  2FKE A;  3UQI A;  1YAT A;  2Q5A A;  2M2A A;  4BF8 A;  1NSG A;  3KAH A;  2Y78 A;  4IQ2 A;  4ODQ A;  4DRH A;  1KT0 A;  2XP7 A;  1Q6U A;  1ROU A;  2F21 A;  1FKG A;  2MLY A;  2RQS A;  2VCD A;  3JXV A;  4FAP A;  2K8I A;  2LGO A;  2RUC A;  2KFW A;  4W9O A;  2M1I A;  5HKG A;  2RUD A;  4TW6 A;  1JNS A;  3IK8 A;  3O5F A;  2ZR4 A;  2ZQT A;  5HUA A;  1FKL A;  1F40 A;  1TCO C;  3TDB A;  5BXJ A;  1FD9 A;  2KE0 A;  1PIN A;  4FN2 A;  4ITZ A;  3KAC A;  4N19 A;  3RFW A;  1NMV A;  3NTP A;  2MF9 A;  2KGJ A;  3IHZ A;  2VN1 A;  3KAF A;  1FKF A;  1P5Q A;  4QIB A;  1EYM A;  5GPG A;  2PV3 A;  1T11 A;  1ZCN A;  2M08 A;  5DIV A;  3PRB A;  4DRO A;  2DG9 A;  1R9H A;  1Y0O A;  2LJ4 A;  2KI3 A;  3O5P A;  2F4E A;  4IQC A;  1J6Y A;  5DIU A;  3O5J A;  2PPN A;  2LPV A;  1QPL A;  1FKS A;  1KT1 A;  2PV1 A;  3O5I A;  5HT1 A;  3UI6 A;  4DIP A;  1D7I A;  3UQA A;  4DRK A;  4U84 A;  1PBK A;  4ODN A;  4DRN A;  2XP5 A;  5HW8 A;  2UZ5 A;  1C9H A;  3TCZ A;  4DZ3 A;  3CGM A;  2KO7 A;  3IKG A;  2ZQV A;  3KAB A;  1Q1C A; 
#chains in the Genus database with same CATH topology
 2F2D A;  4WIW A;  3UI4 A;  4R0X A;  3WL1 A;  1EQ3 A;  1ZU8 A;  1OWQ A;  2RUR A;  1E6R A;  4JFM A;  3GTY X;  1UR8 A;  1ZBW A;  2XP6 A;  3ARU A;  1U79 A;  1J4H A;  4PTM A;  2FAP A;  4TNS A;  4U86 A;  4Z2J A;  4MNK A;  3ARP A;  3ARO A;  2IF4 A;  1LL4 A;  4HAR A;  1E6N A;  3PR9 A;  2B31 A;  3EY6 A;  4IT4 A;  4Z2I A;  1A7X A;  1UR9 A;  1Q6H A;  4J4O A;  1BKF A;  1FKD A;  1CTN A;  4MAV A;  4DT4 A;  1EIB A;  2MNT A;  3CHC A;  3GU0 A;  4MGV A;  5HWB A;  3JYM A;  4QT3 A;  5I98 A;  1JND A;  4ODR A;  3H9R B;  3B8S A;  1J4R A;  5DO2 A;  2XP4 A;  4ODK A;  1ZBC A;  2OFN A;  1OGB A;  1QZ2 A;  2XPA A;  4L3N A;  3O5Q A;  1HJV A;  3G6L A;  4P8V A;  5DIT A;  4ML4 A;  1ZB5 A;  3EIP A;  3OOB A;  2FKE A;  2M2A A;  4IQ2 A;  4DRH A;  2LGO A;  1O6I A;  2RUD A;  3IK8 A;  2G8Z A;  3ARW A;  1FKL A;  4FN2 A;  3CHF A;  2P4V A;  3NTP A;  3IHZ A;  2KGJ A;  2VN1 A;  3KAF A;  3FXY A;  1ZCN A;  4DRO A;  2DG9 A;  4MNJ A;  1RD6 A;  3O5J A;  4LGX A;  1QPL A;  3UQA A;  1XRV A;  4DWS D;  4DRK A;  2XP5 A;  3CHE A;  2WLY A;  4DZ3 A;  3IKG A;  3G6M A;  1Q1C A;  4G2P A;  1FJD A;  2XP9 A;  3TC5 A;  4R5E A;  5GQB A;  1WB0 A;  2G41 A;  5HBF A;  2DT3 A;  2DPE A;  3FY1 A;  2KR7 A;  4O2T A;  4ODL A;  1FKR A;  1X6N A;  2AWG A;  2B5U B;  1QPF A;  4TX0 A;  3UF8 A;  1YW5 A;  3AQU A;  3WIJ A;  3KAI A;  4JFJ A;  3O5O A;  4DH0 A;  4ODO A;  3WH0 A;  3NRK A;  4DRM A;  1ZK6 A;  2ZR5 A;  1XHG A;  2MLX A;  3O5L A;  1OGG A;  3O5R A;  4Z2H A;  2WM0 A;  5D75 A;  3KAG A;  3RME A;  1JCH B;  3WD1 A;  3CGN A;  2ETN A;  2ITK A;  4WK9 A;  1HJW A;  3IKD A;  3KAD A;  1D7H A;  3KZ7 A;  2WK2 A;  4DRP A;  1X6L A;  4TW7 A;  3PRD A;  4U85 A;  1F8A B;  1NWS A;  2PN0 A;  1HKM A;  4ODP A;  4J4N A;  4LAV A;  4MNM A;  2FDM A;  1W1Y A;  2IUZ A;  2PV2 A;  1FKB A;  1BL4 A;  3O5E A;  4GIV A;  4C02 B;  4Q22 A;  1ZBK A;  4NNR A;  1ROT A;  5J6E A;  1ZL1 A;  1J4I A;  4MPK A;  3O5K A;  1JNT A;  3PA7 A;  3BMB A;  3UQI A;  1HKK A;  1YAT A;  2Q5A A;  4WKH A;  3KAH A;  2Y78 A;  4ZS6 A;  3ARX A;  1ROU A;  2F21 A;  2RQS A;  4IT6 A;  2YBT A;  4W9O A;  3CZ8 A;  4DWS C;  4DWS B;  5HKG A;  3AS0 A;  3O5F A;  5BXJ A;  3TDB A;  1FD9 A;  2KE0 A;  4N19 A;  1W1T A;  4QIB A;  4WKA A;  5GPG A;  3RM4 A;  4HBO A;  2DSU A;  1LQ0 A;  2PPN A;  2A3E A;  5HT1 A;  3UI6 A;  4L72 B;  1PBK A;  2UZ5 A;  4KQZ A;  2KO7 A;  4HBE A;  1IX5 A;  3JYJ A;  4MNL A;  5JH8 A;  4W9P A;  3PRA A;  4UDM A;  3LUO A;  4DRJ A;  2L2S A;  2N87 A;  2LKN A;  3WD4 A;  2F23 A;  2XP3 A;  3AS3 A;  1HJX A;  1NWR A;  3B9A A;  3O5D A;  2XP8 A;  1LG2 A;  4URI A;  3RGC A;  1L1P A;  4JFL A;  4NSB A;  2ESC A;  2MPH A;  4MSP A;  4DRQ A;  4ZPT R;  4LAY A;  2ZQU A;  1Q6I A;  2O9O A;  3CHD A;  2A3A A;  1FKJ A;  1TFV A;  3ARS A;  4ODM A;  3ALG A;  2PPP A;  3NI6 A;  1HXV A;  1E15 A;  1N1A A;  2XPB A;  4W9Q A;  1NWU A;  1JNE A;  4DRI A;  4IPX A;  4MTV A;  4TW8 A;  3GPK A;  1FKH A;  4Z2G A;  4JYS A;  3MDY B;  1K9T A;  2RUQ A;  4GGQ A;  3ARZ A;  5HTG A;  2JZV A;  3UI5 A;  1D6O A;  1VF8 A;  1NMW A;  1WAW A;  2RSE A;  4W5U A;  4TYO A;  3WQV A;  2D9F A;  3O5G A;  3OA5 A;  1D2K A;  4LAX A;  4QZV B;  3KCE A;  2PBC A;  5HW6 A;  4DZ2 A;  4Z2K A;  4BF8 A;  2YBU A;  4WKF A;  1KT0 A;  2QF8 A;  2WLZ A;  3ARQ A;  2VCD A;  2K8I A;  3B9E A;  5GPR A;  2M1I A;  1NH6 A;  3ALF A;  1PIN A;  3KAC A;  4ZPV R;  3W4R A;  1WNO A;  1GOI A;  3RFW A;  3ARY A;  2MF9 A;  3WD0 A;  1FKF A;  3WL0 A;  1EYM A;  4Q7N A;  1E6P A;  3WQW A;  1Y0O A;  1HKJ A;  2KI3 A;  2LJ4 A;  3O5P A;  3QOK A;  1J6Y A;  5DIU A;  2DSV A;  1GUV A;  2LPV A;  2PV1 A;  3WD3 A;  4U84 A;  4ODN A;  4DRN A;  5HW8 A;  3TCZ A;  1H0G A;  3CGM A;  1FKT A;  4ODQ A;  4KR0 B;  1FKI A;  1LL7 A;  1JVW A;  4QT2 A;  3CH9 A;  2DSZ A;  1FFR A;  2ZR6 A;  4XAK A;  1E44 A;  4S3J A;  4JFK A;  1SYT A;  2DT0 A;  4P8U A;  1W26 A;  1HKI A;  1W1V A;  1NWT A;  2DG3 A;  4G50 A;  3ART A;  3O5M A;  1D7J A;  3RM8 A;  4DWS A;  1B6C A;  2DT1 A;  2EUL A;  3ARV A;  2AOS A;  1KFW A;  4Z2L A;  1M5Y A;  1EHN A;  4JFI A;  4ZPW R;  2DG4 A;  1EDQ A;  3VAW A;  1FFQ A;  3FAP A;  1ITX A;  2A3C A;  5HWC A;  1FAP A;  1GPF A;  2PI6 A;  4AY1 A;  3B7X A;  2ZQS A;  3WD2 A;  3UQB A;  3WKZ A;  1FKK A;  1W9U A;  1ZBV A;  5B8I C;  3ODK A;  4LAW A;  3I6C A;  2PPO A;  5HW7 A;  4P8X A;  4WJX A;  4S3K A;  1GRJ A;  2MLZ A;  1NSG A;  1LJY A;  1LL6 A;  1LG1 A;  2XP7 A;  4NZC A;  1Q6U A;  1FKG A;  2MLY A;  3JXV A;  4FAP A;  2RUC A;  2KFW A;  5DF0 A;  4TW6 A;  1JNS A;  2DSW A;  3BXW A;  2ZQT A;  2ZR4 A;  5HUA A;  1F40 A;  1TCO C;  2DT2 A;  4ITZ A;  1W9V A;  1H0I A;  4P8W A;  1NMV A;  3B9D A;  3AS2 A;  3ARR A;  3RM9 A;  1P5Q A;  2PV3 A;  1T11 A;  2M08 A;  1E6Z A;  3PRB A;  5DIV A;  2O92 A;  1R9H A;  2F4E A;  3AS1 A;  4IQC A;  1FKS A;  1KT1 A;  3O5I A;  1W1P A;  4DIP A;  1D7I A;  5DEZ A;  1SR0 A;  1E9L A;  1C9H A;  2A3B A;  2OLH A;  2ZQV A;  1W9P A;  3KAB A; 
#chains in the Genus database with same CATH homology
 2F2D A;  4WIW A;  3UI4 A;  4R0X A;  3WL1 A;  1EQ3 A;  1ZU8 A;  1OWQ A;  2RUR A;  1E6R A;  4JFM A;  1UR8 A;  1ZBW A;  2XP6 A;  3ARU A;  1U79 A;  1J4H A;  4PTM A;  2FAP A;  4TNS A;  4U86 A;  4Z2J A;  4MNK A;  3ARP A;  3ARO A;  2IF4 A;  1LL4 A;  4HAR A;  1E6N A;  3PR9 A;  2B31 A;  3EY6 A;  4IT4 A;  4Z2I A;  1A7X A;  1UR9 A;  1Q6H A;  4J4O A;  1BKF A;  1FKD A;  1CTN A;  4MAV A;  4DT4 A;  1EIB A;  2MNT A;  3CHC A;  4MGV A;  5HWB A;  3JYM A;  4QT3 A;  5I98 A;  1JND A;  4ODR A;  3H9R B;  3B8S A;  1J4R A;  5DO2 A;  2XP4 A;  4ODK A;  1ZBC A;  2OFN A;  1OGB A;  1QZ2 A;  2XPA A;  4L3N A;  3O5Q A;  1HJV A;  3G6L A;  4P8V A;  5DIT A;  4ML4 A;  1ZB5 A;  3OOB A;  2FKE A;  2M2A A;  4IQ2 A;  4DRH A;  2LGO A;  1O6I A;  2RUD A;  3IK8 A;  2G8Z A;  3ARW A;  1FKL A;  4FN2 A;  3CHF A;  3NTP A;  3IHZ A;  2KGJ A;  2VN1 A;  3KAF A;  3FXY A;  1ZCN A;  4DRO A;  2DG9 A;  4MNJ A;  1RD6 A;  3O5J A;  4LGX A;  1QPL A;  3UQA A;  1XRV A;  4DWS D;  4DRK A;  2XP5 A;  3CHE A;  2WLY A;  4DZ3 A;  3IKG A;  3G6M A;  1Q1C A;  4G2P A;  1FJD A;  2XP9 A;  3TC5 A;  4R5E A;  5GQB A;  1WB0 A;  2G41 A;  5HBF A;  2DT3 A;  2DPE A;  3FY1 A;  2KR7 A;  4O2T A;  4ODL A;  1FKR A;  1X6N A;  2AWG A;  1QPF A;  4TX0 A;  3UF8 A;  1YW5 A;  3AQU A;  3WIJ A;  3KAI A;  4JFJ A;  3O5O A;  4DH0 A;  4ODO A;  3WH0 A;  3NRK A;  4DRM A;  1ZK6 A;  2ZR5 A;  1XHG A;  2MLX A;  3O5L A;  1OGG A;  3O5R A;  4Z2H A;  2WM0 A;  5D75 A;  3KAG A;  3RME A;  3WD1 A;  3CGN A;  2ITK A;  4WK9 A;  1HJW A;  3IKD A;  3KAD A;  1D7H A;  3KZ7 A;  2WK2 A;  4DRP A;  1X6L A;  4TW7 A;  3PRD A;  4U85 A;  1F8A B;  1NWS A;  1HKM A;  4ODP A;  4J4N A;  4LAV A;  4MNM A;  2FDM A;  1W1Y A;  2IUZ A;  2PV2 A;  1FKB A;  1BL4 A;  3O5E A;  4GIV A;  4C02 B;  4Q22 A;  1ZBK A;  4NNR A;  1ROT A;  5J6E A;  1ZL1 A;  1J4I A;  4MPK A;  3O5K A;  1JNT A;  3PA7 A;  3UQI A;  1HKK A;  1YAT A;  2Q5A A;  4WKH A;  3KAH A;  2Y78 A;  4ZS6 A;  3ARX A;  1ROU A;  2F21 A;  2RQS A;  4IT6 A;  2YBT A;  4W9O A;  3CZ8 A;  4DWS C;  4DWS B;  5HKG A;  3AS0 A;  3O5F A;  5BXJ A;  3TDB A;  1FD9 A;  2KE0 A;  4N19 A;  1W1T A;  4QIB A;  4WKA A;  5GPG A;  3RM4 A;  4HBO A;  2DSU A;  1LQ0 A;  2PPN A;  2A3E A;  5HT1 A;  3UI6 A;  4L72 B;  1PBK A;  2UZ5 A;  4KQZ A;  2KO7 A;  4HBE A;  1IX5 A;  3JYJ A;  4MNL A;  5JH8 A;  4W9P A;  3PRA A;  3LUO A;  4DRJ A;  2L2S A;  2N87 A;  2LKN A;  3WD4 A;  2XP3 A;  3AS3 A;  1HJX A;  1NWR A;  3B9A A;  3O5D A;  2XP8 A;  1LG2 A;  4URI A;  3RGC A;  1L1P A;  4JFL A;  4NSB A;  2ESC A;  2MPH A;  4MSP A;  4DRQ A;  4ZPT R;  4LAY A;  2ZQU A;  1Q6I A;  2O9O A;  3CHD A;  2A3A A;  1FKJ A;  1TFV A;  3ARS A;  4ODM A;  3ALG A;  2PPP A;  3NI6 A;  1HXV A;  1E15 A;  1N1A A;  2XPB A;  4W9Q A;  1NWU A;  1JNE A;  4DRI A;  4IPX A;  4MTV A;  4TW8 A;  3GPK A;  1FKH A;  4Z2G A;  4JYS A;  3MDY B;  1K9T A;  2RUQ A;  4GGQ A;  3ARZ A;  5HTG A;  2JZV A;  3UI5 A;  1D6O A;  1VF8 A;  1NMW A;  1WAW A;  2RSE A;  4W5U A;  4TYO A;  3WQV A;  2D9F A;  3O5G A;  3OA5 A;  1D2K A;  4LAX A;  4QZV B;  3KCE A;  2PBC A;  5HW6 A;  4DZ2 A;  4Z2K A;  4BF8 A;  2YBU A;  4WKF A;  1KT0 A;  2QF8 A;  2WLZ A;  3ARQ A;  2VCD A;  2K8I A;  3B9E A;  5GPR A;  2M1I A;  1NH6 A;  3ALF A;  1PIN A;  3KAC A;  4ZPV R;  3W4R A;  1WNO A;  1GOI A;  3RFW A;  3ARY A;  2MF9 A;  3WD0 A;  1FKF A;  3WL0 A;  1EYM A;  4Q7N A;  1E6P A;  3WQW A;  1Y0O A;  1HKJ A;  3O5P A;  2KI3 A;  2LJ4 A;  3QOK A;  1J6Y A;  5DIU A;  2DSV A;  1GUV A;  2LPV A;  2PV1 A;  3WD3 A;  4U84 A;  4ODN A;  4DRN A;  5HW8 A;  3TCZ A;  1H0G A;  3CGM A;  1FKT A;  4ODQ A;  4KR0 B;  1FKI A;  1LL7 A;  1JVW A;  4QT2 A;  3CH9 A;  2DSZ A;  1FFR A;  2ZR6 A;  4XAK A;  4S3J A;  4JFK A;  1SYT A;  2DT0 A;  4P8U A;  1W26 A;  1HKI A;  1W1V A;  1NWT A;  2DG3 A;  4G50 A;  3ART A;  3O5M A;  1D7J A;  3RM8 A;  4DWS A;  1B6C A;  2DT1 A;  3ARV A;  2AOS A;  1KFW A;  4Z2L A;  1M5Y A;  1EHN A;  4JFI A;  4ZPW R;  2DG4 A;  1EDQ A;  3VAW A;  1FFQ A;  3FAP A;  1ITX A;  2A3C A;  5HWC A;  1FAP A;  1GPF A;  2PI6 A;  4AY1 A;  3B7X A;  2ZQS A;  3WD2 A;  3UQB A;  3WKZ A;  1FKK A;  1W9U A;  1ZBV A;  5B8I C;  3ODK A;  4LAW A;  3I6C A;  2PPO A;  5HW7 A;  4P8X A;  4WJX A;  4S3K A;  2MLZ A;  1NSG A;  1LJY A;  1LL6 A;  1LG1 A;  2XP7 A;  4NZC A;  1Q6U A;  1FKG A;  2MLY A;  3JXV A;  4FAP A;  2RUC A;  2KFW A;  5DF0 A;  4TW6 A;  1JNS A;  2DSW A;  3BXW A;  2ZQT A;  2ZR4 A;  5HUA A;  1F40 A;  1TCO C;  2DT2 A;  4ITZ A;  1W9V A;  1H0I A;  4P8W A;  1NMV A;  3B9D A;  3AS2 A;  3ARR A;  3RM9 A;  1P5Q A;  2PV3 A;  1T11 A;  2M08 A;  1E6Z A;  3PRB A;  5DIV A;  2O92 A;  1R9H A;  2F4E A;  3AS1 A;  4IQC A;  1FKS A;  1KT1 A;  3O5I A;  1W1P A;  4DIP A;  1D7I A;  5DEZ A;  1SR0 A;  1E9L A;  1C9H A;  2A3B A;  2OLH A;  2ZQV A;  1W9P A;  3KAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...