4TW8A

The fk1-fk2 domains of fkbp52 in complex with ifit-fl
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
235
structure length
235
Chain Sequence
EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
total genus 53
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw8A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw8A02
2XPAA 4IQ2A 3O5PA 1NMWA 2M08A 2L2SA 2XP5A 2RUQA 3H9RB 1W26A 3JXVA 2IF4A 4IQCA 2PPNA 5HKGA 1B6CA 3JYJA 3JYMA 4W9QA 3UQAA 1FKJA 4GGQA 2KGJA 1T11A 1FD9A 2DG3A 2Y78A 1J6YA 4DRHA 2XP6A 1NMVA 2PPOA 1C9HA 1KT0A 5J6EA 2PV1A 3O5RA 4ODLA 4LAVA 1FKFA 4U85A 4ODMA 3UI5A 2LKNA 2XPBA 4MSPA 3UI6A 2Q5AA 1YATA 4ODOA 2XP9A 3B7XA 2XP4A 1Q6UA 4U86A 1JNSA 1EYMA 2F2DA 2RURA 3WH0A 5HWCA 4ODPA 1P5QA 2MPHA 1BKFA 2F4EA 4QT2A 1F8AB 1QZ2A 4DRJA 3UI4A 2MNTA 2AWGA 3O5QA 3KAGA 1J4RA 4DIPA 4ODRA 2RUCA 3KAHA 4N19A 2ZR4A 4W9PA 3O5LA 1J4IA 3O5OA 3EY6A 3ODKA 3NRKA 2RQSA 1BL4A 1D6OA 5HT1A 4LAYA 4W9OA 1FAPA 5HW7A 4DRNA 4QT3A 3PA7A 3RFWA 1FKIA 1QPFA 2K8IA 2KO7A 2LJ4A 4TX0A 1D7IA 2PV3A 2D9FA 3MDYB 4JYSA 3CGMA 1Q6HA 1FKSA 2M2AA 3GPKA 1F40A 1J4HA 2PBCA 5B8IC 2LPVA 2VN1A 1D7HA 2JZVA 3O5GA 3CGNA 1U79A 1KT1A 4JFKA 4LAWA 4DZ3A 2N87A 2KE0A 3O5KA 4R0XA 2M1IA 4DT4A 2F21A 5GPGA 2MLYA 1FKHA 3KAFA 3O5DA 2RUDA 5DITA 3UQIA 1FKRA 5I98A 3PRBA 1JNTA 1Y0OA 3IKDA 1FKLA 3KADA 5DIUA 1R9HA 2XP7A 4DRKA 3KAIA 4ITZA 4IPXA 1FJDA 3UQBA 2MLZA 4J4OA 4TNSA 3UF8A 2RSEA 1D7JA 3FAPA 3RGCA 4C02B 4JFLA 1FKKA 4DH0A 4JFMA 2MLXA 4G50A 3KABA 4DRPA 2UZ5A 5HTGA 1Q6IA 2LGOA 1N1AA 3O5EA 4G2PA 1TCOC 2PV2A 1ZCNA 2KR7A 4TW6A 4BF8A 4DRQA 4DZ2A 2KFWA 3KCEA 3IKGA 3TC5A 4O2TA 2MF9A 3TDBA 5BXJA 3IK8A 1QPLA 2ZR6A 3O5JA 3O5FA 4GIVA 4JFJA 5HW6A 2ZQVA 1M5YA 4ODKA 2FAPA 3VAWA 3TCZA 4TYOA 5HUAA 1L1PA 4DRMA 4J4NA 1HXVA 4MGVA 1FKTA 2ZQTA 5DIVA 1A7XA 1YW5A 3KZ7A 2KI3A 1JVWA 3NI6A 4LAXA 5HWBA 4JFIA 4ODQA 3KACA 4TW7A 1PINA 3LUOA 3IHZA 5HW8A 2ZR5A 3O5MA 3O5IA 2OFNA 1EQ3A 3OOBA 3PRDA 4ODNA 1Q1CA 4DROA 4FN2A 4QIBA 1FKDA 2XP3A 1ROTA 2DG9A 2ITKA 4FAPA 1FKBA 2ZQUA 2ZQSA 4NNRA 2PPPA 4DRIA 1PBKA 2XP8A 1ZK6A 1ROUA 3I6CA 4U84A 2DG4A 4TW8A 5D75A 1FKGA 3NTPA 1NSGA 2FKEA 2VCDA
chains in the Genus database with same CATH superfamily
2XPAA 2XP5A 3B9EA 4MNMA 2RUQA 4NSBA 1B6CA 3JYJA 3UQAA 4Z2KA 1FKJA 2DG3A 2Y78A 2YBUA 2PPOA 4Q7NA 5J6EA 3O5RA 4U85A 2XPBA 3ARYA 1UR9A 2XP4A 3B9DA 3WD3A 2F2DA 2RURA 3WH0A 5HWCA 3ARXA 4ODPA 4DWSA 1BKFA 3ARWA 4QT2A 1QZ2A 4HBOA 1RD6A 1E6ZA 1W1TA 3KAGA 2RUCA 2G41A 3FY1A 3AROA 2DSVA 4PTMA 3ODKA 2RQSA 1BL4A 1W1VA 4WKHA 4XAKA 4QT3A 3RFWA 1SR0A 2K8IA 1D7IA 3EIPA 1ZBWA 4S3JA 1F40A 5HBFA 2ESCA 1TFVA 2VN1A 2JZVA 2FDMA 3BXWA 4HARA 2M1IA 3AS2A 1FKHA 3KAFA 3O5DA 2AOSA 1Y0OA 3KADA 2XP7A 3KAIA 4IPXA 1FJDA 1D7JA 1FKKA 1W9UA 1ZL1A 2MLXA 1ZU8A 2WK2A 4DRPA 1VF8A 1TCOC 3IKGA 4IT6A 3TC5A 1HKMA 2MF9A 3CHEA 2A3CA 2DSZA 1XHGA 5GQBA 2ZQVA 4ODKA 1ZBKA 3VAWA 4J4NA 3WD0A 1FKTA 2IUZA 1YW5A 2KI3A 1LL7A 1NH6A 4W5UA 5HWBA 1EHNA 1GUVA 1HJVA 2DPEA 2OFNA 3CZ8A 3WIJA 1K9TA 3OOBA 2WLZA 3WQVA 3G6LA 4ODNA 1Q1CA 1ROTA 1FKBA 3WD1A 2ZQSA 4DRIA 1LQ0A 3I6CA 1ROUA 1W1YA 2DG4A 4TW8A 1FKGA 3NTPA 4DZ3A 5DO2A 1E15A 4IQ2A 2M08A 2L2SA 3AS0A 2PPNA 4W9QA 4KR0B 2XP6A 4ODLA 1FKFA 1E9LA 2LKNA 2Q5AA 1YATA 1LL6A 2XP9A 2DT2A 1LG2A 4U86A 3B9AA 1NWTA 1H0GA 2MPHA 2F4EA 4Q22A 2ZR4A 4ZPVR 1ZB5A 3NRKA 4W9OA 4DRNA 1QPFA 2KO7A 2PV3A 3CGMA 2M2AA 2F23A 3GPKA 1HKJA 2PBCA 3GU0A 3CGNA 2G8ZA 4LAWA 2KE0A 3O5KA 4WKFA 1NWUA 3UQIA 2ETNA 3W4RA 3PRBA 1JNTA 1D2KA 4L72B 1HJXA 3UQBA 4ML4A 4LGXA 4AY1A 3UF8A 4Z2JA 4JFLA 2B5UB 1SYTA 4JFMA 4DWSD 1H0IA 1Q6IA 1ZCNA 5BXJA 3TCZA 4TYOA 4DRMA 3ARZA 1HXVA 1UR8A 3WKZA 3CHFA 3KZ7A 2DSWA 5GPRA 4Z2GA 3FXYA 2WM0A 2DSUA 2P4VA 4ZS6A 4QIBA 1FKDA 2XP3A 4FAPA 1E44A 4NNRA 2PPPA 2XP8A 4P8XA 1OGBA 3CH9A 1NSGA 2WLYA 4NZCA 3QOKA 3O5PA 4IQCA 4MTVA 3H9RB 3ARSA 5HKGA 1W26A 3JYMA 4GGQA 2KGJA 1J6YA 2YBTA 4ZPTR 1KT0A 3RM4A 2PV1A 4WJXA 4LAVA 4IT4A 4ODMA 3UI6A 4MSPA 1KFWA 1IX5A 4ODOA 3WD4A 5DF0A 3B7XA 1WNOA 1X6NA 1JNSA 3ARRA 1WB0A 4DRJA 1LG1A 2MNTA 5JH8A 1J4RA 3KAHA 3EY6A 4MNLA 4MPKA 1EIBA 1D6OA 4LAYA 1LJYA 3AQUA 5HW7A 4MAVA 1FKIA 1ITXA 1HKKA 2D9FA 4JYSA 3RM8A 1Q6HA 2QF8A 5B8IC 2LPVA 1D7HA 4DWSB 3O5GA 1U79A 4HBEA 1KT1A 4P8VA 2N87A 4R0XA 4DT4A 2F21A 5GPGA 3WQWA 2RUDA 5I98A 3IKDA 4KQZA 1FKLA 5DIUA 2MLZA 1HJWA 4TNSA 1FFQA 2RSEA 3FAPA 4C02B 3RGCA 2O92A 1EDQA 4G50A 5HTGA 3O5EA 2LGOA 4BF8A 4DRQA 4DZ2A 2PV2A 4MNKA 3WL1A 1OWQA 3TDBA 2EULA 4MNJA 3O5JA 3O5FA 4JFJA 4WIWA 4R5EA 5HUAA 1L1PA 3BMBA 3ALFA 3ARVA 4P8UA 1JVWA 3NI6A 4LAXA 1E6PA 4JFIA 4ODQA 3KACA 4TW7A 1X6LA 3LUOA 3IHZA 5HW8A 3O5MA 1O6IA 2O9OA 1JCHB 1HKIA 3ARTA 1E6NA 3CHDA 5DEZA 4L3NA 2DT0A 3WD2A 3CHCA 2B31A 2DT3A 2A3BA 2ZQUA 1PBKA 1ZK6A 4U84A 4DWSC 2FKEA 2VCDA 1NMWA 2A3AA 3JXVA 4WKAA 2OLHA 2IF4A 1T11A 1E6RA 1FD9A 4DRHA 4Z2IA 1NMVA 1C9HA 3ARUA 3UI5A 1W9VA 1NWRA 3PR9A 4QZVB 3RM9A 1Q6UA 1EYMA 1P5QA 1F8AB 1ZBVA 3UI4A 3AS3A 2AWGA 3O5QA 3OA5A 4DIPA 4ODRA 1JNEA 4N19A 4W9PA 3O5LA 1J4IA 3O5OA 3RMEA 5HT1A 1FAPA 3PA7A 1JNDA 2LJ4A 4TX0A 3MDYB 1FKSA 2DT1A 1J4HA 4ZPWR 1NWSA 3ARQA 4JFKA 3B8SA 3ARPA 2MLYA 5DITA 1FKRA 4P8WA 2PN0A 1R9HA 3G6MA 3WL0A 4DRKA 4ITZA 1XRVA 1CTNA 4J4OA 1W9PA 1ZBCA 4Z2HA 4UDMA 4DH0A 3KABA 1FFRA 1GRJA 2UZ5A 1N1AA 4G2PA 2A3EA 2KR7A 4TW6A 2KFWA 3KCEA 4O2TA 3IK8A 1QPLA 2ZR6A 4GIVA 5HW6A 1M5YA 1WAWA 2FAPA 3ALGA 4MGVA 2ZQTA 5DIVA 1A7XA 1GOIA 2PI6A 4Z2LA 1W1PA 1GPFA 1PINA 4WK9A 2ZR5A 3O5IA 3GTYX 1EQ3A 3PRDA 3PRAA 4DROA 4FN2A 4S3KA 2DG9A 2ITKA 4URIA 1LL4A 1OGGA 5D75A 3AS1A
chains in the Genus database with same CATH topology
2XPAA 2XP5A 3B9EA 4MNMA 2RUQA 4NSBA 1B6CA 3JYJA 3UQAA 4Z2KA 1FKJA 2DG3A 2Y78A 2YBUA 2PPOA 4Q7NA 5J6EA 3O5RA 4U85A 2XPBA 3ARYA 1UR9A 2XP4A 3B9DA 3WD3A 2F2DA 2RURA 3WH0A 5HWCA 3ARXA 4ODPA 4DWSA 1BKFA 3ARWA 4QT2A 1QZ2A 4HBOA 1RD6A 1E6ZA 1W1TA 3KAGA 2RUCA 2G41A 3FY1A 3AROA 2DSVA 4PTMA 3ODKA 2RQSA 1BL4A 1W1VA 4WKHA 4XAKA 4QT3A 3RFWA 1SR0A 2K8IA 1D7IA 1ZBWA 4S3JA 1F40A 5HBFA 2ESCA 1TFVA 2VN1A 2JZVA 2FDMA 3BXWA 4HARA 2M1IA 3AS2A 1FKHA 3KAFA 3O5DA 2AOSA 1Y0OA 3KADA 2XP7A 3KAIA 4IPXA 1FJDA 1D7JA 1FKKA 1W9UA 1ZL1A 2MLXA 1ZU8A 2WK2A 4DRPA 1VF8A 1TCOC 3IKGA 4IT6A 3TC5A 1HKMA 2MF9A 3CHEA 2A3CA 2DSZA 1XHGA 5GQBA 2ZQVA 4ODKA 1ZBKA 3VAWA 4J4NA 3WD0A 1FKTA 2IUZA 1YW5A 2KI3A 1LL7A 1NH6A 4W5UA 5HWBA 1EHNA 1GUVA 1HJVA 2DPEA 2OFNA 3CZ8A 3WIJA 1K9TA 3OOBA 2WLZA 3WQVA 3G6LA 4ODNA 1Q1CA 1ROTA 1FKBA 3WD1A 2ZQSA 4DRIA 1LQ0A 3I6CA 1ROUA 1W1YA 2DG4A 4TW8A 1FKGA 3NTPA 4DZ3A 5DO2A 1E15A 4IQ2A 2M08A 2L2SA 3AS0A 2PPNA 4W9QA 4KR0B 2XP6A 4ODLA 1FKFA 1E9LA 2LKNA 2Q5AA 1YATA 1LL6A 2XP9A 2DT2A 1LG2A 4U86A 3B9AA 1NWTA 1H0GA 2MPHA 2F4EA 4Q22A 2ZR4A 4ZPVR 1ZB5A 3NRKA 4W9OA 4DRNA 1QPFA 2KO7A 2PV3A 3CGMA 2M2AA 3GPKA 1HKJA 2PBCA 3CGNA 2G8ZA 4LAWA 2KE0A 3O5KA 4WKFA 1NWUA 3UQIA 3W4RA 3PRBA 1JNTA 1D2KA 4L72B 1HJXA 3UQBA 4ML4A 4LGXA 4AY1A 3UF8A 4Z2JA 4JFLA 1SYTA 4JFMA 4DWSD 1H0IA 1Q6IA 1ZCNA 5BXJA 3TCZA 4TYOA 4DRMA 3ARZA 1HXVA 1UR8A 3WKZA 3CHFA 3KZ7A 2DSWA 5GPRA 4Z2GA 3FXYA 2WM0A 2DSUA 4ZS6A 4QIBA 1FKDA 2XP3A 4FAPA 4NNRA 2PPPA 2XP8A 4P8XA 1OGBA 3CH9A 1NSGA 2WLYA 4NZCA 3QOKA 3O5PA 4IQCA 4MTVA 3H9RB 3ARSA 5HKGA 1W26A 3JYMA 4GGQA 2KGJA 1J6YA 2YBTA 4ZPTR 1KT0A 3RM4A 2PV1A 4WJXA 4LAVA 4IT4A 4ODMA 3UI6A 4MSPA 1KFWA 1IX5A 4ODOA 3WD4A 5DF0A 3B7XA 1WNOA 1X6NA 1JNSA 3ARRA 1WB0A 4DRJA 1LG1A 2MNTA 5JH8A 1J4RA 3KAHA 3EY6A 4MNLA 4MPKA 1EIBA 1D6OA 4LAYA 1LJYA 3AQUA 5HW7A 4MAVA 1FKIA 1ITXA 1HKKA 2D9FA 4JYSA 3RM8A 1Q6HA 2QF8A 5B8IC 2LPVA 1D7HA 4DWSB 3O5GA 1U79A 4HBEA 1KT1A 4P8VA 2N87A 4R0XA 4DT4A 2F21A 5GPGA 3WQWA 2RUDA 5I98A 3IKDA 4KQZA 1FKLA 5DIUA 2MLZA 1HJWA 4TNSA 1FFQA 2RSEA 3FAPA 4C02B 3RGCA 2O92A 1EDQA 4G50A 5HTGA 3O5EA 2LGOA 4BF8A 4DRQA 4DZ2A 2PV2A 4MNKA 3WL1A 1OWQA 3TDBA 4MNJA 3O5JA 3O5FA 4JFJA 4WIWA 4R5EA 5HUAA 1L1PA 3ALFA 3ARVA 4P8UA 1JVWA 3NI6A 4LAXA 1E6PA 4JFIA 4ODQA 3KACA 4TW7A 1X6LA 3LUOA 3IHZA 5HW8A 3O5MA 1O6IA 2O9OA 1HKIA 3ARTA 1E6NA 3CHDA 5DEZA 4L3NA 2DT0A 3WD2A 3CHCA 2B31A 2DT3A 2A3BA 2ZQUA 1PBKA 1ZK6A 4U84A 4DWSC 2FKEA 2VCDA 1NMWA 2A3AA 3JXVA 4WKAA 2OLHA 2IF4A 1T11A 1E6RA 1FD9A 4DRHA 4Z2IA 1NMVA 1C9HA 3ARUA 3UI5A 1W9VA 1NWRA 3PR9A 4QZVB 3RM9A 1Q6UA 1EYMA 1P5QA 1F8AB 1ZBVA 3UI4A 3AS3A 2AWGA 3O5QA 3OA5A 4DIPA 4ODRA 1JNEA 4N19A 4W9PA 3O5LA 1J4IA 3O5OA 3RMEA 5HT1A 1FAPA 3PA7A 1JNDA 2LJ4A 4TX0A 3MDYB 1FKSA 2DT1A 1J4HA 4ZPWR 1NWSA 3ARQA 4JFKA 3B8SA 3ARPA 2MLYA 5DITA 1FKRA 4P8WA 1R9HA 3G6MA 3WL0A 4DRKA 4ITZA 1XRVA 1CTNA 4J4OA 1W9PA 1ZBCA 4Z2HA 4DH0A 3KABA 1FFRA 2UZ5A 1N1AA 4G2PA 2A3EA 2KR7A 4TW6A 2KFWA 3KCEA 4O2TA 3IK8A 1QPLA 2ZR6A 4GIVA 5HW6A 1M5YA 1WAWA 2FAPA 3ALGA 4MGVA 2ZQTA 5DIVA 1A7XA 1GOIA 2PI6A 4Z2LA 1W1PA 1GPFA 1PINA 4WK9A 2ZR5A 3O5IA 1EQ3A 3PRDA 3PRAA 4DROA 4FN2A 4S3KA 2DG9A 2ITKA 4URIA 1LL4A 1OGGA 5D75A 3AS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPA A;  4IQ2 A;  3O5P A;  1NMW A;  2M08 A;  2L2S A;  2XP5 A;  2RUQ A;  3H9R B;  1W26 A;  3JXV A;  2IF4 A;  4IQC A;  2PPN A;  5HKG A;  1B6C A;  3JYJ A;  3JYM A;  4W9Q A;  3UQA A;  1FKJ A;  4GGQ A;  2KGJ A;  1T11 A;  1FD9 A;  2DG3 A;  2Y78 A;  1J6Y A;  4DRH A;  2XP6 A;  1NMV A;  2PPO A;  1C9H A;  1KT0 A;  5J6E A;  2PV1 A;  3O5R A;  4ODL A;  4LAV A;  1FKF A;  4U85 A;  4ODM A;  3UI5 A;  2LKN A;  2XPB A;  4MSP A;  3UI6 A;  2Q5A A;  1YAT A;  4ODO A;  2XP9 A;  3B7X A;  2XP4 A;  1Q6U A;  4U86 A;  1JNS A;  1EYM A;  2F2D A;  2RUR A;  3WH0 A;  5HWC A;  4ODP A;  1P5Q A;  2MPH A;  1BKF A;  2F4E A;  4QT2 A;  1F8A B;  1QZ2 A;  4DRJ A;  3UI4 A;  2MNT A;  2AWG A;  3O5Q A;  3KAG A;  1J4R A;  4DIP A;  4ODR A;  2RUC A;  3KAH A;  4N19 A;  2ZR4 A;  4W9P A;  3O5L A;  1J4I A;  3O5O A;  3EY6 A;  3ODK A;  3NRK A;  2RQS A;  1BL4 A;  1D6O A;  5HT1 A;  4LAY A;  4W9O A;  1FAP A;  5HW7 A;  4DRN A;  4QT3 A;  3PA7 A;  3RFW A;  1FKI A;  1QPF A;  2K8I A;  2KO7 A;  2LJ4 A;  4TX0 A;  1D7I A;  2PV3 A;  2D9F A;  3MDY B;  4JYS A;  3CGM A;  1Q6H A;  1FKS A;  2M2A A;  3GPK A;  1F40 A;  1J4H A;  2PBC A;  5B8I C;  2LPV A;  2VN1 A;  1D7H A;  2JZV A;  3O5G A;  3CGN A;  1U79 A;  1KT1 A;  4JFK A;  4LAW A;  4DZ3 A;  2N87 A;  2KE0 A;  3O5K A;  4R0X A;  2M1I A;  4DT4 A;  2F21 A;  5GPG A;  2MLY A;  1FKH A;  3KAF A;  3O5D A;  2RUD A;  5DIT A;  3UQI A;  1FKR A;  5I98 A;  3PRB A;  1JNT A;  1Y0O A;  3IKD A;  1FKL A;  3KAD A;  5DIU A;  1R9H A;  2XP7 A;  4DRK A;  3KAI A;  4ITZ A;  4IPX A;  1FJD A;  3UQB A;  2MLZ A;  4J4O A;  4TNS A;  3UF8 A;  2RSE A;  1D7J A;  3FAP A;  3RGC A;  4C02 B;  4JFL A;  1FKK A;  4DH0 A;  4JFM A;  2MLX A;  4G50 A;  3KAB A;  4DRP A;  2UZ5 A;  5HTG A;  1Q6I A;  2LGO A;  1N1A A;  3O5E A;  4G2P A;  1TCO C;  2PV2 A;  1ZCN A;  2KR7 A;  4TW6 A;  4BF8 A;  4DRQ A;  4DZ2 A;  2KFW A;  3KCE A;  3IKG A;  3TC5 A;  4O2T A;  2MF9 A;  3TDB A;  5BXJ A;  3IK8 A;  1QPL A;  2ZR6 A;  3O5J A;  3O5F A;  4GIV A;  4JFJ A;  5HW6 A;  2ZQV A;  1M5Y A;  4ODK A;  2FAP A;  3VAW A;  3TCZ A;  4TYO A;  5HUA A;  1L1P A;  4DRM A;  4J4N A;  1HXV A;  4MGV A;  1FKT A;  2ZQT A;  5DIV A;  1A7X A;  1YW5 A;  3KZ7 A;  2KI3 A;  1JVW A;  3NI6 A;  4LAX A;  5HWB A;  4JFI A;  4ODQ A;  3KAC A;  4TW7 A;  1PIN A;  3LUO A;  3IHZ A;  5HW8 A;  2ZR5 A;  3O5M A;  3O5I A;  2OFN A;  1EQ3 A;  3OOB A;  3PRD A;  4ODN A;  1Q1C A;  4DRO A;  4FN2 A;  4QIB A;  1FKD A;  2XP3 A;  1ROT A;  2DG9 A;  2ITK A;  4FAP A;  1FKB A;  2ZQU A;  2ZQS A;  4NNR A;  2PPP A;  4DRI A;  1PBK A;  2XP8 A;  1ZK6 A;  1ROU A;  3I6C A;  4U84 A;  2DG4 A;  4TW8 A;  5D75 A;  1FKG A;  3NTP A;  1NSG A;  2FKE A;  2VCD A; 
#chains in the Genus database with same CATH topology
 2XPA A;  2XP5 A;  3B9E A;  4MNM A;  2RUQ A;  4NSB A;  1B6C A;  3JYJ A;  3UQA A;  4Z2K A;  1FKJ A;  2DG3 A;  2Y78 A;  2YBU A;  2PPO A;  4Q7N A;  5J6E A;  3O5R A;  4U85 A;  2XPB A;  3ARY A;  1UR9 A;  2XP4 A;  3B9D A;  3WD3 A;  2F2D A;  2RUR A;  3WH0 A;  5HWC A;  3ARX A;  4ODP A;  4DWS A;  1BKF A;  3ARW A;  4QT2 A;  1QZ2 A;  4HBO A;  1RD6 A;  1E6Z A;  1W1T A;  3KAG A;  2RUC A;  2G41 A;  3FY1 A;  3ARO A;  2DSV A;  4PTM A;  3ODK A;  2RQS A;  1BL4 A;  1W1V A;  4WKH A;  4XAK A;  4QT3 A;  3RFW A;  1SR0 A;  2K8I A;  1D7I A;  3EIP A;  1ZBW A;  4S3J A;  1F40 A;  5HBF A;  2ESC A;  1TFV A;  2VN1 A;  2JZV A;  2FDM A;  3BXW A;  4HAR A;  2M1I A;  3AS2 A;  1FKH A;  3KAF A;  3O5D A;  2AOS A;  1Y0O A;  3KAD A;  2XP7 A;  3KAI A;  4IPX A;  1FJD A;  1D7J A;  1FKK A;  1W9U A;  1ZL1 A;  2MLX A;  1ZU8 A;  2WK2 A;  4DRP A;  1VF8 A;  1TCO C;  3IKG A;  4IT6 A;  3TC5 A;  1HKM A;  2MF9 A;  3CHE A;  2A3C A;  2DSZ A;  1XHG A;  5GQB A;  2ZQV A;  4ODK A;  1ZBK A;  3VAW A;  4J4N A;  3WD0 A;  1FKT A;  2IUZ A;  1YW5 A;  2KI3 A;  1LL7 A;  1NH6 A;  4W5U A;  5HWB A;  1EHN A;  1GUV A;  1HJV A;  2DPE A;  2OFN A;  3CZ8 A;  3WIJ A;  1K9T A;  3OOB A;  2WLZ A;  3WQV A;  3G6L A;  4ODN A;  1Q1C A;  1ROT A;  1FKB A;  3WD1 A;  2ZQS A;  4DRI A;  1LQ0 A;  3I6C A;  1ROU A;  1W1Y A;  2DG4 A;  4TW8 A;  1FKG A;  3NTP A;  4DZ3 A;  5DO2 A;  1E15 A;  4IQ2 A;  2M08 A;  2L2S A;  3AS0 A;  2PPN A;  4W9Q A;  4KR0 B;  2XP6 A;  4ODL A;  1FKF A;  1E9L A;  2LKN A;  2Q5A A;  1YAT A;  1LL6 A;  2XP9 A;  2DT2 A;  1LG2 A;  4U86 A;  3B9A A;  1NWT A;  1H0G A;  2MPH A;  2F4E A;  4Q22 A;  2ZR4 A;  4ZPV R;  1ZB5 A;  3NRK A;  4W9O A;  4DRN A;  1QPF A;  2KO7 A;  2PV3 A;  3CGM A;  2M2A A;  2F23 A;  3GPK A;  1HKJ A;  2PBC A;  3GU0 A;  3CGN A;  2G8Z A;  4LAW A;  2KE0 A;  3O5K A;  4WKF A;  1NWU A;  3UQI A;  2ETN A;  3W4R A;  3PRB A;  1JNT A;  1D2K A;  4L72 B;  1HJX A;  3UQB A;  4ML4 A;  4LGX A;  4AY1 A;  3UF8 A;  4Z2J A;  4JFL A;  2B5U B;  1SYT A;  4JFM A;  4DWS D;  1H0I A;  1Q6I A;  1ZCN A;  5BXJ A;  3TCZ A;  4TYO A;  4DRM A;  3ARZ A;  1HXV A;  1UR8 A;  3WKZ A;  3CHF A;  3KZ7 A;  2DSW A;  5GPR A;  4Z2G A;  3FXY A;  2WM0 A;  2DSU A;  2P4V A;  4ZS6 A;  4QIB A;  1FKD A;  2XP3 A;  4FAP A;  1E44 A;  4NNR A;  2PPP A;  2XP8 A;  4P8X A;  1OGB A;  3CH9 A;  1NSG A;  2WLY A;  4NZC A;  3QOK A;  3O5P A;  4IQC A;  4MTV A;  3H9R B;  3ARS A;  5HKG A;  1W26 A;  3JYM A;  4GGQ A;  2KGJ A;  1J6Y A;  2YBT A;  4ZPT R;  1KT0 A;  3RM4 A;  2PV1 A;  4WJX A;  4LAV A;  4IT4 A;  4ODM A;  3UI6 A;  4MSP A;  1KFW A;  1IX5 A;  4ODO A;  3WD4 A;  5DF0 A;  3B7X A;  1WNO A;  1X6N A;  1JNS A;  3ARR A;  1WB0 A;  4DRJ A;  1LG1 A;  2MNT A;  5JH8 A;  1J4R A;  3KAH A;  3EY6 A;  4MNL A;  4MPK A;  1EIB A;  1D6O A;  4LAY A;  1LJY A;  3AQU A;  5HW7 A;  4MAV A;  1FKI A;  1ITX A;  1HKK A;  2D9F A;  4JYS A;  3RM8 A;  1Q6H A;  2QF8 A;  5B8I C;  2LPV A;  1D7H A;  4DWS B;  3O5G A;  1U79 A;  4HBE A;  1KT1 A;  4P8V A;  2N87 A;  4R0X A;  4DT4 A;  2F21 A;  5GPG A;  3WQW A;  2RUD A;  5I98 A;  3IKD A;  4KQZ A;  1FKL A;  5DIU A;  2MLZ A;  1HJW A;  4TNS A;  1FFQ A;  2RSE A;  3FAP A;  4C02 B;  3RGC A;  2O92 A;  1EDQ A;  4G50 A;  5HTG A;  3O5E A;  2LGO A;  4BF8 A;  4DRQ A;  4DZ2 A;  2PV2 A;  4MNK A;  3WL1 A;  1OWQ A;  3TDB A;  2EUL A;  4MNJ A;  3O5J A;  3O5F A;  4JFJ A;  4WIW A;  4R5E A;  5HUA A;  1L1P A;  3BMB A;  3ALF A;  3ARV A;  4P8U A;  1JVW A;  3NI6 A;  4LAX A;  1E6P A;  4JFI A;  4ODQ A;  3KAC A;  4TW7 A;  1X6L A;  3LUO A;  3IHZ A;  5HW8 A;  3O5M A;  1O6I A;  2O9O A;  1JCH B;  1HKI A;  3ART A;  1E6N A;  3CHD A;  5DEZ A;  4L3N A;  2DT0 A;  3WD2 A;  3CHC A;  2B31 A;  2DT3 A;  2A3B A;  2ZQU A;  1PBK A;  1ZK6 A;  4U84 A;  4DWS C;  2FKE A;  2VCD A;  1NMW A;  2A3A A;  3JXV A;  4WKA A;  2OLH A;  2IF4 A;  1T11 A;  1E6R A;  1FD9 A;  4DRH A;  4Z2I A;  1NMV A;  1C9H A;  3ARU A;  3UI5 A;  1W9V A;  1NWR A;  3PR9 A;  4QZV B;  3RM9 A;  1Q6U A;  1EYM A;  1P5Q A;  1F8A B;  1ZBV A;  3UI4 A;  3AS3 A;  2AWG A;  3O5Q A;  3OA5 A;  4DIP A;  4ODR A;  1JNE A;  4N19 A;  4W9P A;  3O5L A;  1J4I A;  3O5O A;  3RME A;  5HT1 A;  1FAP A;  3PA7 A;  1JND A;  2LJ4 A;  4TX0 A;  3MDY B;  1FKS A;  2DT1 A;  1J4H A;  4ZPW R;  1NWS A;  3ARQ A;  4JFK A;  3B8S A;  3ARP A;  2MLY A;  5DIT A;  1FKR A;  4P8W A;  2PN0 A;  1R9H A;  3G6M A;  3WL0 A;  4DRK A;  4ITZ A;  1XRV A;  1CTN A;  4J4O A;  1W9P A;  1ZBC A;  4Z2H A;  4UDM A;  4DH0 A;  3KAB A;  1FFR A;  1GRJ A;  2UZ5 A;  1N1A A;  4G2P A;  2A3E A;  2KR7 A;  4TW6 A;  2KFW A;  3KCE A;  4O2T A;  3IK8 A;  1QPL A;  2ZR6 A;  4GIV A;  5HW6 A;  1M5Y A;  1WAW A;  2FAP A;  3ALG A;  4MGV A;  2ZQT A;  5DIV A;  1A7X A;  1GOI A;  2PI6 A;  4Z2L A;  1W1P A;  1GPF A;  1PIN A;  4WK9 A;  2ZR5 A;  3O5I A;  3GTY X;  1EQ3 A;  3PRD A;  3PRA A;  4DRO A;  4FN2 A;  4S3K A;  2DG9 A;  2ITK A;  4URI A;  1LL4 A;  1OGG A;  5D75 A;  3AS1 A; 
#chains in the Genus database with same CATH homology
 2XPA A;  2XP5 A;  3B9E A;  4MNM A;  2RUQ A;  4NSB A;  1B6C A;  3JYJ A;  3UQA A;  4Z2K A;  1FKJ A;  2DG3 A;  2Y78 A;  2YBU A;  2PPO A;  4Q7N A;  5J6E A;  3O5R A;  4U85 A;  2XPB A;  3ARY A;  1UR9 A;  2XP4 A;  3B9D A;  3WD3 A;  2F2D A;  2RUR A;  3WH0 A;  5HWC A;  3ARX A;  4ODP A;  4DWS A;  1BKF A;  3ARW A;  4QT2 A;  1QZ2 A;  4HBO A;  1RD6 A;  1E6Z A;  1W1T A;  3KAG A;  2RUC A;  2G41 A;  3FY1 A;  3ARO A;  2DSV A;  4PTM A;  3ODK A;  2RQS A;  1BL4 A;  1W1V A;  4WKH A;  4XAK A;  4QT3 A;  3RFW A;  1SR0 A;  2K8I A;  1D7I A;  1ZBW A;  4S3J A;  1F40 A;  5HBF A;  2ESC A;  1TFV A;  2VN1 A;  2JZV A;  2FDM A;  3BXW A;  4HAR A;  2M1I A;  3AS2 A;  1FKH A;  3KAF A;  3O5D A;  2AOS A;  1Y0O A;  3KAD A;  2XP7 A;  3KAI A;  4IPX A;  1FJD A;  1D7J A;  1FKK A;  1W9U A;  1ZL1 A;  2MLX A;  1ZU8 A;  2WK2 A;  4DRP A;  1VF8 A;  1TCO C;  3IKG A;  4IT6 A;  3TC5 A;  1HKM A;  2MF9 A;  3CHE A;  2A3C A;  2DSZ A;  1XHG A;  5GQB A;  2ZQV A;  4ODK A;  1ZBK A;  3VAW A;  4J4N A;  3WD0 A;  1FKT A;  2IUZ A;  1YW5 A;  2KI3 A;  1LL7 A;  1NH6 A;  4W5U A;  5HWB A;  1EHN A;  1GUV A;  1HJV A;  2DPE A;  2OFN A;  3CZ8 A;  3WIJ A;  1K9T A;  3OOB A;  2WLZ A;  3WQV A;  3G6L A;  4ODN A;  1Q1C A;  1ROT A;  1FKB A;  3WD1 A;  2ZQS A;  4DRI A;  1LQ0 A;  3I6C A;  1ROU A;  1W1Y A;  2DG4 A;  4TW8 A;  1FKG A;  3NTP A;  4DZ3 A;  5DO2 A;  1E15 A;  4IQ2 A;  2M08 A;  2L2S A;  3AS0 A;  2PPN A;  4W9Q A;  4KR0 B;  2XP6 A;  4ODL A;  1FKF A;  1E9L A;  2LKN A;  2Q5A A;  1YAT A;  1LL6 A;  2XP9 A;  2DT2 A;  1LG2 A;  4U86 A;  3B9A A;  1NWT A;  1H0G A;  2MPH A;  2F4E A;  4Q22 A;  2ZR4 A;  4ZPV R;  1ZB5 A;  3NRK A;  4W9O A;  4DRN A;  1QPF A;  2KO7 A;  2PV3 A;  3CGM A;  2M2A A;  3GPK A;  1HKJ A;  2PBC A;  3CGN A;  2G8Z A;  4LAW A;  2KE0 A;  3O5K A;  4WKF A;  1NWU A;  3UQI A;  3W4R A;  3PRB A;  1JNT A;  1D2K A;  4L72 B;  1HJX A;  3UQB A;  4ML4 A;  4LGX A;  4AY1 A;  3UF8 A;  4Z2J A;  4JFL A;  1SYT A;  4JFM A;  4DWS D;  1H0I A;  1Q6I A;  1ZCN A;  5BXJ A;  3TCZ A;  4TYO A;  4DRM A;  3ARZ A;  1HXV A;  1UR8 A;  3WKZ A;  3CHF A;  3KZ7 A;  2DSW A;  5GPR A;  4Z2G A;  3FXY A;  2WM0 A;  2DSU A;  4ZS6 A;  4QIB A;  1FKD A;  2XP3 A;  4FAP A;  4NNR A;  2PPP A;  2XP8 A;  4P8X A;  1OGB A;  3CH9 A;  1NSG A;  2WLY A;  4NZC A;  3QOK A;  3O5P A;  4IQC A;  4MTV A;  3H9R B;  3ARS A;  5HKG A;  1W26 A;  3JYM A;  4GGQ A;  2KGJ A;  1J6Y A;  2YBT A;  4ZPT R;  1KT0 A;  3RM4 A;  2PV1 A;  4WJX A;  4LAV A;  4IT4 A;  4ODM A;  3UI6 A;  4MSP A;  1KFW A;  1IX5 A;  4ODO A;  3WD4 A;  5DF0 A;  3B7X A;  1WNO A;  1X6N A;  1JNS A;  3ARR A;  1WB0 A;  4DRJ A;  1LG1 A;  2MNT A;  5JH8 A;  1J4R A;  3KAH A;  3EY6 A;  4MNL A;  4MPK A;  1EIB A;  1D6O A;  4LAY A;  1LJY A;  3AQU A;  5HW7 A;  4MAV A;  1FKI A;  1ITX A;  1HKK A;  2D9F A;  4JYS A;  3RM8 A;  1Q6H A;  2QF8 A;  5B8I C;  2LPV A;  1D7H A;  4DWS B;  3O5G A;  1U79 A;  4HBE A;  1KT1 A;  4P8V A;  2N87 A;  4R0X A;  4DT4 A;  2F21 A;  5GPG A;  3WQW A;  2RUD A;  5I98 A;  3IKD A;  4KQZ A;  1FKL A;  5DIU A;  2MLZ A;  1HJW A;  4TNS A;  1FFQ A;  2RSE A;  3FAP A;  4C02 B;  3RGC A;  2O92 A;  1EDQ A;  4G50 A;  5HTG A;  3O5E A;  2LGO A;  4BF8 A;  4DRQ A;  4DZ2 A;  2PV2 A;  4MNK A;  3WL1 A;  1OWQ A;  3TDB A;  4MNJ A;  3O5J A;  3O5F A;  4JFJ A;  4WIW A;  4R5E A;  5HUA A;  1L1P A;  3ALF A;  3ARV A;  4P8U A;  1JVW A;  3NI6 A;  4LAX A;  1E6P A;  4JFI A;  4ODQ A;  3KAC A;  4TW7 A;  1X6L A;  3LUO A;  3IHZ A;  5HW8 A;  3O5M A;  1O6I A;  2O9O A;  1HKI A;  3ART A;  1E6N A;  3CHD A;  5DEZ A;  4L3N A;  2DT0 A;  3WD2 A;  3CHC A;  2B31 A;  2DT3 A;  2A3B A;  2ZQU A;  1PBK A;  1ZK6 A;  4U84 A;  4DWS C;  2FKE A;  2VCD A;  1NMW A;  2A3A A;  3JXV A;  4WKA A;  2OLH A;  2IF4 A;  1T11 A;  1E6R A;  1FD9 A;  4DRH A;  4Z2I A;  1NMV A;  1C9H A;  3ARU A;  3UI5 A;  1W9V A;  1NWR A;  3PR9 A;  4QZV B;  3RM9 A;  1Q6U A;  1EYM A;  1P5Q A;  1F8A B;  1ZBV A;  3UI4 A;  3AS3 A;  2AWG A;  3O5Q A;  3OA5 A;  4DIP A;  4ODR A;  1JNE A;  4N19 A;  4W9P A;  3O5L A;  1J4I A;  3O5O A;  3RME A;  5HT1 A;  1FAP A;  3PA7 A;  1JND A;  2LJ4 A;  4TX0 A;  3MDY B;  1FKS A;  2DT1 A;  1J4H A;  4ZPW R;  1NWS A;  3ARQ A;  4JFK A;  3B8S A;  3ARP A;  2MLY A;  5DIT A;  1FKR A;  4P8W A;  1R9H A;  3G6M A;  3WL0 A;  4DRK A;  4ITZ A;  1XRV A;  1CTN A;  4J4O A;  1W9P A;  1ZBC A;  4Z2H A;  4DH0 A;  3KAB A;  1FFR A;  2UZ5 A;  1N1A A;  4G2P A;  2A3E A;  2KR7 A;  4TW6 A;  2KFW A;  3KCE A;  4O2T A;  3IK8 A;  1QPL A;  2ZR6 A;  4GIV A;  5HW6 A;  1M5Y A;  1WAW A;  2FAP A;  3ALG A;  4MGV A;  2ZQT A;  5DIV A;  1A7X A;  1GOI A;  2PI6 A;  4Z2L A;  1W1P A;  1GPF A;  1PIN A;  4WK9 A;  2ZR5 A;  3O5I A;  1EQ3 A;  3PRD A;  3PRA A;  4DRO A;  4FN2 A;  4S3K A;  2DG9 A;  2ITK A;  4URI A;  1LL4 A;  1OGG A;  5D75 A;  3AS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...