4TWBA

Sulfolobus solfataricus ribose-phosphate pyrophosphokinase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
291
structure length
278
Chain Sequence
MIIIGGSATNGIDESLSKILSIPLVKVENKIFPDGESYIRVPSSIRDEEVLLVQTTDYPQDKHLIELFLIAETIRDLGAKKLTAIVPYLAYSRQDRRFKDGEAISIKTILHILSEVGVNTLVVVEPHKPEELSYFKGELKIVHPYHQIARKIKEIIEDPFILAPDRGALDRARKIAEEINAPYSYIEKERNINLKGKDVVIIDDIISTGGTIVQATRLAYSLGAKSVTAAAIHLLLVGGAKERLREVGVKTLIGTNTINVNDKDIITIDVSQSIALSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase
publication title Structure of dimeric, recombinant Sulfolobus solfataricus phosphoribosyl diphosphate synthase: a bent dimer defining the adenine specificity of the substrate ATP.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 93
structure length 278
sequence length 291
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4twbA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4twbA02
2C4KA 1I0IA 1VCHA 2YZKA 1L1QA 4LYYA 1WD5A 2PRZA 4LYGA 5BRNA 1G9SA 2HCRA 5HIAA 4M0UA 1CJBA 1P18A 1U9ZA 3H83A 1OROA 3OZGA 5KAPA 1G2QA 1ECJA 4QYIB 5ESWA 1NONA 3GGJA 5BSKA 4PAWA 4X44A 1QCCA 1OPRA 1A95A 1UPFA 4PFQA 4M0KA 1DKUA 1ZN9A 2PRYA 3DEZA 3M3HA 1IBSA 1Y0BA 1DQNA 1L1RA 3G6WA 5BQPA 1UFRA 2XBUA 1NULA 1A96A 1ECGA 1AO0A 1I0LA 3QW4B 1A98A 4P84A 1OREA 4M0PA 1V9SA 4RAQA 3MBIA 4P3KA 1QB7A 4P82A 1ECFA 1A3CA 1QCDA 3OZFA 1BD4A 1GPH1 4IJQA 1VSTA 1I5EA 2JI4A 2AEEA 3MJDA 3N2LA 4FYMA 1DKRA 4OHCA 1JLSA 1ECBA 2H08A 1D6NA 4LZOA 4QRIA 1TC2A 3GGCA 3ACBA 3ACCA 1G2PA 1XZ8A 2EHJA 3KB8A 5IAOA 4RAOA 1G9TA 2JKZA 4MB6A 1O5OA 4P83A 2DY0A 4LZNA 3OHPA 4RADA 5HKLA 4S2UA 1LH0A 4P86A 1ZN8A 1A97A 4JITA 1HGXA 5ESXA 5EUCA 4RV4A 1UPUA 1I14A 1XTUA 4WN3A 3EFHA 5KAMA 3HVUA 2WNSA 4RABA 1HMPA 1P4AA 4RQAA 1XTVA 1QK5A 3GEPA 4JLSA 2PS1A 3NAGA 3S5JA 4F8EA 1STOA 4RHXA 2IGBA 5BQOA 1U9YA 5JV5A 2FXVA 1PZMA 1ZN7A 1QK4A 4X45A 2H06A 5E38A 1TC1A 4RHUA 4KN6A 1BZYA 1P17A 2GEBA 1VDMA 4RACA 2E55A 3LPNA 3LRTA 3O7MA 1BD3A 1W30A 5K51A 1XTTA 2JBHA 1J7JA 1O57A 1P19A 1Z7GA 3ACDA 4RHTA 2H07A 1A4XA 2P1ZA 4RQBA 1GRVA 5IPFA 4RHYA 3DAHA 1MZVA 4ZFNA 4TWBA 3DMPA 4P81A 1XZNA 1JLRA 4QYIA 2JKYA 2VFAA 4RANA 1DQPA 1R3UA 4LZAA 1YFZA 4Z1OA 1QK3A 1I13A 1QB8A 4P80A 1ECCA 5JSQA 4WMLA 1FSGA 1DBRA
chains in the Genus database with same CATH superfamily
4KDEA 5E2BA 3IP6A 4PLFA 2R1UA 1Q2UA 4UPDA 1WX1A 3L4KA 2DULA 3PT9A 4Z4CA 2X0DA 1H0HA 2OD2A 1SRRA 5ENVA 4E21A 1E18A 1XTKA 4RPLA 3JQAD 4QXOA 3FW1A 1Z0IA 4UAGA 3EDRA 1OFIA 4CN9A 4ZCTA 3CEMA 2JHCA 1F6DA 2VSFA 3HH8A 4P7GA 2VJPA 1ADYA 1RWMA 2OAQ1 4KQJA 1P75A 1KYZA 4GLBA 4LK2A 1VZ2A 4EL0A 3OEYA 4DA8A 4KVAA 1QHEA 2I4IA 4DR4B 4FMDB 1UKYA 1E3JA 3OU2A 4MQ6A 1O8CA 1L7XA 2YS7A 2DQSA 3N0VA 4FEYA 4DT1B 5KTSA 4BQQA 1SKAA 5BOVA 4N18A 1MFZA 2ZUTA 4LGYA 3ILYA 2C94A 1JFRA 1I7DA 1L7BA 2Z58A 2XWPA 4WJKB 3EDYA 3EVZA 1QRRA 4P3KA 3LPCA 3BFXA 2WHQA 4GWLA 1ZFNA 3WL6A 3AF4A 5JALA 2XUQA 2D1SA 1UBLS 1VSTA 1K8QA 2Y0EA 4MWOA 1W2GA 5GINE 1K6XA 2IYWA 3QRWA 2V65A 2H18A 3LVFO 2IXEA 2HI0A 5HF9A 3OHSX 2PMFA 3TEMA 5IKPA 3EDMA 3NBMA 5E7QA 4JQZA 4TTSA 4Z0TA 2AE1A 4UM9D 2NO1A 2VC2B 4O08A 2CNWD 4I46A 5ARCA 4P86A 5H83A 2G72A 2OLKA 2WJYA 1JALA 2HTFA 4F11A 3ZD9A 1LPNA 4F1JA 3CR8A 4JI8B 1MJNA 1FQOA 1Y9AA 3TRJA 4FFBB 4B46A 4FFRA 3HXOA 3VJMA 4CU5A 3LUHA 1L5RA 1Y6JA 5AOBA 5H3LA 3LUKA 4PX9A 4XB6B 1ENYA 4RETA 5B30A 3DUFA 3SC4A 2IBMA 3CNLA 4D56A 2WU4A 2Z4RA 1ZJZA 1Z2CA 2YS6A 1ODFA 2H4WA 3L8YA 3WGTA 4Y6QA 4EGFA 2J5BA 1CIVA 5CEEA 2CUTA 5AVRA 4F92B 1VPLA 3EVTA 1RKVA 3RAEC 4C06A 3DLPX 1SAYA 2PAAA 3K9GA 4M53A 1GN8A 4E07A 1NRIA 2YNMA 3HBMA 3RSLA 3WYGA 2WG1A 1YBFA 3SR3A 1G5PA 2V3CC 1X7ZA 5CLIA 3PKJA 3FPEA 2XUJA 5GM2A 1Z2OX 2DOKA 2I3GA 3P96A 3PI6A 1BEUB 4RZ2A 4BP1A 5ELXA 1GPWB 4MARA 2I7CA 1IDN1 1F2TA 2XTAA 2ZLBA 5D86A 3ETLA 4FIZA 3PR2B 3HWWA 1WCYA 2RHJA 4GRIA 5BT9A 4X3OA 3SJBA 4AJ2A 1YZUA 3ZZ1A 1CY1A 2EJWA 3EUWA 1MVLA 1KQNA 4A0RA 3OC6A 2X5KO 1E1LA 1N7HA 1JQLB 1QYIA 3KKEA 4KIUA 3W4IA 4OHKA 4F6RA 2ZDHA 2G9NA 5EIXA 1QO0A 2B3DA 5HPYB 5KYKA 5FWNA 2ES4A 5CU7A 3L8MA 5FBZA 3RUHA 4AIIA 2QI9C 3P2EA 1KO5A 3HCOA 3OE4A 1ZM4A 5H9VA 4HAYA 4H31A 1JG1A 1U7ZA 1X2EA 4DV4B 3SZLA 3VI4B 4Q9JA 5KQMA 1L5KA 4L0QA 2BEUA 3DTVA 4Y0AA 1FNNA 3TTYA 3TUIC 1EPUA 1JDSA 1NA5A 2ZJ7A 2OM2A 3C3KA 3KAJA 1QOZA 5H82A 1PSWA 2QQFA 3EC1A 4H2DA 3VZQA 4IV8A 4Y1RB 4MRRA 4TVSA 1CR1A 2W6JA 5FBKA 3U7QB 5B64A 2I2FA 4MR9A 3DGFC 1CY8A 4KL8S 5HBGA 1PD0A 2A0UA 4KE8A 3SZMA 1G20B 4D8TA 4ZDIA 3E22A 1Q0QA 2AFIB 3IQHX 1YR3A 3L6UA 4EB6B 2RHDA 2VF7A 1X0XA 2FNAA 3F6YA 2H8KA 4PC6A 4RORA 4CBVA 4CT4B 4EG6A 4UATA 1XNHA 1KFCB 5B7QA 3QSYA 1VLVA 1YZVA 3CC8A 2CVFA 1GLGA 4G0MA 3IJEB 4RGQA 2ZUDA 4U3JA 1RRMA 2BFEB 4L76A 4KQIA 4KXFB 4N5IX 5DM0A 4ZYYA 2IS4A 2QNIA 1CT9A 1NYRA 1N0HA 1E5QA 2FW9A 5AW2A 2ZPAA 5G4LA 4HNRA 4BFWA 1YB1A 2RCNA 3VKVA 2X4LA 4HS9A 1HFKA 5CK4A 5IH3A 1Y3CE 2XDWA 3W2GA 4O5AA 4CKWA 1G6HA 4YAJA 4U7DA 1OW3B 2HRRA 3F2VA 4IF6A 2GLTA 1J8VA 3PGJA 1OZHA 2NAPA 2R4QA 2B4TO 1S7GA 3AR9A 2LCQA 4B3FX 5IABA 1SC4A 5C8YF 3TG8A 1NBIA 3ISVA 3UBMA 5GVSA 4NCBA 5L45A 3OKPA 3TW4A 1JAIA 3QBVA 4NZPA 4BV8A 1CUBA 1PJZA 3NJ8A 5LCXA 3I9MA 4J91A 1MC1A 4Q39A 1N2HA 2PIDA 3M4XA 2DH5A 2OCLA 3H2IA 4DE5A 3LH5A 2QS9A 2H16A 4R8SA 3VU9A 4XM0A 5F2NA 4H6XA 1SVUA 5TC4A 4ENVA 1UOPA 2AXEA 3UJDA 4ZCPA 4CEJB 3I01A 3IPRA 4TVKA 3R9XB 4AJ9A 1KWKA 1Z38A 2JPDA 4UBJA 3G2NA 1FMTA 1N2CE 2ZIZA 5ADWA 3FDFA 1ANKA 1T5IA 3DP9A 5LB2A 2QJFA 5HEKA 1IAQA 3G9XA 4HH1A 1RKQA 3M81A 4MVJA 5I9MA 1Y1SA 1VFNA 3DQZA 4ZO9A 3ZWOA 2O59A 5J1TB 1R8JA 3W2EA 4QLOA 3NOQA 5IT5A 2FW6A 1ZIDA 3D3WA 3REFA 5IH7A 4D46A 5JXWA 1NTOA 2G82A 2ORWA 3DKPA 1X3SA 3AM1A 4DBLC 2WAYA 4FDUA 4UPVA 4DA6A 1ZOSA 4FTWA 4GMHA 4DYVA 5EZYA 3IULA 1QX3A 3P0FA 4M8LA 1XTTA 3BJRA 3IOYA 1QH8B 3ZGOA 1WKVA 1YACA 1H66A 2UYQA 3ORQA 3DOCA 1N6LA 1NNUA 3WGYA 1CDOA 4BBZA 5KHLB 1JN0A 2QD1A 1JJBA 3JQGA 5GJWC 1PFKA 2CLMB 3FUWA 4P3PA 1HRDA 2P78A 3KWFA 1MMFB 2I6GA 3C3YA 2NXCA 2GJ9A 1XLWA 3N59A 1R0WA 1ZJJA 2JIQA 1SUCA 1IK6A 1E99A 5A9RA 5HM8A 1NV9A 2B2CA 1BKSB 1X39A 3TCNA 3IEXA 4E94A 4N6NA 5CDFE 3B5JA 5ECWA 3W8DA 1KBOA 3MRTA 4QATA 3DPUA 3ZHBA 2C9MA 1DAEA 4CIYA 3L49A 3ZHRA 1RXVA 1UXJA 4FPXA 2ZP1A 4FIDA 5KSOA 3A6EA 3GUCA 2Z6UA 5HFNA 5CXSA 3HKDA 3K9LA 3L8CA 2H51A 4HLUC 4JFAA 1VCOA 2TYSB 3AERB 4PC7A 1Q12A 2EFJA 3H05A 2PX8A 3WLIA 3RUIA 2CFOA 3PGKA 2B4RO 3F6RA 2Z6AA 1N1MA 2HCFA 1U7OA 4P4TA 2Y2VA 3DBRA 2YWXA 4X7BA 2HRBA 3HN2A 4R8MA 2Y93A 4H6WA 4OXYA 4WBNF 2WM9B 1QO7A 5A9SA 4IIJB 2I8CA 3C39A 4MGHA 1S2MA 4JIMA 5ALXA 4DLSA 1FB5A 5CR9A 5DMHA 5LZ7A 1RRFA 1PBNA 1KEVA 3KEGA 3QNWA 5JWOA 1BWPA 2DUWA 5JZBA 1KHTA 1A9PA 1J21A 1OREA 4Q3CA 5ADHA 4JH0A 4JP5A 2DSNA 2MSLA 1MP0A 2QX7A 4HDCA 3SR4A 3JS5A 5IP5A 4N9QA 1ZJ4A 1XEWX 3DMDA 2H9IA 1M6VA 4WFIA 4YP7A 4B3IA 3EXHC 3M6FA 4RKWA 1T3HA 2DYKA 4N4AA 3S0JA 3VC3A 3FIUA 4A03A 1I2DA 1FUKA 1Q1NA 1XKLA 1OGYA 2GSDA 2QR3A 2BDTA 4UASA 3WKAA 1TW2A 2EBHX 4HRXA 2A57A 4S3MA 2OZEA 4TL8A 1K7SN 5E0KB 1S02A 3UMCA 3X2SA 1BVHA 1ORRA 4FDTA 5LD2C 2IY9A 2BISA 3VZPA 1X1SA 1E6CA 2GBLC 4KGDA 3STVA 2LDXA 4WVFA 2J45A 4ETMA 3GEHA 3RJMA 1MB3A 1OJ7A 3L1IA 3RVBA 1KZHA 3UKDA 1GUZA 3HCFA 1Z7WA 3RHTA 1QKIA 4LRWA 4WAUA 2FX3A 4KE6A 3PQ4A 1MO4A 5NULA 3V2HA 4CDGA 3UXYA 3SIWA 4GZ5A 1RAHA 3JWPA 4UCXA 4YO7A 4JLNA 1YS9A 4FX2A 3J7TA 1A5BB 3BJMA 3DNFA 1YR1A 4OKSA 5CG2A 1JEEA 1JKIA 2QNBA 1A04A 1X92A 2PX3A 2XYGA 2RGBA 3FROA 3KKLA 3QIVA 2X2PA 4PHHA 1KFEB 1ZM3A 3IDAA 3P1JA 4R9RA 3WO0A 5BOSB 1Z4OA 2FN3A 4MLDA 1YO6A 1CUSA 4DCCA 1OLXA 2CN1A 4XDGA 2Q6OA 4EB8A 1Y1LA 2IKQA 2OORC 2BGGA 3TKYA 2OQIA 3C4VA 4TWAA 3PLAE 1XQVA 3IDOA 4EG4A 2NXEA 1JDNA 4CHGA 4KN9S 3D7SA 1UBCA 3LCJA 3Q2OA 2VJAA 3MLAA 4HDOB 1KGSA 1LNQA 3F90A 5F51A 3DVQX 3PICA 1T4BA 1HF3A 3NDJA 2NQTA 1J2YA 1ACLA 1VE3A 2YFKA 3PFHA 4OQNA 2VDNB 3PITA 5SYNA 3ZCXA 4C01A 5ALPA 1US8A 2QD4A 4HYEA 4IDPA 2OD7A 2VAXA 1I6KA 3DE7X 1V6CA 3E6AA 1MEOA 5DP2A 3FZQA 1BDIA 4GMDA 2GVNA 2WYWA 5J63A 3WHLA 4Z51A 2NYVA 4OHVA 2PUTA 2X5NA 3F4KA 2I1QA 4BKUA 1TECE 1NXXA 4YV1A 3BH6A 3VC1A 1MRZA 3QUQA 3CBQA 4F91B 1M6YA 1AQLA 1M1NB 3IR7A 2BC9A 3SK0A 1YQWA 3H0EA 5B55A 4Z99A 3EHDA 1IQ0A 3P2OA 1JG4A 1RBYA 3KJIA 2O8BA 5JD5A 4I19A 2B2NA 3OPXA 4Z53A 4HX5A 4M0UA 4HMPA 1JEQB 1Z4MA 2W2LA 1RZ3A 1XDBA 5IBQA 1CG6A 1V5GA 2AG6A 3U3KA 3NXKA 3EUFA 2C2YA 4YCAA 4CLXA 4KQMA 13PKA 3EQ7A 1HQDA 3EFBA 3JVUA 3KQOA 3R7WA 2P5SA 1BHJA 4ZOEA 1C8KA 1KI7A 1W59A 3E18A 4BNZA 2QVZX 2ZJ8A 5CXUA 2V3VA 4KP7A 1PZEA 2WTNA 1QH9A 2YINC 1P91A 3V4PB 4DWOA 5HVNA 3N8GA 1KIMA 3SVLA 4ZVSA 3RVLA 1WXWA 3LUBA 5B58T 3QXGA 3A6ZA 3DOJA 4E5NA 1A8IA 1NU6A 1GSOA 3M6AA 4DLTA 5F12A 4BX3A 4CCYB 5A5GA 1NVVQ 2JATA 3KDPA 3ZEIA 4XOIA 3R4VA 4V0QA 4YUYA 2MYPA 4LOIA 1O95A 3V8EA 5CTJA 1JT2A 2H54A 1BC5A 2V7UA 5D3QA 1JHOA 1ORTA 4N5MA 3C5WP 1A8HA 4WZBA 1UDXA 4F6CA 3CVVA 4RLFA 1RQLA 2BZSA 4M1KA 4NPAA 1CR2A 1MF7A 2AKYA 2PYZA 3MPOA 4FYIA 1TU3A 1VB5A 1MOSA 1ZBDA 3KYJB 4HX2A 1PBTA 4Q9DA 2YQ4A 1Q0SA 2RH9B 5EINA 3X2FA 4OGWA 5JS1A 1IRXA 1K97A 3RYHA 3SR0A 4C43A 2QTTA 1GRQA 1XYVA 4NH0A 4BV2A 1Q0UA 4E4TA 2HUNA 3BXZA 3H1GA 3TQCA 1EJ6A 5JVDA 5KZMB 3N53A 3R74A 3GMDA 4D97A 3W4JA 4EHFA 3CN7A 3W05A 2BUCA 3UB2A 3ZC3A 5JHHB 2V6BA 3TBHA 4CQMD 5JUWA 3N2IA 1E2NA 2LV8A 4EVRA 2Y8EA 2A4KA 4LG1A 4LX8A 4Q02A 3SJUA 4JDUA 2PV7A 1KAQA 2P3LA 4ZA2A 2F3SA 3K6KA 1AHPA 1L8LA 4Q7MB 5F1OA 1DLIA 4QDOA 1P2UA 2H2GA 3A4VA 1ONBA 3LD9A 4JI5B 2A3RA 1TC1A 3WL8A 4B75A 1W5EA 2NZVG 3OIGA 1LDGA 3ER6A 4UKDA 1WTCA 3D4NA 4OA5A 2FX2A 3T38A 3OZVA 3LCMA 3N1UA 1QSGA 3THOA 4GLLA 3ELBA 4BASA 3VH3A 5ARBA 4UQOA 2UAGA 4RIFA 9MHTA 1N25A 1Y1PA 1TMOA 4U0JA 4PBTA 1L7PA 4IUCS 4ISCA 1MC4A 2GM9A 2X3FA 1TD1A 1E0SA 2C2GA 3T9AA 1F2UA 1K06A 2TMGA 4BNDB 4UQLA 3IXLA 4PXSA 2WJPA 1RABA 2Y3IA 3ILHA 4NENA 4WTOA 1V1JA 1N6IA 3L7KA 3TSAA 5TV2A 4YV7A 4RE6A 4RV9A 2BSQA 2DTDA 3PQ3A 3GLHA 4FD2A 2NZUG 4FI3F 3WMWA 4AYXA 2O8CA 1S0UA 2LE0A 2Q6KA 5FI0B 4M55A 3TGPA 5ITZB 3G6KA 1CUAA 3L2OB 3LUGA 4XGRA 2C4NA 3PD7A 1Z35A 1BJRE 4D9BA 5A3RA 2ZCJA 3ENVA 1FSSA 2E85A 1NXSA 4MPRA 3VSAA 2BSAA 2AOTB 1YGYA 2C29D 2HCRA 1GZ3A 3TCXB 5KNCD 3TW0A 5AM0A 1LFDB 1SCBA 2JFGA 1G38A 2LKDA 2FDCA 2EKPA 4BRWA 2A0YA 5BUQA 2Q6TA 3BH7A 2G8LA 4F4JA 4AN0A 1EFKA 3W3AA 5EMMA 1MW8X 1DWQA 1GG9A 4UTZA 4Q9HA 1KERA 3AESA 5F5XA 2AN9A 3LPAA 3ZDQA 4W4TA 2NUPB 3NTUA 2NQ2C 3NANA 1E0DA 2R86A 1P74A 4MQEA 1PAUA 3FPFA 3EIEA 1TK9A 3F6PA 3VR2D 3T1NA 5EQDA 1H4VB 3O5AA 3COYA 1ZK1A 3CUEF 1ECGA 3I28A 3T1YB 4UZFA 3QEBZ 2HX1A 1GKYA 2C99A 4LJ5A 3KJNA 4IMRA 2D1QA 3JQ7A 3MJTA 4KAXA 3NHUA 5CYOA 3OM1A 4E88A 3ADCA 2ETVA 3LYUA 2O8CB 3I92A 3LIIA 1D2MA 4PS0A 2ZXUA 1GOTA 4DGQA 7REQA 2FFHA 3AINA 2PX0A 3KDSE 2F67A 1GTRA 2P9JA 3K30A 4QRIA 1KI6B 1O7JA 3H7IA 1K89A 1RXWA 3QMWA 1VKJA 3UWKA 3TGWA 1DO0A 2FG7C 1YCFA 4RK7A 3V00A 4N7BA 3RGGA 4YPVA 4EYGA 1BWQA 2NUAA 3EEIA 2GNOA 3ORYA 4O1MA 4UUMA 4BQRA 3FBWA 4QUDA 2XZLA 1PJ8A 4QHTA 1PI3A 3WADA 3SE7A 3GUHA 1N2IA 4D96A 1EBUA 4ZDWA 3PFBA 1XDSA 1BE6A 3O1HB 3T95A 4RH0A 4BU1A 4YDQA 1CS0B 2HMVA 3VO1A 1TVMA 2HOQA 4JLSA 4MKHA 2OBMA 4EB3A 3UJ6A 4LIPD 4PNHA 4CGZA 3QUSA 2AOWA 4YRIA 1L4YA 1R6BX 3ZK9A 3D6HA 1XYYA 5AKKA 2FXVA 1UZNA 3BTUA 4QT0A 4DV7B 2QZJA 1CR4A 1CKEA 2CHUA 5DBEX 4YJGA 3TOVA 3DOOA 2WP8J 4FFOA 3RVDA 4D02A 4XYLA 1U0TA 4ZQEA 2QW8A 3DTVD 1Z56C 1O08A 4A6PA 3T1HB 3OZTA 5C1DA 1DDIA 4G85A 3RIXA 4S05A 1RRKA 3TYXA 3DL7A 3OECA 4RGBA 1CCWA 4BO0A 1PK8A 3MYYA 5EJIA 1TLFA 2C4HA 4FX5A 5INTA 3H5VA 4TQAA 1ND5A 1Z2AA 1OYWA 3DYBA 3O47A 1EFUA 1U0RA 5E8JA 5F4BA 1C7QA 5TX7A 3TO5A 5JJBA 5LOVB 5GZ3A 4X0EA 4OXRA 4HGQA 1G1AA 2RHRA 3JAWB 4AP9A 16PKA 3FPLA 1UDWA 2L82A 4BGVA 4JXKA 1RFGE 3ESDA 3HDTA 3G0DA 3QOYA 1CRLA 3R6DA 4TKLA 2WY2D 2PL9A 1KSHA 3Q1LA 4G2NA 4F4IA 1Y3DE 3IAM1 2J4FA 4Q7QA 1XLVA 2UV8A 1Q50A 2MYNA 1G3IA 2I7TA 4KJZA 2NU8A 3FOBA 3JY6A 2BVNA 2AZXA 1X6VA 1MTOA 1WAMA 3A1SA 2ZOSA 3N2NA 1XEWY 3VDMA 1T0HB 1INLA 1MO3A 2Y1KA 2AFHB 3VR3D 2P2SA 1A9XA 2GFIA 2V5UA 1OT5A 1QBGA 3PYXA 3RU7A 2C78A 1H5UA 3KKPA 3OM8A 4I7EA 4INOA 5FUYA 4GPEA 2O3SA 4R1MA 2PH7A 1RWXA 4P33A 4PQFA 2XCUA 1E6MA 4UTNA 1DIAA 3A70A 3CRVA 4ZO8A 4NOJA 5I8WA 2CXNA 4FE3A 5BRAA 2CHVA 4DG5A 1YE3A 4BO9A 3DOIA 3FA2A 4BEVA 1UPXA 4HYTA 1Z0UA 2JIZA 4N3NA 4KXMA 4BRUA 3HYCA 4M0LA 1SFRA 2R2GA 1EFHA 2EFCB 1HO3A 2W2VA 1KI9A 2X5JO 3FSGA 4MQFA 4TQGA 4YP6A 4ZYZA 1FBTA 4F38A 1RMQA 1XA4A 4NABA 1EFVA 2P8JA 2HIAA 5J4VA 1HG0A 2WTAA 3T3NA 2CEAA 4R2WA 2R84A 1V7QA 3DGEC 1Q5PA 1E60A 2VDLB 3EVEA 3RWOA 4M9CA 3TM5A 2QM7A 4Y6OA 1W36B 5F23A 1QH1A 4MR7B 5FUXA 5IZCA 3SCZA 3U1TA 3UAGA 1QX4A 4E1AA 3QFSA 3OSUA 1GGVA 2HWUA 4WXYB 3QE4A 5JWRA 3JSAA 1TTQB 3WBBA 4PRZA 5IJ9B 3U60B 1NKSA 2YN0A 2C88A 2YXNA 3L0ZA 4W5QA 1N5KA 3BQNB 1LBEA 2R4TA 1SBTA 2VCYA 3NBZC 5EP4A 3S2UA 3G7UA 1YTLA 3GL9A 3RFTA 1AGNA 2C07A 2IL1A 4TM7A 3QKRB 4DLYA 2H85A 1FE8A 4YP9A 2GRUA 1FZTA 3OH8A 3N6VA 3FKSD 4YAIA 4UM8B 3QU4A 4PSUA 1DFIA 2M6RA 4FN5A 3IL2A 3DZDA 5CHEA 4PSVA 1MHTA 2X1LA 5K4AA 1M33A 1I7QB 2KLBA 1EXMA 3U4QB 2WV7A 4CM4B 4UHCA 2PWYA 3UXEA 2O2XA 4LTNA 3OZXA 3V1UA 3V32A 1CHDA 3CIFA 4L9AA 4TSFA 3JATB 2YH2A 5FOWA 3WSVA 1D03A 4NV1A 1W581 4X3PA 2DKOA 4IVPA 2GEVA 2QW0X 1XTRA 3ZVLA 4KAJA 1MAAA 2GAIA 4DMCA 2EF1A 3EGDB 2C3UA 2MMGA 3HMKA 1DO2A 2OMEA 4JLPA 1WHSA 1TE2A 4MWTA 2UVDA 3ROGA 1H8HA 2C96A 4XJXA 5BN1A 4RK6A 1T8UA 4CKZA 2FVXA 2C9OA 1JUDA 5LQUA 4RKFA 2NO5A 5JXJA 4TKMA 4DA9A 1JLLB 1ZSYA 2O05A 1YL5A 4JZKA 2HHHB 3F9RA 3NX4A 4G5FA 3TRDA 3U0VA 4BFVA 2GBIA 4GKAA 1V0JA 1QQTA 4GOKA 2O5VA 2YWBA 4A4DA 3FYTA 2WI8A 1TYDE 1RCUA 2X0RA 3O8LA 1W36C 1Z17A 2BM1A 1E5DA 4K1LA 4LISA 4LVOA 1VYTA 3IQXA 5LQSA 2XUDA 1LNSA 2HA2A 3JR7A 4IJWA 3HB1A 1PK7A 4TSKA 4BQEA 3EQ2A 2AV6A 4R2KA 4DF3A 1DBQA 1T5DX 2H9YA 1YK1A 3RSFA 3VHXA 4AL4A 4GPAA 1EZ1A 3P2MA 5J2TF 4JT9A 1YFZA 2XTMA 1ZPDA 4CNQA 3FVQA 1RPJA 1H94A 2ZZKA 1CJSA 2XIQA 2ZGVA 4YT5A 1IXRC 1T2UA 3WRYA 3O8DA 4IXNA 5IUNC 1AKUA 3A25A 3P9XA 3MLEA 1U9CA 4FFPA 4F3KA 2C4MA 4YT8A 2QVGA 3RODA 2Z5VA 3RTBA 2PUCA 4JELA 3U44A 2WINI 1Z07A 2V7VA 1YL6A 1CNMA 5CH5A 3ABSB 3C6QA 4FVTA 3LE8A 4LTDA 2BP7B 3V2IA 2XA9A 4UCFA 3BGOS 3GT4A 4R1QA 2EIHA 4D41A 2QRLA 2BLLA 1XRSB 3OD1A 3SS7X 2JJ1A 4IFEA 2WF9A 3CJTA 3P4YA 4IH4A 5AHRA 1S4MA 1ZS9A 3TKAA 3NZEA 1F0NA 2O07A 3CT4A 3OJEA 2RAPA 1H3NA 1U0FA 3GGSA 3UUEA 2UKDA 2F90A 1AO0A 3RRYA 5TJ9A 3WYCA 2YWEA 3I8OA 2IKSA 3LBAA 2Q2VA 3COWA 3LWBA 3PUXA 3QEMA 2EIXA 3C3MA 3QFFA 2C1ZA 2GCEA 4ZVRA 3T7RA 2W8BA 1UMBB 1IUOA 3LA8A 4R81A 5CCXA 3MWJA 1KU0A 4LHEA 4RUKA 4Z4GA 4UBNA 2JLWA 3TXYA 1BH2A 1I80A 4B6SA 5J2UF 3IPAA 4TN5A 2WF6A 4QQFA 4E46A 1USVA 1V43A 4HNVA 3AG5A 1OU0A 1NSFA 2Z56A 2DLDA 3HO8A 2IWRA 3PRYA 4MGEA 2Q21A 3HUUA 4BNFA 3O3OB 1JE0A 3B1WA 3FUTA 4P5EA 3GFVA 4J29A 1Q3KA 2EGUA 1ULTA 3DDWA 3L43A 3L7CA 4G1BA 4P83A 4R1OA 1E1RA 1TM7E 1ENZA 1BDJA 2HPAA 3Q12A 3WYBA 1Z4NA 4MVYA 4QTXA 4IMIB 4NATA 3WGLA 5CB0A 4RV4A 4CMIB 2VDPB 4AJKA 2IFTA 2RDMA 2WNSA 3S2GA 3KYDA 2QM0A 1YFJA 3FBTA 4URHA 1XEXA 2IXDA 2EBWA 5D7BA 3ADBA 1GEEA 2Q4RA 2OD9A 3FR7A 3THWB 1QTQA 2YHUA 3OZRA 4GGPA 1TQHA 1FUEA 4P5PA 1IZYA 5JATA 4ZU3A 4DLAA 5D5PA 4AAYA 2JBWA 4AUEA 1VHWA 5E9AA 3B7GA 4AG5A 1AC5A 4QBTA 2GILA 3CLHA 1MO6A 4RXTA 4I5EA 2Q28A 2BM0A 2VJQA 1BCSA 1MNQA 2W6ID 2X58A 1C9JA 3BXFA 3OZWA 4JD5A 2WSLA 5L3SA 1RI2A 1AN9A 3V4ZA 3KTFA 1SVWA 2M1XA 4KAFA 2FPUA 1A9TA 2PVSA 4DUZB 1EVQA 3V1KA 3EY9A 4MW5A 5IFKA 6CHYA 4CPDA 4L22A 1D1SA 1EB9A 1X7WB 2ECQA 2VLBA 2WUFA 1QO9A 3AB8A 4RMIA 1QDUA 5DNAA 1HDXA 4NCAA 2GYWA 1FW8A 2RHCA 4M9SA 1JR6A 3NT2A 3OE5A 4RVFA 4IGKA 4PWZA 3S99A 1JNYA 1QXSA 5SZJA 2C2KA 4L5AA 4Q82A 3AY6A 1Z2DA 3DCNA 4HRYA 4JLVA 4YJHB 5ELLA 4S1WA 1O0CA 3EAFA 5DYGA 2DBRA 2I33A 2B4KA 1V16A 3NH9A 5DHRA 2BHRA 1H2AS 4I4NA 2QNRA 4DSAA 4R2MA 2OOSA 3C1AA 3KIPA 3ZK8A 1SIOA 5LDGA 1G5IA 5BMVB 2V96A 1NT2A 2DWOA 5BSVA 1K1EA 1LV7A 1VP9A 5DE3A 4DG9A 3F9CA 5EUMA 5FRDA 1JHAA 2WJGA 1CQXA 5HR5A 4KYTA 4OK5A 4DMHA 2FN8A 4HVTA 4UAUA 1J5XA 2DLNA 2HL6A 1LKZA 2H4JA 1PGOA 3IURA 4G65A 3M34A 5F21A 3USES 1U2GC 3CKYA 1NY5A 4L57A 1U5BA 4FMCB 4MS3A 1SY7A 4OQMA 1RQXA 1QRUA 2HT1A 4MYHA 1NM5C 1RC1A 2E18A 1XTSA 4NH4A 3ZHSA 3VBEA 2VQFB 3GUUA 3U6BA 4TT8A 4BWYA 3R7NA 3TOZA 2IYUA 3PTAA 4G26A 4ACAA 4MUAA 1B76A 1ML4A 2JLZA 2Z2YA 3V80A 4C0HA 4ZARA 1CQZA 3IEVA 1VIAA 1PDVA 2WTMA 4N39A 3GFGA 4BLSA 3H1PA 3H6HA 2Z98A 5IJXA 3SF8B 1QTNA 1XZQA 3MGCA 4JKYA 1OT3A 2CL6X 3EEOA 1PJ4A 2O2EA 1CW2B 4JMPA 1R0BA 3K9QO 3F4BA 4RIEA 1O96B 2RGDA 4HX9A 1E32A 4HPWA 4IEEA 1Z34A 3G2JA 4BLQA 1MLDA 1MQAA 5IYZF 3I04M 3TNLA 1QFYA 4AZVA 1DTEA 4EZIA 2HU5A 1MD9A 2YUTA 1JRLA 2OAEA 2QR5A 3BKXA 3DMYA 4Q3BA 4YJ3B 1FX0B 3CH6A 5CPFA 4O4HA 1KOLA 2JI4A 3UJ8A 5KNDA 4LF5B 5F3WB 3DEYX 1QM5A 5FNZA 5MFZA 2MSKA 4ZQGA 1TC2A 1M10A 4JV5B 1XZAA 2BFNA 3L84A 3JTMA 4WKCA 1A9RA 4KQ2A 4LF4B 2ZSJA 3O38A 2CJWA 1EA5A 1SVIA 3ER8A 4RD1A 1DRJA 2EFHB 1B7GO 2XCOA 4WZAB 3WDMA 4LYAA 1KA9H 1LSSA 5JH7B 3ET5A 4MICA 1YI0A 1XF1A 3MTQA 1PJTA 2JIBA 3EIFA 2CF5A 1WUIS 2PKQP 4IOMA 4AURA 1IOZA 3TLXA 1QORA 4N0DA 4N82A 5EJEA 2PS3A 3LF1A 5JIBA 3N70A 1BW9A 1QOQB 2H6EA 2WOOA 1PTJA 1U8EA 3ZNPA 3R6TA 2KX7A 3JRNA 5KDOA 5A04A 2Y92A 1W5TA 3B53X 3ESYA 2I6UA 4QGSA 7YASA 4LQ4A 7GPBA 2DE0X 4OHZA 4G1CA 1J9EA 4D57A 5LBIA 1JG7A 3X1JA 1VPWA 4IKEA 1ZXXA 4CFZA 1F17A 4IG4A 5JSZA 2O8FA 3M2TA 1VE1A 1J0EA 3A14A 3KSBC 4AF6A 1YK0A 3A7DA 1NVDA 1XN1A 4MUFA 4NK4A 4AMUA 3GFSA 4NDZA 5DASA 1WBDA 1RT9A 5CIQA 1YJXA 5HJ7A 5I4KA 5KTNA 1E59A 3KLBA 4BNXA 4C0BA 5BVHA 3IMGA 3W3AD 1P2SA 3AF2A 3II6X 3H8VA 4DIFA 3EYWA 5HFAA 2FSSA 1VG9B 2W0SA 4X3CA 1L4NA 4U7TB 2M6SA 4HG2A 5HDQA 3S1SA 1Z16A 4KTTE 2LNDA 3AFMA 3MB8A 3DKIA 5CBPA 4PNPA 1BFUA 1AY0A 1KK0A 2LZ0A 1JQEA 2Q6LA 1G5RA 4B33A 5T8KC 4EEZA 1T6ZA 4ESVA 2HRDA 1Y5IA 2H65A 2QYSA 4II3A 3U19A 3K0BA 1GZSA 2VUSA 3I1YA 2IWHA 4AW9A 5KYWB 2GPTA 5ARDA 2OCAA 2YRFA 3AJAA 4WX2B 2FW0A 2OY0A 3K70C 5IMSA 1Q17A 1N0UA 1W73A 2QQ0A 2Y1FA 3KOUA 3F7TA 4NCNA 1AURA 5CIWA 5EJ6A 1Y3FE 3M6IA 1CK4A 1WD5A 1Q74A 1XU7A 2G4LA 2GZSA 2JGNA 2NZJA 3JWEA 3R5KA 4MIYA 1GGFA 4X8LA 3OZGA 3RT9A 1SCIA 2I2XB 1U2DC 3HBFA 4MEAA 4DRYA 3ROEA 3NR2A 1XQXA 1A5SB 4OF4A 2QB5A 3SNHA 3OLYA 1QGAA 4M0FA 3AP1A 2CGEA 1F8XA 3GDFA 4J0KA 1BCRA 2QJOA 4RPCA 5K3OA 3E5HA 1EP1B 3KYCA 5EWLA 3T5DA 1IHUA 2GRAA 1P5JA 5LM3A 2HBQA 1QQBA 4IIUA 3KSZO 4KVGA 2B2XA 4U7HA 4C22A 3MJEA 2CZGA 2Q9AA 4PTLA 1L5OA 3OBBA 3K20A 3TZBA 5CDHA 4XLTA 2ZVQX 3BX1A 1V9SA 3F8WA 1QJCA 2YRWA 1YR8A 1Z29A 4HVLA 1PCXA 4ZAYA 4NFHA 5C1BA 5AVUA 2B8EA 1Z0JA 4LHVA 5LN1A 2P2ZA 1BVRA 3S1AB 2R751 2M6KA 1ZEMA 2QAGA 2PQ6A 1EFTA 3MJ4A 4B8WA 4C4ZA 4LFBB 3QOXA 3P9QA 3GJ5A 4DB4A 3AHFA 1U2RA 5A4FS 3A9SA 1VPVA 1G66A 2HXSA 2J6HA 3A9UA 3K9BA 3OKFA 3OJXA 3FGPA 4DKJA 1F5SA 1TEVA 2GPWA 4HNAB 3W9BA 4OMDA 4POOA 3CT6A 2AG5A 1VJCA 1VLQA 1OKKD 2HJ9A 4KO1S 4MJXA 4MRMA 4HAOA 2W6MA 2JC3A 4JJKA 4RCYA 3OMLA 4EFDA 5JJIA 4KFSA 5EJ2A 3DLIA 2QE7D 3PPVA 3A37A 4URUR 3F46A 3RV3A 3BSSA 3VHRA 4F5ZA 4ENSA 5CLJA 3A1DA 2CLLB 3VYVA 1L3CA 7ABPA 4LOAA 3T52A 2QL7A 3PT5A 2XW6A 1W1UA 4YBRA 4OQPA 2C4TA 5IUKC 4JB8A 3B6KA 1ETHA 1OBOA 1ZK4A 1Z6GA 1UM9A 3BEOA 1TPYA 2HK7A 4LZPA 4OFBA 4XIIA 3SLGA 4GKBA 4R8RA 3UOAB 1PZNA 1XD8A 2ZRFA 3K4PA 1LLUA 3ESBA 2C42A 3GLUA 4KN6A 1A69A 4M87A 4TYQA 3VR6A 2PR2A 2O6LA 4J4BA 4OKNA 2KYRA 5ESDA 5I9NA 4GNKA 3ZBTA 2Q3DA 5DGCA 2PXAA 3G9UA 5MN4A 3KSAC 2NUTB 1DCMA 4BFZA 5IXYA 4N3AA 1I9GA 5U4QA 3EULA 3HVJA 4C3VA 1SB9A 3MFYA 4KW7A 3GUYA 4DRXA 5KU1A 3MPUA 2ZRLA 2VJKA 4Z5XA 4W82A 1YB7A 5HRAA 3A26A 2QTWB 2ZS7A 3QXCA 1QP0A 1JSCA 3ES9A 3GY0A 3I9FA 1PR3A 3QE9Y 5KWEA 2NPFA 4PY2A 3WKDA 4DN6A 1CZKA 1N1GA 3ZXYA 3SM9A 4JC0A 4LXGA 1UWKA 5CM2Z 4BLTA 4D74A 2C2ZA 2VR1A 3IEIA 1L5MA 1OLSA 4XLZA 3JTEA 1NNSA 3HJTA 2BI8A 2HA3A 4FGWA 3UOWA 2B3TA 1MAUA 2CDRA 1NX6A 1G3MA 2I8AA 3PNQA 4FR2A 2RAVA 3BZWA 4HFMA 4Q4HB 2L19A 1CEXA 1XVTA 3GJTA 4PHFA 4FGJA 3EAGA 3EF0A 3QVUA 5BRJA 1XCPA 1CHNA 1JQDA 2IW1A 5C4MA 1P7VA 2FAXA 2YY6A 3H8JA 4NYMR 2IZZA 5DX0A 1P1KA 1AZLA 1NBME 2OQRA 4G25A 3X3HA 1EFRA 4N3BA 4XUGB 5CRIA 3U7IA 1U2PA 3LDFA 1S9DA 1UBHS 5I3CA 2FPIB 2QRZA 3MNFA 2XMGA 4TXNA 2NMVA 1XB2A 1CUEA 4H7IA 1MENA 1CUDA 3AI1A 3PPWA 5ICEA 4MQ4A 1JQ5A 5IKMA 4NQRA 3H2SA 3L7BA 1CTQA 1SHZA 2C0QA 2JLAA 2WJVA 2ZWIA 4PU0A 4DHWA 1JDJA 5B6JA 1Z63A 1M2OA 3KPVA 1ZHOA 4KEAA 4PG6A 5KBYA 2VO1A 3C8HA 4C6RA 1QVRA 3URMA 3WDSA 1PL8A 4NZZA 5IAGA 4Z86A 3SVTA 4MEBA 2B83A 4DJFC 1X19A 4GE0A 2Q3CA 3HJHA 1CS4C 4TS1A 1NV8A 1XRMA 2PTGA 4F12A 1JA9A 3K5HA 4KZPA 4E70A 4OI1A 3CW8X 1V35A 3OCWA 4L08A 1WXHA 3ZZUA 4WZZA 4ZQIA 4G1VA 4YP0A 3ED1A 1N5OX 1ZC3A 5FWYB 3EXEB 1MAVA 1JEDA 3LX6A 1H8HD 3JYNA 2IHJA 1PJRA 3O8NA 4ND3A 2OWDA 1P0CA 2XGMA 3BE8A 5C32A 4RFSB 4U4AA 5JRDS 5DYIA 2FSFA 2QSUA 4MB6A 2CCKA 5B4TA 4OP1A 2VTBA 2C8LA 2CXOA 1FNCA 1M2NA 4KN5A 5TEVA 1N0IA 1OD6A 6AT1A 2MOKA 3NTQA 4MCJA 5IC6A 2ZBFA 1EP9A 4UU0A 2QGFA 4OXIA 3ZVKA 5EE1A 3SJZA 1OGJA 1DKPA 3H1FA 4KLCA 3Q98A 1XNRB 2CMDA 1QS0A 3ML1A 3HXMA 4H60A 2YRXA 1D6SA 4KQKA 1P2BA 1ESDA 4YDHB 3P4XA 1Z08A 4ABYA 5J23A 4IRXA 1VCIA 2B34A 1EH5A 3FYUC 1E1KA 4JEMA 2E87A 2ZB4A 4LDNA 3E03A 1IBKB 1FMJA 1QGZA 1C3JA 2L0XA 2WIFA 3E9YA 3P9ZA 2XXAA 3AILA 5UKDA 3SFZA 1C0EA 4WVLA 4QKQA 1LJUA 3VXKA 1HSOA 2UUOA 1DE0A 1WB9A 2JAPA 3HY4A 2DEUA 1PFUA 1XRNA 2BTQB 1OVMA 1V3VA 3ABIA 4MV4A 4WNIA 3GVPA 3GQBB 4D79A 4BATA 5JMTA 3QJGA 4W5WA 5CB6A 3IVAA 5AKXA 3RWBA 4V0SA 5F33A 2CF6A 3CLVA 1ZGAA 1A71A 3FWPA 4C5BA 1L4EA 3CKKA 3P52A 1E3IA 1F38A 1U7DA 2C2BA 1DXHA 4Y9SA 1U0OC 3UFBA 1IN8A 5KSWB 3PUHA 4ASUD 4UD6A 3FYSA 5IPFA 4D4MA 1ACJA 1NXWA 2FZEA 4HEA6 3ZV3A 3P2JA 4CV1A 4XD7A 1NMSA 1YZGA 1FZQA 1IQRA 2VSNA 2VJOA 4XX0A 4KZKA 1ZUNA 5B3AA 1ILEA 1ZW1A 2I80A 1XELA 4QD3A 4II7A 4JB0A 1QG0A 1SXJC 2A5LA 1PS9A 4L3OA 1SQGA 1GL6A 1NW9B 5D3KA 3IAM6 5JLJA 3I5XA 1VKHA 3NGXA 2LP4Y 2WDZA 2WSSA 3LT4A 4E0BA 4EEKA 1IN6A 1KVQA 2YOHA 3AB3A 3I64A 4K6HA 4Q3OA 1T3GA 2ZZMA 3AGPA 3BDIA 3REQB 2W71A 3CLTD 4E2FA 2H57A 4ETNA 2X7HA 3UGKA 5LPNA 2R8BA 4EF6A 3KLNA 4NR0A 5DM2A 3ONFA 2PV0A 3YASA 2MR5A 4RPIA 2O2SA 3SYRA 1CRZA 5DYWA 1JHQA 3K92A 5EN4A 5E7MA 1E1RD 2WC1A 4MPDA 1J1IA 3VU0A 4O2BB 1VGVA 2AGVA 3FWZA 3KSDO 1HC7A 1GKKA 3ASYA 2P27A 3DFFA 5K3CA 3H4TA 3PFCA 1O97C 1TO1E 1SZJG 2XGGA 2H0AA 4HGYA 4BN4A 1TB4A 2H2HA 1YQUA 3OSZA 1XR3A 4KUHA 3EUAA 4L7QA 4F9FA 2D54A 4GMXA 4P08A 4AB1A 4JY7A 1SUBA 1Z25A 2TSYB 2IOQA 4S2EA 2P68A 5JMPA 3ROPA 2BEVB 1UK9A 4BNMA 2O8VA 2OV6A 2JK0A 1I4EB 1EK6A 5DK4A 2UYYA 2A9FA 4QLAA 1IHOA 4B7UA 2GF2A 1NR7A 1R6TA 2QGNA 1XTZA 2RGAA 5G0UA 4EBBA 5C7LO 4C88A 5BPHA 4KXNA 1UXHA 1HY3A 2ZSDA 2GNPA 2FPLA 3IVXA 4M98A 1L7NA 2AHOA 2YL2A 1EE1A 3BIFA 3ITDA 3UM9A 2AZMA 4CI9A 2FPKA 4R68A 4C4PA 1EX9A 2FUKA 5FOUA 3BB4A 4Z3DA 3V48A 1YKGA 4L4UA 3CV3A 2II6A 2D0IA 4QUKA 2OCGA 4WHMA 4MRVA 3OKCA 4BNGA 3FHJA 4ZI7A 3P26A 2J5KA 3LHSA 4QTYA 1CY0A 1SVOA 1V37A 3P27A 3A4YA 4DQLA 4F8YA 4QTUB 1ZGBA 3W6UA 5EWMA 1PSDA 5CA1A 1YMUA 4OXQA 3WK5A 4WPGA 3KUCA 4LA4A 1DTWA 1KXJA 1PR5A 1WXFA 3ZS8A 1YDWA 3LGAA 4JUCA 3FY4A 4M4SA 1ZN7A 4G37A 1NVUQ 4AP6A 5FTMA 4DJDC 1A27A 1PKXA 1TKCA 1PVVA 1ZA2A 1JR4A 2RJ3A 3KSRA 2DWCA 3D4LA 4UVDA 4EFKA 3ICEA 1ISMA 4ALIA 4RF3A 4CM7A 3D6FA 2Y9PB 3E48A 3GNQA 4GSLA 1N7JA 2MHCA 4I66A 4GDMA 2QPLA 4J16C 4U63A 4QC2A 1B0AA 2VKTA 4FMDF 4ZEWA 2WVGA 5CDSA 2DSTA 4CL8A 1MFPA 4PS1A 5IULC 4R1SA 2CL5A 5EUQB 2WF5A 3CR3C 2PE5A 4LXUA 3I2JA 3VNUA 4KNYA 4NBUA 1VJ1A 4G3XA 3WE7A 1LWNA 1SBHA 5DNVA 1PU2A 3RCBA 5KUTA 1I6LA 1RWOA 1TYCA 3HA5A 4PSAA 4E6EA 2RJOA 2LBPA 4G67A 4YLYA 1ZOOA 1A8PA 1D09A 3W4KA 1EK0A 4QRDA 4CKEA 3LK6A 3GBSA 1SCUB 2BFBA 4JQSA 2QI9F 3LDUA 4NP6A 4UTOA 2H2AA 4Q1EA 4XSGA 3X1XA 2QSJA 4E5DA 5L3QB 2XJ4A 6REQB 3L8GA 4ZREA 4A8HA 2AI1A 5KWJA 3RUFA 1FSGA 4C5AA 2C4KA 3GRUA 3O95A 5JISA 2PRZA 1CSEE 3NEPX 4JYPA 1DFHA 3WFIA 1NBHA 1T4DA 3GD7A 3KOMA 4OU5A 3WNQA 1U5CA 3T5PA 5CVVA 1KEWA 1WVGA 1VG1A 2GRJA 1E5VA 2Q5LA 4YJFB 3JQBA 3KZNA 4P5DA 1RI5A 1HDCA 1SB8A 1JAHA 2O8EB 1QKKA 4J4TA 4KV9A 4LPSA 3L7IA 4M89A 3WK4A 1UKBA 3MT9A 3R20A 3R8CA 3MTDA 2TRSB 4HL6A 4I1YA 2B36A 3SXJA 1UMDA 5H0IA 1QVAA 4DZZA 1ZAKA 4L0CA 4NOLA 1DQNA 1XIVA 4AWBA 5A3JA 3AM5A 2C1EA 3QM1A 5LQAA 3CNQS 4RD6A 3O9VA 3PDJA 5HSGA 3M7IA 4N5HX 1E2QA 2Y6UA 3K1AB 5C52B 3BUSA 1CZUA 2I34A 4R41A 3L8DA 3A9RA 4D0NA 2DMRA 4BX9A 2IZ6A 1SHLA 4RTOA 4LNUA 4V0KA 5K0NA 4DUPA 3B2QA 3BMXA 1ISGA 4ZCSA 4C4YA 4XFJA 1L9XA 1N5RA 4KO2S 1XLTC 2EKBA 4RWEA 3H4VA 4OHCA 2PXCA 4ZD6A 3WLLA 2IPAB 2ID9A 4RDHA 3PUIA 2WEKA 5AM2A 1ZN2A 2M32A 2WTEA 2ZYTX 1G2PA 4WESA 1OFGA 2EHJA 3KAKA 4NDAA 5EZ6B 3HXQA 3CZ9A 2NXJA 3T7CA 4ZIRB 5LIPA 1PW5A 2I6QA 4IGAA 4RPJA 4EF5A 2V6JA 3LSTA 1NQTA 4NAUA 4Q1CA 4OGLA 4OQYA 4YQEA 3TUZC 1NVKA 2OC4A 3I6ZA 1DEKA 3ORSA 4KPGA 4BKQA 2Y1XA 3ZWBA 5CX1A 1WUTA 4CLDA 5GONA 4O1IA 3ANLA 1J8QA 4JR0A 4D4LA 4NG5A 2NVUA 5A1TA 2ZI3A 3ESRA 3QELA 1GG8A 1SD5A 1KL7A 1ORWA 3FVVA 4OHXA 4BBJA 5HUHA 2RC6A 5CNIA 5E9WA 1DAMA 2PFKA 3D7MA 5E7IA 3QIAA 4TMZA 5L53A 4R0NA 1MBZA 4I1UA 4B4VA 4EJMA 4AY6A 4F84A 2G1KA 3GRPA 3UN1A 4NXNB 1SXHA 2XNSA 1WV1A 2V59A 3QXXA 3TRHA 5FDFA 1H65A 2YCBA 2R9VA 3HFJA 5LL6P 4XM1A 1E9VA 1KXZA 5FFMA 5CXXA 5HWSA 5L51A 4Y6SA 4GQBA 1D2NA 3U4GA 4BNLA 1GFWA 2LVBA 4S1NA 1A5AB 2GD0A 2YZMA 5D00A 4AZSA 4ED9A 2C2OA 4Q3DA 4LRQA 4PPNA 4Q12A 1CY4A 2VH2A 3ECSA 3MERA 1PLJA 2ZTUA 4QO7A 2FMHA 2EYQA 5DJ5A 2LPMA 2PLAA 2DKFA 2A5DA 3O9ZA 1A4XA 4KDCA 3FMFA 4B79A 2E4VA 3G23A 2I87A 4OXXA 4AUMA 4GDFA 1F8GA 1MJ5A 2WWXA 3MD0A 4NNJA 5BUZA 3VJKA 2HSZA 3FFTA 5AM3A 1E2JA 4K46A 2WTXA 3KB1A 2P9HA 1X7ZB 3CNBA 2EL9A 3RYCA 1FDTA 1LSUA 1K8RA 4ENTA 3F3YA 2PR7A 1GCAA 5KOIA 1HG1A 3TW8A 3I4FA 3D8HA 3RC2A 1CUUA 2PD4A 1X1AA 5A4JA 3SYTA 1TOAA 1Z0SA 2XQIA 3E3OA 3D3QA 3PD0A 2VT3A 4D3YA 4Z7NB 3O1LA 4EZBA 4HQLA 3N2ZB 1SUDA 3DJFA 3SHTA 5JJLA 4F6RB 3KAQA 4YPOA 4ENUA 1DWPA 1XMOB 1JEYB 4H59A 3D59A 2OPBA 1G2QA 3QH4A 2JL1A 2WKQA 3AP3A 4CV2A 1QIHA 2C82A 3A6DA 4PANA 3UMRA 3EQ8A 3H2HA 3QMPA 2I1VB 4IQGA 4AF8A 1RHQA 3DDNA 2FG5A 3C6ZA 2BEUB 3V8QA 1UJ2A 2QM3A 2EGHA 2D7CA 3ENNA 2FSVA 4OBWA 1ZL0A 4RGYA 3BPSA 3HBJA 5DBGA 1B2LA 2G8NA 3CHYA 5CM9C 2CFCA 1YB4A 2P75A 2H2IA 2C5EA 3SEAA 3NDPA 3WOVA 4TTPA 1C3OB 3I05A 4AKEA 4BQIA 1BIFA 1OTXA 2PGJA 4IWXA 2F3UA 5I01A 5HILA 1X1DA 5KYYA 3RIGA 1ULBA 4ECEA 3CVJA 2M9MA 2V7EA 4IDCA 4KH0A 2J8ZA 1Z0DA 3K8YA 4JI7B 3ICWA 3QLUA 3L5KA 5IWAB 2DFLA 4MS1B 3RSHA 2B5WA 1SKYE 3GJ4A 3L3BA 1M8PA 1ZITA 2OXEA 821PA 3VR6D 1TK2A 5FKJA 5HOQA 1EGHA 4ZVPA 3ACCA 3IP1A 4KCGA 1E98A 4IFTA 1IC6A 1SXJD 3J81A 1UXGA 1XMPA 5G0VA 4PGFA 4LF8B 3TIVA 3FI0A 1H1LA 1EM8A 5AOCA 4EG7A 4LJSA 3VOTA 5B6IA 2F1RA 4HB2A 1GKIA 2Q8NA 2YYSA 2PFGA 3HVRA 4ZVNA 2FWBA 4X1IA 4UOZA 3DAPA 1L0BA 1DT3A 3D4IA 4MRNA 2H2WA 1A1VA 1HMPA 1JEOA 2D5IA 1TMGE 1FFSA 4QYMA 5MGBA 3A4MA 4UNIA 1KKLA 2QXUA 3C5EA 3FAZA 3LY9A 3CB2A 5F2KA 1STOA 2B35A 2PSHA 4Y9RA 3T5MA 3UW3A 2XZDA 3WHPA 2G0TA 3EC7A 4G4SP 1KY5A 2ANCA 2K7ZA 3PC7A 4IILA 1WUJS 2P5TB 3DLCA 1DIOB 2F1IA 1YR6A 2YMMA 3KOYA 4R69A 4NMLA 1IHPA 2WYUA 3P7MA 2Q0SA 3KPWA 4FBGA 2CVPA 2HIGA 4ITUA 4J07A 4P8RA 4RDIA 2PA0A 3TLJA 1VIYA 3VYTB 1HXHA 1O97D 5IRCD 2C3PA 2O0HA 3OTHA 3PVSA 2ATEA 2QIOA 2UZIR 5BSRA 2GCGA 4QE3A 4NYIR 1T8YA 5ENDA 5BO5A 1KVRA 1BMDA 3LF2A 1DXYA 4C2TA 1E3MA 1H8EA 1XKQA 3M1LA 1COWD 1DO8A 1UBOS 5LZ2A 1M8KA 2XAUA 4IIJF 1LV8A 2ZPTX 3JRWA 1AKMA 3M4NA 4CLRA 5AVSA 4WZ6A 3X1YA 4CM5A 5H80A 1V4BA 4JYAB 1MX5A 1FNBA 2F4NA 4H7KA 3W6ZA 3E8XA 2ZRQA 3RC7A 4YX9A 4BE4A 1NW5A 3HRKA 5I8ZA 5A4MS 1CR0A 1KO4A 4CLOA 3V7FA 2W6NA 3AUJB 3D7KA 3K9CA 3GFPA 4PC1A 1NOJA 3Q0IA 3A7EA 4KITB 2YV4A 4D42A 1V1MA 2V4ZA 1NBAA 4X1KB 3TZ6A 4UXHA 4LZLA 3IDSA 4EGJA 2YW2A 2J0QA 2EKQA 1M0WA 1FJXA 2V55B 3WHIA 4BVHA 1UKAA 5CVDA 4B5KA 4RCZA 4JMLA 1ECJA 2AOUA 2FEMA 1QHNA 1U3GA 2DUJA 1TM1E 2HJHA 3EPKA 1WJGA 2VLIA 1MW9X 4Y2QA 1VBFA 1F0YA 3VR5D 1XTQA 3V7UA 4LWOA 3AR7A 2J0VA 4DSNA 3GPDG 1ONOA 2EFGA 2A9RA 3EGXA 2GS9A 5CAEA 2G71A 1UKEA 1IY2A 1BXZA 1SG0A 2ZYAA 3ABQB 3HKDB 3MMXA 4QAJA 4QXMA 1D07A 4WCFB 1GILA 3SMQA 2BTOA 2BJVA 1BXRB 1UUFA 2YJ3A 3FTPA 3ZCTA 3MK31 4Y7DA 3F5QA 2QRMA 1TYAE 4BNTA 1VHDA 4JWKA 5CLHA 1W4AA 4ND4A 3DBRB 1UFKA 3IUBA 4EENA 3KT0A 3FCEA 3N2LA 5DTMA 5EP3A 5FTNA 4E1VA 4GVLA 3C0KA 3BAFA 1WZIA 1Y7PA 4PNZA 3N3AC 1ORHA 2VTEA 4BLVA 5CXQA 1HSZA 4RY0A 4UEKA 4HDKA 4K87A 4HZUB 3TNYA 4PYQA 4MGYR 5JYDA 4HWOA 3AY7A 3OI7A 1JE1A 4UAJA 5GV8A 2RHBA 3PQ8A 4K86A 4GYKA 5HP4A 2VP3A 1ES9A 3VV2A 1K2VN 3O8OA 4NPHA 3UNXA 1M6VB 3FOWA 4TZ6A 4TKUA 5ALLA 4JBLA 1T9KA 3V1NA 1B6SA 2ZI6A 3TL3A 4M7OA 1KMHA 4WASA 2ONZA 5A9TA 1XRRA 1IN7A 3OJLA 5DX8A 3OY2A 3WNBA 2DU8A 1IUNA 4ALLA 2Z57A 1FU7A 4C6TA 1KZ9A 2ACKA 1FP7A 1W1WA 1H05A 2DF8A 1U90A 3MUFA 4UMDA 2QPOA 4V0LA 2P4HX 4Q1DA 5HKOA 1HA3A 1QQ7A 5IBPA 5HOEA 4DREA 2BFWA 5MHTA 4EX6A 3IUYA 3HVHA 3RIHA 4AMBA 1XF9A 3GH3A 4ENWA 1ATZA 3IIMA 3MMNA 4KYUA 1MVNA 3KOWA 5FOTA 4I5GA 4P0PB 1M67A 4MUMA 1TEHA 3U4MA 3R3WA 2AL7A 1R88A 4YRTA 2JFXA 2WWWA 3TVDA 3ADKA 5F3RA 2CE2X 4Q16A 4EYOA 1ITZA 1Z68A 5LQDA 4WCFC 2NNLD 4Z2YA 1W96A 3SAJA 1VPEA 3FNEA 1RWBA 4O2AA 5ECGC 4JC8A 5CX4A 3ZLUA 1QC5A 4RHTA 5JNRA 3WIEA 4IHQA 1BTOA 5JU6A 3RNOA 1AV6A 3ZDZB 1N3YA 4HGOA 4DMUB 2G36A 4CR6A 3VU1A 3F7NA 4JGIA 2Z9DA 5BW8A 4DR2B 1LY1A 1GL7A 3TKLA 1G2OA 1ST3A 4JEIA 4U02A 4PX3A 4RA6A 3TE7A 3MS4A 4OREX 4UTRA 2VSOA 1DXQA 4QYIA 5DNWA 3R7SA 4IJVA 1YNSA 3C6KA 4ZVLA 3QITA 4B7XA 3DBHA 3HUDA 1N2ZA 1GT6A 1JWLA 4C1BA 1CF2O 3IDZA 3R41A 1KVSA 1Y9DA 3GYGA 4PZDA 5IF3A 2VNSA 3WL4A 2QUHA 3M5DA 4RVCA 5DIFA 4JI2B 2WUEA 1RU3A 2FJPA 4P4SA 3O0DA 3WGGA 4WIAA 3KT6A 1KK3A 3RRXA 1E7MA 2HDWA 1BHQ1 4N0QA 4RJTA 4KXWA 4CEIA 1MABA 2ZJ3A 1LCIA 1MV5A 3MILA 4M0EA 3N28A 5KSPA 4D1YA 5JDCA 3FOZA 3SHVA 3RT1A 3O8CA 3WZLA 5LLSA 2V8OA 4YP5A 4A0HA 1Z06A 4EW2A 1Z5WA 1V7CA 4C4TA 3KXPA 3IOEA 3USCS 4OQ4A 3ZYCA 1A88A 1U80A 1XCBA 2FPSA 4Y0NA 1Q14A 4E5UA 2ZUUA 2IPLA 3N8IA 3A6PC 2CFIA 3IGFA 5DK6A 2QSYA 3G6WA 1OSNA 5DSXA 4ZXFA 2OB1A 1DV1A 5B53A 2A1IA 3SQDA 3LBYA 2X7XA 1Z0ZA 2ECOA 1XVIA 1YDEA 4JKOA 1JHYA 4KC0A 4Q3NA 2YASA 3L82B 4XPZA 4M1OA 2CNBA 5ITSA 5B2FA 2HSDA 2IF0A 1OLUB 3LQRA 4CT5A 1DEXA 4RV5A 2H1FA 3T3IA 3ZLJA 2DR0A 2WSIA 4YCDA 3I42A 4KKXB 3D9QX 1EVYA 2NYRA 2X40A 4NY1A 1WZCA 1G5FA 2PGDA 5LA6B 4EP1A 2FPPA 3U3JA 4BXOA 4YXWD 4LYDA 1NOKA 2XMBA 3U37A 4O4JA 4EO4A 1L7MA 3RVQA 4REQA 3FKQA 4JYBA 2RKWA 1KY4A 4R7GA 3V4FA 2BHLA 1RIIA 4OLBA 4EOGA 2AEFA 1N2XA 3QWFA 1S1CA 2Q50A 4GMGA 4L74A 1E69A 3ZDRA 1J25A 2C7PA 2VYCA 1P29A 2DWQA 2EX0A 5EZSA 3DULA 4BVGA 3EXFB 3TSWA 1CR6A 4WZBB 3JZDA 1BYUA 1U94A 4KXYA 3WOHA 1AB6A 1G20E 3M49A 4UOEA 2AFIE 1SUFA 1U0NA 4QFMA 1IEXA 2WAMA 3ELYA 3NTVA 1VJ0A 1RC8A 1LD3A 2A1TS 2IPNA 4ZO7A 5CDFA 4ZK6A 4DIUA 1J2UA 1DEHA 5ILQA 3RYHB 3H5RA 1RYHA 3EMKA 2OQVA 4EW1A 3FTFA 1XVLA 2FFRA 3NVMB 3ZW9A 1KR2A 1ZH4A 3HZRA 3QF4A 4A91A 5EYPA 3DC7A 5JVDB 1G21B 3WYFA 4CIDA 1XA3A 3BHNA 5E3IA 4E51A 3ZOKA 2E4UA 1QJ4A 2JZOA 2PO7A 1PV1A 5HXAA 2R6AA 1FTWA 3V4OA 2FUNB 4HLCA 1S2LA 2PX6A 4B6RA 1KI4A 4RTSA 4RMJA 4ITRC 1C50A 4F85A 3F47A 3K70D 4BDSA 3GX1A 3A1FA 4MQ5A 4ZGBA 4O63O 3FCYA 2QRPA 3FTCA 3PUJA 1GNQA 3T0FA 2YFYA 1NP7A 4PZLA 3IO5A 2IYNA 1VMDA 5G2OA 4B3SB 1FLAA 2OKCA 1M5RA 1XCGB 3FWNA 4J75A 5F7ZA 3OCYA 4WXHA 5EIOA 1TJ3A 3CX3A 3ND8A 4JDPA 2XZTA 4OBBA 3BIOA 3OEWA 3V34A 2XOKD 3UJNA 1OIVA 5CJ2A 1DPGA 2BBWA 1Z6ZA 3EFEA 3L1HA 3NVAA 4LHZA 3TQRA 3SX4A 3JAMA 1QFMA 2R1ZA 3DFZA 5JLAA 3WI7A 2YKGA 4TV9B 1T1JA 1WZUA 3KBBA 3ZHVA 1UAYA 2WPNA 1G8JA 2ISCA 2N9UA 3PDIA 4F60A 2DT8A 2IEBA 4ZV9A 1Y4SA 2AQHA 4QYWA 3G68A 2P9ZA 3ZWKA 1H0RA 1PWEA 3BA6A 4ZZIA 4IJMA 4NENB 3D6MA 4M83A 4FD3A 1Y1TA 1G18A 2L18A 5K7SA 3GLHB 3OOYA 2PS0A 3STUA 1EHIA 3ICQB 2OCIA 2ZJ5A 2YC2C 1RHRA 1ACMA 1WB5A 5LQMA 1R0CA 3DE2X 5FTJA 5KVSA 2QTMA 1MAHA 3LVQE 1P62B 2OHVA 2EKLA 1FYEA 2GZRA 1VL1A 1I1HA 2R4UA 4ZYXA 4US2R 3OY7A 4DDTA 4HQOA 4RK4A 4RTPA 2RHMA 4RXMA 4UTXA 3JQ8A 1S89A 2OXCA 2BGWA 3BDAA 2YICA 3CZPA 5ALSA 2DFKB 4HWRA 2ZAYA 3KE9A 3IJ5A 1M0TA 1MIHA 3KXIA 2IY7A 2JH9A 3H42B 3HR7A 3IT3A 4Y9TA 1SBCA 1AHNA 5DEIA 5EWJB 3L7YA 2WJ6A 4RY9A 2CDNA 3GQVA 3W6NA 4CM3A 1BD4A 4XWOA 3AESB 1FLDA 2DT5A 2HXYA 3DBIA 2PO5A 2CE7A 4X95A 3EMDA 4PBRA 4DUGD 2OP1A 2JCGA 5TMEA 2H63A 3DHWC 4IYJA 3WLRA 3L0SA 2R79A 4R0MA 5LOVF 1P7CA 1WETA 3Q41A 3PQCA 4RHFA 3MSXA 2COEA 2W9XA 1K08A 3D6UA 2RARA 4QBHA 3RC1A 5MN5A 1C9KA 4A8JA 4BQNA 1T25A 1GQ2A 4DAEA 3LBHA 3A3OA 1VHQA 3U09A 3H8WA 3KJQA 4M7PA 1KEPA 3S6JA 5LLDA 1Z5PA 3QXJA 1BU5A 3L8EA 2IXAA 3MLBA 5KVAA 1QHSA 1RWVA 1Y63A 1ZGGA 3Q7IA 4FJ2A 1FFCA 3OOEA 1M0EA 1DT5A 1C1HA 3OZCA 3PA8A 4KNWA 1P0PA 3QBDA 1Z6TA 3GXBA 1U9IA 2NUAB 4ZJUA 4WINA 2JLUA 2IDZA 3GGOA 3K2IA 4Y98A 3G2IA 4YWHA 4KV7A 2SCUB 3KE8A 5G3ZA 3AH8A 5LDHA 3UMMA 2NLOA 3C7AA 1OBFO 3PPXA 4GPTA 3OJCA 2WILA 3VHQA 1FRZA 3EXG2 3GEEA 1G8FA 3AF1A 1LLFA 4I2NA 2N75A 3OT5A 2WDPA 3RJ9A 2NT4A 3V2GA 2XVZA 3CRRA 4PYRA 4YCNA 4HI0E 4LE0A 5JCZA 4C14A 2FX5A 1ZO8A 3LX5A 3ZIAD 2H52A 2J9ZB 2Y0PA 4GOOD 4P54A 1JVBA 2DFTA 3JQEA 2VYND 1PGPA 4JEHA 4NOKA 4PHTA 4B4KA 1X7HA 4U1RA 4V0ME 4LVNA 4BO5A 1ADBA 1FYDA 3KB2A 1EFAA 4IVQA 4Q9IA 3KXLA 1HT3A 1EQUA 3CVOA 3Q8XB 5K0EA 4X92A 1OZGA 3LGSA 1I1OA 3R3JA 4JBIA 3MC1A 2I76A 4EQ6A 5FWXA 1PL7A 1C41A 4YCLA 2PUVA 3U2QA 2ICAA 4RMNA 3A2MA 1A72A 1J70A 1G9SA 1LBIA 4NHEA 3VTAA 3KQUA 1M2GA 1YBMA 3CCFA 4E33A 3CVXA 4TLLB 2WOJA 3CSUA 4JWTA 2JD1A 4XGIA 2NSHA 1EINA 3O2QB 4GI1A 5BSKA 4BYGA 2I66A 1X77A 3KU1A 5ALWA 4CCWA 3IOCA 2Y0DA 3NO4A 1UPBA 2C8VA 2JKVA 3QTBA 2NSJA 2I22A 2A78A 2BDUA 5EE3A 4DBVO 5IM4F 2OESA 1T6BY 1EDOA 1TVEA 2ZAOA 4WKNA 2XWJI 3WRXA 2UYOA 4EATA 1L7DA 5EHGA 2QK4A 4W5NA 1UEJA 1D9XA 2CXRA 2EG9A 4TLDA 3HHPA 3ETHA 4GZ3A 4I5IA 2UYGA 2I65A 3B6JA 4BJHB 3ON5A 3TIGA 3PQ5A 3TPFA 3W6OA 5CFOA 3O6VA 3ONEA 3TQSA 1KO1A 1A77A 5C34B 2R00C 4YBZA 5JZOA 1M8FA 2YFHA 5KQGA 1D4ZA 1WSDA 4OL9A 5K0ZA 2I9PA 3HCBA 5J9FA 3A06A 1DJOA 1PG2A 1QPBA 5EP2A 2AD1A 2W58A 4MB2A 4XSHA 3BD9A 2G5TA 4JJGA 4KMOA 1JLSA 2GJ4A 2PYDA 1R9MA 1SOAA 2EKZA 1ZX1A 4K9KA 4MQFB 4MIEA 2PMKA 1EIZA 2V7QD 4GPIB 1DIGA 2H1WA 5TRTA 3SDZA 3THXA 3AETB 3DT8A 5BP7A 3FCAA 5DHAA 4AJJA 2UXDB 4CLHA 3SG0A 1ID1A 1EBBA 1UK8A 2RGYA 1QH1B 3WTBA 4URXR 5KB3A 4YHHB 3ZHQA 1JXQA 1YQ9A 2KW5A 2IBSA 5A06A 4QO8A 4HDSA 2V5VA 1VM6A 4HDQB 3G9ZA 3V9AA 1DC7A 1YJCA 1RWQA 1L9KA 3DVAB 4GI5A 4RVSA 2C57A 3IODA 1NW7A 4OK3A 4A3SA 2X0FA 1C4WA 2G5GX 1O0SA 3LVBA 4CM9A 5F7XA 1NL3A 2OZPA 1L5YA 2ZVDA 2PHZA 3AKYA 3BE6A 3C4JA 3CF0A 4E08A 2OCKA 5K8IA 1TI7A 1B1CA 1JFSA 1KDRA 3EVAA 3OQMA 1THZA 2QYTA 2OGUA 4PQRA 2GWRA 3LT2A 4D6YA 1NNEA 4C4XA 2C2HA 5TVGA 2XNDA 4Z9XA 5CDYA 3K9FC 2WWHA 4INAA 4XAQA 3R3UA 5ALEA 2X4DA 5HTKA 3GLQA 1T8PA 1FVXA 1NZJA 3R0XA 3CH5A 4C7OA 1YR2A 5IVDA 4ZVVA 4AN4A 4ZTUB 3U61B 1M74A 1HBJA 3L06A 4MUBA 2ZULA 4KFUA 1KOGA 4CR8A 3RHZA 4S04A 3HABA 2OM6A 1E2UA 1Y7TA 1ZOPA 3ZYZA 1D2AA 1K7EB 2F64A 3BYZA 4A26A 2AVDA 3ZBQA 1UXKA 1CIJA 1FRVA 3S55A 2L2QA 4TLBA 4KO8A 4QUBA 1JIUA 1PT6A 1W19A 4ZT5A 1H2ZA 2HREA 2WZQA 4G36A 3S4YA 3TZQA 3I9V6 4JUIA 4HK4A 5HCIA 3W90A 4CQJA 3HJNA 4UEWA 4UREA 4UQPA 5EQTA 5TXGA 3R44A 5C8YA 3OPYA 1WBBA 1LBTA 4O59O 1ZR4A 2FPOA 3U9SA 1BOOA 4EH1A 2DPHA 5AQ1A 3HCRA 4YRZA 2QT9A 1K9SA 3W5SA 4RX1A 4PXYA 2Q2OA 3MRXA 5FULA 1YS6A 3GJRA 2ZCUA 3GFTA 3ST7A 2PL1A 2F59A 5J5VA 1E4YA 4BGDA 3NBYC 4C0QC 5A5FA 4NYJR 3JASA 4TS3A 1GQOA 5D3MA 3V4VB 2C4WA 2MYUA 4E5MA 3V46A 1W93A 1P18A 5EHIA 3SPXA 3STXA 4PQEA 4TT3D 4DDWA 3NS7A 4G0PA 1OAAA 2GAOA 3HRHA 4KU4A 4OJKA 3GGJA 1IONA 3I2GA 4A92A 2F3RA 3AFGA 3T5GA 2EJVA 1A95A 2FE1A 3NEAA 4JVLA 2P6NA 2IPOA 1RIFA 1N4AA 3PXEA 4RH3A 1EXVA 3U81A 3ZY2A 1DKNA 2JA1A 5DOZA 3WMXA 5HIJA 2AYZA 2PKXA 3KNZA 5ES4B 2CJFA 2Q07A 3U44B 4MIKA 1JL3A 4AZ3B 2R6ZA 4JBGA 1Q0LA 2O52A 2PZJA 2FKAA 2HU8A 1FTGA 4KI0A 3KAPA 3HY6A 2XOEA 3MGAA 2Y0CA 3Q0TA 4DYHA 3OZSA 1A3CA 1XD2B 3H2GA 2XGOA 3ZU5A 1VKZA 5IK2D 2GYYA 4IIXA 3ZV7A 2PD6A 4BUJA 4BP3A 1UQTA 4D9JA 5BN4A 2FSHA 1K5PA 2O0MA 2CVQA 3P9YA 3R3YA 1CYDA 5AVZA 5IAEA 4UE2A 1DC6A 1E96A 3EARA 1DG9A 3OZBA 3U1BA 5D84A 2BGJA 1II9A 2G1UA 4B8ZA 1J8YF 4ZMBA 4ARVA 4MUGA 5BYKA 1NFFA 3GZJA 3QEMB 3BGWA 3NHSA 4G1FA 4RJKA 4JP2A 5ICGA 1YZ3A 2B8JA 4G09A 1T8RA 1W34A 2W8BB 3AUTA 2IH2A 2FUG6 1JBQA 4I81A 2JH3A 5ESXA 3FTEA 1YBAA 1K6IA 2P5YA 1UBEA 1ZNYA 2YIDA 5ULLA 5BMVF 2WTUA 4WV3A 2BBTA 2F7SA 2GDJA 4MCHA 4CMCA 1I5RA 3GLTA 3ILVA 1I0ZA 4MVJH 2HZBA 4PYKA 4BMYA 2JDID 4C1NA 1RWPA 3PNVA 4FE4A 3FSRA 5EESA 3R23A 4DDUA 2ZATA 1LRLA 2FSGA 2IS6A 5F1PA 3LUAA 1G5HA 2NU9B 4K28A 5FPTA 3W06A 2FWAA 1NLMA 1R3DA 1B73A 1D0SA 1RKBA 3B9PA 2P0AA 4FFWA 4WBNA 3B6IA 5C9ZA 1PLLA 3RAFC 3UWPA 1U11A 3A9CA 1RKXA 3H17A 4IKOA 3FRHA 4N3GA 3KYDB 8ATCA 3OTIA 4DSTA 3KV1A 1GTL1 1XZGA 2HBYA 3R8XA 2IH4A 5JR3A 3FFWA 1ADFA 3CS3A 3UCXA 3HLKA 4OBXA 4NNPA 1UKCA 3IT0A 3P32A 4PC2A 2FXIA 3TJRA 4DR6B 3A05A 3DS8A 3N5KA 1OXTA 4JLWA 4MKIA 5A3SA 4QELA 2GKGA 5KJCA 4Y6RA 1ZBQA 3D8UA 1ND6A 1TIBA 1CP2A 1RPNA 4MKGA 1YI8A 4LXHA 4E6PA 1GTMA 4PNEA 1LNZA 2ZYDA 4KGVA 1VBNA 1IRIA 1W2HA 3NYWA 4D5EA 1BCSB 3U17A 1K2WA 5KNBH 3T3PB 1KFKB 4WXEA 1FJGB 1U63A 1WCIA 5F3DA 2IEGA 3FNGA 3Q40A 1GKLA 2AZDA 4RANA 4DEYA 3P9IA 3IP7A 2CNOA 5KMGB 1IM8A 3QEJA 3DDZX 4GUDA 4BGEA 2Z8YM 2AW5A 1N9KA 2C9CA 2A4MA 2RKBA 4UMFA 2PPLA 4P38A 3PE6A 1NUHA 4RGVA 4C7BA 3OICA 1GLVA 1DBRA 1PS0A 4F04A 4FR5A 4BVEA 2YYAA 3ZXIA 3BFJA 4DABA 2OXRA 1NYLA 3DEJA 1T0BA 1SCKA 3M9WA 3ABZA 1II8B 1NYTA 4KQFA 4NZYA 5JH7F 1X80B 2AC7A 1T5OA 1JKJB 4EHJA 2QX4A 3I6MA 1JHRA 1OPRA 1P9RA 1ZHFA 2VWPA 4GICA 1MOQA 4ONEA 4S1OA 5FOSA 3DKVA 4A2PA 3PFFA 5A3QA 4GBJA 4FUTA 4KXLA 4RK0A 5BR8B 1Z5GA 4ADSG 5H9WA 2NYUA 5IBCA 4DLVA 5LLTA 3GMTA 1I51A 5I7EA 4HQ0A 4MS3B 2B99A 5CCBA 1NN5A 3C16C 4NTZA 3EA5A 1MG5A 3EZLA 4Q93A 3B85A 4A2QA 1K75A 3WBFA 3S5UA 3B1XA 5BWCA 1K3TA 1N9GB 3BXHA 4P36A 2IOYA 3OPYI 4HADA 5HJ2A 3D0QA 2WHPA 4DIEA 4H1WA 5L7WA 2OHXA 4G0UA 3BB3A 4GH5A 4ZOLB 1YVEI 3MCTA 1N5DA 3NTOA 1NYQA 2OVFA 3WWYA 3DFUA 3ICOA 4YFVA 4DLXA 1OA0A 4NJOA 1UIRA 1WVMA 3FCXA 1JH9A 4G4GA 4L6IA 1A7UA 5B1SA 2Z3WA 5JYEA 4PSCA 1ZIOA 1JI0A 1RAAA 1QYWA 3I9OA 4RQUA 2OT3B 4DCPA 4FEAA 4C7VA 1SQ6A 1DL5A 1GY8A 1L5ZA 2AFHE 1ZKDA 5AK3A 4HD8A 4CF6A 5KYUA 4O4HB 1MQ8B 2LCFA 5LBTA 4K0KB 3ESXA 4H4EA 4I55F 3H5TA 1L6IA 3O83A 3HYNA 3TDMA 3FBGA 3LUDA 2B5VA 4RJ2A 5B36A 1VL5A 4B3RB 1EYZA 1TT5A 5B6PA 1L1EA 3TR0A 4BMOB 2X19A 1JBEA 1CJVC 2Q2WA 4B4UA 1YKSA 1T2VA 4NE7A 3OT1B 2R48A 5DISB 1KE2A 3EK2A 4LRYA 5AMXA 3R09A 1MT0A 3HDHA 3KSUA 2Q3BA 3LY5A 5M3BA 4YRGA 3O1JC 5BVGA 2IIVA 4CDRA 4OJTA 3HG7A 4WA7A 3W2TA 1IATA 1TIPA 1U1DA 1O5IA 2BFDB 5BQ3A 1G8SA 5BMOA 5M2QA 4NONA 2APJA 2VP2A 1Z45A 3GZ4A 3Q4GA 3HGQA 4HMOA 4R54A 2I29A 3RSOA 5HQTA 4RTNA 4QUIA 1KNQA 5FBHA 2O1EA 1OFTA 1BO6A 1CDEA 1PLKA 1R9NA 2HTEA 5CGZA 2FG6C 1Z47A 2K4MA 1WY7A 2P6PA 4N6OA 3DOFA 2JGDA 1KO7A 2AZTA 2H07A 5KJFA 1JTEA 3PCRB 5HQ3B 4CMEA 4FGZA 4EYEA 5B57C 4X1YA 3ZU3A 4HTFA 5JSZB 1XD9A 1NDQA 1UBSB 2R6JA 3ZK7A 2O8FB 3UXHA 4M9UA 3WWEA 1PNQA 1YCHA 2QN8A 4BO8A 1GCOA 3RROA 3TRFA 3C2QA 3CRNA 3K09C 3N8KA 4WXPA 1GLNA 2XEXA 4YCBA 4BS9A 4DWWA 4N76A 1UK7A 3CF4A 1VYVA 5BVHB 2J6CA 2JLXA 2W11A 4W6QA 1OMOA 3DV0A 2ONKA 2XT6A 4QREA 2R1VA 1QFJA 2JFBA 1FFDA 3P9KA 1LDEA 3U4HA 4D82A 2RIPA 2V5AA 2A35A 5ICMA 1NPYA 5CBPB 1XL1A 1P2FA 6GPBA 3H9GA 2XRZA 1ZD8A 2SECE 2Q5JA 4WN9B 1E7WA 5B3JA 3AEKA 3GGDA 5JCPA 2OB2A 4DTCA 3HPQA 5TPWB 3IP8A 4AJHA 1I6MA 4HYQA 3AKDA 5BQFA 5C8ZA 1NQXA 3Q6NA 4MI1A 5REQA 1RJEA 4NOMA 4TWRA 1AQYA 5CDTA 1P9OA 2XXBA 4GG1A 1O4VA 2BKLA 3EOBI 5FAXA 3K5WA 4LYJA 3HBLA 4DPKA 4J2HA 4QGFA 3OMWA 5DLPA 3UKOA 1CJTC 4XTCS 1ZW6A 3NHZA 3HN7A 3IS3A 3BAZA 3FMGA 1PE0A 1THMA 4B3CA 4EYSA 3OJWA 4TV8B 2Y67A 4X6XA 2ZUVA 5ERXA 3JQ9A 4GP9A 1QDLB 3GBPA 3IOMA 3KYCB 5EWLB 4M9RA 4A73A 3Q88A 4UDYX 2PAFA 1R9JA 3DE4X 4OJMX 4J6FA 2OHGA 1Z15A 2QPTA 3ANNA 5LIRA 2QVBA 4HXEB 1E2IA 4PIVA 1ZOLA 3LLVA 4BVBA 3TTSA 4Y2PA 1USIA 4ETWA 2IDMA 3Q2IA 4WKGA 1ADGA 3D5TA 3IIIA 4RO0A 1X42A 1G9TA 1R74A 4Y1EA 1BG6A 3TMKA 3U4DA 3MCZA 1ZK3A 3H0CA 5IVPA 1WKCA 4I5FA 4TWJA 5K3SA 4J43A 3EVDA 2GN8A 3ZTWA 4LF7B 4FXOA 1REQA 4AY2A 2V7WA 4ZAVA 1YH3A 3FCSB 3ZZMA 2AR0A 1LLDA 4HPJB 3HM2A 2GPJA 1T9GR 3LQFA 3RUAA 4KBFA 1Z4LA 4DV2B 1EUQA 2Z8YA 3T5TA 4UCQA 1USWA 5LSAA 2X22A 3DH0A 3N58A 3QWHA 3LA6A 3A36A 4H3VA 1WQ3A 4KSYA 3LDGA 4L5IA 5DGDA 3WISA 3AZPA 3A2KA 2Y76A 2Z1NA 4BKPA 1P0QA 3GWGA 1FRQA 4DEXA 4JVNA 1E1DA 2VYQA 5K0TA 4OLFA 5KSYA 2KJQA 1M75A 2RBGA 2I99A 1ATIA 3IEPA 3ROTA 3R7DA 2XBLA 4B6PA 5FAKA 3EMBA 4Z3OA 2IYEA 4O6VA 4M9XA 3OLVA 2WU1A 4NU6A 2G9ZA 4UDNA 1PJAA 3MAAC 2E21A 3NUZA 1FYWA 4S12A 2F1JA 3ZGVA 3ZCUA 2F1KA 4UZEA 3MQ2A 4YC7A 5ECYA 1XKTA 3SE0A 2ZRNA 1XEAA 4QICA 4PX5A 2B6HA 1UM9B 1Q95A 121PA 2JB9A 3AKCA 5EFZA 1MGOA 4KWHA 3EH2A 2CLEB 1FBNA 2HPZA 1GRVA 2QL9A 2W4QA 3CF2A 3I1FA 3KQQA 4PHGA 1JDTA 1Q3HA 2QU7A 4P0QB 2V74B 1ZOIA 2E5WA 2EC5A 5DM1A 2ZRCA 5AXBA 3STTA 4WOKA 2G1PA 2QKYA 3MM4A 4DS3A 4R5MA 3TZCA 1MH1A 1ODCA 2GZ1A 3KT8A 2VPWA 4I0WB 3SIPA 2Z2IA 5BV1A 2D5LA 4QAQA 4XUEA 3RJTA 2VYVA 3O2SB 1E5XA 3CX6A 2AMYA 3QV2A 3F8TA 4Z8XA 5EE0A 4QQKA 2D8AA 4MRPA 4DCJA 5LYYA 4TS9A 4PLCA 3ZEAA 5B1YA 2C7GA 5KQPA 4MYUA 4WK0B 3TNFA 3GO4A 1ISIA 2RGXA 1OLSB 2A9QA 5GZ1A 2Z6VA 3LG2A 5IKEA 5EJ9A 3RFCA 1JPNA 1M2FA 2BMJA 3PLNA 3BCSA 3CWQA 2YHIA 2I6TA 4QBFA 2CLIB 3OCZA 4P58A 5T5QA 2VQ6A 4HWPA 1BRMA 1GITA 1RYYA 3R0IA 3WWPA 4QU0A 4P34A 3R6GA 3PFGA 4KAAA 1TAGA 1SZPA 4ZKEA 2D2XA 4EGCB 2REQA 2F3QA 2ZT8A 3K0AB 3M1YA 1T2DA 1UIMA 4CUJA 1JPUA 3A3YA 4EYQA 3VKGA 2IX9A 2XB2A 5MFPA 3DBLA 1TAHA 1ORDA 3PDUA 3ZZNA 4QLBA 2AC2A 1EVZA 1WB6A 1LDMA 2PKWA 3OD5A 1UFVA 1XCOA 3FOAA 3TI9A 3E82A 4GI7A 2C9YA 4Q6WA 5KC8A 2XNDD 1XQ6A 4FC6A 5E3HA 2QL5A 2ZUSA 1M2OB 4J0IA 4LMBA 1EQAA 2QT1A 4XWYA 2HH9A 3I8XA 3E5MA 1J2TA 1T43A 2WF8A 1OLOA 4ZN6A