4TWBA

Sulfolobus solfataricus ribose-phosphate pyrophosphokinase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
291
structure length
278
Chain Sequence
b'MIIIGGSATNGIDESLSKILSIPLVKVENKIFPDGESYIRVPSSIRDEEVLLVQTTDYPQDKHLIELFLIAETIRDLGAKKLTAIVPYLAYSRQDRRFKDGEAISIKTILHILSEVGVNTLVVVEPHKPEELSYFKGELKIVHPYHQIARKIKEIIEDPFILAPDRGALDRARKIAEEINAPYSYIEKERNINLKGKDVVIIDDIISTGGTIVQATRLAYSLGAKSVTAAAIHLLLVGGAKERLREVGVKTLIGTNTINVNDKDIITIDVSQSIALSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase
molecule tags Transferase
source organism Sulfolobus solfataricus
publication title Structure of dimeric, recombinant Sulfolobus solfataricus phosphoribosyl diphosphate synthase: a bent dimer defining the adenine specificity of the substrate ATP.
pubmed doi rcsb
total genus 93
structure length 278
sequence length 291
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4twbA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4twbA02
1I14A 4LZNA 4RV4A 3ACDA 4PFQA 1QCDA 1UPUA 4RHTA 1P17A 4P84A 5ESXA 4LYGA 4P83A 4F8EA 1Y0BA 1ECBA 4X44A 4X45A 1G2QA 1L1QA 1I0IA 3QW4B 3DAHA 1U9ZA 3GGJA 1NONA 5HIAA 4WMLA 3EFHA 1J7JA 5BRNA 1OPRA 2FXVA 1GRVA 5IAOA 1G9TA 1UFRA 5ESWA 3H83A 1GPH1 3OZGA 2H08A 1XZNA 3KB8A 3GEPA 1A4XA 1MZVA 1QK4A 4FYMA 1G2PA 1Z7GA 1AO0A 1ECFA 1STOA 2IGBA 1FSGA 3MJDA 1DKRA 1I5EA 1DQPA 5IPFA 1JLSA 2JKZA 4RABA 1A98A 1DBRA 1XTVA 2XBUA 4WN3A 1P19A 4S2UA 1OROA 1QCCA 3M3HA 3ACCA 2GEBA 1O57A 1PZMA 5KAMA 1P4AA 1VCHA 1D6NA 1ZN7A 4RADA 1R3UA 1XTTA 3LPNA 5BQPA 1WD5A 1OREA 1ZN9A 2P1ZA 3GGCA 4Z1OA 4M0KA 1O5OA 4QYIB 1A95A 2PRZA 4JLSA 4RAQA 2EHJA 1NULA 1YFZA 4RQAA 2DY0A 4OHCA 4RHYA 3HVUA 1JLRA 1A3CA 1L1RA 4RAOA 2H06A 1QK3A 4P81A 5EUCA 1IBSA 4JITA 1TC2A 4P3KA 3LRTA 2YZKA 5KAPA 1W30A 4QRIA 1XZ8A 1V9SA 4M0UA 4P80A 5E38A 3N2LA 1BD4A 1QB7A 4M0PA 4QYIA 1ECCA 1QK5A 2JI4A 3DEZA 3MBIA 3OZFA 4LZAA 4P82A 4MB6A 1DQNA 2VFAA 1A96A 1G9SA 1BZYA 1ECJA 4ZFNA 1TC1A 5JSQA 4RHUA 3S5JA 4RHXA 4RANA 1ECGA 4IJQA 1CJBA 3G6WA 1BD3A 1HGXA 1ZN8A 1A97A 2C4KA 3NAGA 1VSTA 2JKYA 1P18A 5HKLA 5K51A 1VDMA 1LH0A 4PAWA 4LZOA 1XTUA 3ACBA 2JBHA 2AEEA 4KN6A 2H07A 4LYYA 5JV5A 2PS1A 3OHPA 1QB8A 1I0LA 1UPFA 5BSKA 3DMPA 1U9YA 3O7MA 2PRYA 1DKUA 2E55A 4P86A 4TWBA 1HMPA 2WNSA 4RQBA 4RACA 2HCRA 1I13A 5BQOA
chains in the Genus database with same CATH superfamily
1ZRSA 3IIEA 4RYDA 5TIIA 2VKTA 1DAHA 5AW0A 1GGJA 1XUOA 3ETNA 3ICOA 4Z86A 5JLAA 5CA0A 3AG5A 2RHMA 1UPUA 2J3JA 3LQ2A 4P0TA 2EJUA 1DG1G 4JLAA 1TMYA 1DIGA 2CJFA 3V2IA 3QM1A 5KWVA 2LCFA 4G5SA 4ZO9A 3IA2A 4NATA 3LLVA 4FSHA 1E3WA 5EE5B 4JC4A 1NYQA 2DSTA 3AZPA 4YJGA 3DR5A 1GG2A 1WB4A 1KARA 1T2DA 2C2YA 3QFFA 4RFSB 4TL7A 3G0GA 3U4CA 3LLSA 1E99A 1B41A 3R4VA 5JASA 1NUHA 3VC1A 1W0CA 2ZUBA 5JNVA 4XIIA 3C15C 3I32A 3SBOA 2RGBA 2ZYDA 4EPXA 4R4JA 3ZCTA 3EQ9A 2R0QC 4B34A 3F78A 3WQQA 3FBGA 3OEHD 4EQ6A 2WM9B 3ZDEA 5BW5A 4YQFA 1L4MA 1ZJ4A 2J3KA 1O6GA 2XVAA 3O26A 4PYNA 1RM5A 3H17A 1DRUA 3L6UA 5EMLA 1AS0A 3EMKA 2QTAA 3ACCA 2QZZA 3GUHA 3R3HA 1ODLA 3FYSA 2R6DA 3UWMA 2C98A 1G5TA 5H3HA 2EVWX 5H8WA 2Q4BA 3M4XA 3AF3A 4BRUA 4HUTA 2CLOB 1A9XA 1R0YA 3JVDA 1NATA 4GLBA 4CHTA 5DNDA 1PG0A 2WSIA 4RXTA 1QMPA 3MF4A 4H31A 2V4MA 4NVRA 3ABZA 1LF5A 1EGHA 1Y5MA 4WL0A 4ZOEA 5F76A 3AYZB 3Q6NA 4QXMA 1G291 4L27A 3K70B 5I9BA 3KL4A 5CFZA 1JI0A 4O8CA 3IODA 1D0IA 1BKDR 3GFOA 3PQDA 4G81A 1KU0A 4PAQA 2PUCA 3B1WA 5L7TA 4MVJP 1H1DA 3TINA 2OG2A 1JTFA 5K3SA 3TBHA 3K96A 3PC6A 3EPLA 1OASA 5FAKA 4JELA 2A1TS 4B3RB 1AXRA 3NCHA 5JIBA 4FMDF 4EHIA 4E1BA 3CY6A 3RUPA 3DEZA 1IOWA 2DTXA 2RBEA 4Q7MB 5DX1A 3L79A 3VC3A 3VZQA 4CLEA 5EPOA 3SM3A 3UMMA 3X43A 2EJVA 2OESA 2PGDA 1MAWA 3IQEA 4MCIA 4Z2YA 1E3IA 2JI9A 3GLGB 2TMDA 3DKIA 1RJ9A 2RHRA 3D2LA 1I8TA 1ZVJA 2OV8A 3IBYA 2EL9A 4M88A 4IYRA 1RACA 5DLQC 3L05A 4YRDA 1NWHA 4D3XA 2RC6A 3ESDA 1U0JA 3ZV7A 5D1NA 1A1VA 1OXUA 5CCXA 3PUXA 2VDMB 5BMVA 1YI8A 2W0SA 2HBYA 3GA5A 4TL6A 1BMTA 1M34B 4R71A 4JOQA 3GJ8A 5FJIA 2VAMA 3WWPA 4FKBA 4DSOA 2HLHA 1DEKA 1PDWA 3QW2A 4FDMA 3EW7A 2C04A 3LBNA 4PQGA 1BW9B 2KM1A 2VTDA 2WQ6A 1P1IA 2W2OA 1K8RA 2EZ4A 2FI1A 4X54A 1M34A 2XF8A 3CLUC 3NEYA 5DYGA 4J3FA 3CG4A 1IEXA 5KYXA 3ZIAD 4DC0A 3T41A 1G8FA 4JGBA 3O8DA 5AM4A 5DYWA 2IS1A 5D6OA 3L9WA 1Q0QA 1Q6ZA 5DTQA 3JYPA 3A2MA 3QBTA 3BZUA 4YMUA 5A2GA 2PIAA 4BMZA 1RTKA 2VWPA 1QVAA 3FPLA 3PNVA 1XA3A 4JL6A 1TUIA 3OLYA 3FYDA 4D8YA 2O8FB 1E0SA 1ADFA 2ZW9A 5IABA 1PEKE 1UBRS 1VLLA 5JCPA 2Q6OA 3VPAA 3U4AA 1UZAA 1PK8A 3EN0A 3LG2A 2BEJA 4W6ZA 4N54A 2BKVA 3EGDA 3SYKA 4I66A 1IC6A 2OUIA 4TLLB 3VZSA 1XROA 1KJIA 2NTEA 4L72A 1OFUX 1YZNA 3ORFA 1M2VA 2ZCVA 3RFFA 4LF7B 2ZTMA 2VF8A 3USZA 3BSWA 5CITA 2WE8A 2AOTB 4U2BA 5A04A 4FMDB 2FWIA 1CY2A 2WDZA 2BI8A 4DFDA 1QR2A 4G0QA 1IWPB 4J16C 1I1NA 5ESDA 2J09A 3HY6A 2GRAA 4WVLA 3RREA 1IHPA 2H65A 3ZV3A 4MGKR 1NQTA 3C16C 5GONF 5E8RA 1VTKA 3VYRB 4FGJA 3QLVC 2JK0A 3E1SA 2G0TA 4NXMB 2I1WA 2DPHA 1PJ3A 3W5DA 3QXXA 2CLSA 5IDXA 3E5RA 1O6FA 1N6PA 2JGDA 2GZAA 3OTWA 3SM9A 3STUA 4HNUA 1ISPA 2QNRA 4H59A 3OCXA 4B84A 2OENG 2W2LA 3H2KA 4Y2RA 4Z9AA 2WSSD 4Q66C 3U09A 1LDMA 1RZRD 7AT1A 4RDHA 2RI1A 3PNQA 5JSZB 4GG1A 3MIZA 1J1ZA 1HKHA 2PTHA 4JLMA 1H66A 2H1VA 3I37X 2X8AA 2V0GA 3EEBA 1C9KA 3T5AA 1LV7A 4YJ2F 1F9EA 4UQOA 1N3LA 1YH3A 1DDOA 1FFSA 1W87A 4TX1A 5JBIA 3ZTYA 2CXQA 5BVGB 5LZ8A 4KXUA 3ZBQA 3B1XA 4LXGA 1ZCFA 3N39C 1O8CA 3WDKA 3ROTA 1FYXA 4GL4A 1CIVA 2ZZKA 3UT0A 4EYKA 1T9GR 2PG3A 3TOSA 1KK0A 4K1LA 3P9RA 2VDWB 3A28A 3OECA 4X1KA 2O2CA 4CMJA 2H5EA 5K3DA 5KQLA 1MAAA 4KLNA 5J5AA 3MRTA 3LK7A 3LQ4A 3LP6A 4ENSA 2I9KA 3CZCA 4A0HA 2GEDA 3MUOA 1GNPA 3D6HA 2FETA 2QXYA 2WTAA 5DYIA 2CVPA 2OXRA 2OK8A 2ZAOA 3N8NA 3RSZA 2XUDA 4KV7A 5T41A 1IAQA 3U31A 1RZUA 1KJYA 3A6FA 3N86A 4CMEA 2R87A 2RIPA 3E3NA 3PX2A 3D8TA 2V58A 3LWBA 4EM6A 1GRRA 3NVAA 1J8MF 4H0FA 5B36A 1N5IA 1BHQ1 3TL2A 1QFSA 2DBVO 1SEPA 3U60B 3GLTA 3C97A 1KDVA 1P2BA 1IYZA 1ZD9A 5TDHA 1QGOA 4NI5A 4P38A 4L0MA 4G24A 3E58A 3NKFA 2PO5A 3HFSA 1EM6A 3BQ9A 3F2VA 3R7LA 2GF9A 5AUOB 5C1BA 3FDXA 3L43A 4M99A 1KYXA 4X6YA 3R3UA 4WSOA 1JR3E 4B85A 2VRCD 2V98A 1PR5A 3R20A 3LXRA 4JCOA 5IXSA 5CCBA 2I3AA 5JT1A 2UXDB 4AKGA 4B3GA 1A7KA 2R8RA 2GEFA 2E5FA 3PYMA 2MINB 3OURA 4CGZA 5AVYA 3HUUA 3SS9X 4GPAA 3W2HA 2ZRFA 2XNDA 1FRVA 3HRHA 4RV4A 1L7QA 3QFTA 5ECGC 4L4UA 5ALZA 2HSDA 1J2YA 1D09A 3OE5A 3W5IA 3UT6A 1SOMA 5AXCA 2AI3A 4D82A 1POWA 4IDDA 3HU2A 5AOBA 4F8EA 5K4HA 1JQLB 4D7AA 1HQKA 4G1FA 4KAAA 3P71T 1CJUC 1JPJA 3VJLA 2H16A 1W49A 5BT9A 2G04A 4EKGA 2AMJA 2I7XA 1BKYA 2OWDA 3MWYW 1SY7A 3FB4A 5B7QA 4F4IA 5REQB 2P2GA 3FSEA 3KXDA 4G5OA 1NLZA 1SVUA 2Q1YA 3D7NA 3IDOA 4HXFB 3MN1A 4JMPA 3A05A 3TDKA 2KBFA 4N12A 4BO5A 1TVMA 3C8DA 5CDFE 2XI4A 5ALMA 2FW7A 2V5AA 5AJYA 2J85A 1B74A 2I8LA 1OQAA 3OJ0A 2XDAA 2O2IA 2K7FA 1G2PA 4IDCA 1LVGA 4O8ZA 1LGYA 3L0ZA 2GRUA 3FMGA 4GYJA 1UOOA 3ZGNA 5L9AA 3BKXA 5FOTA 3HEAA 2B5WA 3GARA 2IGTA 3G49A 3ICQB 4KVAA 1I4DD 3K5PA 3ZBTA 4DR2B 3FCXA 4C06A 6LDHA 1NPDA 1GVHA 2I22A 1UJBA 3H42B 1J70A 2OGWA 4HWKA 1D6NA 4R1PA 1VL5A 4RQTA 1AY0A 1L5VA 2ZUCA 4PZYA 5JDIA 1UADA 2V3VA 2H6EA 1FS6A 4ZJYA 1W48A 3AKDA 4WESB 3PDJA 5JADA 1K9VF 4YPVA 5GQSA 4D4KA 3HSSA 5IU6A 2F1OA 2DY0A 2BGWA 1JQJC 5CAEA 3U3DA 1FNMA 3HUDA 3LPAA 3K9WA 4B40A 2P9GA 3B3FA 3RS7A 1YVPA 4XJXA 5JEEA 3L4KA 4NAVA 2C5SA 1WSWA 1QJ4A 1T1RA 3FYUC 5E4FA 5EJ5A 5TMDA 3WA7A 2YZ2A 4N48A 4FP9A 5K4AA 3HVKA 5CGQB 4R1OA 4JYZA 2DWCA 4GO1A 4IQFA 2QG9A 5A02A 2J9FB 1K27A 2QKYA 3RSCA 1GLGA 1DJOA 2RFLA 4A1FA 4CCYB 4ZT2A 5KJCA 1CZRA 2R47A 4ZYVA 1Y3AA 3RHTA 4YRGA 3OT5A 4LZAA 4KH0A 1M1ZA 1LW7A 2Z4TA 4PLWA 3TLMA 5FLKA 1WCYA 5TPWA 1CDEA 1DGQA 2OM6A 2RJOA 2XEDA 3PG5A 4Q4JA 5BXQC 1EDDA 4L0QA 4TXLA 5LU8A 1II8A 1Y9DA 4OU5A 2HKIA 3CZ4A 3LOPA 4ZDIA 1YC5A 1OFTA 2L82A 2ACVA 4LNHA 2VRNA 1FIUA 2VLBA 4QUGA 1UFVA 3EEOA 3RHFA 2HMSA 2WMYA 2XTMA 2JVIA 4IO1A 5C8VA 4P4SB 1V5IA 3LF1A 3M6UA 1X86B 5CVJA 4MPJA 1R5BA 3OZ7A 3EG9A 1G1AA 4H0NA 1EZ4A 3K0KA 5CDYA 3ND8A 1Q83A 2IP2A 5WRFA 1G8MA 3EVDA 3BH0A 2N9UA 2VEDA 4JC8A 3OZDA 1OCEA 1MX9A 4CT5A 4GZMA 4EB6A 2E82A 4F4HA 3K70C 1B73A 4RD1A 2HGZA 3LGXA 3Q7EA 5M2QA 3C87A 4U5QA 3OY7A 2A4KA 5HFNA 1SULA 1CP3A 5LXTB 1DX9A 4FWTA 4WCVA 1TO6A 4MP3A 3IE1A 4X9XA 5AWFC 3W4JA 1X15A 4ADSG 4KMRA 2BGRA 4KR6A 4DCNA 1XDUA 5KTRA 4JSYA 5BORA 3GB9A 3H0EA 2OBLA 3P2KA 4BTVA 2I6FA 3GY0A 1CB7A 3JARA 5EWMA 4F8JA 4DDTA 6ADHA 5EMJA 3RABA 2OHFA 2AK2A 4MAFA 4O2AA 4UAJA 3KZMA 2RJNA 4C4PA 2QN3A 2C78A 1L5GB 2QYOA 1K5DA 3AUYA 3O73A 3T5GA 4BN4A 4OP3A 3ZS9A 3R0XA 4CU5A 3QA3E 2JCBA 3FWHA 3A1DA 1IG0A 4IILA 3MPUA 1T43A 2XGJA 2W9XA 4AMBA 1BS9A 1JG4A 1D5CA 2AYYA 3PS9A 2DEUA 4AO7A 3FVVA 5CTAA 2ZI6A 4ZQBA 5BWBA 2XB4A 5FOXA 4OI0A 3ASVA 5LDHA 5AKZA 2NADA 2OO5C 1QH1A 3RT7A 2YCLA 2RHCA 1ULHA 2FDRA 2NO0A 3A10A 5A9SA 3SF0A 5ALGA 5I4KA 1AU9A 1M6VB 2O2XA 2OP0A 3LQFA 1Q15A 3GOQA 3KLNA 1Q19A 2V45A 2EWVA 2QAGA 5J59A 3Q5GA 1RT9A 2VAWA 3UENA 1ATIA 1N5DA 3L1UA 4R3UC 4N5IX 2B0JA 5G2OA 1ZHOA 3C3BA 3Q0TA 3ZWBA 4WFQA 2O06A 1WSDA 3G1UA 4Z0HO 3EX7C 1Z17A 5M34A 4G0YA 1MGPA 2FFJA 3R7BA 4W1SA 4N3GA 3I9NA 3A7DA 4XTCS 4A0QA 1ZINA 1P33A 5IKOA 2XJ9A 4Y1RB 5LOVA 1NJ8A 1DC7A 1X19A 2W11A 3DGEC 3TD9A 1Z4PX 3KDAA 3OPMA 1NW8A 1EESA 3VPXA 4G1VA 2IX3A 3ZWYA 1CUVA 5LPNA 3I83A 4CMIB 1AZLA 1YBVA 2P77A 4KLCA 4KQHA 1Z25A 1T9GS 3D3EA 3K9NA 4Q00A 4C0JA 1W36D 2BEUB 2H8KA 1DQNA 3JQBC 1HZJA 5IK2A 3UKDA 4EB3A 5JAMA 4QAQA 1MIOB 2AZTA 5LQSA 4AP9A 4O63O 1BCRB 3SNKA 2I4RA 1RWQA 3R9IA 1Y6QA 1VE7A 3AFIA 3ZE8A 4DQUA 3ZDFA 5CLLA 4MVCA 4NBTA 2WAOA 4C5AA 2YRWA 4LA4A 3NP9A 2XECA 3C7KA 1IN7A 2IZ7A 2WF5A 4XXHA 1L7PA 1T8SA 4XCVA 1A9RA 1CRLA 3CUUA 1F5NA 3EXG2 3F5QA 4GMGA 2VCYA 2ZT6A 3CRRA 4IGAA 1ZW6A 4JKYA 1KIFA 4NDZA 3VI3B 4RJKA 1U11A 5ADUS 5LMNB 3FMPB 1K7CA 2GD6A 1SK9A 4LUCA 1NQXA 1TQ2A 2BTQA 4TS9A 3LUFA 1G8YA 1YCGA 3GDOA 3OCVA 5FOUA 3RRXA 5REQA 3DB1A 4CEHB 2OGZA 4FX2A 4GI2A 4D43A 4J9VA 3GUUA 2IV7A 3MMPA 3FSRA 4TVSA 3LCUA 3WP1B 1I4OA 1LTQA 2JGEA 1GG8A 1W2GA 3QLVA 4LXXA 3A26A 2AJDA 4RV9A 4U8GA 4D0RA 2DXIA 5LBUA 5EXPA 3FKJA 3D6NB 2IUSA 1G9XA 2J08A 3HH8A 1FP2A 1XKLA 4B31A 2IXAA 3GC6A 5EXTA 3MINB 4C0LA 2JGNA 5KYWB 5IM4F 1NR5A 3DKKA 4OA8A 2IPOA 5CB4A 5K6TA 3FF4A 4MPRA 4IX1A 2VA8A 1GQRA 4R1SA 5JQGF 5IH7A 3CEHA 1V48A 2FP3A 4DCVA 4BXOB 4YROA 3BA1A 1R8XA 5IN5A 1CQJB 3WB0A 2UZ0A 3OPVA 2FOLA 1C14A 1GRVA 4YXWA 4BLUA 1L5YA 2GAAA 2YHBA 2Z98A 1C7RA 4P4GA 4ZRMA 3O0TA 3WYBA 2AN3A 4JEIA 1HSOA 3ROMA 3JU3A 3LPMA 4FFMA 2WMOB 4V39A 4BQPA 5AK5A 1KI6A 1F17A 4N9QA 5CVTA 2P0YA 4W5RA 3ND6A 4MQEB 2PUAA 2X8JB 4K6FA 2QT0A 3EZ6A 1M1YA 3Q7SA 4RVDA 4MINA 1LY1A 3JQRA 5CBPB 4JP5A 3K1JA 4LRQA 3KUUA 1LTHR 2GZRA 1V11A 2V74B 2AXQA 1VBNA 3PQ3A 1KI6B 1U2GC 3GO4A 4KFCA 4U7WA 3GMTA 4BL5A 4L8LA 3BE6A 5LMCA 1G8AA 1K86A 1LKZA 1T36B 2J0SA 3CB4A 3GLUA 1F6DA 4HWSA 3A6KA 1I4EB 1X7DA 5B3KA 2IUFA 2V7GA 5ICCA 3IMKA 3FCAA 2KLBA 4AYTA 4D44A 2VTEA 3CNNA 1OBOA 3S8EA 4CR6A 3TX6A 1NFRA 2Q2QA 3GQBB 2QN9A 2YH2A 2WJPA 4KRGA 3K0CC 5HR5A 3DEFA 3NIWA 1OJLA 2WVJA 1IEVA 3V7UA 1W30A 3SD7A 1PGNA 1HFWA 2MR5A 2PYZA 3RS8A 2IYTA 4GXNA 4Q9HA 1AS2A 2XRFA 4DQ0A 1NN5A 2QGNA 5C2JB 1JIKA 2QBYB 2ATIA 3ESQA 2I7VA 3HKCA 3HYCA 3UJAA 3M7IA 4B3CA 1WB9A 4TUYF 1SG6A 5CYGA 3REOA 1N2SA 1LDYA 3O6VA 4NMXB 2NTJA 3DW3X 5J4HA 1L8OA 3WLRA 2ODQA 4BNYA 4KGZA 5I7UA 2VHZA 1NU8A 4Z4CA 4BQNA 3EE6A 2C83A 3A1TA 3PC8C 2E5WA 5JEDA 2IDKA 2OSVA 1TYAE 5AW4A 1G3IA 3THRA 4D41A 1YB1A 5TLSA 3IE2A 2AR9A 1DBSA 1VPWA 5A5GA 1WQ3A 4IBOA 2XUHA 1LDNA 3E3MA 4E03A 4ABTA 4KGVA 1IATA 4TZ6A 1P18A 2YV1A 2IV2X 4PZ9A 2IH2A 1U5AA 2HRDA 4MJXA 2PZMA 5HILA 2OHXA 4HDNA 1KF0A 3FWZA 1O96A 2H07A 1JBQA 1DNPA 4M1YA 1JAZA 1AMUA 3I04A 4I1IA 2R8EA 1CFJA 1G2IA 1JWBB 3EEIA 4OQPA 3AM4A 1I1HA 2I6QA 4B3FX 3THYB 1OHHD 2IXTA 4BNNA 5B3LA 3H0KA 1ZDMA 5TS3A 3RD5A 1JDTA 1N1GA 1R0CA 1UF9A 1KDRA 2BP7B 3HJTA 3LNTA 4M9ZA 4ND1A 4YI3A 3MQ4A 5GM2A 1SZDA 3QWHA 1I13A 1YUMA 2BJVA 1II9A 5KWEA 3ES9A 2CUZA 2RDMA 3RJ5A 4TRRA 2TYSB 1E0JA 2CYAA 3MCTA 1WSBA 1Q12A 2BCGY 5H3LA 2FLKA 3VSDA 2ESRA 3KSDO 1LSUA 4F3NA 1FFAA 1ZL2A 1UFOA 4K6MA 5C52B 2XCTB 2F8TA 5JDIC 4YLEA 4N82A 3H9UA 4XPIB 4TN5A 5AUQA 1RE1A 4IJMA 1IRIA 4BEJA 2PRKA 4PANA 5A5VA 5JUWA 3KQNA 1T8WA 3O93A 5ALDA 2ECPA 3TLKA 5IYZB 2PWPA 3WNBA 1TU4A 3TTSA 2P41A 3GGPA 1YK1A 2LNDA 3NAQA 5BXYA 3WMWA 4D5GA 4D3SA 1P1BA 3OZGA 4A9AA 1UBFA 1FRZA 3CGGA 1Q7RA 5J4KA 1HLDA 3LV8A 4RVOA 3PJGA 4ITUA 1FY2A 2BGIA 3KQPA 2ZWOA 1QIMA 1FYFA 1Q14A 2C2BA 1HOXA 2Y6VA 3KYDB 1I2ZA 3NWPA 3PDCA 3Q10A 4UQPA 5MGNA 1TA9A 3KHSA 4HVAA 4KYUA 1KR5A 2HWKA 1QC5A 3BHJA 4LQ4A 4DDHA 3VNBA 3ZYZA 2Q4OA 2R65A 3HABA 2XX3A 4MKZA 1E7SA 3GLGA 3OFJA 4MR9B 4C22A 4YPFA 4X1OA 1EVYA 4WX2B 3IDQA 1PJ2A 4IH1A 3WKAA 4I14A 2OC4A 2PX6A 3QFSA 3R0IA 1Z2AA 2C4UA 4W1QA 4C7KA 3R3ZA 2XGSA 2W2KB 1L4KA 1TF5A 2VHQA 3L7LA 1QFZA 4R51A 4ZREA 1W19A 4G0PA 3ROXA 2HSGA 2WV9A 3U7QB 1VPVA 1J0DA 1DDGA 2VCHA 4JJ7A 1GPJA 5IJXA 3VFDA 4OSOA 1ZCAA 3ESBA 5SY6A 3RCBA 1HNXB 1PJTA 2DFDA 3WRWA 1JPNA 3ZY3A 3DFZA 4TXMA 4N8DA 3RC3A 3C98A 5FPYA 2WICA 3KPYA 1QXSA 1FDRA 2E85A 3L1VA 1WEHA 4XUEA 1SD2A 3OIVA 4R8RA 4BB0A 3BJMA 1Z0FA 5B12A 1VBFA 2EL7A 2MYTA 4LJAA 4YCJA 5E3JA 4DIOA 3GPCA 3PL1A 3ZE2B 4D1YA 4BQRA 4I9NA 4EECA 1QIEA 5CXSA 4RPHA 4XGIA 4ETMA 1RAFA 5DYYA 1IULA 4URWR 2C4WA 1OHHA 1ZK1A 3ZHOA 3PCTA 5JJKA 1Y48E 3UMRA 1SXIA 1PEYA 3P52A 4N41A 3BMQB 1GRQA 4LY0A 4LHWA 1YJ8A 3NM6B 4Q7JB 1U2TA 2O8VA 4NBNA 1VKZA 1FFDA 1NFFA 2AV6A 4PPNA 4ZPJA 3OSUA 3BTOA 3BIXA 1NVDA 3HMKA 3ONVA 1SELA 3ETDA 2FPOA 2IIBA 1ID8A 1MO4A 2BL4A 3CT4A 5CW2A 3E3LA 4AO8A 3H8SA 4JNKA 3UJHA 1C0LA 4UCQA 4OHXA 3TH5A 4A73A 4IR7A 4B35A 4ALLA 4HH0A 1PFVA 4NRDA 4KZKA 4OB6A 2PKXA 2V59A 4BMPB 1GAJA 1QCDA 2P4UA 4F1JA 1F2UA 4ZN6A 4RKEA 4PWYA 4EJ6A 2XXBA 4DLRA 3TRIA 3A4IA 5JPDA 3PQ8A 1NF9A 3UAZA 4XLTA 3O2JA 3IP8A 3RVNA 1KEEA 3RAPR 5CNKA 4EJSB 3L04A 1D2CA 2DH6A 3T1NA 5KI6A 3W8NA 4PV7A 2I78A 5HIAA 1S4QA 4LJ5A 4M76B 5EZ5A 4KQKA 4XWAA 2GETA 3F46A 4EG8A 5IT4A 3PWZA 1U0SY 2C2MA 3ELYA 4EJSA 4ZYXA 1HDRA 3BGSA 4R84A 4UUPA 4C3UA 5C8ZA 3I9JA 4D25A 4R54A 4QOFA 2C57A 4AWXA 4GOLD 4OHVA 2W6JA 1TL7C 3DQZA 5EZYA 4DQDA 7REQA 4AUKA 1FFWA 2JB9A 5AMXA 2P2DA 1C4OA 1XD2A 5K3OA 3G17A 3WK7A 2TMYA 2G17A 1RP1A 1HF3A 1U8XX 2YQZA 5IULC 1U8YA 3U6KA 1E9SA 2JLBA 2ODAA 5T4FA 3GLGE 1F7VA 2Q2WA 2X6TA 3AQIA 1B8PA 5GJCA 5A5EA 3C1UA 3IEPA 1P1CA 1VRWA 3JYLA 3SFTA 3H7AA 1UZMA 4DE5A 3W9SA 3PDIA 3BULA 4ODIA 1E3MA 1L5KA 2OKGA 1N6RA 3DSRA 1EVJA 3O3MB 1HC7A 1T9BA 4FSXA 1Z0ZA 1BGVA 1NVUQ 2IXBA 4I9HA 3LECA 4V03A 2GPSA 3L5KA 3ZHVA 2BAGA 2WEKA 3TTXA 4CCAA 1U6KA 4JGIA 4V2IA 2HF2A 2O1SA 2VDVE 4L95C 2IPXA 4LY6A 2IX9A 3X1MA 4A3SA 2FEOA 4AQYB 3IV6A 2XVMA 2PXCA 3DFFA 2YHIB 4JI1B 3SKXA 3FTEA 3ON5A 2FQ1A 2W6IA 1E2KA 1JRLA 3VGPA 2YN0A 2OZKA 2P2LA 3KTOA 4OMDA 1V9SA 4B33A 1YZLA 3R5FA 4HSGA 4BMVA 4KHZA 3WS7A 4DLKA 4F12A 1L7EA 1XQ9A 4PYIA 3WNZA 2PX0A 3IR7A 2GM3A 4XD2A 3T3HA 4G1MB 4CQMA 2REBA 5IFKA 1VB3A 3RU2A 2D0DA 1JZTA 4G8JA 4QRHA 3VAAA 2VFAA 4E2XA 1Z29A 1F14A 5LQMA 2EX1A 1GQOA 3QX3A 3NWEA 4FWBA 4Q15A 1VJGA 2SCUB 3ORSA 4DDWA 1FMCA 2ZSAA 1C0PA 2H92A 4U6SA 5KYYB 1XTJA 2XV1A 3NEPX 4DNXA 4RF4A 2MSKA 3OIYA 1UEJA 1Y6GA 3GJSA 3INRA 2VT2A 4L22A 4ZTBA 1YR8A 1NSFA 3H1PA 3H5NA 4ZVPA 2CEAA 2ZP1A 5B37A 5EJ6A 4CQNA 3TSAA 3NYRA 3DWIA 3M33A 3EB9A 3NS7A 1T9ZA 3FGOA 4RNCA 4XCXA 4YRLA 1GTRA 5BYAA 3AZOA 4V0NA 1E66A 5DMHA 3EDYA 3TOVA 1NUSA 5FTWA 1FB5A 4K3UA 4QOJA 3DQQA 2IVZA 2GHTA 5EG5A 3OTOB 3CVYA 1E7QA 3QPVA 4GIBA 2H4ZA 4XARA 4GF5A 3A1NA 3R9XB 1N5MA 1BEZA 1G98A 3K94A 3WOHA 2IT1A 1BIFA 2C07A 1E94E 3H5OA 2YV5A 2RD2A 4JBXA 1J09A 2ZYRA 3D0QA 1W4ZA 2WABA 4DCCA 1VIMA 4NU6A 2ENWA 2QL7A 1Q3TA 2JLUA 4RDCA 1UT5A 3FFTA 5B4UA 2Z08A 1Q1AA 3W5BA 3D4PA 1GKKA 1U1GA 3PP8A 5CIYA 4U4AA 3KQKA 1N9GB 2HA7A 2XKBA 4POAA 3JWGA 5IYZF 5HGXA 3EXFA 2WM3A 4LKOA 2OCBA 3ETGA 2AOUA 3BYZA 3RC7A 1XCMA 1Y34E 2RHTA 1Z8FA 1A5SB 1RYZA 2ZYGA 5BYBA 3I3SR 3WDMA 1E2HA 2H7YA 3I73A 2HNKA 1NVTA 4X3PA 1EPUA 3UJ9A 3JV7A 1GFZA 2JEYA 4FYMA 2ZJFA 4G5RA 2FGJA 3D2CA 3IGFA 3CSSA 1WW2A 1YS4A 2D74A 3OQJA 4RJIA 3ZE7A 4MKHA 4UDYX 3IJ5A 3AF6A 3URKA 3TD6A 2XCSB 3UV6A 2DERA 4EMSA 3NYWA 1VDZA 2RGYA 1HXHA 1QQTA 2WWIA 4LZJA 4NJMA 3WAKA 1HTWA 5L3VA 3U3KA 1ZWLA 2PMBA 2VDOB 4M9SA 1TFRA 2EOAA 4XEUA 1L5ZA 1RADA 2F2TA 3N7AA 4HAIA 4KQMA 4DA6A 1KYZA 1WZ2A 1KC1A 5EP1A 3V1NA 4E3ZA 1YQWA 4I9GA 1PQUA 5EC8A 3GLKA 1WQ4A 1TM2A 2HRCA 1XZGA 1PQWA 2IEZA 2ZRHA 2HCTA 3B1YA 3DBLB 3LAWA 4KQ2A 4OY3A 4QWWA 3NDBB 1N57A 2P3QA 4KC0A 4ZEOA 4HS4A 1ACJA 5DV9A 3WBBA 4NJOA 3HCDA 1N25A 1DSSG 3W2IA 4V0KA 5JWHA 5CB4B 1T3LA 2GN4A 1OKKA 1U4NA 1FP4A 1XFDA 5E2IA 4RTOA 2EDCA 4X8MA 1NJ1A 2ID8A 1GDHA 5CD9A 1YAHA 4BFUA 2YMPA 2EWWA 5CVVA 3WNVA 2R5NA 4JP8A 2FW0A 1BD4A 2D5LA 2I6UA 2Q8PA 3HP1A 4S12A 4XYMA 4ZU6X 3RW9A 4E21A 2XQIA 5BSHA 3INTA 3W6ZA 3OZFA 4AZ3A 5JCJD 3VHQA 3PGJA 1EFPB 1Z0AA 5BV0A 5M04A 2R6JA 2QTMA 3ZY5A 3NNNA 1Z5OA 4FYPA 4CFYA 1RNLA 4I1RA 4ETNA 5GZ3A 2WKWA 4NARA 5BSTA 1FXUA 1L5QA 2CXSA 1F8YA 2JGFA 4HJXA 4IVRA 1E6EA 4D0LB 1WNTA 3OOJA 1ZJ5A 5FX2A 1KYYA 1CBUA 1OWLA 5P21A 2CK3D 1QIIA 4TMKA 5KDDA 1EAYA 1PFYA 3AF5A 2Y2VA 1RKVA 4GZ5A 5CNJA 3CVXA 1LI5A 1QS0B 2ZIXA 4HX9A 5EE9A 4H3SA 5DNCA 3RAEC 4M3NA 2ZU6A 1QV9A 4JYBA 2HRRA 1KA9H 5TT1A 4JBNA 5A4IS 4FBGA 1ZUHA 4KO3S 2PUFA 4HRXA 1UPTA 2OYCA 1BVUA 4CJXA 1IMOA 1RWNA 2ILTA 2AC4A 4G65A 4JB2A 3O9MA 1SU8A 5GZ6A 3O7MA 3ANXA 4C89A 3B1KA 4KBFA 2O3SA 1Z4NA 2QX9A 1RQXA 1TE2A 4IQ8A 1WPQA 3I76A 4NHEA 2A9VA 2HUPA 2ZIWB 2HL6A 4LTMA 3I3OA 3IHLA 4BC0A 2I4TA 4IY1A 4AO6A 1UWKA 1UBTS 3HI4A 3SNHA 3GZTB 4V3CA 4PXAA 4CUJA 3V34A 3ER9A 3RV3A 2OECA 2QK4A 3KS9A 1INLA 3Q3HA 4A0FA 4F56A 1WMAA 1YZKA 4GQBA 4YBRA 5C5CA 3AVYA 2UZIR 1LRLA 2TMKA 1P39A 2B2XA 7ABPA 3UGJA 3FUUA 3SSNA 1HDOA 3MCZA 4NFLA 4OHRA 2Q49A 2X0DA 2VN8A 1SPXA 4OGWA 3A4MA 1GZVA 1EXWA 3QPAA 4DT1A 1EK1A 2ZT8A 4ZZ0A 1TEXA 1XMXA 2G28A 3O2NA 1FDTA 4YAOA 4QTTB 4Y2HA 4CDMA 1GQFA 2YRFA 2GAOA 2PBLA 1JWLA 2VYVD 3X2FA 2NLOA 2BM8A 2EWMA 2C9BA 3DVRX 3KFVA 1QG6A 3NBKA 2G6BA 4OFZA 3SVZA 2H7XA 4N8EA 5FOVA 4A26A 1LPOA 1PSZA 4HEHA 1GPKA 2AQIA 2Q5CA 3C6ZA 2QD5A 2ZYVX 3OCWA 4ILEA 2VTBB 3QUBA 4HLNA 5EYPA 3LH5A 3WWCA 5FEMA 1ZN7A 5HBRA 3CRVA 3ND5A 7YASA 4B3JA 3IR6A 2GKSA 3W90A 2J3LA 1NF8A 5GGYA 3I5XA 1RXEA 1N2EA 5EZ6B 3MCAA 1KGSA 2YHSA 3FOEC 2R68A 4AD8A 4KPYA 1BN6A 2WQZA 3KZXA 2AUTA 4QQRA 3TL3A 2E89A 1CUYA 2DFLA 4P81A 3X1ZA 2BFBB 1KORA 2YICA 2Z2KA 2OTCA 3V1UA 1I1OA 4R40A 2GAFA 4PYKA 3B6KA 1XNJA 3ELUA 4FD3A 3LQRA 2FUG1 4P7BA 3OKPA 3K72B 2W00A 3FUCA 1OR8A 4K9OA 1TECE 3L0CA 3G0IA 3PZBA 2YMQA 3BPSA 3QKTA 1C9NA 3HBMA 1ZIDA 2QHXA 4L9RA 5BWNA 3LDGA 2BMWA 4LYEA 3UATA 1QLJA 4NNJA 3M1YA 1YCDA 2QR3A 4DCGA 2EYUA 2FPMA 2O50A 4NPHA 4QVKA 1A96A 1MTZA 5K09A 1N78A 4HAYA 2HMTA 1ESEA 3P1JA 3HSKA 1CJCA 1QFYA 2O8FA 4BMDA 1UIRA 2G80A 4HEQA 1FUKA 3PXCX 4TWRA 1QP0A 3BMNA 1JFVA 3KWLA 3RFUA 2Q9UA 2FPSA 5JZVA 1GCAA 3QX8A 2AS0A 2AZ4A 3E9MA 4G5HA 5I7HA 4PWZA 3SBXA 1M6EX 3OI7A 4RBNA 3PHHA 1IN1A 2GFHA 3BCHA 3QVKA 2C54A 4LOKA 4ND3A 1AUQA 3NTRA 4P8RA 4PNHA 3WZ2A 1Q3KA 1RPJA 3TMYA 3LKZA 4BB9A 1U3UA 3ZI4A 4FN4A 2XCLA 1XNHA 4ALNA 1TJ3A 2D5AA 5AOAA 1U2ZA 3ETLA 1OI3A 4N49A 3NGMA 3TVTA 4CLHA 5AI9A 1GOTA 1P7ZA 4HLCA 1R8YA 1MQ9A 1ZD8A 3I9FA 3THWA 1Q1QA 1GQYA 1CUAA 2CUTA 5JWRA 4CTKA 4JHXA 3EJWA 4XI9A 2XMCA 3NORA 3HCCA 4FOOA 2XNKA 4QUDA 4PFQA 2BM1A 4N7JA 2LDXA 4FYWA 1SC4A 3KD3A 1KPIA 4XUGB 4Y6SA 2IPMA 5D3KA 1PZEA 2Q45A 4MTLA 1KE2A 3SZMA 1NBWB 2IIVA 1G60A 2QN1A 3FTQA 4LZWA 2COKA 2L69A 3R9KA 1GA4A 1RHMA 3OBIA 4FCVA 2DLCX 1NV8A 2E1PA 4DNQA 1FLVA 1G3RA 4MV5A 4ZHQF 1C0EA 3DC2A 4WTOA 3AL0C 2HB6A 2RARA 3RSOA 2II6A 4BGDA 1OB5A 3VDRA 2X2FA 2NN3C 1IOZA 2NOAA 2HQRA 2PY6A 1L7NA 3B2NA 2TSYB 3U4IA 1T2NA 2CWWA 3JYQA 4GGPA 5I7AA 5C4GB 4UOEA 3WGYA 1S2OA 4FHEA 3VKFA 2WJZB 5ELXA 3PNBA 1RE0A 2OY0A 1I2CA 3HDYA 1E8DA 3LIPA 3DTVA 4MV1A 1FBTA 4UHHA 2FFAA 1GZ3A 3LLCA 1BFDA 1PV2A 4WBXC 3T06B 4BZPA 4ZU1X 3FPJA 1HFKA 5DCUA 3BWYA 3WV5A 4XVHA 5AVSA 4U02A 4ARBA 4KQ9A 3I12A 4UNSA 2OPBA 2W6ZA 3IUYA 4ZT7A 1C7IA 1IJEA 3ZQUA 1CQWA 3TNJA 1L7OA 1O77A 1N1EA 2JFYA 2VF7A 1DXOA 3DL7A 5DN6A 4OQLA 2QUKA 4MNTA 2VWHA 1SC1A 4YUAA 4GUAA 1CEEA 5F1KA 3ZWDA 4D0GA 4EQZA 4JX8A 2PGAA 4PAMA 2ZRDA 1KJWA 1Z5NA 3HUEA 1YU9A 2BTEA 3KJIA 1NWCA 3M81A 1JA1A 4DIUA 3DWEX 1Y6ZA 4G8BA 4PC6A 1KMIY 1YOBA 4MUGA 1M0WA 4RJLA 1I80A 1X1AA 2PT5A 4ER5A 3DMRA 3ZD7A 1XZ8A 5BUCA 2B8TA 2EFCB 3I58A 2ZRKA 4S3MA 4XR9A 2DQYA 3TW8B 1D6MA 1KI1A 4R16A 2ZJAA 2Z1DA 3DMDA 1LBIA 1WXWA 2GEVA 3FN4A 1KOJA 1JEYB 1T5HX 3MMZA 2V6IA 3QBEA 2EF1A 4V24A 1HT3A 5KU1A 1U02A 2YV2A 3SIRA 3IFSA 3RNLA 5I9IA 1XQWA 4OXRA 5BV2P 3IC5A 5B30A 1UXIA 5BN5A 3IQDB 2A9QA 3RYHB 1ZH0A 2PE5A 3GT7A 2QRHA 4GWGA 2AX3A 5A6SB 3Q88A 4UDNA 2I6XA 3CH4B 3G2LA 4YH1A 4TTIA 1J21A 3QA9A 4RW0A 1ZOPA 2QYSA 4I5DA 1LK7A 2GQ0A 4OLJA 4X0EA 2R1VA 3QKSB 2VYNA 1ADBA 2JFZA 2XAUA 3HUFA 4NJEB 4EG6A 5GWXA 1SD5A 2Q7XA 5A6SA 3IQFA 3NKVA 5ALYA 2ET6A 4YLGA 3LVFO 2P7HA 4KG7A 1APBA 1OIVA 2MWMA 4GLFA 3K71B 3FZEA 4QNRA 4MHOA 2X19A 2WMDA 4EY8A 1Q6YA 4IDOA 4TV9F 1Y42X 1RJGA 3TFOA 5JMTA 1QHXA 2HJWA 3NO4A 3CBQA 3V55A 4PRZA 3VH4A 1F7UA 3IH5A 1Z33A 1D6JA 1LU9A 4A82A 1JBEA 5JFGA 4RACA 1A7UA 2WFLA 2NVWA 4IIDA 1T9CA 5D7NA 4CF6A 2Y0EA 3CUTA 1ZRNA 1R10A 1HORA 4XVRA 3F2IA 1GT6A 3W8FA 4XQ0A 4UUMA 1OLXB 2HJSA 4FEEA 4L8VA 3W8RA 3UKJA 2UKDA 3DOCA 3GRYA 3IT3A 3S2GA 5ALVA 2WQ7A 1XNGA 3IAXA 2J0EA 1M2FA 1MRSA 1NVAA 2XMRA 3WGNA 4ITVA 4XWOA 5C0OE 3M6LA 5KOHA 3GNQA 4W7IA 1NMEA 3V4RA 3A25A 2PGOA 4EHJA 5AHRA 3TYXA 4JOSA 4QECA 1E6KA 4RPKA 4IUYA 4IIBA 3ZH9B 3GFRA 1KAHA 4EPWA 1RQ7A 4HUQB 1WSAA 1X6VA 5TQ0B 4QXAA 3N3BC 5HW0A 3W1WA 2F43B 1JHDA 4MUFA 3D7SA 1ZM3A 3FVTA 3QKRB 3PFCA 4RJJA 4JXZA 1UM8A 1GL3A 2NU7A 2GCEA 3O4GA 4BNZA 4CNBA 4DCJA 4A27A 1L7AA 3BHMA 1B3BA 1M1UA 2UVPB 1JIUA 2EG9A 4KWEA 4RD4A 5DBEX 2B6NA 1A8HA 1LC0A 3F47A 4YPOA 4Q3NA 5KAMA 1H5QA 2AOTA 4DAEA 3GJYA 4GBGA 1UPBA 1Y9ZA 4JL5A 2HJRA 4B75A 4YO7A 5B3JA 1OREA 1UC4B 3V6LA 3DZBA 3LUDA 4GU5A 5H70A 1U3VA 2IHUA 1VJTA 2HIGA 1WETA 1DBIA 5FL3A 2V7QD 2Y1CA 3NI2A 4ENTA 1LJLA 1P1JA 4K6KA 3G0DA 1P7CA 3GD7A 4OYLA 1IZ9A 1A3CA 3AP3A 3PHJA 3ZCRA 2VVTA 5ICMA 2ISCA 4MYRA 5DTMA 2CBZA 2YXNA 3EXEB 1KNXA 2RBKA 2FR8A 2IOHA 2AEFA 1RQLA 3OM1A 4QRIA 1C2YA 1NLFA 1PBTA 2V7XA 2YOHA 3C5WP 2OYRA 3E2PA 4IZOA 4Q7KA 1HFJA 1WS6A 4YBZA 3USCS 4GPTA 5KQSA 3Q3GE 4AROA 2NU8A 2LGJA 2J5RA 4AY3A 1UR5A 4F71A 3GJ5A 3CHYA 4TKVB 3I9LA 3GCDA 5I3ZA 2QB5A 1E61A 3FFAA 3K8OE 3D8UA 3Q0IA 1N8KA 1O08A 4OAPA 2O9JA 2ZRMA 5A3JA 4FR0A 4J1NA 1MAHA 1OB2A 2REQB 2O2JA 3K3PA 3WJAA 2CDNA 3NAMA 5EKUA 4XM2A 1X39A 4JQYA 1LLQA 2Z9DA 2Q1WA 5FUQA 2H11A 4LRYA 3HK2A 1U8CB 4HRYA 4DL9A 3QELB 4W8HA 1QHHA 2ODPA 1E2UA 2AD5A 3TLXA 4A8TA 5JDCA 1JEOA 5HF6A 4WT7A 4EW1A 3L18A 5KDOA 3I4FA 1NVGA 4V0SA 5CR9A 1VJ0A 3KSUA 3OQPA 4IIHA 3UAGA 2G7MC 4WZAB 2ZBDA 1NMSA 4OPMA 5DNWA 1S8OA 5JXGA 4ETWA 2X77A 5TARA 4QGHA 1VMKA 1UKYA 1G2OA 5CT9A 5LMZA 4A91A 3AF0A 1PO7A 2VBGA 1WE2A 4JC0A 1K5HA 3OIWA 4WXYB 2VBFA 5F2EA 4ZC8A 3GGOA 2G9NA 2NO4A 2PH1A 3W2TA 5B6PA 1P0PA 1ORVA 4HLUC 4F46A 1E2QA 4DKJA 3OC6A 2V6JA 2QRJA 3NHWA 1CUGA 3L93A 4E5KA 2DYKA 3AP2A 3T9BA 2BE7A 3BHIA 4PRYA 4S1WA 3OPQA 4TV9A 3TFWA 3GHHA 3GL9A 5GVRA 2HZ7A 2PUDA 4R8LA 2P3LA 1YKSA 5ITSA 1JFRA 3LSYA 1JKJA 4TLDA 4EH1A 3O4HA 5JFOA 4L3WA 2CUNA 5LYJF 1FP6A 1FBNA 1SXJB 5AJZA 3FWKA 3QXGA 4WDQA 3FRHA 5LKRA 1ZD3A 5L7WA 1Z36A 1JHUA 2QWXA 2H31A 5HRUA 4GX2A 4E7OA 2FTKE 2YWEA 4FKZA 2C59A 1DLJA 1T3GA 3SZOA 3UANA 3O8QB 3ETEA 4YNBA 1JYSA 4E08A 2JLVA 5ICSA 1YBHA 1CUFA 2RAUA 3HL0A 4JT4A 3CR7A 2WVGA 1UMDA 3NHRA 1QQAA 1QVRA 4P4UA 1AN0A 5IXYA 1YQGA 1XJWA 3P7MA 1AKRA 1D5WA 1XLVA 1H0SA 4L85A 3ZU2A 4D56A 5ITZB 2CJYA 3FWYA 3OTQA 3IMGA 1TM3E 3DJYA 4GEKA 4DDVA 5DHUA 1XDWA 5KQMA 2EV9A 1DBPA 5K2OA 3DOEA 3K9LA 5K0TA 1PK7A 1SUBA 4RSGA 2X3YA 3AVOA 3U13A 1P9LA 13PKA 3DMGA 4QLOA 5CB6A 3U44A 3G2NA 5FCDA 1R4NB 1DX4A 5K3AA 4OMFG 2WF9A 1SKUA 1AKYA 4J1TC 3SR3A 5DHFA 2A7QA 2Q0XA 3E9NA 3S1LA 2VHWA 4BZWA 1PFUA 2HJ9A 4TV8B 1J8FA 2R00A 3B5IA 3TI9A 3DUWA 3T1VA 3VNQA 2XZDA 4DMFA 4H1WA 1D1TA 2C5BA 1SU4A 2R96A 3LT4A 4RPGA 1F5SA 2VNKA 5F33A 4C05A 1AF7A 3MUNA 2FRVA 3PEVA 4OB7A 4KI0A 2ZUUA 4MAMA 5KHOC 2EIHA 1MX1A 4ZQFA 1T4BA 1JSRA 2CXTA 4GBED 5HCNA 5A03A 1BDJA 2HCBA 2ZSDA 3H1TA 4MI6A 1VL1A 2YIVX 5JZBA 1EWTA 4OHYA 1OXBB 2ACKA 1HLGA 3S81A 4YJHB 1F06A 2IF0A 4KVGA 4DMUB 3QEAZ 3LVBA 5IXJA 4UUAA 4Y0AA 1M66A 4E12A 2X0EA 1JH8A 3RTCA 2VF5X 3JQAD 1K2WA 3D3QA 3KB6A 3WKBA 4BVLA 1T5LA 1B1AA 4HQNA 2G36A 1JJFA 2ACWA 3UF0A 4TQGA 4ZDKA 3VR5A 2RG7A 1XT6A 4LVOA 5I9NA 1VYHA 2ZPTX 3CISA 2QENA 1O58A 4QO7A 5ERGB 1AC5A 1HRKA 2BHLA 2QTFA 1COWD 3K9HA 1DVRA 3JQ7B 3PQCA 1H6AA 1YE8A 5G0WA 4ZAZA 1V35A 5A3RA 3UJDA 2Q2NA 2RBGA 2XQFA 2XVZA 1LPAB 3KT8A 2VJLA 3N2ZB 4IX9A 1NLMA 1YTLA 4KN9S 1ZK0A 3B7PA 5KNCD 4LXIA 3Q85A 1KPHA 1TI7A 1X1TA 3IBFA 4EEKA 5AVWA 1IN5A 1BH2A 1P80A 5A9SB 4BC1A 3AJAA 2GA8A 1GZ4A 2J6HA 5E6RB 4W5NA 3D3WB 1ZIOA 3WIVA 1X1CA 1Y3HA 2QAJA 4KNYA 1AKVA 1UWVA 2JI8A 4JLUA 5B55A 4AS1A 2VI5A 4YCLA 3DLBA 2IUYA 1THTA 1KAQA 1N9KA 4PTZA 5BUQA 5CA1B 4XA8A 2I0FA 4J0GA 3FFBA 2NACA 3PUWA 3V4SA 5TRTA 4FOPA 4M37A 2ZJ4A 5DZSA 5D3MB 4YRMA 3E0QA 3T0FA 4EJMA 1LS1A 2V55B 3ILYA 5J43A 2D6FA 2IPLA 1SBCA 1J6UA 4B8ZA 2OXIA 5I7OA 5EWLA 1U9JA 3ZHYA 5T4EA 1GG5A 2NX2A 2FQYA 2IDJA 4H77A 4C5CA 1K5PA 1BDBA 2IEBA 4LJRA 4QJ4A 1C3VA 1JDSA 4X7PA 4JJZA 1EXNA 2R7NA 2CLHB 4PG6A 5ECDA 4F4CA 3NEAA 2H4FA 1RM0A 1A98A 2WIFA 4CW7A 1MU0A 1RHRA 1YVEI 5BVHB 1CWUA 2I2FA 1E1CA 2QYHA 2GAIA 3JQ8B 4BQEA 2O8NA 1EU1A 1UDXA 4JODA 2ZWAA 3ANLA 2FHSA 4YV7A 3DBIA 2X4LA 3I72A 4Q1VA 4Y8VA 1X7ZA 1V5FA 5ESRA 5HE9A 1F1JA 4YUYA 4B6FA 2E37A 3OCYA 2G5GX 4P34A 4KK3A 3WYCA 2QA5A 1G19A 4NCKA 5FUXA 2OGUA 1RWVA 1TRKA 2YWGA 4OB8A 4WXMA 4A8PA 5LC1A 2EKDA 1H05A 2OOKA 5FOSA 1ICEA 1PGQA 2W2LD 5MGBA 2FFHA 2NYUA 5DE3A 3KJHA 1N36B 1GSIA 4WCFC 1U65A 1ZM4A 3T61A 2BN4A 5KTMA 3IJPA 2VAXA 5CK4A 3W9UA 1T3TA 4C9BA 3U19A 2V7PA 3K7EA 2NO6A 3RVBA 3CVVA 2PNFA 1Z4IA 1MAVA 2OZLA 3O8QA 4UTVA 3LL7A 3NALA 3ABRB 3B82A 4UBNA 2DC1A 3O1LA 4Z4EA 4LCBA 3Q8XB 1EX7A 4PX2A 2QZ4A 2VHEA 4Q1CA 4LDZA 5KO2A 3RU3A 2YJ4A 1PUIA 4LXTA 4S0ZA 3QVVA 2YWRA 4ZXFA 4EAQA 3VR5D 3PQFA 3ONFA 2CLEB 1C30B 4CCYA 4FLMA 5AD1A 1GPMA 1RRMA 3PF9A 3VR4A 3KVVA 4JJEA 1ECJA 3K5HA 3QJYA 4O4JF 1ZD2P 3UM9A 4QGSA 4GOJA 2XMZA 2WIKA 1FFGA 1XLTA 5AKIA 1HEYA 3MTJA 3G0OA 3K6SB 3NPMA 4MVXA 4UEQA 4ENRA 4IJ5A 5LFAA 4G89A 3OC0A 2FRDA 2P9FA 3MERA 3NKLA 3VUEA 1H6BA 4ZI7B 3AJ9A 3QF7A 4LJ8A 2H17A 2ZIEA 1FPMA 1OGJA 4CKBB 2VJOA 2JJMA 1ZI6A 5LQKA 3AR3A 2XVYA 2PGJA 4MVJD 4AG5A 1XEXB 1BAPA 1GGVA 2I71A 2GYUA 1IXZA 2PX3A 4AF7A 1S9HA 4RVSA 3QU5A 4YIKA 2D54A 4FHDA 4MQ6A 3AUSA 5KHAA 3DLCA 2GJ4A 5AW6A 5EWJA 5EJ7A 3MD9A 3A3KA 1QYCA 4HYTA 4MVJF 1DXYA 1GLNA 3KOWA 1Z26A 1KEKA 2KBEA 2LP4Y 4EHFA 2FMFA 3HKEB 4JUCA 1JDBB 2AF3C 3KQYA 1WKVA 3PD1A 3U3RA 3EMVA 4K26A 4D8WA 5JNSA 5FXMA 3QWAA 3MHPA 5I3CA 3QF4A 3QVOA 4G86A 2IDMA 1V95A 3O4RA 1K98A 1UOEA 1ZM2A 2AOUB 1W76A 3AEKB 3WSTA 1ZIPA 5JAOA 5JRZA 1KYIA 3ZJTA 2W4IA 3AUKA 1VRVA 2C8JA 2XHZA 4Y2YA 1RP7A 3BF7A 3TR5A 5CURA 3WGUA 2BMEA 3QNWA 1O6CA 4PGMA 2EJWA 3TTUA 2NO5A 1LLDA 1ZAKA 1T2VA 2NPIA 2NUAA 4GI7A 4M9QA 2BMVA 4GXQA 3SCZA 3UTCA 4LHSA 4YP9A 3KRTA 1M0SA 5DWQA 3KAKA 3SSOA 1YQXA 3DO8A 4OQ4A 1FDVA 1CE8A 2X86A 4HNSA 3MM4A 1M76A 1SCBA 4J7XA 4R2LA 4U7PB 1JDUA 4UUQA 2VIIA 5TXGA 1ZJWA 2VT7A 1M5UA 1XCPA 1PTKA 4XR4A 4KCGA 2W2NA 3S2EA 1MXHA 2DBQA 2VNJA 3T9AA 3TB6A 3PHIA 1L6IA 4RMJA 5EIBD 3WB2A 4DV7B 1CRPA 3U4HA 2FQWA 1JNXX 2GNOA 2IFTA 2BR3A 3ECCA 1WPGA 4YCDA 4A5OA 2JS7A 3G8DA 4MR8A 3COVA 3M2PA 4JP2A 4I6GA 3TTYA 5K0ZA 4DLWA 1A8IA 3HR7A 3IAS1 1GGHA 2PTGA 2GJ9A 4MYCA 4RULA 2XWSA 2BFCB 4LY9A 5A0FA 1O87A 3AC0A 3RRYA 2IY8A 4R0NA 3LCJA 5AKXA 3ER6A 3PFWO 4BMXA 3QENA 5FNZA 1YMVA 3N53A 2QD2A 4CV0A 2COEA 3AHFA 2AJBA 3LT0A 3DOOA 3N6VA 4NYIQ 1LB1B 1V11B 2Y66A 2Z2XA 3AR7A 4E2ZA 3ROGA 2ON6A 1ZGGA 2ERYA 5TGZA 4LYAA 2BW0A 4Q47A 1SCNE 3L7NA 4GE3A 3C5EA 4FIZA 5DRYA 1KRXA 1K75A 5CJPA 2ZTVA 4YJ3F 4B7CA 4C08A 4EW6A 1E2JA 3FOAA 2A0XA 2BJHA 1EDEA 1H9CA 3O82A 3CKLA 3QKUA 1X7XB 2WTBA 3HVHA 4M8LA 5CNIA 5CX1B 5B3AA 3TCNA 5IKXA 1WO8A 2OLEA 3QBVA 4E13A 3HO1A 3AOEA 2ZM5A 2MIIA 3H8JA 2J59A 4M9UA 1P8AA 1DAOA 4UARA 2XT9A 3VYSB 1N2CA 2CL6X 3ZIDA 2YIDA 4ZOLF 1RQPA 2M1XA 1J22A 2IYUA 3ONWA 5LCXA 1LZKA 2FN4A 4AZ0B 3D6UA 4HGZA 2PKYX 3E61A 3U0VA 4BLQA 3CCBA 4KACA 1E0AA 2MSEB 5EP4A 1ZH6A 3KKPA 5IC4A 4FHCA 4GNRA 3K9FC 3G5MA 1N9ZA 2I67A 1BO6A 2P9EA 2ZJ5A 2JCGA 3L8MA 3V4ZA 1ZGJA 1QHEA 2QJOA 3AUAA 1UAYA 1C1YA 3WLTA 3ZI0A 4E6PA 5IYZA 1TJYA 5LYJB 3A6PC 3JZFA 4Y98A 1KEVA 1P0MA 3U7GA 3UWDA 1ZFNA 2J9GA 1QQ7A 4D98A 5FADA 1PR6A 2EBUA 3PPXA 3ZTTA 4F3KA 1VG9B 1F20A 1W59A 2DWUA 3TUJC 3T9FA 3WGMA 3LOQA 4DIBA 4D92A 1CZHA 3S8MA 2QTHA 2HU7A 1ZAYA 1MEOA 1VIDA 3JQ9C 3OPXA 2VP2A 1KPGA 1DDIA 2IUTA 3QFHA 2GN9A 1MCZA 1FXWF 1I33A 2QTWB 1PZNA 2KB0A 4C03A 1XRMA 4Q3BA 2BLLA 4MO2A 3SN6A 1EVKA 1AJEA 3K31A 3VX3A 1RYMA 2EFEB 4HFMA 3V42A 1RTTA 3MJEA 1RQRA 3BAZA 2AFHB 2Z2JA 2FSSA 5A1JA 2WUFA 2C88A 1KYWA 1XEXA 3MPOA 4PG5A 3VZPA 1UFKA 4MWTA 1KKUA 1P44A 2YW9A 3DHNA 2XT0A 1GKUB 1M2OB 1PWEA 4JBGA 2B94A 1OFHA 2JGAA 2VTVA 4ZDJA 4G0WA 3P9PA 1V1JA 4QDZA 3L0IB 1RPNA 3TW8A 1W44A 2HWWA 3W3AA 1W5SA 3SHQA 3UICA 4A23A 5KSWB 4URXR 5KOYA 3O7WA 2HMAA 1P2UA 5BQ5A 2E6UX 3I45A 1PP4A 4H1VA 4UEOA 5EGNA 5HM6A 3GJ4A 1S6YA 5C1PA 4UTRA 5IJWA 1CPYA 1UBCA 1C30A 1LZLA 3HVIA 2Q07A 4XM1A 1JG2A 1S4MA 1GUAA 1BQEA 2JBAA 2PXXA 2RGXA 2W2PA 2G3YA 3BMQA 3OOWA 2YXDA 5IVDA 3GRFA 4Z1OA 1IB6A 4BNXA 2YC2C 1SHKA 1FQJA 3SQNA 3ZZTA 1ZLXA 1N75A 3GUYA 3LD9A 4YT4A 1XRLA 4MEBA 2M6LA 5KS2A 1IXKA 4PTLA 4YRCA 4F5WA 4MV0A 3H6KA 2WWHA 4D97A 3B6ZA 4FYYA 3OUZA 1SXPA 4RIFA 5C35A 3RADC 1RWMA 4ZOLB 2BHTA 2PO7A 3Q8MA 1JAXA 1Q0UA 3TZLA 2BMDA 3MD0A 5LA6A 1UKCA 3U3XA 4FLFA 4X7RA 1P4JA 5DSXA 5TSDA 2HK6A 3W79A 1EX1A 5K0GA 4EGAA 1J4AA 3ZJ5A 5BSWA 4ES6A 2ATCA 2PZ8A 2YV4A 1Y89A 4KDFA 1XBTA 3BAFA 4R2MA 3T5CA 3ZOKA 1KK3A 5E6UA 5NLLA 4B09A 1QBKC 2NVUB 3TJZA 1YOVB 2V65A 3GT4A 4PYQA 5CT4A 3OLZA 3BWDD 2X5NA 2XBLA 1DIOB 1GGNA 2H2DA 4AIIA 3NT5A 1O54A 3JPWA 3U6BA 4MUEA 1E18A 4QM7A 4ZT3A 3VKGA 2AOWA 2BSXA 1Y8CA 2WU1A 3U39A 5BPFA 2POCA 3D5QA 2B61A 4U2GA 5IDQA 3MMNA 2CLDX 2PGIA 4KPFC 2YY5A 1EZZA 1U3CA 2OHIA 2G67A 3CEAA 4KXFB 1WABA 2AZDA 1SO8A 4XASA 3VAYA 1FS5A 2GI4A 1ZU5A 2O1EA 1QU3A 3AM3A 4TWJA 1W2HA 1G16A 1WCXA 2NUBA 2YWCA 4AF6A 1J9GA 1ONPA 2CF5A 3QG1A 5C8YA 4XCQA 1Y8QB 4B83A 2ZBEA 3K8YA 1W0KD 5D2CA 1HNNA 5DLPA 1S8AA 3DE7X 1UBSB 3AEKA 5JS8A 2JFXA 1P77A 5EJ9A 5J58A 3E35A 1HDXA 4DIDA 3UH0A 2G82A 1GFSA 5SICE 2V8OA 3UT5B 4A8JB 3AIIA 1JBKA 3RSFA 2AZXA 3C3DA 4R05A 4BNHA 4EW2A 3JRWA 3H16A 1PL8A 1DAKA 4JKIA 5AKKA 3RNOA 4DW8A 4PCLA 2Y76A 4E5UA 1H65A 3FMVA 3LX5A 4YMWA 1H0HA 1NJ6A 1P0CA 1Z38A 2HLDA 3GLHB 3WZMA 4J9UE 3U7FB 2C4HA 1KY3A 4HI0E 4B8WA 4M9CA 3NBAA 3UHPA 1U1EA 2XRMA 3IUBA 3L6DA 2WZBA 1SG9A 4HAOA 4L28A 2ZYIA 5DLYA 4U2KA 2MINA 1IVYA 1O95D 2B1RA 2PMKA 3ZNNA 2VPIA 4D4HA 3MJTA 3X1JA 5LNK6 1YTUA 4ENQA 4OLHA 2RI6A 4Y2VA 2I80A 3CLTC 3UZUA 2J5KA 2FP4B 1GCIA 3M3HA 3DTYA 1YQTA 2H5LA 4QPPA 2X9GA 4DBLC 4A0RA 5F7OA 3AR8A 4C6TB 4JUFA 1V7PC 3N0WA 1V8FA 3JQCA 1Y4ZA 2HM7A 2CYCA 1YBFA 3G89A 4RXMA 2C4MA 1XTKA 3L6OO 4O4LA 1MJNA 3F74A 5TNXA 4ZKDA 5JRJA 3SY8A 4QBGB 2ZS7A 2BGNA 3PXEA 3D54D 1KMHA 2HV8A 1XA0A 1TK3A 2QVLA 1BQ3A 3GT3A 4L6CA 4NESA 1GTZA 1T8TA 2WZQA 3AIKA 4FQ7A 4KXYA 4Y1RA 3DLIA 2ZYHA 5DBFA 4TRJA 4G4JA 2PYIA 3K6SA 1GM5A 3IEVA 4HQ6A 1Z8DA 3SZGA 1JI3A 1II0A 1Z5WA 5IX8A 3HXQA 3GYGA 3B6EA 2E4WA 3DA8A 4LJ4A 1J5XA 4BNVA 1CQZA 4IHJA 2FQXA 4NQRA 2ANBA 4YRTA 2A1IA 3ZCPA 5DBHX 4XGQA 1TUBA 1TQ6A 3E7XA 1T2FA 3GAMA 5FWDA 3UK7A 3WMRA 3VSEA 1O89A 2FSGA 5LQJA 1I3MA 2WHRA 4AZSA 4RA6B 2P8JA 1DBWA 3WXMA 4E4RA 1H1LA 1PWZA 3NBXX 3BSYA 4I9UA 2VH2A 3KTDA 1M2GA 1OOEA 2M98A 2JCSA 3DCYA 3LHFA 3FPAA 3N0TA 1TUGA 2AFVA 4TYNA 5EUMA 3R5JA 4ZYTA 4LXYA 4EHNA 1UBKS 2Q6VA 3OX3A 4W9NA 2ZXUA 3UWPA 3DD1A 3FDIA 3GFBA 2QSUA 3SF8A 1J2JA 1XTBA 1UBNA 2JDIA 4H2DA 1B8UA 4RA9A 4BNWA 2VDPB 4B6GA 1TW2A 3EQ8A 4HMQA 4OQXA 4CKZA 3EGIA 3VR5H 1JDPA 4MQBA 1A27A 2OO5A 4ML3A 2VG8A 3RJTA 1PEDA 1TFUA 3ID6C 1HE2A 4MLCA 1DEXA 4Y0NA 2I87A 3JRXA 3RFVA 1EQAA 3DE6X 3VSAA 2GNAA 4X41A 1A4RA 2Q5OA 2ZYTX 1PX0A 2J3MA 1PRYA 2QRUA 1L9XA 1XTRA 2ETVA 2YWDA 3ZV6A 4UPDA 4ZOAA 2BGUA 2C61A 4BQSA 3IRVA 2UZ4A 5H0IA 4LIPD 1XTQA 2WMNB 4PHFA 3VKHA 3DC7A 2HYDA 2ARKA 4D3DA 3MB8A 1HPLA 3TLEA 3WZLA 1Z5PA 3OH8A 1GNLA 4G0VA 1BHO1 4UATA 3O8RA 1T4CA 4YI5A 2DSNA 1VBKA 4MHSA 4A8JC 4LF8B 4D57A 3DOIA 2HJGA 2BH9A 1KSHA 2EQBA 4DARA 4L5IA 5GOTA 4ZZ3A 1Z07A 2B1IA 5E1DA 1HURA 1Z7BA 4EB6B 4DV6B 2WOOA 3C1AA 3K09A 1CVRA 4Z54A 2C3OA 2WW8A 1KTVA 4BP8A 2PR2A 1DKQA 2QTZA 3J7TA 1PGPA 3G85A 1QNLA 2CDCA 3C8UA 3P26A 4BVKA 4YWJA 1PLJA 1XD8A 2NPOA 1JSZA 4FOLA 3PNLA 1U1FA 3H97A 4K40A 3JALA 3T4PA 1XP8A 4PCVA 2XKKA 4YUZA 3CXRA 5IJ9B 3U61B 4R6XA 3CH6A 4TTJA 1RWKA 3NB0A 5HIJA 3H2YA 3SC2B 2YCBA 2H54A 1XYYA 1SOUA 3W9YA 4CR7A 1YDMA 2OORC 3OU7A 2XTJA 1G5HA 3AESA 3IPLA 5JO9A 3BE8A 1H2RS 4GMFA 4CE6A 3ZDRA 2BDUA 5TPWB 3GVHA 3IUNA 4N7MA 4CIYA 5KB3A 2B20A 4EI9A 2H1LA 1J0EA 4BFLA 1U0LA 3FI9A 3IO5A 4DV3B 2N0SA 2OM2A 1SUFA 4O2AB 2ORWA 1S3SA 3UN1A 3W1VA 2RK4A 3JATB 1YFZA 1DRVA 1ADJA 2EFGA 3CUKA 3LDHA 3CNQS 5LIPA 1EUDA 3C74A 5CEEA 5L40A 2B8EA 3ZLTA 2YOFA 1K63A 1SCDA 5IMSA 4Q4CA 3AKCA 2GTIA 3PKJA 2GO7A 1KRHA 1XDDA 3GJTA 4F2WA 1USIA 4RV5A 5FPKA 3KE8A 2FCRA 2CZCA 3AGPA 5K0CA 2XZTA 4KQIA 3WFJA 1U90A 2BOVA 4L78A 1YZUA 5B1IA 4CMAA 4QYIA 4PZDA 5JCOA 2AJLI 2E6KA 4O3FA 3BXFA 4W4TA 4W82A 3OQVA 4PZCA 4L16A 4P92A 3A1CA 3IIKA 2WM2A 4Q7LA 4RSHA 4BQQA 4Z3OA 3VO1A 1ZMOA 1OZ0A 2DECA 1U7XA 2WILA 3WBFA 1UXHA 4CLOB 1CETA 1CZOA 1GPLA 2GNPA 3IBGA 2Z4SA 3QELA 2J4DA 4OYYA 5DWVA 3V3TA 3DLPX 3U9LA 4ENWA 3REFA 1MQAA 1NF3A 3M9XA 8OHMA 1E7WA 2IZ1A 4FZRA 3QFCA 2X6QA 3W2GA 1KO7A 2OV4A 1NXXA 2WJ4A 1LVUA 1DCKA 3L3BA 2QY6A 2Q1TA 4KLZA 2Q21A 1TQ8A 4IZHA 2C2HA 3QEKA 2K87A 2AEEA 2G71A 4NOMA 1E20A 1N3IA 4HRVA 3N6XA 4G1UC 4LHEA 1U2GA 4GM0A 1R1DA 5F52A 4C4SA 2VNHA 4E22A 4W9RA 4KITB 3VZCA 3CCFA 2ZRNA 3EQZA 1TUBB 2CYBA 2EP8A 3PC4A 4KQCA 1U9YA 1UM9B 1U9IC 1KYTA 1U98A 4PO9A 3ZWAA 1OLSA 3DCJA 2HLNA 4AG3A 1UMKA 3JWEA 1RLUA 3UXEA 1EHYA 4AN1A 1RKBA 1T5BA 5IHPA 4XJSA 4LDPA 4MVJH 5CVUA 1L5OA 5E4JA 3PNSA 2IU0A 3N8DA 1TZKA 5ENDA 3K0CA 4A15A 1EBUA 4XW2A 1G3QA 2Z09A 2AFIA 4MULA 4EF6A 2WIBA 1T6NA 1W1IA 3IYLW 2ONKA 3RAGA 3FCOA 3FYUA 1YZYA 3F6SA 4E30A 2VF4X 3FSGA 1O95C 4Z4GA 4ZALA 3GJ3A 3LVQE 4GW3A 2X0RA 3FPFA 4D4LA 3K9BA 3U5TA 4AULA 2WAMA 4C7VA 3R9WA 1EP3B 2D4HA 1VCOA 3MWDB 3FMFA 4KR0A 3N8IA 4JYPA 2W2QA 4AJEA 1E63A 2P4EA 1PS9A 3H83A 2CE2X 3BMCA 1EG2A 1DRWA 3ZIUA 1AK2A 5JAIA 3MT9A 4MEJA 1IZZA 3HJGA 3KOZA 1YJXA 5AI5A 5K6AC 1UFQA 2QTVA 3SIXA 1NL3A 3HJHA 4N7BA 3SI7A 5EMNA 3AEXA 4BN0A 5JYCA 2IGBA 2DUJA 1TNDA 3TUIC 2YQ5A 1Z06A 1L2TA 4FGKA 3FBTA 4Y3UA 5THXA 2ASVA 2AYXA 1JB9A 2BTOA 2XUZA 1EGAA 5CA0F 2C5LA 4LDAA 3GP3A 2ZUWA 3ZN2A 3WAJA 3CX3A 4NR0A 2PBFA 1W35A 2B92A 3PQ7A 1XNQB 1BE1A 2AKYA 2BV3A 2QF7A 5IAGA 5C34B 4ACAA 1D2GA 3HZOA 2GBIA 5EE3A 1YR7A 1FLAA 3UVEA 5JNLA 5JZMA 3RVPA 1N32B 3IHTA 3LPNA 4MIEA 5B57C 4NK4A 1V47A 2FZWA 3I4CA 3O8OA 4TTQA 3K8ZA 3B1JA 4KGXA 3ZS8A 2PRZA 1MVLA 4TSFA 4A6XA 2H00A 2W6NA 4F2GA 3AO0B 5C8XA 1U0OC 3PR2B 3FWNA 1X14A 4JI5B 3CF4A 1QORA 2ZUSA 1KC3A 5G4KB 3VXKA 2V3CC 2VNIA 2ZRQA 3HXLA 2H06A 4OH1A 2B4QA 4RJTA 1Z37A 5T8KC 1ANKA 1PWXA 3FPSA 4Q21A 1AUPA 1QM5A 2HDNB 4KKVA 3G5AA 4JUDX 4W6QA 3OCJA 1T4GA 2RGUA 3H1FA 5EQJB 4HZUB 4F84A 4LOLA 3W0LB 1ONNA 1W47A 2ZB7A 3QI7A 4IH4A 4KPGA 1Q0ZA 5E38A 2C2OA 2OCIA 1V5WA 2PZEA 2WFZA 3O9VA 4N5DA 2GTHA 4P31A 4ER3A 2AZMA 1SVIA 3DEYX 3BZWA 5K8JB 2X7JA 4HWRA 1PR1A 5FO0A 1JNYA 1Z3CA 2ZDGA 4YQYA 4EB0A 3BCRA 2IZ6A 2VQFB 3R75A 3AFHA 1ZICA 4JJKA 1PGJA 2OC9A 2WJYA 4Q4AB 1ITZA 2COUA 4H7JA 2E18A 3S99A 3LT5A 3WO1A 3ZHTA 1OXMA 1TX4B 3IBCA 4EEZA 2PJZA 2DFPA 4F45A 2JW5A 1TC1A 2QL9A 4FYHA 5FBWB 2XNCA 4ZZ1A 1Y81A 2WIGA 2H18A 3H65A 3VVLA 4GVPA 3UXYA 1AX9A 1RC0A 5TJHA 3OHMA 4PRLA 4ID3A 3BB4A 1QYIA 2YZ7A 2AG8A 4C3VA 4WXPA 3KNZA 3R5KA 4GRDA 4E14A 4X92A 4JLDA 4MARA 3T5MA 5IRCD 2JFFA 4FVTA 4TMFA 1K4YA 4BO7A 3HYRA 4ITRC 1GZUA 3STXA 4QZVA 4LY3A 2IY9A 4ZP1A 2D5IA 2IIPA 2XQJA 2P40A 4B74A 1ZJJA 3A37A 4IEFB 5CLGA 2VT6A 1VLQA 4BTLA 2ZJ0A 3WA6A 4LF5B 1NN0A 2JHGA 3FIUA 1TGYA 5G0SA 3MB5A 4X94A 3GJ0A 1E79A 2WNSA 5LNK1 2XDQB 1SBNE 2GCOB 1R88A 4MWCA 3QH4A 4NZOA 5B3JC 2EHDA 1EB9A 2ZB4A 2CBXA 4RE6A 1QHHB 2JIQA 4KAFA 4ARUA 5JISA 4GMDA 5KSYA 1YZTA 2WKPA 3JZAA 4B2IA 2O5EA 1KSJA 3AFGA 1L5NA 3NTUA 4D3FA 2O19A 4BV8A 3I09A 5B7NA 4F5YA 2HC9A 4HEA1 4R6WA 5B2EA 1LVHA 1KQOA 1QBGA 2Y1KA 5CM8B 4BNLA 3S55A 4NV1A 1IJKA 2VXBA 2VYCA 3DO5A 1U3FA 3ZXIA 2QD1A 2Y67A 3NFRA 4YX9A 1J7JA 2FSHA 5HE8A 2HBZA 1U3GA 1NW4A 3ICPA 1Q84A 1QAOA 1U1IA 1Y80A 1TB4A 3H4TA 3KX2A 3M5WA 4G6ZA 4IXTA 1K6JA 4C0WA 2OZEA 1GTL1 1K7YA 2VA9A 5EZQA 4OI2A 4XSVA 4CT4B 1MFZA 4OK6A 1YFLA 2IE0A 2E4VA 1RMQA 3S2IA 5ABPA 4LF4B 1XD9A 2YQ4A 3N05A 4IIJB 2C4VA 4O6VA 4BNUA 3OLWA 1P4SA 3SBEA 2PEZA 1H8EA 1E1DA 1JUDA 2JFWA 3ELWA 4MRAA 4C7OA 4XE5A 2AUNA 4YMIA 5ICFA 2CCKA 4PM4A 1WF3A 4B7UA 3LUPA 3ZD9A 5DOVA 3C85A 4C1NA 1GTSA 4TV9B 3IDSA 4P3OA 1QIHA 2R6CA 2YFYA 2OMEA 3RTAA 3ZLVA 3NGXA 2VAVA 3DZIA 3EF0A 3HJAA 4KXWA 1UBHS 4FSDA 5TE9A 5EIEA 1MABB 1ND6A 3I6QA 2ZSJA 4BCDA 4QU0A 5ALIA 1NW7A 1UBUS 2ZVJA 5IDVA 1P0IA 2GHIA 1J5PA 5L3QA 2O8EB 1M8FA 5CEJA 4GUDA 5ARDA 3O83A 3PZRA 5E9JA 4BNDB 2C95A 5CPFA 4MW0A 4IDEA 2CFOA 3IT1A 3VH2A 4BLPA 3COPA 4QG3A 3S7TA 3ZDXB 1J0CA 3QEJA 4UTZA 3RK1A 4C29A 1WPXA 4Q9KA 4TKZA 4KAXA 4I55F 1GKLA 2R62A 3C2QA 3PA6A 3PHLA 4BO0A 1MF7A 4EZEA 4NH4A 4JJAA 3KYCA 3A1FA 3M2TA 3M49A 1WCV1 1OKKD 1UT8A 3WGOA 3ZHCA 1EG7A 3O0DA 3WK5A 4KX3A 4U0JA 1RWOA 3QEMB 2R8ZA 1R7RA 4FN5A 4D0NA 4CXMA 3E48A 3KKOA 3PLRA 4RK1A 4F2DA 3LUHA 1YNSA 1QANA 5F35A 3PDIB 4X66B 3SYLA 4RELA 1M8KA 3FTPA 3PD0A 5K3FA 3OEED 4HZUA 2I33A 3GROA 5IAEA 2ONJA 1P5RA 4NZNA 5HVNA 1MX3A 2J0UB 2OV3A 3DBRA 3H2GA 3L0PA 4EWLA 3B3QA 1HI9A 1NE7A 1ODKA 3COZA 3EASA 3G2MA 3HRKA 4P53A 1BCSA 3EDOA 5DI9A 1NU6A 4EFLA 3EPRA 3WP0A 3A3NA 2RHLA 3USES 4B2LA 4DRXB 3JVUA 3WGTA 2O8DA 1QRDA 1CVLA 1EX6A 1BCRA 3P9CA 1MC5A 1MH9A 4Y2QA 1J42A 1R6VA 4P0PB 3GU3A 2H0AA 3KSMA 4I55A 1PNRA 1RYDA 3Q87B 4MGEA 2CDBA 3RM3A 4IXWA 3PGMA 1ZUNA 3S8YA 4FC6A 1FNDA 4FUTA 4K05A 2QNIA 2JLYA 1Z63A 2CXXA 4LJ6A 3M82A 3TZHA 4OQZA 3PTAA 5A3QA 4FYIA 3KJFA 2B30A 5ARCA 4OFXA 1I10A 4GPD1 4DR7B 1T1IA 3DF7A 4J1QA 1EWVA 3FNHA 4LZNA 3GP8A 1RJFA 3N87A 1W5TA 1BWPA 3ZV4A 4QHYA 2DT5A 2X40A 4HGYA 4N0QA 3L8EA 4I2VA 1Z4LA 2QE7A 2Z3WA 2IYYA 1CR0A 5AW3A 3EQ6A 3VJRA 4L4ZA 5CD1A 1QNFA 4X45A 4Q3EA 3HU1A 5HRAA 4RFVA 3DOFA 4HC4A 2C2ZA 4B81A 1QOPB 2H7VA 4PN3A 5HOEA 2YBDA 3HFGA 3W5HA 1T6XA 4UBKA 4D42A 1WB6A 3I0MA 3F67A 1X38A 4L1KA 2NT4A 3ODGA 5CFRA 5LL6P 1EUZA 4PLYA 3MGBA 3KB8A 4DXDA 3MINA 5KYWA 3ZZUA 1TLTA 3QZUA 3EARA 1PUJA 3B5JA 5ALJA 3B6IA 3FJ1A 3G0CA 3QUTA 5CEFA 1FF9A 4HL6A 1EXVA 1CLUA 3EAGA 5CJJA 2OWEA 3EHEA 5FH9A 3KTAB 2ZQZA 2PKRA 3E1GA 2QVGA 4F7DA 2C5FA 1TM1E 1UJ6A 1XTVA 2CLLB 2JJ2D 3I9V1 3K2BA 3O8OB 4I50A 2OFFA 3UPUA 1DE0A 4UXIA 4KO8A 3FR8A 4UEWA 3ZXXA 2QPOA 3CUVA 4QVGA 1NI5A 2Y9MB 4HFJA 1LPPA 5CLFA 1KH3A 1NQUA 4FJ1A 4FGUA 3ANYB 2FF7A 1OSNA 1LV8A 1NPTO 1Y33E 2B9EA 2EJCA 3B6JA 3PGLA 3RIEA 3TW6A 3VDXA 4UAGA 2AXNA 4IAOA 1QYDA 4K9MA 2PL1A 3S1AA 3GFTA 3UHJA 5BMOA 4M36A 2GPAA 3BBLA 1PF7E 1XL0A 5JBQA 3IP7A 5JJBA 1MV8A 2J6CA 2IEGA 1QK3A 5IBPA 3P32A 4PPFA 4PSVA 3TE7A 1KVQA 5FFNA 3OX2A 1G17A 4BQFA 1QU2A 1TO2E 2HU5A 1QO9A 3OQ1A 1LLCA 3OTIA 3Q7RA 3QBJA 1A8UA 4EYEA 1KIMA 3OQHA 1K9SA 3CPJB 2I8AA 4RHFA 1QZXA 1H2ZA 5J2TA 2ZG6A 2O7SA 4WNAA 2DB3A 5F73A 2Q3BA 2ORIA 2X1MA 4MA0A 4BX3A 1IWBB 1OU4A 3CN7A 3FH0A 5IDYA 3WLAA 3LXUX 4MWOA 1IMJA 2V0NA 3I05A 1I4TD 1Y63A 1GADO 1YL6A 3L40A 2CNKA 4Q82A 1Q0SA 4ACBA 2HQBA 1M10A 1LLFA 5AKEA 4ZVSA 3STHA 1Z39A 3DEJA 1FFEA 3FNFA 4PIVA 2VR1A 2J5XA 4RHXA 2GEKA 3AESB 4UJ5A 3VAZA 4KSCA 4ZVMA 2BLNA 2HBRA 2XLCA 2Y1DA 2PUHA 1I6MA 4WUTA 1AQ6A 1OAOC 3DG9A 5K3CA 1ZCBA 4WJKB 3EQ7A 3N8GA 1FSFA 3AEZA 4EX7A 4A2CA 3KU4A 4ROSA 4BQIA 3JAWA 1GPWB 4JSTA 1LDEA 3B89A 3H75A 3JATA 4BB5A 1PD0A 4DF3A 4DQLA 1CX9B 3CJQA 4GEGA 1XU9A 4WEOA 1T3SA 1WNFA 3DMTC 3GP5A 5GIOE 3U4DA 4KR9A 3MRVA 1CS4C 1NQ5A 3AETA 3I0NA 4JVMA 1JLHA 4IGIA 1V9CA 3EY4A 4AP6A 2WJWA 3QWFA 1NW3A 1SCQA 3CZAA 1ML4A 3OOEA 2GB4A 2B1QA 3IDZA 2Q50A 4HKTA 5F77A 1J9EA 4EQ6B 1J1UA 2GBGA 2C0PA 1BCSB 1BJTA 1NQWA 1PKEA 1XK6A 1ZIXA 4KOAA 4W5HA 4A10A 2GA9A 2O52A 2PM8A 3ACDA 3H05A 2HUNA 2JK1A 2LBPA 4DUYB 1V3TA 1FZQA 4DJDC 5B7GA 3PKZA 1EDZA 4EYQA 3TXAA 4D9JA 2C3YA 3ITDA 2Z6QA 5E3HA 4M86A 3Q9NA 1UANA 3O1JC 3PB3A 1BWRA 1C1XB 4KV9A 3V8PA 3WRXC 1XVTA 2H9YA 2NSJA 3TE6A 1YR1A 4G23A 4CI0B 2WAYA 1S89A 1IPEA 2FZCA 1R3DA 1V1RA 4EUFA 1EUCA 2DPXA 1W85A 1X70A 4URFA 8MHTA 1E9FA 4PGGA 1CUZA 3GOHA 4HATA 3PT5A 4D9NA 1NNI1 2YJNA 1EXMA 2JJ2A 2C7BA 5HQJA 1B4DA 3U49A 4D79A 2F1IA 2GPWA 3EH2A 3KUKA 1D2EA 3ORHA 4RCVA 3ZLBA 1H3FA 4UPEA 1KQGA 3HJRA 1FMFA 2O0LA 4MMXB 1A9TA 2YMMA 1STOA 4FYKA 4ZI5A 3A32A 5JAQA 1I5EA 3CV3A 4XYLA 4MP6A 4ZD6A 4WA8A 2YMLA 3ROZA 3MS7A 2OYSA 3UC9A 3UY4A 2D13A 2BMFA 2RC5A 4WHMA 2HCFA 3CBGA 3N1UA 2XEXA 2HBQA 1OWMA 4WKPA 4BX0A 1AKEA 3A11A 3I52A 5CFLA 2CNBA 2WFMA 4L4YA 2OXEA 1P1FA 4O1IA 3J7AC 3SQXA 5JTUA 1C4KA 1PLKA 1VP9A 2YW2A 3HCOA 1GYPA 3STTA 4OH7A 1ISHA 4BWVA 1QPBA 2GDZA 1QP7A 2XUPA 1YB2A 2Y4NA 2ZT7A 4IW3B 1YB7A 1S2DA 3THOA 3FCEA 4TUYB 4CIVA 4DPMA 3DL0A 3EPKA 1GFWA 3N5CA 2EZ9A 5D3ZA 1YDEA 5IN4A 2IDZA 1Y4DE 2BFFA 1QTIA