4TWYA

Structure of sars-3cl protease complex with a phenylbenzoyl (s,r)-n-decalin type inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Fused-ring structure of decahydroisoquinolin as a novel scaffold for SARS 3CL protease inhibitors
pubmed doi rcsb
source organism Human sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4twyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4twyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4twyA02
1PPZA 1WOFA 3RMOH 1ZJDA 1T8MA 1C1MA 3SJ8A 2QF0A 2ZEBA 4CBOA 2CGAA 3TH2H 3U8RH 2ZHDA 4ISIH 1QHRB 1UVPA 4BAHB 2STAE 1BMMH 1TX6A 1HPGA 3MU0A 1BRUP 1SGTA 1HAVB 4E7NA 5JBAS 2HGTH 2C8XB 2ODQA 2O8WA 1P57B 1BZXE 4MNYA 4UFDH 1O33A 2ZF0H 4B2BA 3UTUH 4Q80A 1QBVH 3CS0A 1UVSH 1O2WA 2WYJA 5EQRA 1Z1JA 3HK6B 2JETB 1O36A 4INLA 5AFZH 1GI2A 1ZMNA 1KDQA 1GBLA 1C1NA 1ZTJA 3TGIE 1VJAU 1B5GH 1MU8B 4ABHA 1NRRH 2AGEX 1BJVA 5FX6A 1O2ZA 2FPZA 2D26C 1A5GH 1WCZA 1ZTKA 2CHAC 4K5ZA 4AOQA 1KIGH 1MAYA 1GCTB 1GMHG 1GJ8B 1W7GH 3AW1A 1C2EA 3SU2A 3TU7H 4FUJA 2K1QA 3HGNA 2SGDE 1GVLA 1QBNA 1AMHA 1K2I1 1J15A 5A0BA 1O31A 2Z9JA 1O3BA 3BG4C 3TGJE 3A8DA 1EASA 4ASHA 4NG9H 2YNAA 1DWEH 2OQUA 3M5LA 3ODDA 2ZNKH 5HGGA 3UQVA 1TPPA 3SJOA 2P95A 1F0TA 3PMHB 1OWEA 1HV7A 3EA8A 3PMAB 3RXOA 3PLPA 3A82A 2WV5A 1NRQH 1Y3WA 2VJ1A 3QN7A 3ATKA 5EW1H 5B6OA 5DP6A 3EDXB 3MH7A 4JCNA 1O3NA 1O37A 1YPHC 1Z7KA 4B2CA 4ABIA 2PWXA 2XWAA 3M3VA 3KIDU 4R8TB 4I8JA 2PKSB 2O8LA 2ZFRH 4CRCA 3ODFA 1DE7H 3Q3XA 4GSOA 5L2YH 1TMUH 1LKBA 2FYRA 5GCHG 1H1BA 1KLTA 1NN6A 1QURH 4AG2A 3T28A 1YF4A 2UUKB 3RM0H 4KTSA 1ELDE 4WMFA 1OPHB 1L4DA 2FTLE 3FVFB 3GY5A 4BTIB 4TYDA 3MH4A 1AFQC 4I8GA 1GBKA 1ELCA 5A8XA 3RLWH 1HAVA 1NC6A 1GHAF 1ZLRA 1OOKB 4E06H 4I8KA 1ZHRA 1TYNA 3P95A 2OC0A 4ZHMU 3RP2A 4U32A 2TGPZ 1EOLA 1LQDB 4FUDA 4QT8C 4YOIA 1BJUA 2GP9B 2G4UA 4CR9A 5ABWA 1LTOA 2P59A 3LJJA 3BTGE 1OX1A 4AN7A 1BTHH 5AVDA 3KN2A 1F0RA 3HK3B 3RXBA 1YM0A 3SNBA 5JB8S 1Y59T 1UTLM 3SV7A 4I8LA 2FI3E 4HGCA 2GZ8A 2BD9A 4VGCB 1DS2E 1TGBA 2B9LA 1TONA 4Q2KA 4NWLA 1XVOA 1JRSA 1ELVA 2TRMA 1W3CA 1Q3XA 5GDSH 1AY6H 1AWHB 4CRAA 2AEIH 3GCHC 2GCTB 1PPGE 3KHVA 5E0JA 1TOCB 1TMBH 3LOXA 4LK4A 3T62A 3MO3A 2ZDNA 5HM9A 2SNVA 1TB6H 2ODPA 2QAAA 3A86A 5AFYH 4YESB 2BY6X 1O3HA 2HPPH 1DX5M 1ORFA 1ZMJA 3RXKA 2B8OH 1HJAB 5E2OA 3MU1A 3E1XB 2VIVA 1GDQA 1JOUB 2OINA 1N8OC 4X6PA 3VFEA 2A7HA 2BZAA 1KYNA 1BHXF 3A81A 1ZTLA 2FLRH 1O2PA 1TAWA 3SGAE 4Y11E 3RXMA 2VIDA 1C5XB 2JH0D 1KXFA 3M7UA 2UUFB 2FDAA 3S9CA 1S81A 4A5TS 1SQOA 1TIOA 2O8MA 1PJPA 3URCA 4MTBA 2RG3A 1BUIA 1ELAA 1MD7A 2BLVA 3QK1A 3KEEA 2IPHA 1GHBF 1WQVH 1C1TA 4NSVA 4NGAH 1BMLA 4Y71A 1T4UH 1O2VA 4M7GA 1C2GA 1MKWK 1SGFA 3KQEA 4FXGH 3NZIA 4Z6AH 1QCPA 5FBIA 2G81E 1DWDH 4AFZA 3SZNA 2Z3CA 3MNSA 1FY8E 1SGPE 3D65E 1P3CA 3URDA 1HAPH 1QIXB 4NIWA 1XXFA 2SGFE 4I31A 4Y8YA 1TA6A 1P02A 1C4U2 3EA9A 1HB0B 1UCYK 1NT1A 2A5IA 2BY8X 1HCGA 1PFXC 2O8TA 5C20A 1FPCH 1OXGA 3CS7A 1PYTC 1MZDA 2PHBA 1ZMLA 1CBWB 1P03A 3PMJA 3P6ZB 2F9VA 1SHYA 2P93A 1FJSA 1SB1H 2SFAA 3FP6E 2BQWB 1C1OA 2FOFA 5F8XA 3DD2H 1FN8A 1O2YA 1RTLA 3P17H 2D2DA 3BIVH 4A1VA 2ZFFH 1SQTA 4JZDH 5DP9A 1AB9C 2AGIX 1QQUA 3KQCA 4K2YA 1Y3XA 5HXFA 1C5RA 4SGAE 8LPRA 2ZU2A 1RFNA 2ZGBH 1DANH 1GI1A 4WH8A 8KME2 3ESTA 3VEQB 3UY9A 4UFFH 4Y0ZE 2VGCC 1GMCG 1ZRKA 3RXIA 2H5DA 1ELTA 2G55A 4DCDA 5EQQA 4BAMB 1BB0B 1HLTH 3GYLB 3NPSA 3GOVB 1TPOA 5I46H 3PWCA 2NWNA 1XUJA 1BTUA 2XNIA 4ISOA 2NU2E 5EPYA 1HBTH 1Z6JH 1B7XB 3ZVCA 2ZTXA 3EAJA 2ANYA 1P01A 1S0RA 1EATA 1F2SE 1YBWA 2J9NA 3ENSB 3R0FA 1O5CB 2NU3E 4HTCH 1J17T 2ULLA 3O8CA 1EAXA 1P04A 4HFPB 1KXAA 1SC8U 1NROH 4ABGA 1MTUA 2PW8H 2W5EA 4H6SB 5DKMA 1WV7H 3P8GA 1ZSLA 3NUMA 1LVBA 3FP8E 2Y7XA 1A3EH 4K3JA 1C5TA 4GPGA 2BDYA 4Y6DA 5L30H 1BHXB 4H6TA 4JZIA 4AFUA 1O5BB 3RXRA 1QJ7B 4ZAEA 5K7RA 4OS4A 3SU0A 1UTQA 1MTWA 4IMQA 1BBRH 2D1JA 2PFEA 5EW2H 1ESTA 3BTEE 2OC7A 1Z71A 4X2WA 2RA3A 4MNVA 3B9FH 2WPMS 1MBQA 1YP9A 1C2MA 3RXLA 3GCTG 1AWFH 1P2OA 3P8FA 2EI6A 5IDKA 4LZ4B 1TLDA 2CHAB 3M7QA 1DSUA 1O5DH 1C5QA 3F9EA 1YKTA 2ESTE 4ZXXH 2ODYB 1UTMA 1C4Y2 4JZEH 1V2KT 3VB5A 2IOTA 2UWLA 1Z8RA 2ZQ2A 2PR3A 1BRBE 2EA3A 1ABJH 1UVTH 1DICA 4WXVA 3RC6A 2WINI 3NWUA 4NZLA 1DWCH 3QGJA 1QNJA 3RU4T 3AASA 1BMNH 4K8YA 1ANDA 2H1UA 3L6PA 4XOJA 2C93B 1A5IA 3M7TA 2Q6DA 1VGCC 1YLDA 3BG8A 1Y3UA 4NSYA 5L2ZH 1GG6B 2G8TA 1UHBB 3QZRA 3Q77A 3Q00A 4U01A 5AHGH 1GMDG 3ATLA 4WF8A 3UR6A 1TQ7B 2FESH 2QY0B 5FXLA 4D9RA 1BBRE 1ESAA 1NESE 1QQ4A 5GCHF 3U1IB 1MTNC 1O2LA 3LU9B 1H4WA 1OWKA 1J8AA 2ZGCA 2BOKA 1YYY1 3HATH 2H6MA 3TLOA 1GDNA 1FONA 1P2IA 2ZQ1A 4ABEA 3GDSA 1KSNA 3ZVGA 4AFQA 1EB2A 5LGOA 4CR5A 1SGEE 1OWHA 2XBWA 2FLBH 1C5WB 3H7OA 3BIUH 4NIYA 2ZDVH 4IGDA 3E0NB 4AORA 3ZZ5A 3RXFA 4TWYA 3TK9A 3UOUA 1XUIA 7KMEH 1C2LA 1BOQA 2AFQB 4DGJA 3MOCA 1O3CA 1FI8A 3SHCH 1ACBE 2XCFA 2GDDA 3P8NA 3LONA 3DA9B 2BDAA 1TRYA 3ZVDA 2XYAA 2ANWA 2Y5FA 4Y0YE 1EOJA 2IJOB 2PKAB 5EPNA 1S6HA 1V2TT 4Z0KA 3GCHB 1DOJA 4BXSA 1Y3YA 1K1JA 4D7GA 4K1SA 1C1VH 3PTNA 1W0ZU 2HNTF 1IQNA 2J38A 1BTZA 1M9UA 4FU9A 2ZFTA 2HVXA 1C2HA 2FM2A 1TNKA 1Y3VA 1EUFA 1FUJA 1HAXB 4DIIH 5JDUB 2FOGA 2A5KA 3UWJH 3SV6A 1H8DH 1FIZA 4Q7ZA 1RXPA 3N7OA 2C8YB 2FMJA 1ZGVA 1ETRH 3DFJA 1O3AA 3ATMA 4NA7A 5JYIA 1S5SA 1P3EA 2BDHA 1O3EA 2BLOA 2J2UA 2BD8A 2P3TB 1AI8H 5LPFA 3TJOA 2WUBA 3T29A 3ZVEA 4IBLH 2J4IA 4X6MA 3SQHE 4KKDA 3A88A 4YM9A 1DT2A 1YCPM 5C5NA 3AAUA 1W14U 1W8BH 1C1UH 3U8OH 2ZGXH 1DVAH 1XVMA 2A32A 2TBSA 3GCNA 4HZHA 4A6LA 1SR5C 1C2IA 1WUNH 1QR3E 2BD7A 3RXQA 4ISNA 1D3DB 2QYIA 3O8BA 4X1SU 5E8EH 4BANB 1CA8B 4X0WU 3TH4H 1SGQE 4WJG2 1GI6A 4CRFA 2ANKH 2ZGJA 2ZDAH 4OS1A 5EXMA 3KQBA 2Q6GA 1FMGA 2QV1A 3EYDA 5FAHA 4GAWA 1THPB 2HPQH 2FP7B 2FWWA 2AERH 3NKKA 4X2YA 2B5TB 1RS0A 1EB1H 1JIRA 1V2LT 1WAYB 2ZU1A 2FTMA 3E91A 3OTJE 4DJZB 1GBHA 1QB1A 2BY5X 4MPWA 1ELGA 2ZU3A 4ZKNU 2SNWA 2F83A 2H5CA 4CH8B 1JRTA 2BZ6H 4K8BA 4ZHLU 4LXBH 1AN1E 3DT0H 4UONA 5GXPA 1T31A 1GBJA 1L1JA 1GJAB 3UNRA 4O9VA 1AB9B 4ABAA 4CRBA 1RTFB 6ESTA 1GJBB 1XKAC 3LGTA 1XX9A 4ZKSU 2BYAX 3D49H 3A7TA 2SGAA 1C5YB 2WPJS 2PKAA 3ZZDA 1CSOE 2IN2A 4K60A 2G00A 1OSSA 3QZQA 1P09A 2C8ZB 2FOBA 1GMCF 3A7WA 1EX3A 1TA2A 4ZXYH 2OCVB 3W95A 2ZHFH 3PO1C 2GMTC 3EQ0H 3BN9A 1IQIA 4JMYA 2Y81A 4Y7BA 5FCRA 2XBVA 1WYKA 1OP0A 2BXTH 2WPKS 3V3MA 4D7FA 1ZPBA 4KELA 3OYPA 1P11E 2QXGA 1FQ3A 1GHZA 4NFEA 5DO4H 1V6DA 1K1IA 4DURA 1DM4B 4A1XA 1P2JA 1IQHA 2RCEA 4MNWA 3A8AA 2HNTE 4Y10E 3SU3A 1B0FA 3E90B 1JMOH 1FLEE 1FXYA 2OLGA 1NU7B 4Y76A 1S83A 2BTCE 2J34A 1O3FA 4Y79A 3LH1A 3RXDA 2GT7A 2BVSH 2BVXH 1G36A 2AMPA 3A8BA 3GDVA 1V2WT 5TCCA 5ETXA 1O3OA 1V3XA 1EJNA 1Q31A 3TK5A 2ZDMA 1IOEA 1MQ5A 4ISHH 3L33A 1QGFA 3RXJA 1GVZA 2G5VA 1LHCH 3A7ZA 2PUQH 3ZZCA 1ZYOA 2C4FH 2ZDLA 4XSKU 3ZZ7A 2Q6FA 1K1MA 4TPIZ 1O2HA 3GCTF 1DUEA 1A0LA 2J92A 3I29A 4ZUHA 1RD3B 1TGNA 1N6XA 1OYQA 2A2XH 1EPTC 1E0FD 1SLUB 3SO3A 1VZQH 2UWOA 3MNXA 2Y5GA 2XBYA 1LO6A 4FU8A 1AGJA 1AQ7A 3GY6A 2FZZA 1K22H 3RLYH 1CT0E 5EXLA 1FZZA 2ZHWH 4A92A 1NRNH 4F4OC 1TRNA 4WH6A 1V2UT 1RRKA 2EI7A 2AMQA 2Z6BD 5GIBA 3LGWA 1FAKH 2FX4A 1GJ9B 4B71A 1C2KA 4INKA 2K7XA 1LPGB 1V2RT 3PROA 4IC6A 3SGBE 1EP6A 1DXPA 1F0SA 3D62A 3M3SA 1DDJA 3SBKA 4YLQH 1IQFA 1ARBA 3D23A 3F9GA 4IC5A 3QWCH 1MAXA 3ITIA 3M35A 1SGDE 3LC3A 4ZROA 2XTTB 4CH2B 3LPRA 3QLPH 2UUYA 2VVUA 4JK6A 2LIZA 3U1JB 1QB6A 5GPIB 1A7SA 1MKXH 4AGKA 1VJ9U 1GMDF 5FPTA 2VVVA 1HDTH 2CJIA 1P06A 1OP8A 3K9XB 3GICB 1NU9A 5DGJA 1F5KU 5LH8A 1P0SH 1FN6A 3TK6A 1RIWB 1UTJA 3GY7A 1UK2A 3TH3H 1NPMA 3KGPA 3MO6A 2ZTYA 2XCNA 4E7RG 2TPIZ 2ZCKP 4ESTE 1GBCA 3SJIA 1C1SA 3S7HB 2PTNA 2OC1A 4X8VH 5DP8A 1K21H 1PPFE 5EODA 1GI3A 2PGBB 5DP4A 1AVGH 1WQSA 1GHVH 1VCPA 5JPMH 2A4OA 2TGTA 3BV9B 3L3TA 1LHGH 4D8NA 1H9IE 5EU8A 2BLQA 2Z9IA 1C5OH 2ZFPH 2GT8A 4O97A 1CA0C 3SN8A 3Q3YA 1GI4A 1IHSH 3P8OA 2G4TA 1W10U 1O30A 1RTKA 5L6NH 1MD8A 1QA7A 2Y5HA 1G32B 2W7UA 4NIXA 4DY7B 3MU8A 1TNIA 4R0IA 2WUCA 2DE8A 1GBMA 1P2MA 1EJMA 5TCAA 1HNEE 1DLEA 3LKWA 5FPSA 1KXEA 3SU4A 1MCVA 1TX7A 3GY8A 1HUTH 2R2WU 2M5TA 2ZWLH 1GJ6A 1YGCH 2QXJA 3EA7A 5LPEA 3LIWA 1BIOA 2PV9B 1Y8TA 2O9QA 1DWBH 1O3JA 1O32A 1NFYA 3FANA 5A8YA 2C90B 3HGPA 4CRGA 3LGYA 4AYVB 3SI3H 2VWMA 1UO6A 3E6PH 3R3GB 5C2ZA 1QRZA 3T25A 5C67A 1C5MD 1BTWA 1ELFA 5GJ4B 4YT6H 2WPIS 3E8LA 1GGDB 3SJKA 1CT4E 5F6MA 1OYTH 1QBOA 1FAXA 3MMGA 3SNCA 2XW9A 2JKHA 3Q76A 2CN0H 3PM3A 3QTOH 1AFEH 3TPIZ 2FIRH 1MZAA 2VIWA 1LVOA 2JETC 2GV6A 2GTBA 2ZC9H 3HPTB 3LJOA 4BTUB 2QC2A 1IAUA 1G3DA 2V0BA 5CHAB 1JXPA 3LGVA 1SLXB 6LPRA 1GJDB 2BMGB 3MH5A 2H2ZA 1P05A 1O2MA 1L0ZA 1BTPA 3ZZ9A 1XUGA 1TALA 4MPXA 2PSYA 1GCTC 1MBMA 1ZR0A 1C9TA 4AYYB 1MCTA 2ANMH 1V2QT 2VIQA 1EP5A 1P2NA 2GX4A 2OC8A 3UNQA 4FUEA 1H8IH 2ZI2H 1HIAB 1GI8B 3SQEE 2PTCE 1GI9B 1XUHA 2YNBA 1YLCA 1W12U 2VU8E 1UK3A 4GVUA 5HMAA 2EC9H 1T32A 1TQ0B 1YPMH 1HGTH 2WPHS 1PQ8A 2SGPE 1CHOG 1P2KA 1DY8A 3U98H 3TJVA 1VITH 2FS8A 3B8JA 4NCYA 2A2QH 3M36A 3S9AA 1SG8B 4WY3A 1GWAA 4CHAC 2FOMB 2A45B 2LPRA 4I32A 3BTTE 3A7YA 4Q7XA 5A2MH 2STBE 1XXDA 3PO1B 1A61H 5JB9S 1SGCA 1D4PB 1UVUH 1T7CA 3C1KA 1GBDA 3A87A 3SJ9A 1WTHD 4KP0A 4X6OA 5E0GA 3AAVA 3H7TA 4X6NA 2VIPA 4TPYA 1O2IA 1HAOH 3BG4B 3C27B 2BDBA 5BPEA 3RXVA 1MQ6A 4O03A 1GBTA 1MTSA 2GVFA 1ZHMA 1S0QA 2ZZUH 3VXFH 1EZUC 2W3IA 3B23B 1YPLH 3F68H 5DP5A 3ZZAA 3P92A 1SFIA 4WWYA 4A7IB 1O2KA 2ZFQH 2O8UA 4Y8XA 4XDEA 1CGJE 3MTYA 4DVAU 2ZCLP 1KLIH 4E05H 1A1RA 3RU4E 3PWBA 3F9FA 5SGAE 2JH6D 2VVCA 3A7VA 2DE9A 3K2UA 5FX5A 3UFAA 3QUMP 1E36B 1F5RA 2ZGHA 2BM2A 1TPAE 3MU5A 1G3CA 1YPHE 3BTWE 1LQEA 4J2YB 2GDEH 1O3IA 3Q3KA 1GHXH 2ILNA 5T6GA 1VCQA 1O38A 4YT7H 3MFJA 1PQ7A 2ZO3H 3QTVH 4FVDA 1ZHPA 1TABE 3KL6A 1D6RA 1AFQB 1AVXA 2GCTC 5JBCS 2AIQA 3UREA 1F7ZA 1EPTB 5ESBA 1KXCA 3LDXH 5K0HA 1O2UA 4NA8A 5G4BA 1O2OA 1UVOA 3BEIB 1D3PB 4NWKA 4ZKRU 1SMFE 1SLVB 3H5CB 3NXPA 2QN5T 1C2FA 4UFEH 5DPAA 3MO9A 1N6YA 1ZGIA 1GBAA 1D3TB 1C1QA 2G51A 1FY1A 4IS5A 3HKJB 2A1DB 1Z8GA 5EXNA 1LKAA 3F6UH 3VGCC 1VR1H 1AUJA 1OWDA 1UTPA 5BRRE 4UD9H 3K65B 4NA9H 3RC5A 1SPJA 3SNAA 1HXEH 1O34A 3S9BA 1PQ5A 1CT2E 4OS7A 2QGRA 2LNCA 3AW0A 4NZQA 1MTVA 5T3HA 3PMBB 2ZU5A 1O3KA 3TNSA 1HAHH 4AB8A 2ZCHP 1AE5A 1O2JA 3U69H 1GJCB 1EXFA 3LT3A 2EEKA 1SOZA 1O2QA 3ZZ6A 2FOAA 2RA0A 1UTNA 1N1LA 1GL1A 1PPHE 2HLCA 1YC0A 1F5LA 2UWPA 2Y7ZA 1XMNB 5J4SA 1AU8A 3SUEA 2Z9GA 4Q7YA 3QX5H 3KQDA 3OX7U 2BQ7B 1IQJA 3A8CA 1YPGH 3FAOA 1CHGA 1BRAA 1KDQB 2ZPSA 3VB4A 1N8OB 1O2GH 2DUCA 4D9QA 4HI3A 2UUJB 4GUXA 1ETTH 1Z6EA 1W11U 3PYHA 3A80A 1AHTH 4FUFA 2A4GA 1CE5A 1CBWC 1HJ8A 1W7XH 4IN2A 1X7AC 1UHBA 2ZTZA 3SU6A 1NY22 4WMEA 1C1PA 1NTPA 1MMJN 4MVNA 4BOHA 1CQQA 3QGNB 1MKWH 1CGIE 3ZYEA 1VITG 3NCLA 2F9PA 3EGKH 1SVPA 4B75A 3SW2B 1C5NH 1FY5A 2FX6A 3FFGA 1AIXH 4JZFH 4FVBA 4LZ1H 1K1PA 1SGNE 3IITA 1GBFA 1IHTH 1C1RA 2PLXA 4XBDA 2BD2A 3F9HA 3AVZA 1ARCA 1UCYH 4PROA 1ANCA 1HXFH 1HAYB 2JH5D 3T27A 1KXDA 2VH6A 1KTSB 4AG1A 3TGKE 1FY3A 4YOGA 1BTXA 1K28D 1DLKB 1Q2WA 2BD3A 2HWLB 2B0FA 2PSXA 3KNXA 1HAGE 1TOMH 2YOLA 4X1NU 2W7SA 9ESTA 3UQOA 4OS2A 2G52A 4X1PU 2FYQA 4ABJA 1WBGB 6CHAC 2Z94A 5T6DA 1YCPK 3PLKA 4XFQA 3M37A 4IMZA 1S82A 1O3DA 1S6FA 1LHFH 1GI0A 2ALVA 3BEUA 2V35A 1LCYA 1L1GA 3RXPA 3LC5A 4RKOB 2CV3A 3ZYDA 2BDCA 3TVJB 3T5FH 1O3LA 1DPOA 1ZOMA 2FS9A 3VB7A 1HAZB 1IQKA 1ETSH 4GHQA 1OKXA 3BTQE 3U9AH 5DJ7A 1P12E 3UWIA 1LDTT 1SGYE 2VGCB 2VH0A 1L1NA 3O8RA 4U2WA 1LPKB 1OS8A 3A84A 1G9IE 1JBUH 3SUFA 4OGYA 1O5AB 5A0AE 1A5HA 1W0YH 2GCHG 4FU7A 1O0DH 3K6YA 4WMDA 1QL8A 4I8HA 2R0KA 1C4V2 5C3NA 1W2KH 2Z9LA 3MNBA 1CU1A 4FUCA 2Z7FE 2ZHEH 1DUAA 1KTTB 4JZ1A 3SUGA 1E37B 1O2RA 4ABFA 5CE1A 3TJUA 3MWIU 1BBRK 4YOJA 3RXHA 1UCYE 3WY8A 1DSTA 1EAUA 3T26A 3NK8A 1BCUH 1Z1IA 2WV4A 1F0UA 5T6FA 2ASUB 3RXAA 4DG4A 2GV7A 1K9OE 3MYWA 1WSSH 3RXCA 1IQLA 4AX9H 1LHEH 1NRSH 4BAKB 1GI7B 1SLWB 1XUKA 4YLUA 1BRCE 3V13A 1ZJKA 1ZPZA 1SQAA 1RGQA 5I25A 1KY9A 1AVWA 2F3CE 1T4VH 2CF8H 1GBBA 3BTME 1CHOF 2GD4B 1BQYA 1O5EH 2Q1JA 3BTDE 1E34B 1T8OA 4B2AA 3ELAH 1G37A 4UE7H 2PGQB 1IQMA 4CHAB 1NM6A 3MU4A 4JYVH 1A0HB 1GG6C 3OY6U 4XBBA 2RDLA 3EE0B 2R9PA 1QRWA 1Y5UT 1ESBA 1P10A 1SL3A 4TY6A 1AE8H 2OP9A 2BLWA 2CMYA 3JZ1B 3O8DA 1YPJH 1V2VT 2F9UA 5CMXH 3KF2A 3UUZA 1G3EA 3ZVBA 2R3YA 3LGUA 4MPUA 1CO7E 2ZKSA 4JYTA 3EBNA 1GI5A 2H9TH 7GCHG 3SGQE 1TMTH 1WTGH 2A7JA 5E0HA 3V0XA 5DK1A 1UTKA 1QRXA 4X8TH 3V7TA 2QF3A 1GHWH 1RJXB 2VNTA 4DIHH 2KAIB 2XWBI 4CREA 1JIMA 4DOQA 3SOSA 1VGCB 2HALA 2FO9A 3STJA 8GCHF 4RSPA 1GCDA 1ID5H 1HYLA 5IYTA 1A3BH 2AH4X 1QA0A 3P70B 2QXHA 1FV9A 2C3SA 3FP7E 1K1LA 1T8LA 2F91A 1TBQH 1P8VC 1OP2A 1THSH 5LPRA 1MTNB 3TNTA 2J94A 4GCHG 1ZPCA 1HJ9A 1V2ST 4ZH8A 2FI4E 1AO5A 2W26A 4X8SH 3CENA 1QL9A 2BB4A 1SBWA 6GCHG 1E35B 1Z8IB 1V2OT 2BY9X 3T2NA 4ZKOU 3ATIA 3E0PB 2OD3B 3S0NA 2FODA 2EI8A 1JWTA 3OU0A 2J95A 2TGAA 1GL0E 3OY5U 1GPZA 1D3QB 2VWOA 2R3UA 2XC4A 3KCGH 4O3UA 4AGJA 2P94A 3DHKH 3RXTA 2FXRA 1O35A 3G01A 2H9EH 3W94A 1BT7A 2VWNA 4U30A 3FZZA 4GLYA 3VGCB 4O3TA 1PQAA 3SNEA 2P3UB 2P8OC 1S85A 1S84A 3BTHE 2PUXB 2OBQA 1IQEA 1D9IA 1TNLA 2R0LA 4X2XA 3UIRA 2F9BH 4MQAA 1SHHB 1PPCE 1P9UA 1KXBA 5PTPA 1C5PA 1V2JT 1EQ9A 4KGAA 2THFB 5F8TA 4NFFA 1EAWA 2FEQH 4MLFB 5HYOA 2BHGA 1P2QA 2XXLA 2BVRH 2OTVA 3VB6A 4MNXA 1CVWH 4UDWH 4D76A 3RM2H 2I6QA 9LPRA 1SGFG 5ESTE 1C2DA 2Z3EA 4ZMAH 3BSQA 3QO6A 2ZG0H 1O2TA 2F9NA 3MNCA 3LH3A 1J9CH 2VIOA 1Z8JB 4GHTA 3QDZB 1GBIA 2KAIA 2VWLA 4ISLA 3RUOA 1HFDA 3A7XA 1QJ6B 2ZU4A 4WXIA 3ATWA 2P16A 2XRCA 3M5OA 1EAIA 2D8WA 4YTAA 1VCWA 2AMDA 1UTOA 1UMAH 1ABIH 4B76A 3TIUA 1XM1A 8ESTE 1VITF 1GHYH 3GISB 2BXUH 4XBCA 5FPYA 4JK5A 3SUDA 3BF6H 1A2CH 1LVYA 2BX3A 3V12A 3VXEH 4ABDA 2G5NA 3PV4A 5JBTA 2FI5E 4H4FA 4YZUA 4J1YA 5C1YA 5FBEA 2OXSA 2TGDA 3RXEA 1IQGA 1XKBC 1YCPH 1E38B 2BDIA 3MI4A 3A89A 2VINA 4MPVA 1G2LA 4F49A 1U6QA 4I33A 2GZ9A 4CRDA 2A4RA 3FZDA 3MH6A 3I78A 1OWJA 1C9PA 1TE0A 3SV2H 1SGIB 1W13U 2TIOA 3GY4A 4FUGA 1BA8B 6CHAB 2HNTC 2BY7X 2C8WB 3GY2A 2I6SA 1MH0A 1P9SA 2R2MB 1DFPA 1LVMA 5H4IB 2SGQE 4MDSA 1C2JA 4NIVA 4THNH 3VPKA 3SNDA 1PPBH 4X8UH 3E16B 2V3HH 1LHDH 2VB0A 3PTBA 4RN6A 5EOKA 4OS6A 1UJ1A 1BTYA 1SSXA 1A0JA 4X1RU 1NO9H 4CBNA 2HRVA 2GKVE 2H9HA 1NZQH 1TFXA 2Y6TA 2CXVA 2WYGA 3PLBA 1G3BA 1TNJA 2AYWA 2PKSC 1NRPH 2ZPQA 2FOCA 2GMTB 4OS5A 4K1EA 2OUAA 2GCHF 2ZPRA 2B7DH 3JZ2B 4X1QU 1GJ4H 1K1NA 1GJ5H 1H9HE 2BDGA 5A0CA 4DW2U 2BX4A 1OWIA 3UPEA 1F92A 1G30B 2A4QA 2Z9KA 2ZP0H 5DG6A 3MHWU 2ZA5A 4INHA 3RU4D 3ZZ3A 3OSYA 4BXWA 1TNGA 3SV8A 1GHAG 2XBXA 2BD5A 2A31A 4FUBA 2FOHA 2P3FH 1A46H 3RMMH 4RKJB 1GMHF 4IW4E 4K69A 3STIA 1ZSJA 1O39A 4B73A 5J4QA 5GWZA 4Y7AA 1QB9A 1FPHH 3M61U 2GGVB 1O3GA 3ZZ8A 1O2XA 4K1TA 1AZZA 2AGGX 2NU4E 4YO9A 1QL7A 2A7CA 4BAQB 8GCHG 3A83A 4UEHH 2QIQA 2BD4A 1HRTH 3UNSA 1BDAA 4BTTB 3A85A 4ABBA 3VB3A 3HKIB 3SV9A 4FUHA 1AUTC 1TGTA 4VGCC 1GDUA 5F8ZA 1QJ1B 1G2MA 5TJXA 1AD8H 1DITH 1O5FH 1AKSB 1J16A 4TWWA 5C1UA 1K1OA 3M5NA 3GCOA 1SFQB 5FCKA 2ZIQH 3RMLH 5A09A 1D6WA 1NFUA 1HIAA 1HAIH 3LGIA 3SI4H 1MUEB 3ZVFA 3M3TA 1C1WH 2ZDKA 1DY9A 4B1TA 1ELBA 3I77A 4BNRA 2AS9A 2Y82A 1ZRBA 3SU5A 3F1SB 4AFSA 4JYUH 2GZ7A 3PB1E 1C5VA 1HJAC 5EG4A 4OGXA 1RIWC 1V2NT 1FNIA 3IWMA 3TITA 1B0EA 3ZZBA 3ZZ4A 4SGBE 4WVPE 2W3KA 1EKBB 3SORA 1LMWB 3DUXH 3K6ZA 3RXGA 1C5ZB 1O2SA 1LPZB 1C5LH 1MKXK 2NU1E 1EZXC 2BOHB 2OBOA 3RMNH 1O5GH 1GJ7B 4H42U 7GCHF 1TX8A 1C5SA 3SU1A 1DXWA 2A0QB 1NFXA 1Y5BT 1SI5H 4FUIA 1FIWA 1O2NA 3S7KB 2SGEE 1GVKB 1CGHA 2WPLS 3GY3A 1EJAA 1SOTA 1SGRE 2NU0E 1EZSC 1FY4A 2FOEA 4LOYH 5EQSA 2A5AA 3RDZA 2XC5A 1TPSA 3ZV9A 1GHBG 2QA9E 1TGCA 1V2PT 1ELEE 2BQ6B 3TJNA 1J14A 5EGMA 7LPRA 2F9OA 1KLJH 1O3PB 1QTFA 1L4ZA 3GYMA 4IN1A 1NFWA 5F03A 4ZHAA 3E3TA 1WU1A 3S69A 1ZZZA 3BTFE 5JBBS 4DT7B 2ZECA 4UFGH 1TBRH 3GDUA 3RXSA 4GCHF 4AZ2B 1FDPA 5C1XA 5AF9H 1O3MA 1MU6B 3UOPA 4X2VA 1ANEA 1H9LB 3RC4A 5A8ZA 1C5UA 2V3OH 3UR9A 2Z3DA 2Y80A 4AB9A 1GBEA 6GCHF 1TNHA 2ZHQH 4I7YH 5C5OA 2V6NA 2OQ5A 1AKSA 4MG3A 2QCYA 3ZVAA 5FHTA 1Y5AT 2AIPA 5E2PA 2ZFSA 1GGDC 2XC0A 3IG6B 3BTKE 4Y8ZA 1A4WH 1CA0B 1NS3A 3ZV8A 1BITA 2P8OB 3M5MA 5HM2A 1L2EA 1XUFA 1YPKH 1PYTD 5DP7A 3DFLA 1EPTA 1T8NA 3U8TH 1TGSZ 1PPEE 2HOBA 4BAOB 4TY7A 1INCA 4KTCA 1ANBA 3SHAH 2QXIA 4KTUA 3RXUA 1YPEH 1QY6A 1THRH 4A1TA 5DP3A 3BEFB 3CP7A 7ESTE 1EZQA 5CHAC 1TBZH 1ZSKA 1BMAA 1AZ8A 1QFKH 2ALPA 1UK4A 1TWXB 4B74A 1V2MT 4XE4A 1TRMA 2CF9H
chains in the Genus database with same CATH superfamily
1PPZA 1WOFA 3RMOH 1ZJDA 1T8MA 1C1MA 3SJ8A 2QF0A 2ZEBA 4CBOA 2CGAA 3TH2H 3U8RH 2ZHDA 4ISIH 1QHRB 1UVPA 4BAHB 2STAE 2JIZD 1BMMH 1TX6A 1HPGA 3MU0A 1BRUP 1SGTA 1HAVB 4E7NA 5JBAS 2HGTH 2C8XB 2ODQA 2O8WA 1P57B 1BZXE 4MNYA 4UFDH 1O33A 2ZF0H 4B2BA 3UTUH 4Q80A 1QBVH 3CS0A 1UVSH 1O2WA 2WYJA 5EQRA 1Z1JA 3HK6B 2JETB 1O36A 2M2AA 4INLA 5AFZH 1GI2A 1ZMNA 1KDQA 1GBLA 1C1NA 1ZTJA 3TGIE 1VJAU 1B5GH 1MU8B 4ABHA 1NRRH 2AGEX 1BJVA 3PV2A 1O2ZA 5FX6A 2FPZA 2D26C 2F4LA 1A5GH 1WCZA 1ZTKA 2CHAC 2K0QA 4K5ZA 4AOQA 1KIGH 1MAYA 2J97A 4DT4A 1GCTB 1GMHG 1GJ8B 1W7GH 3AW1A 1C2EA 3SU2A 3TU7H 4FUJA 2K1QA 3HGNA 2SGDE 3KYFA 1GVLA 1QBNA 1AMHA 1K2I1 1J15A 5A0BA 1O31A 2Z9JA 1O3BA 3BG4C 3TGJE 3A8DA 1EASA 2QF4A 4NG9H 4ASHA 2YNAA 1DWEH 2OQUA 3M5LA 3ODDA 2ZNKH 5HGGA 3UQVA 1TPPA 3SJOA 3GS9A 2P95A 1F0TA 3PMHB 1OWEA 1HV7A 2AHME 3EA8A 3PMAB 3RXOA 3PLPA 3A82A 2WV5A 1NRQH 1Y3WA 4OM9A 3F3BA 2VJ1A 3QN7A 3ATKA 5EW1H 5B6OA 5DP6A 3EDXB 3MH7A 4JCNA 1O3NA 1O37A 1YPHC 1Z7KA 2V3MA 4B2CA 4ABIA 2PWXA 4ACBA 2XWAA 3M3VA 3KIDU 4R8TB 4I8JA 2PKSB 2O8LA 2ZFRH 4CRCA 3ODFA 1DE7H 3Q3XA 4GSOA 5L2YH 1TMUH 1LKBA 2FYRA 5GCHG 1H1BA 1KLTA 1NN6A 1QURH 4AG2A 3T28A 1YF4A 2UUKB 3RM0H 4KTSA 1ELDE 4WMFA 1OPHB 1L4DA 2FTLE 3FVFB 3GY5A 4BTIB 5KGOA 4TYDA 3MH4A 1AFQC 4I8GA 1GBKA 1ELCA 5A8XA 3RLWH 1HAVA 1NC6A 1GHAF 1ZLRA 5B6LA 1OOKB 3WWBA 4E06H 4I8KA 1ZHRA 1TYNA 3P95A 2OC0A 4ZHMU 3RP2A 4U32A 2TGPZ 5FL7D 1EOLA 1LQDB 4FUDA 4QT8C 4YOIA 1BJUA 2GP9B 2G4UA 4CR9A 5ABWA 1LTOA 2P59A 3LJJA 3BTGE 1OX1A 4AN7A 1BTHH 5AVDA 2YMSC 3KN2A 1F0RA 3HK3B 3RXBA 4RI0A 1YM0A 3SNBA 5JB8S 1Y59T 1UTLM 3SV7A 4I8LA 2FI3E 4HGCA 2GZ8A 2BD9A 4VGCB 1DS2E 1TGBA 2B9LA 1TONA 4Q2KA 4NWLA 1XVOA 1JRSA 1ELVA 2TRMA 1W3CA 1Q3XA 2JJ2D 5GDSH 1AY6H 1AWHB 2JDID 4CRAA 2AEIH 3GCHC 2GCTB 1PPGE 3KHVA 5E0JA 1TOCB 1TMBH 3LOXA 4LK4A 3T62A 3MO3A 2ZDNA 5HM9A 2SNVA 1TB6H 2ODPA 2QAAA 3A86A 5AFYH 5C0TA 4YESB 2BY6X 1O3HA 2HPPH 1DX5M 1ORFA 1ZMJA 3RXKA 2B8OH 1HJAB 5E2OA 3MU1A 3E1XB 2VIVA 1GDQA 1JOUB 2OINA 1N8OC 4X6PA 3VFEA 2A7HA 2BZAA 1KYNA 1BHXF 3A81A 3DSPA 1ZTLA 2FLRH 1O2PA 1TAWA 3SGAE 4Y11E 3RXMA 2VIDA 1C5XB 2JH0D 1KXFA 3M7UA 2UUFB 2FDAA 3S9CA 1S81A 4A5TS 1SQOA 1TIOA 2O8MA 1PJPA 3MQKC 3URCA 4MTBA 2RG3A 1BUIA 1ELAA 1NBMD 1MD7A 2BLVA 3QK1A 3KEEA 2IPHA 1GHBF 1WQVH 1C1TA 4NSVA 4NGAH 1BMLA 4TT3D 4Y71A 1T4UH 1O2VA 4M7GA 1C2GA 1MKWK 1SGFA 3KQEA 4FXGH 3NZIA 4Z6AH 4AC9A 1QCPA 5FBIA 2G81E 1DWDH 2V7QD 4AFZA 3SZNA 2Z3CA 3MNSA 1FY8E 1SGPE 3D65E 1P3CA 3URDA 1HAPH 1QIXB 4NIWA 1XXFA 2J5UA 2SGFE 4I31A 4Y8YA 1TA6A 1P02A 1C4U2 3EA9A 1HB0B 1UCYK 1NT1A 2A5IA 2BY8X 1HCGA 1PFXC 2O8TA 5C20A 1FPCH 1OXGA 3CS7A 1PYTC 1MZDA 2PHBA 1ZMLA 1CBWB 1P03A 3PMJA 3P6ZB 2F9VA 1SHYA 2P93A 1FJSA 1SB1H 2SFAA 3FP6E 2BQWB 1C1OA 2FOFA 5F8XA 3DD2H 1FN8A 1O2YA 1RTLA 3P17H 2D2DA 3BIVH 4A1VA 2ZFFH 1SQTA 4JZDH 5DP9A 1AB9C 2AGIX 1QQUA 3KQCA 4K2YA 1Y3XA 5HXFA 3KYGA 2CK3D 1C5RA 4SGAE 8LPRA 2ZU2A 1RFNA 2ZGBH 3OE7D 1DANH 1GI1A 4WH8A 8KME2 3ESTA 3VEQB 3UY9A 4UFFH 4Y0ZE 2VGCC 1GMCG 1ZRKA 3RXIA 2H5DA 1ELTA 2G55A 4DCDA 5EQQA 4BAMB 4B6EA 1BB0B 1HLTH 3GYLB 3NPSA 2RDEA 3GOVB 1TPOA 5I46H 3PWCA 2NWNA 1XUJA 1BTUA 2XNIA 4ISOA 2NU2E 5EPYA 1HBTH 1Z6JH 1B7XB 3ZVCA 2ZTXA 3EAJA 2ANYA 1P01A 1S0RA 1EATA 1F2SE 1YBWA 2J9NA 3ENSB 3R0FA 1O5CB 2NU3E 4HTCH 1J17T 2ULLA 3O8CA 1EAXA 1P04A 4HFPB 1KXAA 1SC8U 1NROH 2WPDD 1MTUA 2PW8H 2W5EA 3WW7A 4H6SB 4ABGA 5DKMA 1WV7H 3P8GA 1ZSLA 3NUMA 1LVBA 3FP8E 2Y7XA 1A3EH 4K3JA 1C5TA 4GPGA 2BDYA 4Y6DA 5L30H 1BHXB 1BMFD 4H6TA 4JZIA 2RFKC 4AFUA 1O5BB 3RXRA 1QJ7B 4ZAEA 5K7RA 4OS4A 3SU0A 1UTQA 1MTWA 4IMQA 3WWFA 1BBRH 2D1JA 2PFEA 3FO8D 5EW2H 1ESTA 3BTEE 2OC7A 1Z71A 4X2WA 2RA3A 4MNVA 3B9FH 2WPMS 1MBQA 1YP9A 1C2MA 3RXLA 3GCTG 1AWFH 1P2OA 3OAAD 3P8FA 2EI6A 1YWUA 5IDKA 4LZ4B 1TLDA 2CHAB 3M7QA 1DSUA 1O5DH 5HKKD 1C5QA 5DN6D 3F9EA 1YKTA 2ESTE 4ZXXH 2ODYB 1UTMA 1C4Y2 4JZEH 1V2KT 3VB5A 2IOTA 2UWLA 1Z8RA 2ZQ2A 2PR3A 1BRBE 2EA3A 1ABJH 1UVTH 1DICA 5CDFE 4WXVA 3RC6A 2WINI 3NWUA 4NZLA 1DWCH 3QGJA 1QNJA 3RU4T 3AASA 1BMNH 3F0PA 4K8YA 1ANDA 2H1UA 3L6PA 4XOJA 2C93B 1A5IA 3M7TA 2Q6DA 1VGCC 1YLDA 3BG8A 1Y3UA 4NSYA 5L2ZH 1GG6B 2G8TA 1UHBB 3QZRA 3Q77A 3Q00A 4U01A 5AHGH 1GMDG 3ATLA 4WF8A 3UR6A 1TQ7B 2FESH 2QY0B 5FXLA 2QF5A 4D9RA 1BBRE 1ESAA 1NESE 1WXRA 1QQ4A 5GCHF 4F48B 3U1IB 1MTNC 1O2LA 3LU9B 1H4WA 1OWKA 1J8AA 2ZGCA 2BOKA 1YYY1 3HATH 2H6MA 3TLOA 1GDNA 1FONA 1P2IA 2ZQ1A 4ABEA 3GDSA 1KSNA 3ZVGA 4AFQA 1EB2A 5LGOA 4CR5A 1SGEE 1OWHA 2XBWA 2FLBH 1C5WB 3H7OA 3BIUH 4NIYA 2ZDVH 4IGDA 3E0NB 4AORA 3ZZ5A 3RXFA 4TWYA 3TK9A 3UOUA 1H8HD 1XUIA 7KMEH 1C2LA 2XNDD 1BOQA 2AFQB 4DGJA 3MOCA 1W0JD 1O3CA 5EJ1A 1FI8A 3SHCH 1ACBE 2XCFA 2GDDA 3P8NA 3LONA 3DA9B 2BDAA 1TRYA 3ZVDA 2XYAA 2ANWA 2Y5FA 4Y0YE 1EOJA 2IJOB 2L74A 4YXWD 2PKAB 5EPNA 1S6HA 1V2TT 4Z0KA 3GCHB 1DOJA 4BXSA 1Y3YA 1K1JA 4D7GA 4K1SA 1C1VH 3PTNA 1W0ZU 2HNTF 3SYJA 1IQNA 2J38A 1BTZA 1M9UA 4FU9A 2ZFTA 2HVXA 1C2HA 2FM2A 1TNKA 1Y3VA 4TSFD 1EUFA 4B6FA 2EQNA 1FUJA 1HAXB 4DIIH 3NRLA 2FOGA 5JDUB 2A5KA 3UWJH 3SV6A 1H8DH 1FIZA 4Q7ZA 1RXPA 3N7OA 2C8YB 2FMJA 1ZGVA 1ETRH 3DFJA 1O3AA 3ATMA 4NA7A 5JYIA 1S5SA 1P3EA 2BDHA 1O3EA 2BLOA 2J2UA 2BD8A 2P3TB 1AI8H 5LPFA 3TJOA 2WUBA 3T29A 3ZVEA 4IBLH 2J4IA 4X6MA 3SQHE 4KKDA 3A88A 4YM9A 1DT2A 1YCPM 5C5NA 3AAUA 1W14U 1W8BH 1C1UH 3U8OH 2ZGXH 1DVAH 1XVMA 2A32A 2TBSA 3GCNA 4HZHA 4A6LA 1SR5C 1C2IA 1WUNH 1QR3E 2BD7A 3RXQA 4ISNA 1D3DB 2QYIA 3O8BA 4X1SU 5E8EH 4BANB 1CA8B 4X0WU 3TH4H 1SGQE 4WJG2 1GI6A 4CRFA 2ANKH 2ZGJA 2ZDAH 4OS1A 5EXMA 3KQBA 2Q6GA 1FMGA 2QV1A 3EYDA 5FAHA 4GAWA 1THPB 2HPQH 2FP7B 2FWWA 2AERH 3NKKA 4X2YA 2B5TB 1RS0A 1EB1H 1JIRA 1V2LT 1WAYB 2ZU1A 2FTMA 3E91A 3OTJE 4DJZB 1GBHA 5EJZA 1QB1A 2BY5X 4MPWA 1ELGA 5F53A 2ZU3A 4ZKNU 2SNWA 2F83A 2H5CA 4CH8B 1JRTA 2BZ6H 4K8BA 4ZHLU 4LXBH 1AN1E 3DT0H 4UONA 5GXPA 1T31A 3H09A 1GBJA 1L1JA 1GJAB 3UNRA 4O9VA 1AB9B 4ABAA 4CRBA 1RTFB 6ESTA 1GJBB 1XKAC 3LGTA 1XX9A 4ZKSU 2BYAX 3D49H 3A7TA 2SGAA 1C5YB 2WPJS 2PKAA 3ZZDA 1CSOE 4Z1MD 2IN2A 4K60A 2G00A 1OSSA 4ASUD 3QZQA 1P09A 2C8ZB 2FOBA 2KZ4A 1GMCF 3A7WA 1EX3A 1TA2A 4ZXYH 2OCVB 3W95A 2ZHFH 3PO1C 2GMTC 3EQ0H 3BN9A 1IQIA 4JMYA 2Y81A 4Y7BA 5FCRA 2XBVA 1WYKA 1WDIA 1OP0A 2BXTH 2WPKS 3V3MA 4D7FA 1ZPBA 4KELA 3OYPA 2WV9A 1P11E 2QXGA 1FQ3A 1GHZA 4NFEA 5DO4H 1V6DA 1K1IA 4DURA 3KQ5A 1DM4B 4A1XA 1P2JA 3OFND 1IQHA 2RCEA 4MNWA 3A8AA 2HNTE 4Y10E 3SU3A 1B0FA 3E90B 1JMOH 1FLEE 1FXYA 2OLGA 1NU7B 4Y76A 1S83A 2BTCE 2J34A 1O3FA 4Y79A 3LH1A 3RXDA 2GT7A 2BVSH 2BVXH 1G36A 2AMPA 3A8BA 3GDVA 1V2WT 5TCCA 5ETXA 1O3OA 1V3XA 1EJNA 1Q31A 3TK5A 2ZDMA 1IOEA 1MQ5A 4ISHH 3L33A 1QGFA 3RXJA 1GVZA 2G5VA 1LHCH 3A7ZA 2PUQH 3ZZCA 1ZYOA 2C4FH 2ZDLA 4XSKU 3ZZ7A 2Q6FA 1K1MA 4TPIZ 1O2HA 3GCTF 3DCLA 1DUEA 1A0LA 2J92A 3I29A 4ZUHA 1RD3B 1TGNA 1N6XA 1OYQA 2A2XH 1EPTC 1E0FD 1SLUB 3SO3A 1VZQH 2UWOA 3MNXA 2Y5GA 2LP6A 2XBYA 1LO6A 4FU8A 1AGJA 1AQ7A 3GY6A 1SQRA 2FZZA 1K22H 3RLYH 1CT0E 5EXLA 1FZZA 2ZHWH 4A92A 1NRNH 4F4OC 1TRNA 4WH6A 3AK5A 1V2UT 1E79D 1RRKA 2EI7A 2AMQA 2Z6BD 5GIBA 3LGWA 1FAKH 2FX4A 1GJ9B 4B71A 1C2KA 4INKA 1E1QD 2K7XA 1LPGB 1V2RT 3PROA 4IC6A 3SGBE 1EP6A 1DXPA 1F0SA 3D62A 3M3SA 1DDJA 3SBKA 4YLQH 4ZCNA 1IQFA 1ARBA 3D23A 3F9GA 3OEHD 4IC5A 3QWCH 1MAXA 3ITIA 3M35A 1SGDE 3LC3A 4ZROA 2XTTB 3EE7A 3LPRA 4CH2B 3QLPH 2UUYA 1UW7A 2VVUA 4I86A 4JK6A 2LIZA 3U1JB 1QB6A 5GPIB 1A7SA 1MKXH 4AGKA 1VJ9U 1GMDF 5FPTA 2VVVA 5C94A 1HDTH 2CJIA 1P06A 1OP8A 3K9XB 3GICB 1NU9A 5DGJA 1F5KU 5LH8A 1P0SH 1FN6A 3TK6A 1RIWB 1UTJA 3GY7A 1UK2A 3TH3H 1NPMA 3KGPA 3MO6A 2ZTYA 2XCNA 4E7RG 2TPIZ 2ZCKP 4ESTE 1GBCA 3PRBA 1C1SA 3SJIA 3S7HB 2PTNA 2OC1A 4X8VH 5DP8A 1K21H 1PPFE 5EODA 1GI3A 2PGBB 5DP4A 1AVGH 1WQSA 1GHVH 1VCPA 5JPMH 2A4OA 2TGTA 3BV9B 3L3TA 1LHGH 4D8NA 1H9IE 5EU8A 2BLQA 2Z9IA 1C5OH 2ZFPH 2GT8A 4O97A 1CA0C 3SN8A 3Q3YA 1GI4A 1IHSH 1W0KD 3P8OA 2G4TA 1W10U 1O30A 1RTKA 5L6NH 1MD8A 1QA7A 2Y5HA 1G32B 3VG8A 2W7UA 4NIXA 3CNRA 4DY7B 3MU8A 1TNIA 1H8ED 4R0IA 2WUCA 2DE8A 1GBMA 1P2MA 1EJMA 5TCAA 1HNEE 1DLEA 3LKWA 5FPSA 1KXEA 2KR7A 3SU4A 1MCVA 1TX7A 3GY8A 1HUTH 2R2WU 2M5TA 2ZWLH 1GJ6A 1YGCH 2QXJA 3EA7A 5LPEA 3LIWA 1BIOA 4ACAA 2PV9B 2K8IA 1Y8TA 2O9QA 1DWBH 1O3JA 1O32A 4P00A 1NFYA 3FANA 5A8YA 2C90B 2LELA 3HGPA 4CRGA 3LGYA 4AYVB 3SI3H 2VWMA 1UO6A 3E6PH 3R3GB 5C2ZA 1QRZA 3T25A 5C67A 1C5MD 1BTWA 1ELFA 5GJ4B 4YT6H 2WPIS 3E8LA 1GGDB 3SJKA 1CT4E 5F6MA 1OYTH 1QBOA 1FAXA 3MMGA 3SNCA 2XW9A 2JKHA 3Q76A 3N99A 2CN0H 3PM3A 3QTOH 1AFEH 3TPIZ 2FIRH 1MZAA 2VIWA 1LVOA 2JETC 2GV6A 4Q4LA 2GTBA 2ZC9H 3HPTB 2XOKD 3LJOA 2WHXA 4BTUB 2QC2A 1IAUA 1G3DA 2V0BA 5CHAB 1JXPA 3LGVA 2KX4A 5EIYA 1SLXB 6LPRA 1GJDB 2BMGB 3MH5A 2H2ZA 1P05A 1O2MA 1L0ZA 1BTPA 3ZZ9A 1XUGA 1TALA 4MPXA 2PSYA 1GCTC 1MBMA 1ZR0A 1C9TA 4AYYB 1MCTA 2ANMH 1V2QT 5DSFA 2VIQA 1EP5A 1P2NA 2GX4A 2OC8A 3UNQA 4FUEA 1H8IH 2ZI2H 1HIAB 4HG6A 1GI8B 3SQEE 2PTCE 1GI9B 1XUHA 2YNBA 1YLCA 2IJD1 1W12U 2VU8E 1UK3A 2HVYB 4GVUA 5HMAA 2EC9H 1T32A 1TQ0B 1YPMH 1HGTH 2WPHS 1PQ8A 2SGPE 1CHOG 1P2KA 1DY8A 3U98H 3TJVA 1VITH 2FS8A 3B8JA 4NCYA 2A2QH 3M36A 3S9AA 1SG8B 4WY3A 3N7EA 1GWAA 4CHAC 2FOMB 2A45B 2J98B 2LPRA 4I32A 3BTTE 3A7YA 4Q7XA 5A2MH 2STBE 1XXDA 3PO1B 1A61H 5JB9S 1SGCA 1D4PB 1UVUH 1T7CA 3C1KA 1GBDA 3A87A 3SJ9A 1WTHD 4KP0A 4X6OA 5E0GA 3AAVA 3H7TA 4X6NA 2VIPA 5EJLA 4TPYA 1O2IA 1HAOH 3BG4B 3C27B 2BDBA 5BPEA 3RXVA 1MQ6A 4O03A 1GBTA 1MTSA 2GVFA 1ZHMA 5GNDA 1S0QA 2ZZUH 3VXFH 1EZUC 2W3IA 3B23B 1YPLH 3F68H 5DP5A 3ZZAA 3P92A 1SFIA 4WWYA 4A7IB 1O2KA 2ZFQH 2O8UA 4Y8XA 4XDEA 1CGJE 3MTYA 4DVAU 2ZCLP 1KLIH 4E05H 1A1RA 3RU4E 3PWBA 3F9FA 5SGAE 2JH6D 2VVCA 3A7VA 2DE9A 3K2UA 5FX5A 3UFAA 3QUMP 4FETA 1E36B 1F5RA 2ZGHA 2BM2A 1TPAE 3MU5A 1G3CA 1YPHE 3BTWE 1LQEA 4J2YB 2GDEH 1O3IA 3Q3KA 1GHXH 2ILNA 5T6GA 1VCQA 1O38A 2PP6A 4YT7H 3MFJA 1PQ7A 2ZO3H 4M9FA 3QTVH 4FVDA 1ZHPA 1TABE 2GJGA 3KL6A 1D6RA 1AFQB 1AVXA 2GCTC 5JBCS 2AIQA 3UREA 1F7ZA 3DSOA 1EPTB 3F2HA 5ESBA 1KXCA 3LDXH 5K0HA 1O2UA 4NA8A 5G4BA 3U28C 1O2OA 1UVOA 3BEIB 1D3PB 4NWKA 4ZKRU 1SMFE 1SLVB 3H5CB 3NXPA 2QN5T 1C2FA 1SKYE 4UFEH 5DPAA 3MO9A 1N6YA 2YMSB 1ZGIA 1GBAA 1D3TB 1C1QA 2G51A 1FY1A 4IS5A 3HKJB 2A1DB 1Z8GA 5EXNA 2J98A 1LKAA 3F6UH 3VGCC 1VR1H 1AUJA 1OWDA 1UTPA 2KCOA 4UD9H 5BRRE 3K65B 4NA9H 3RC5A 1SPJA 3SNAA 1HXEH 1O34A 3S9BA 1PQ5A 1CT2E 4OS7A 2QGRA 2LNCA 3AW0A 4NZQA 1MTVA 5T3HA 3PMBB 2ZU5A 3F2FA 1O3KA 1VKYA 3TNSA 1HAHH 4AB8A 2ZCHP 1AE5A 1O2JA 3U69H 1GJCB 1EXFA 3LT3A 4FOUC 2EEKA 1SOZA 1O2QA 3ZZ6A 2FOAA 2RA0A 1UTNA 1N1LA 1GL1A 1PPHE 2HLCA 1YC0A 1F5LA 2UWPA 2Y7ZA 1XMNB 5J4SA 1AU8A 2W6ID 3SUEA 2Z9GA 4Q7YA 3QX5H 3KQDA 3OX7U 2BQ7B 1IQJA 3A8CA 1YPGH 3FAOA 1CHGA 1BRAA 1KDQB 2ZPSA 3VB4A 1N8OB 1O2GH 2DUCA 4D9QA 4HI3A 2UUJB 4GUXA 1ETTH 1Z6EA 1W11U 3PYHA 3A80A 1AHTH 4FUFA 2A4GA 1CE5A 1CBWC 1HJ8A 1W7XH 4IN2A 1X7AC 1UHBA 2ZTZA 3SU6A 1NY22 4WMEA 1C1PA 1NTPA 1MMJN 4MVNA 4BOHA 1CQQA 3QGNB 1MKWH 1CGIE 3ZYEA 1VITG 3NCLA 2F9PA 3EGKH 1SVPA 4B75A 3SW2B 1C5NH 1FY5A 2FX6A 3FFGA 1AIXH 4JZFH 4FVBA 4LZ1H 1K1PA 1SGNE 3IITA 1GBFA 1IHTH 1C1RA 2PLXA 4XBDA 2BD2A 2IPQX 3F9HA 3AVZA 1ARCA 1UCYH 4PROA 1ANCA 1HXFH 1HAYB 2JH5D 3T27A 1KXDA 2VH6A 1KTSB 4AG1A 3TGKE 1FY3A 4YOGA 3ZIAD 1BTXA 1FX0B 1K28D 1DLKB 1Q2WA 2BD3A 2HWLB 2B0FA 2PSXA 3KNXA 1HAGE 1TOMH 2YOLA 4X1NU 2W7SA 9ESTA 3UQOA 4OS2A 2G52A 4X1PU 2FYQA 4ABJA 1WBGB 6CHAC 2Z94A 5T6DA 1YCPK 3PLKA 4XFQA 3M37A 4IMZA 1S82A 1O3DA 1S6FA 1LHFH 1GI0A 2ALVA 3BEUA 2V35A 1LCYA 1L1GA 3RXPA 3LC5A 3PRDA 4RKOB 2CV3A 3ZYDA 2BDCA 3TVJB 3T5FH 1O3LA 1DPOA 1ZOMA 2FS9A 3VB7A 1HAZB 1IQKA 1ETSH 4GHQA 1OKXA 3BTQE 3U9AH 5DJ7A 1P12E 3UWIA 5HIYA 1LDTT 2EY4C 1SGYE 2VGCB 2VH0A 1L1NA 3O8RA 3FN8A 4U2WA 1LPKB 1OS8A 3A84A 1G9IE 1JBUH 2W6JD 4OGYA 1O5AB 3SUFA 5A0AE 1A5HA 1W0YH 2GCHG 4FU7A 1O0DH 3K6YA 4WMDA 1QL8A 4I8HA 2R0KA 1C4V2 5C3NA 1W2KH 2Z9LA 3MNBA 1CU1A 1KMHB 4FUCA 2Z7FE 2ZHEH 1DUAA 1KTTB 4JZ1A 3SUGA 1E37B 1O2RA 4ABFA 5CE1A 3TJUA 3MWIU 1BBRK 4YOJA 3RXHA 1UCYE 3WY8A 1DSTA 1EAUA 3T26A 3NK8A 5CHBA 1BCUH 1Z1IA 2WV4A 1F0UA 5T6FA 2ASUB 3RXAA 4DG4A 2GV7A 1K9OE 3MYWA 1WSSH 3RXCA 1IQLA 1OHHD 4AX9H 1LHEH 1MABB 1NRSH 4BAKB 1GI7B 1SLWB 1XUKA 4YLUA 1BRCE 3V13A 1ZJKA 1ZPZA 1SQAA 1RGQA 1YLNA 5I25A 1KY9A 1AVWA 3OTPA 2F3CE 1T4VH 2CF8H 1GBBA 3BTME 1CHOF 2GD4B 1BQYA 1O5EH 2Q1JA 3BTDE 1E34B 1T8OA 4B2AA 3ELAH 4Q63A 1G37A 4UE7H 2PGQB 1IQMA 4CHAB 1NM6A 3MU4A 4JYVH 1A0HB 1GG6C 3FOAA 3OY6U 4XBBA 2RDLA 3EE0B 2R9PA 1QRWA 1Y5UT 1ESBA 1P10A 1SL3A 4TY6A 1AE8H 2VBCA 2OP9A 2BLWA 2CMYA 3JZ1B 3O8DA 1YPJH 1V2VT 2F9UA 5CMXH 3KF2A 3UUZA 1G3EA 3ZVBA 2R3YA 3LGUA 4MPUA 1CO7E 2ZKSA 4JYTA 3EBNA 1GI5A 2H9TH 7GCHG 3SGQE 1TMTH 1WTGH 2A7JA 5E0HA 3V0XA 5DK1A 1S6LA 1UTKA 1QRXA 4X8TH 3V7TA 2QF3A 1GHWH 1RJXB 2VNTA 4DIHH 2KAIB 2XWBI 4CREA 1JIMA 4DOQA 5T1VA 3SOSA 1COWD 1VGCB 2HALA 2FO9A 3STJA 8GCHF 4RSPA 1GCDA 1ID5H 1HYLA 5IYTA 1A3BH 2AH4X 1QA0A 3P70B 2OK5A 2QXHA 1FV9A 2C3SA 3FP7E 1K1LA 1T8LA 2F91A 1TBQH 1P8VC 1OP2A 1THSH 5LPRA 1MTNB 3TNTA 2J94A 4GCHG 1ZPCA 1HJ9A 1V2ST 4ZH8A 2FI4E 1AO5A 2W26A 4X8SH 3CENA 1QL9A 2BB4A 1SBWA 6GCHG 1E35B 1Z8IB 1V2OT 2BY9X 3T2NA 4ZKOU 3ATIA 3E0PB 2OD3B 3S0NA 2FODA 2EI8A 1JWTA 2F43B 3OU0A 3OEED 2J95A 2TGAA 1GL0E 3OY5U 1GPZA 3W1EA 1D3QB 2VWOA 2R3UA 2XC4A 3KCGH 4O3UA 4AGJA 2P94A 3DHKH 3RXTA 2FXRA 1O35A 3G01A 2H9EH 3W94A 1BT7A 2VWNA 4U30A 3FZZA 4GLYA 3VGCB 4O3TA 1PQAA 3SNEA 2P3UB 2P8OC 1S85A 1S84A 3BTHE 2PUXB 2OBQA 1IQEA 1D9IA 1TNLA 2R0LA 4X2XA 3UIRA 2F9BH 4MQAA 1SHHB 2QE7D 1PPCE 1P9UA 1KXBA 5PTPA 1C5PA 1V2JT 2WZQA 1EQ9A 4KGAA 2THFB 5F8TA 4NFFA 1EAWA 2FEQH 4MLFB 5HYOA 2BHGA 1P2QA 3UAIC 2XXLA 2BVRH 2OTVA 3VB6A 4MNXA 1CVWH 4UDWH 4D76A 3RM2H 2I6QA 9LPRA 1SGFG 5ESTE 1C2DA 2Z3EA 4ZMAH 3BSQA 3QO6A 2ZG0H 1O2TA 2F9NA 3MNCA 4P02A 3LH3A 1J9CH 2VIOA 1Z8JB 4GHTA 3QDZB 1GBIA 2KAIA 2VWLA 4ISLA 3FKSD 3RUOA 1NBME 1HFDA 3A7XA 3PV5A 1QJ6B 2ZU4A 4WXIA 3ATWA 2L6OA 2P16A 2XRCA 3M5OA 1EAIA 2D8WA 4YTAA 1VCWA 2AMDA 1UTOA 1UMAH 1ABIH 4B76A 3TIUA 1XM1A 8ESTE 1VITF 4XD7D 1GHYH 3GISB 2BXUH 4XBCA 5FPYA 4JK5A 3SUDA 2KM0A 5KECA 3BF6H 1A2CH 1LVYA 2BX3A 3V12A 3VXEH 4ABDA 2G5NA 3PV4A 5JBTA 2FI5E 4H4FA 4YZUA 4J1YA 5C1YA 5FBEA 2OXSA 2TGDA 3RXEA 1IQGA 1XKBC 1YCPH 1E38B 2BDIA 3MI4A 3A89A 2VINA 4MPVA 1G2LA 4F49A 1U6QA 4I33A 2GZ9A 4CRDA 2A4RA 3FZDA 3MH6A 3I78A 1OWJA 2KFWA 1C9PA 1TE0A 3SV2H 1SGIB 1W13U 2TIOA 3GY4A 4FUGA 1BA8B 4XRNA 2HNTC 6CHAB 2BY7X 2C8WB 3GY2A 2I6SA 1MH0A 1P9SA 2R2MB 5C17A 1DFPA 1LVMA 5H4IB 2SGQE 4MDSA 1C2JA 4NIVA 4THNH 3VPKA 3SNDA 1PPBH 4X8UH 3E16B 2V3HH 1LHDH 2VB0A 3PTBA 4RN6A 5EOKA 4OS6A 1UJ1A 1BTYA 1SSXA 1A0JA 4X1RU 1NO9H 3F0OA 4CBNA 2HRVA 2GKVE 2H9HA 1NZQH 1TFXA 2WSSD 2Y6TA 2CXVA 2WYGA 3PLBA 1G3BA 1TNJA 2AYWA 2PKSC 1NRPH 2ZPQA 2FOCA 2GMTB 4OS5A 4K1EA 2OUAA 2GCHF 2ZPRA 2B7DH 3JZ2B 4X1QU 1GJ4H 1K1NA 1GJ5H 1H9HE 2BDGA 5A0CA 4DW2U 2BX4A 1OWIA 3UPEA 1F92A 1G30B 2A4QA 2Z9KA 2ZP0H 5DG6A 3MHWU 2KCPA 2ZA5A 4INHA 1E1RD 3RU4D 3OSYA 3ZZ3A 4BXWA 1TNGA 3SV8A 1GHAG 2XBXA 5IK2D 2BD5A 2KCAA 2A31A 4FUBA 2FOHA 2P3FH 1A46H 3RMMH 4RKJB 1GMHF 4IW4E 4K69A 3STIA 1ZSJA 3DSGA 1O39A 4B73A 5J4QA 5GWZA 4Y7AA 1QB9A 1FPHH 3M61U 2GGVB 1O3GA 3ZZ8A 1O2XA 4K1TA 1AZZA 2AGGX 2NU4E 4YO9A 1QL7A 4F55A 2A7CA 4BAQB 8GCHG 3A83A 4UEHH 2QIQA 2BD4A 1HRTH 3UNSA 1BDAA 4BTTB 3A85A 4ABBA 3VB3A 3HKIB 3SV9A 4FUHA 1AUTC 1TGTA 4VGCC 1GDUA 3F2GA 5F8ZA 1QJ1B 1G2MA 5TJXA 1AD8H 1DITH 1O5FH 1AKSB 1J16A 4TWWA 5C1UA 1K1OA 3M5NA 3GCOA 1SFQB 5FCKA 2ZIQH 3RMLH 2HLDD 5A09A 1D6WA 1NFUA 1HIAA 1HAIH 3LGIA 3SI4H 1MUEB 3ZVFA 3M3TA 1C1WH 2YMSD 1DY9A 2ZDKA 1ELBA 4B1TA 3I77A 5KEDA 4BNRA 1EFRD 2AS9A 2Y82A 1ZRBA 3SU5A 3F1SB 4AFSA 4JYUH 2GZ7A 3PB1E 1C5VA 1HJAC 5EG4A 4OGXA 1RIWC 1V2NT 1FNIA 3IWMA 3TITA 1B0EA 3ZZBA 3ZZ4A 4SGBE 4WVPE 4RT1A 2W3KA 1EKBB 3SORA 1LMWB 3DUXH 3K6ZA 3RXGA 1C5ZB 1O2SA 1LPZB 1C5LH 1MKXK 2NU1E 1EZXC 2BOHB 2OBOA 3RMNH 1O5GH 1GJ7B 4H42U 7GCHF 1TX8A 1C5SA 3SU1A 1DXWA 2A0QB 1NFXA 1Y5BT 1SI5H 4FUIA 1FIWA 1O2NA 3S7KB 2SGEE 1GVKB 1CGHA 2WPLS 3GY3A 1EJAA 1SOTA 1SGRE 2NU0E 1EZSC 1FY4A 2FOEA 4LOYH 5EQSA 2A5AA 3RDZA 2XC5A 1TPSA 3ZV9A 1GHBG 2QA9E 1TGCA 1V2PT 1ELEE 2BQ6B 3TJNA 1J14A 5EGMA 7LPRA 2F9OA 1KLJH 1O3PB 1QTFA 1L4ZA 3GYMA 4IN1A 1NFWA 5F03A 4ZHAA 3E3TA 1WU1A 3S69A 1ZZZA 3BTFE 5JBBS 4DT7B 2ZECA 4UFGH 1TBRH 3GDUA 1QZ8A 4RT0A 3RXSA 4GCHF 4AZ2B 1FDPA 5C1XA 5AF9H 1O3MA 1MU6B 1K0HA 3UB0A 3UOPA 4X2VA 1ANEA 1H9LB 3RC4A 5A8ZA 1C5UA 2V3OH 3UR9A 2Z3DA 2Y80A 4AB9A 1GBEA 6GCHF 1TNHA 3SZEA 2ZHQH 5C0UA 4I7YH 5C5OA 2V6NA 2OQ5A 1AKSA 3N7DA 4MG3A 2QCYA 3ZVAA 5FHTA 1Y5AT 2AIPA 5E2PA 2ZFSA 1GGDC 2XC0A 3IG6B 1YY3A 3BTKE 4Y8ZA 1A4WH 1CA0B 1NS3A 3ZV8A 1BITA 2JJ1D 2P8OB 3M5MA 5HM2A 1L2EA 1XUFA 1YPKH 1PYTD 5DP7A 3DFLA 1EPTA 1T8NA 5HIZA 3U8TH 1TGSZ 1PPEE 2HOBA 4BAOB 4TY7A 1INCA 4KTCA 1ANBA 3SHAH 2QXIA 4KTUA 3RXUA 1YPEH 1QY6A 1THRH 4A1TA 5DP3A 3BEFB 3CP7A 7ESTE 1EZQA 5CHAC 1TBZH 1ZSKA 1BMAA 1AZ8A 1QFKH 2ALPA 1UK4A 1TWXB 2KCYA 4B74A 1V2MT 4XE4A 1TRMA 2CF9H
chains in the Genus database with same CATH topology
1PPZA 1WOFA 3RMOH 1ZJDA 1T8MA 1C1MA 3SJ8A 2QF0A 2ZEBA 4CBOA 2CGAA 3TH2H 3U8RH 2ZHDA 4ISIH 1QHRB 1UVPA 4BAHB 2STAE 1BMMH 1TX6A 1HPGA 3MU0A 1BRUP 1SGTA 1HAVB 4E7NA 5JBAS 2HGTH 2C8XB 2ODQA 2O8WA 1P57B 1BZXE 4MNYA 4UFDH 1O33A 2ZF0H 4B2BA 3UTUH 4Q80A 1QBVH 3CS0A 1UVSH 1O2WA 2WYJA 5EQRA 1Z1JA 3HK6B 2JETB 1O36A 4INLA 5AFZH 1GI2A 1ZMNA 1KDQA 1GBLA 1C1NA 1ZTJA 3TGIE 1VJAU 1B5GH 1MU8B 4ABHA 1NRRH 2AGEX 1BJVA 5FX6A 1O2ZA 2FPZA 2D26C 1A5GH 1WCZA 1ZTKA 2CHAC 4K5ZA 4AOQA 1KIGH 1MAYA 1GCTB 1GMHG 1GJ8B 1W7GH 3AW1A 1C2EA 3SU2A 3TU7H 4FUJA 2K1QA 3HGNA 2SGDE 1GVLA 1QBNA 1AMHA 1K2I1 1J15A 5A0BA 1O31A 2Z9JA 1O3BA 3BG4C 3TGJE 3A8DA 1EASA 4ASHA 4NG9H 2YNAA 1DWEH 2OQUA 3M5LA 3ODDA 2ZNKH 5HGGA 3UQVA 1TPPA 3SJOA 2P95A 1F0TA 3PMHB 1OWEA 1HV7A 3EA8A 3PMAB 3RXOA 3PLPA 3A82A 2WV5A 1NRQH 1Y3WA 2VJ1A 3QN7A 3ATKA 5EW1H 5B6OA 5DP6A 3EDXB 3MH7A 4JCNA 1O3NA 1O37A 1YPHC 1Z7KA 4B2CA 4ABIA 2PWXA 2XWAA 3M3VA 3KIDU 4R8TB 4I8JA 2PKSB 2O8LA 2ZFRH 4CRCA 3ODFA 1DE7H 3Q3XA 4GSOA 5L2YH 1TMUH 1LKBA 2FYRA 5GCHG 1H1BA 1KLTA 1NN6A 1QURH 4AG2A 3T28A 1YF4A 2UUKB 3RM0H 4KTSA 1ELDE 4WMFA 1OPHB 1L4DA 2FTLE 3FVFB 3GY5A 4BTIB 4TYDA 3MH4A 1AFQC 4I8GA 1GBKA 1ELCA 5A8XA 3RLWH 1HAVA 1NC6A 1GHAF 1ZLRA 1OOKB 4E06H 4I8KA 1ZHRA 1TYNA 3P95A 2OC0A 4ZHMU 3RP2A 4U32A 2TGPZ 1EOLA 1LQDB 4FUDA 4QT8C 4YOIA 1BJUA 2GP9B 2G4UA 4CR9A 5ABWA 1LTOA 2P59A 3LJJA 3BTGE 1OX1A 4AN7A 1BTHH 5AVDA 3KN2A 1F0RA 3HK3B 3RXBA 1YM0A 3SNBA 5JB8S 1Y59T 1UTLM 3SV7A 4I8LA 2FI3E 4HGCA 2GZ8A 2BD9A 4VGCB 1DS2E 1TGBA 2B9LA 1TONA 4Q2KA 4NWLA 1XVOA 1JRSA 1ELVA 2TRMA 1W3CA 1Q3XA 5GDSH 1AY6H 1AWHB 4CRAA 2AEIH 3GCHC 2GCTB 1PPGE 3KHVA 5E0JA 1TOCB 1TMBH 3LOXA 4LK4A 3T62A 3MO3A 2ZDNA 5HM9A 2SNVA 1TB6H 2ODPA 2QAAA 3A86A 5AFYH 4YESB 2BY6X 1O3HA 2HPPH 1DX5M 1ORFA 1ZMJA 3RXKA 2B8OH 1HJAB 5E2OA 3MU1A 3E1XB 2VIVA 1GDQA 1JOUB 2OINA 1N8OC 4X6PA 3VFEA 2A7HA 2BZAA 1KYNA 1BHXF 3A81A 1ZTLA 2FLRH 1O2PA 1TAWA 3SGAE 4Y11E 3RXMA 2VIDA 1C5XB 2JH0D 1KXFA 3M7UA 2UUFB 2FDAA 3S9CA 1S81A 4A5TS 1SQOA 1TIOA 2O8MA 1PJPA 3URCA 4MTBA 2RG3A 1BUIA 1ELAA 1MD7A 2BLVA 3QK1A 3KEEA 2IPHA 1GHBF 1WQVH 1C1TA 4NSVA 4NGAH 1BMLA 4Y71A 1T4UH 1O2VA 4M7GA 1C2GA 1MKWK 1SGFA 3KQEA 4FXGH 3NZIA 4Z6AH 1QCPA 5FBIA 2G81E 1DWDH 4AFZA 3SZNA 2Z3CA 3MNSA 1FY8E 1SGPE 3D65E 1P3CA 3URDA 1HAPH 1QIXB 4NIWA 1XXFA 2SGFE 4I31A 4Y8YA 1TA6A 1P02A 1C4U2 3EA9A 1HB0B 1UCYK 1NT1A 2A5IA 2BY8X 1HCGA 1PFXC 2O8TA 5C20A 1FPCH 1OXGA 3CS7A 1PYTC 1MZDA 2PHBA 1ZMLA 1CBWB 1P03A 3PMJA 3P6ZB 2F9VA 1SHYA 2P93A 1FJSA 1SB1H 2SFAA 3FP6E 2BQWB 1C1OA 2FOFA 5F8XA 3DD2H 1FN8A 1O2YA 1RTLA 3P17H 2D2DA 3BIVH 4A1VA 2ZFFH 1SQTA 4JZDH 5DP9A 1AB9C 2AGIX 1QQUA 3KQCA 4K2YA 1Y3XA 5HXFA 1C5RA 4SGAE 8LPRA 2ZU2A 1RFNA 2ZGBH 1DANH 1GI1A 4WH8A 8KME2 3ESTA 3VEQB 3UY9A 4UFFH 4Y0ZE 2VGCC 1GMCG 1ZRKA 3RXIA 2H5DA 1ELTA 2G55A 4DCDA 5EQQA 4BAMB 1BB0B 1HLTH 3GYLB 3NPSA 3GOVB 1TPOA 5I46H 3PWCA 2NWNA 1XUJA 1BTUA 2XNIA 4ISOA 2NU2E 5EPYA 1HBTH 1Z6JH 1B7XB 3ZVCA 2ZTXA 3EAJA 2ANYA 1P01A 1S0RA 1EATA 1F2SE 1YBWA 2J9NA 3ENSB 3R0FA 1O5CB 2NU3E 4HTCH 1J17T 2ULLA 3O8CA 1EAXA 1P04A 4HFPB 1KXAA 1SC8U 1NROH 4ABGA 1MTUA 2PW8H 2W5EA 4H6SB 5DKMA 1WV7H 3P8GA 1ZSLA 3NUMA 1LVBA 3FP8E 2Y7XA 1A3EH 4K3JA 1C5TA 4GPGA 2BDYA 4Y6DA 5L30H 1BHXB 4H6TA 4JZIA 4AFUA 1O5BB 3RXRA 1QJ7B 4ZAEA 5K7RA 4OS4A 3SU0A 1UTQA 1MTWA 4IMQA 1BBRH 2D1JA 2PFEA 5EW2H 1ESTA 3BTEE 2OC7A 1Z71A 4X2WA 2RA3A 4MNVA 3B9FH 2WPMS 1MBQA 1YP9A 1C2MA 3RXLA 3GCTG 1AWFH 1P2OA 3P8FA 2EI6A 5IDKA 4LZ4B 1TLDA 2CHAB 3M7QA 1DSUA 1O5DH 1C5QA 3F9EA 1YKTA 2ESTE 4ZXXH 2ODYB 1UTMA 1C4Y2 4JZEH 1V2KT 3VB5A 2IOTA 2UWLA 1Z8RA 2ZQ2A 2PR3A 1BRBE 2EA3A 1ABJH 1UVTH 1DICA 4WXVA 3RC6A 2WINI 3NWUA 4NZLA 1DWCH 3QGJA 1QNJA 3RU4T 3AASA 1BMNH 4K8YA 1ANDA 2H1UA 3L6PA 4XOJA 2C93B 1A5IA 3M7TA 2Q6DA 1VGCC 1YLDA 3BG8A 1Y3UA 4NSYA 5L2ZH 1GG6B 2G8TA 1UHBB 3QZRA 3Q77A 3Q00A 4U01A 5AHGH 1GMDG 3ATLA 4WF8A 3UR6A 1TQ7B 2FESH 2QY0B 5FXLA 4D9RA 1BBRE 1ESAA 1NESE 1QQ4A 5GCHF 3U1IB 1MTNC 1O2LA 3LU9B 1H4WA 1OWKA 1J8AA 2ZGCA 2BOKA 1YYY1 3HATH 2H6MA 3TLOA 1GDNA 1FONA 1P2IA 2ZQ1A 4ABEA 3GDSA 1KSNA 3ZVGA 4AFQA 1EB2A 5LGOA 4CR5A 1SGEE 1OWHA 2XBWA 2FLBH 1C5WB 3H7OA 3BIUH 4NIYA 2ZDVH 4IGDA 3E0NB 4AORA 3ZZ5A 3RXFA 4TWYA 3TK9A 3UOUA 1XUIA 7KMEH 1C2LA 1BOQA 2AFQB 4DGJA 3MOCA 1O3CA 1FI8A 3SHCH 1ACBE 2XCFA 2GDDA 3P8NA 3LONA 3DA9B 2BDAA 1TRYA 3ZVDA 2XYAA 2ANWA 2Y5FA 4Y0YE 1EOJA 2IJOB 2PKAB 5EPNA 1S6HA 1V2TT 4Z0KA 3GCHB 1DOJA 4BXSA 1Y3YA 1K1JA 4D7GA 4K1SA 1C1VH 3PTNA 1W0ZU 2HNTF 1IQNA 2J38A 1BTZA 1M9UA 4FU9A 2ZFTA 2HVXA 1C2HA 2FM2A 1TNKA 1Y3VA 1EUFA 1FUJA 1HAXB 4DIIH 5JDUB 2FOGA 2A5KA 3UWJH 3SV6A 1H8DH 1FIZA 4Q7ZA 1RXPA 3N7OA 2C8YB 2FMJA 1ZGVA 1ETRH 3DFJA 1O3AA 3ATMA 4NA7A 5JYIA 1S5SA 1P3EA 2BDHA 1O3EA 2BLOA 2J2UA 2BD8A 2P3TB 1AI8H 5LPFA 3TJOA 2WUBA 3T29A 3ZVEA 4IBLH 2J4IA 4X6MA 3SQHE 4KKDA 3A88A 4YM9A 1DT2A 1YCPM 5C5NA 3AAUA 1W14U 1W8BH 1C1UH 3U8OH 2ZGXH 1DVAH 1XVMA 2A32A 2TBSA 3GCNA 4HZHA 4A6LA 1SR5C 1C2IA 1WUNH 1QR3E 2BD7A 3RXQA 4ISNA 1D3DB 2QYIA 3O8BA 4X1SU 5E8EH 4BANB 1CA8B 4X0WU 3TH4H 1SGQE 4WJG2 1GI6A 4CRFA 2ANKH 2ZGJA 2ZDAH 4OS1A 5EXMA 3KQBA 2Q6GA 1FMGA 2QV1A 3EYDA 5FAHA 4GAWA 1THPB 2HPQH 2FP7B 2FWWA 2AERH 3NKKA 4X2YA 2B5TB 1RS0A 1EB1H 1JIRA 1V2LT 1WAYB 2ZU1A 2FTMA 3E91A 3OTJE 4DJZB 1GBHA 1QB1A 2BY5X 4MPWA 1ELGA 2ZU3A 4ZKNU 2SNWA 2F83A 2H5CA 4CH8B 1JRTA 2BZ6H 4K8BA 4ZHLU 4LXBH 1AN1E 3DT0H 4UONA 5GXPA 1T31A 1GBJA 1L1JA 1GJAB 3UNRA 4O9VA 1AB9B 4ABAA 4CRBA 1RTFB 6ESTA 1GJBB 1XKAC 3LGTA 1XX9A 4ZKSU 2BYAX 3D49H 3A7TA 2SGAA 1C5YB 2WPJS 2PKAA 3ZZDA 1CSOE 2IN2A 4K60A 2G00A 1OSSA 3QZQA 1P09A 2C8ZB 2FOBA 1GMCF 3A7WA 1EX3A 1TA2A 4ZXYH 2OCVB 3W95A 2ZHFH 3PO1C 2GMTC 3EQ0H 3BN9A 1IQIA 4JMYA 2Y81A 4Y7BA 5FCRA 2XBVA 1WYKA 1OP0A 2BXTH 2WPKS 3V3MA 4D7FA 1ZPBA 4KELA 3OYPA 1P11E 2QXGA 1FQ3A 1GHZA 4NFEA 5DO4H 1V6DA 1K1IA 4DURA 1DM4B 4A1XA 1P2JA 1IQHA 2RCEA 4MNWA 3A8AA 2HNTE 4Y10E 3SU3A 1B0FA 3E90B 1JMOH 1FLEE 1FXYA 2OLGA 1NU7B 4Y76A 1S83A 2BTCE 2J34A 1O3FA 4Y79A 3LH1A 3RXDA 2GT7A 2BVSH 2BVXH 1G36A 2AMPA 3A8BA 3GDVA 1V2WT 5TCCA 5ETXA 1O3OA 1V3XA 1EJNA 1Q31A 3TK5A 2ZDMA 1IOEA 1MQ5A 4ISHH 3L33A 1QGFA 3RXJA 1GVZA 2G5VA 1LHCH 3A7ZA 2PUQH 3ZZCA 1ZYOA 2C4FH 2ZDLA 4XSKU 3ZZ7A 2Q6FA 1K1MA 4TPIZ 1O2HA 3GCTF 1DUEA 1A0LA 2J92A 3I29A 4ZUHA 1RD3B 1TGNA 1N6XA 1OYQA 2A2XH 1EPTC 1E0FD 1SLUB 3SO3A 1VZQH 2UWOA 3MNXA 2Y5GA 2XBYA 1LO6A 4FU8A 1AGJA 1AQ7A 3GY6A 2FZZA 1K22H 3RLYH 1CT0E 5EXLA 1FZZA 2ZHWH 4A92A 1NRNH 4F4OC 1TRNA 4WH6A 1V2UT 1RRKA 2EI7A 2AMQA 2Z6BD 5GIBA 3LGWA 1FAKH 2FX4A 1GJ9B 4B71A 1C2KA 4INKA 2K7XA 1LPGB 1V2RT 3PROA 4IC6A 3SGBE 1EP6A 1DXPA 1F0SA 3D62A 3M3SA 1DDJA 3SBKA 4YLQH 1IQFA 1ARBA 3D23A 3F9GA 4IC5A 3QWCH 1MAXA 3ITIA 3M35A 1SGDE 3LC3A 4ZROA 2XTTB 4CH2B 3LPRA 3QLPH 2UUYA 2VVUA 4JK6A 2LIZA 3U1JB 1QB6A 5GPIB 1A7SA 1MKXH 4AGKA 1VJ9U 1GMDF 5FPTA 2VVVA 1HDTH 2CJIA 1P06A 1OP8A 3K9XB 3GICB 1NU9A 5DGJA 1F5KU 5LH8A 1P0SH 1FN6A 3TK6A 1RIWB 1UTJA 3GY7A 1UK2A 3TH3H 1NPMA 3KGPA 3MO6A 2ZTYA 2XCNA 4E7RG 2TPIZ 2ZCKP 4ESTE 1GBCA 3SJIA 1C1SA 3S7HB 2PTNA 2OC1A 4X8VH 5DP8A 1K21H 1PPFE 5EODA 1GI3A 2PGBB 5DP4A 1AVGH 1WQSA 1GHVH 1VCPA 5JPMH 2A4OA 2TGTA 3BV9B 3L3TA 1LHGH 4D8NA 1H9IE 5EU8A 2BLQA 2Z9IA 1C5OH 2ZFPH 2GT8A 4O97A 1CA0C 3SN8A 3Q3YA 1GI4A 1IHSH 3P8OA 2G4TA 1W10U 1O30A 1RTKA 5L6NH 1MD8A 1QA7A 2Y5HA 1G32B 2W7UA 4NIXA 4DY7B 3MU8A 1TNIA 4R0IA 2WUCA 2DE8A 1GBMA 1P2MA 1EJMA 5TCAA 1HNEE 1DLEA 3LKWA 5FPSA 1KXEA 3SU4A 1MCVA 1TX7A 3GY8A 1HUTH 2R2WU 2M5TA 2ZWLH 1GJ6A 1YGCH 2QXJA 3EA7A 5LPEA 3LIWA 1BIOA 2PV9B 1Y8TA 2O9QA 1DWBH 1O3JA 1O32A 1NFYA 3FANA 5A8YA 2C90B 3HGPA 4CRGA 3LGYA 4AYVB 3SI3H 2VWMA 1UO6A 3E6PH 3R3GB 5C2ZA 1QRZA 3T25A 5C67A 1C5MD 1BTWA 1ELFA 5GJ4B 4YT6H 2WPIS 3E8LA 1GGDB 3SJKA 1CT4E 5F6MA 1OYTH 1QBOA 1FAXA 3MMGA 3SNCA 2XW9A 2JKHA 3Q76A 2CN0H 3PM3A 3QTOH 1AFEH 3TPIZ 2FIRH 1MZAA 2VIWA 1LVOA 2JETC 2GV6A 2GTBA 2ZC9H 3HPTB 3LJOA 4BTUB 2QC2A 1IAUA 1G3DA 2V0BA 5CHAB 1JXPA 3LGVA 1SLXB 6LPRA