4TWYA

Structure of sars-3cl protease complex with a phenylbenzoyl (s,r)-n-decalin type inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Fused-ring structure of decahydroisoquinolin as a novel scaffold for SARS 3CL protease inhibitors
pubmed doi rcsb
source organism Human sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4twyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4twyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4twyA02
1BQYA 2GDEH 4I8GA 1MQ5A 4A7IB 1C2JA 2WPHS 2FX6A 1H8DH 1P10A 2HNTE 2G8TA 3A7XA 2TGAA 1PJPA 3PWCA 1GJ5H 3TVJB 2OD3B 1TPAE 3ENSB 3PMJA 2NU1E 5H4IB 1BA8B 2TGDA 3S9AA 3SUDA 3KL6A 4NSVA 2AGIX 4FUBA 4TYDA 3M3SA 5ESBA 1O3BA 1MH0A 5ABWA 1ZPBA 4MTBA 5C1UA 8KME2 1EPTB 1LHFH 4BTIB 1GVLA 1V2KT 1G36A 2ZI2H 4OS7A 4XOJA 5HM2A 1FNIA 1GI0A 4LOYH 2QY0B 1O3EA 3QGJA 2VWLA 1A7SA 1DPOA 1NT1A 3RXRA 4FUDA 1HUTH 2DE9A 3VFEA 4AYVB 1UJ1A 1SGTA 1XVOA 2TIOA 2V3HH 3S9CA 3T27A 1GHAF 3AASA 1OWHA 1PFXC 2XYAA 4ISIH 4LXBH 5AFYH 4RSPA 3T2NA 3SW2B 2IJOB 3AAUA 1P12E 1TX7A 1IQLA 3TH2H 5JYIA 1C1PA 1QFKH 3RXUA 1P04A 1H9IE 1VITG 1ZMNA 1QR3E 4B73A 3GY7A 3PYHA 2D26C 3HPTB 3R0FA 1CHOF 1NFUA 5DP7A 1O31A 1A5GH 1F7ZA 1CA0B 5F8XA 2F9NA 2ILNA 1C4V2 1C5VA 1K28D 1HB0B 1TNKA 2OQUA 5IDKA 1S81A 3M5LA 5FAHA 4ZHLU 5HYOA 3IG6B 1V2LT 2O8LA 1BRUP 4KTUA 2JH0D 5GIBA 1LHDH 1HBTH 4D76A 2F91A 1LVBA 1LO6A 5J4SA 4YTAA 5K7RA 4WH6A 3M36A 1O34A 1O2PA 1YPGH 2SGDE 3E0NB 1A0HB 4IGDA 5AF9H 4A1TA 2A5IA 5EGMA 1NTPA 4K3JA 3A80A 1O3JA 2XCFA 2IOTA 5E0HA 3AW0A 2UWLA 3AW1A 4U01A 2G81E 2QV1A 3FANA 3SJ8A 3BG4B 5JBTA 2Y80A 1WU1A 2PFEA 1SLWB 1PQ8A 1ACBE 4AX9H 1SGQE 3BEIB 3A7YA 4FXGH 1SVPA 2ZDAH 3LGYA 2SGQE 2ZFFH 3SJOA 2G52A 4I7YH 1AN1E 1BDAA 1KTTB 2YNAA 1OXGA 2BVXH 3P8OA 4LZ1H 4O3TA 1GBTA 3W95A 4WF8A 3SUFA 4AFZA 2AMPA 1NU9A 1N8OB 3K2UA 4Z0KA 1NRSH 5GWZA 3MH4A 2FM2A 2AMDA 4BANB 4CR5A 5C20A 2W3IA 1TRNA 1ELFA 1IHTH 1O2KA 1FLEE 1W13U 4DIHH 4M7GA 5A8YA 1XM1A 1ZGIA 2VWNA 4OS1A 5A0CA 1MTNC 3BSQA 2ZFRH 1FY1A 1YC0A 2A7JA 1QCPA 1Y8TA 4F49A 1ABJH 5HXFA 2Z94A 3F9EA 3RMOH 1ARCA 1RD3B 2HVXA 2QF3A 3GCNA 1S0QA 1WTGH 4Y8YA 4AB8A 2Y5FA 2VH6A 1G3EA 4ZXXH 1ELDE 1VITF 1O5CB 3KIDU 1SLXB 7GCHG 1HDTH 3LPRA 1MU6B 1H9LB 1K22H 2C3SA 4B1TA 5GXPA 2Q6GA 2ZA5A 2THFB 4NWKA 1PPCE 3OU0A 3TK5A 2BOKA 3LH3A 5DKMA 1D3TB 1IQMA 1RTKA 1O5FH 3VB7A 1E35B 1GDUA 1P2JA 3U9AH 1PPBH 1TAWA 4TWYA 2EC9H 1GI6A 3RXLA 1GBBA 1FI8A 1C9PA 1Z6EA 4TWWA 7KMEH 1VCWA 1C4U2 3O8DA 3SQEE 3CS7A 1TIOA 4I8HA 2ZU4A 1JXPA 5I46H 4A1VA 1GMDG 1O2HA 1ZYOA 4XBBA 1K1MA 3SN8A 3PO1C 1LDTT 3EYDA 2PSXA 2Q6FA 1AKSA 3NUMA 1HAVB 1GI7B 3PLBA 4Y7BA 4AB9A 3LGIA 2UWOA 1WBGB 2RA3A 1XUGA 1BTXA 2FOMB 2Y6TA 3UREA 3LGTA 3NKKA 5EPNA 1UVUH 3KN2A 4VGCC 4GSOA 4UE7H 4NWLA 2NU3E 3HATH 1O33A 3RUOA 4ABJA 2WYJA 1GJCB 1C5OH 3SU0A 1HFDA 3O8BA 1O3IA 2BB4A 4DOQA 4RKJB 3RDZA 1T4VH 1ZHMA 3HGPA 1DSTA 2A45B 2P3FH 1SR5C 2G00A 4CR9A 2A31A 6GCHG 5GJ4B 4ZH8A 1BMMH 2ZPRA 1O5BB 4NIWA 3QZQA 1Y3XA 2HGTH 4MPXA 3R3GB 1XUHA 1SFQB 4YM9A 1NY22 1VR1H 2WPKS 3S9BA 1ZTJA 4MNVA 4K1EA 1IQEA 1W8BH 4Q7YA 2JETB 3F68H 1IQGA 3UUZA 3A86A 3BF6H 1RGQA 1GBIA 1TGNA 1WOFA 4FU9A 1L0ZA 4R8TB 1O2YA 2QXJA 2BQ6B 1OWJA 1IQNA 3A7TA 3BIVH 1HAPH 1SHYA 1CHGA 3F9GA 2B8OH 5FCRA 3PMAB 1UTMA 2FI4E 1LVMA 1O2MA 5DP9A 5F6MA 3OY6U 1L4DA 7GCHF 1SGFA 2GT8A 5C5NA 1GGDC 1OWDA 2XCNA 4KKDA 2BY7X 2KAIA 4CRAA 1P57B 1UVSH 1LHGH 1X7AC 1BJVA 1O3GA 2O8UA 2P8OC 1G9IE 1A0JA 2RG3A 3F6UH 3GDSA 1Y59T 2SNWA 5F03A 3VEQB 2SFAA 1BTYA 1P2NA 3LIWA 4KP0A 4FUCA 3SJKA 1AE8H 3MH7A 5A8XA 1Z71A 1ANBA 2AYWA 3PM3A 4HFPB 4GUXA 3C1KA 1D3DB 4MDSA 3A87A 5DG6A 4ASHA 3RXFA 3ITIA 3SGBE 5EW2H 1GPZA 1ZRBA 3SU5A 4NA7A 8GCHF 1GBLA 3ZV8A 1PQAA 2BD4A 3PV4A 1ELCA 1KDQB 3ZYDA 2VIDA 2QN5T 1V2QT 1YPMH 1C5SA 4ZKNU 1LMWB 1V2MT 1T7CA 1V2UT 1QBNA 2FI3E 1ZLRA 3BG8A 1J8AA 2GZ7A 3RLWH 1B7XB 3K65B 3I78A 1DVAH 4JZ1A 3EAJA 1OWIA 5DK1A 2GX4A 1VITH 2ASUB 5EXNA 2P94A 2BDIA 2WUCA 3SV9A 1MKXK 3MI4A 1GG6B 4GHTA 1KLJH 1AB9C 1TGCA 3UIRA 4TPIZ 5GCHG 3NCLA 1P11E 2XBWA 3Q77A 5DO4H 2OC7A 2W26A 2BLQA 2R0LA 3MU5A 5ETXA 3SU3A 1DDJA 2G51A 2FOGA 2Z7FE 1O2QA 2BDHA 5E8EH 3BTDE 4MNXA 3KHVA 1ZHPA 1TX8A 4X1SU 4IC6A 1Q3XA 4NZQA 1D3PB 4WY3A 1QTFA 3CP7A 1ZTKA 4UD9H 1O3HA 1DLKB 1FIZA 2OCVB 5K0HA 5FPTA 1ANDA 3RXBA 1LHCH 3NZIA 3VXFH 1SL3A 1AIXH 1QQUA 3S7KB 1XUFA 4NSYA 1DITH 2ZPQA 1HXFH 1EZQA 4B2CA 2GCTC 1W3CA 1CU1A 1O37A 2AEIH 3PTBA 1PYTC 3I77A 4CRCA 1LVYA 1OP0A 1BTZA 5L2ZH 1GBDA 1YPEH 3OX7U 2BDGA 2W7UA 2GKVE 3FP6E 1P03A 3F9FA 1ESAA 3VB4A 1KXBA 2A4RA 2J92A 3OYPA 4Y6DA 4Z6AH 1ELEE 2P95A 1D3QB 1GCTC 1ZSLA 1JIMA 1MU8B 1MKWH 1CBWB 1P2OA 4KTCA 2PKSB 3RXCA 4BAKB 4KTSA 1HPGA 1AI8H 1FDPA 2XW9A 3ATKA 3TJOA 3U1IB 4AFQA 1RXPA 2G5VA 5T6GA 1TALA 3BTQE 1EZXC 1GJ6A 1EP5A 1NO9H 3GDVA 1UTNA 5CMXH 2ZFSA 1C5WB 4FVBA 1TOCB 4KGAA 5HM9A 1BMLA 3SGQE 1W12U 3ZZ8A 1GBHA 1SG8B 4Y8XA 3D23A 3KCGH 5DJ7A 1HJ9A 1W11U 3MNXA 2XBYA 2WUBA 3PTNA 3NK8A 3M37A 2AH4X 3TLOA 1FIWA 3VB3A 2VGCB 4HGCA 1A61H 4X6MA 4D8NA 2C8XB 3RM0H 1AVGH 2FX4A 4MPUA 3SHCH 2YNBA 1MKXH 1UK4A 1O32A 1P9UA 3RC6A 1G2LA 1HJ8A 5EW1H 1QBVH 3BTFE 3QUMP 1A1RA 2ZP0H 1QL9A 3LOXA 4AG2A 1QHRB 1S83A 3BTKE 3SV6A 4UFDH 3OY5U 1AE5A 1EP6A 3KQEA 1EB1H 1GHWH 3K6ZA 5T6DA 4UFGH 4O03A 5DPAA 1AUJA 1DXWA 1T4UH 1O3LA 1VCPA 1P09A 1A5IA 1L1GA 1BMAA 1NN6A 1CT2E 2RCEA 3SBKA 3LKWA 1MCTA 1GBCA 4NIVA 1AGJA 4ZUHA 2BD5A 1UVOA 3UR6A 2ZPSA 1GI1A 4YLQH 9LPRA 3TGJE 3LJOA 1Y3YA 1ANCA 2PHBA 2ZWLH 3TJVA 2Y82A 3V13A 2OBQA 1O3DA 3RP2A 2ZDVH 5E2PA 2BD2A 3ZZ9A 1PQ5A 4I8LA 4J2YB 4Y8ZA 2ZGHA 1UCYK 1GJ4H 3A8DA 2C93B 4GPGA 2FODA 1B5GH 1LQDB 3LU9B 7LPRA 3BV9B 2BYAX 3S7HB 2Q1JA 1A3EH 1ZSKA 2FDAA 2LPRA 2V3OH 2H1UA 1SLUB 1CQQA 3SZNA 4GLYA 3ZZ3A 2ZF0H 6LPRA 2QXHA 1GDQA 1HLTH 2XWAA 4ABGA 2O8TA 4JK5A 1QIXB 4I8KA 1BRCE 4LK4A 3UOPA 3M5NA 2FOBA 3D65E 1IOEA 2ZFPH 3ZVDA 1LCYA 3MTYA 2A2XH 1ZPCA 2PW8H 3ZZBA 3UY9A 3M7TA 2B5TB 4SGAE 3S69A 2BM2A 2HRVA 2UUFB 3HGNA 3SV2H 4YESB 3ZV9A 4CREA 3GCTF 3DD2H 2ZFQH 4Y79A 1OKXA 1YM0A 1MTUA 2UUYA 2EA3A 1MTVA 1FN6A 2XWBI 2XBXA 1O35A 1JRSA 1NRPH 3A8CA 1MBQA 3LGWA 1EX3A 4AZ2B 2W5EA 1V2PT 3RXEA 1GHZA 3F9HA 2GMTC 3A82A 4ZHMU 2FP7B 2FLBH 1AHTH 1W2KH 1IAUA 3K6YA 3L6PA 5JPMH 3SGAE 3PROA 3BTGE 4FVDA 3GY8A 2VJ1A 1L4ZA 2ANWA 1C2IA 1E0FD 1HCGA 1GG6C 4HTCH 1GBJA 4JYUH 2Z3CA 1CT4E 2BX3A 3UPEA 3M5MA 2W7SA 1NZQH 1AFQC 3LH1A 1P2IA 2QGRA 1HNEE 4I32A 2P93A 4WMFA 1GJ7B 1NU7B 1AY6H 5TCAA 1YPHC 2BQ7B 1BRBE 2STBE 1YP9A 3PMBB 3QK1A 3ZYEA 1PYTD 4ZKRU 3RU4D 3LJJA 3MOCA 1C2FA 3MHWU 1GJ9B 5A2MH 1P01A 2VWMA 1RIWB 1O2SA 3LT3A 5GDSH 2VINA 1AFEH 1OP8A 2H2ZA 1QBOA 1SGYE 1UHBB 1NFXA 4WVPE 1MCVA 3M7QA 3RMMH 1BHXB 1KXEA 2GDDA 4MPWA 5T3HA 4WH8A 3URCA 1S6FA 1VGCC 1O36A 3TJNA 2TGTA 2H6MA 1H4WA 3I29A 1QJ1B 3Q00A 5A8ZA 3V3MA 2IN2A 1GHBG 3UWIA 1J14A 1IQIA 3H5CB 1RRKA 1V2JT 1QB6A 2DUCA 2H9EH 3DFJA 3TNTA 2A5KA 1D9IA 1S84A 4O9VA 3GY6A 1TBQH 1J9CH 3SI4H 2NWNA 1SFIA 4OS2A 1C2HA 2PKAA 3GCHC 3ZVAA 3M7UA 1O2XA 4AYYB 2ZKSA 2R3UA 2HOBA 2XTTB 3EBNA 5EQRA 1QA7A 1HIAA 4ESTE 3SUGA 3RM2H 1CGHA 5BPEA 4JZFH 1Z8GA 1O2IA 3RU4T 1SOZA 3M61U 5DP5A 3RXHA 5E0GA 1BTPA 1LKAA 3QO6A 2FZZA 1BTUA 4A6LA 2OINA 1TPOA 2A0QB 1ETTH 3A7WA 2BMGB 1EQ9A 4RKOB 2ZIQH 1EAUA 1H9HE 3T5FH 2TBSA 4E7NA 4XFQA 1SSXA 1P0SH 4CH2B 1UTQA 1OYTH 3LGVA 1XKBC 2PUQH 1GMCG 1C5QA 4AN7A 5GPIB 4PROA 1C1SA 1FUJA 1TB6H 3A8BA 2VIVA 3H7OA 3MU8A 4Q2KA 1Z6JH 3P8FA 1L1NA 4INLA 1Z1IA 5E2OA 1FMGA 4X1NU 1P05A 5F8TA 2EEKA 2WPMS 2P59A 4ABFA 3EA7A 1QB9A 2O8MA 1FY5A 2BDYA 4ISNA 4AGKA 1FY4A 2BD9A 3A89A 1KXDA 3VGCC 2HALA 1F5RA 4K8BA 1SC8U 3WY8A 3E3TA 1O3MA 2OUAA 1QRWA 1YPLH 1ZOMA 2V35A 1CT0E 1V2WT 3P17H 4B75A 3VB6A 2F9BH 1G3DA 1DX5M 2FOHA 1YPKH 1W7XH 2BY6X 5FHTA 3MO6A 3ZZAA 1DICA 1WTHD 2AIQA 1G30B 2XNIA 3ODDA 2FOCA 1L2EA 1YYY1 3NPSA 4DGJA 1O2ZA 1TLDA 3MNSA 2NU0E 2C8WB 2QIQA 5JDUB 2Z9KA 3EDXB 1W10U 1GI3A 2ZHFH 4CRGA 1GHBF 3A88A 1DLEA 1C2DA 3MU4A 1HAXB 2ZTZA 3RXMA 1ELGA 1P2KA 1SGNE 2C4FH 3OTJE 3GCOA 5I25A 1EAXA 1O3PB 1THRH 1T8LA 1ELBA 1BJUA 1KY9A 4DCDA 2PGQB 1NRRH 1P9SA 2C90B 1EATA 3E8LA 2A32A 5L2YH 4UFEH 3TGIE 1O2LA 4A92A 3O8CA 1EJNA 1W7GH 1UK2A 1RTFB 3UTUH 4JYTA 2FLRH 1Z8RA 1QQ4A 2C8YB 3W94A 1HJAB 1GI8B 1KLTA 3A84A 5HMAA 2FOEA 2J94A 1DUEA 3U98H 1QL7A 3VB5A 1C5XB 1MBMA 1EPTC 1OWEA 3ZZ5A 3EE0B 3SV8A 1C2LA 2R3YA 3MNCA 3GYMA 2PWXA 4Y11E 3FVFB 2NU2E 1F92A 3ZVFA 5C1YA 1F0TA 4NZLA 3PB1E 2TGPZ 1TA2A 4MNYA 2XC5A 3Q3KA 2Z9IA 3A8AA 2GZ9A 1THSH 1ESBA 4AG1A 3UR9A 1O2VA 1UK3A 5A0BA 5TCCA 4A5TS 1LPZB 4U30A 3TK6A 1ANEA 4BAMB 3IITA 4WJG2 1HAYB 2GV7A 2I6SA 1GMCF 2D8WA 1SQAA 1C1MA 3BIUH 4K60A 1K1IA 6CHAB 2UUKB 1AVXA 1MZDA 2QXGA 1C1QA 2WV4A 4H4FA 1NFWA 4NA9H 1TMTH 5EU8A 1K1LA 2SGAA 1AZ8A 1KYNA 4IMQA 3UOUA 2FMJA 1EASA 1YCPK 1GMDF 1CA0C 1KTSB 4JK6A 2CGAA 1EB2A 1MD7A 3HKJB 3L33A 3H7TA 2LIZA 3QX5H 3FP8E 5FXLA 2OC0A 2B7DH 1G2MA 1V3XA 2Q6DA 4Y10E 1DY8A 4X2YA 3RMLH 1XX9A 4DY7B 2FTLE 1GWAA 5TJXA 1O2NA 2BZAA 4NIYA 1PPFE 1DWEH 4D7FA 1ORFA 2R2MB 4BAHB 5EQQA 1P2MA 1KIGH 1DXPA 1C1TA 4ABDA 2FS9A 3KQBA 1TPPA 1VCQA 3ZVEA 4UFFH 3GY2A 1XMNB 3BG4C 4K8YA 4NFEA 1GJ8B 1XXFA 6GCHF 4U2WA 4UEHH 3UNQA 3RLYH 1IQKA 2H5CA 1LQEA 1VJAU 1TBZH 5FX5A 1UO6A 4CBOA 1K1NA 3RXVA 1TNLA 5CHAB 2OP9A 2EI6A 1JWTA 1EJAA 1EKBB 1EPTA 2QA9E 3EQ0H 1FONA 4BTTB 4BTUB 1C1UH 1K1PA 1C5MD 3BEFB 1N8OC 2VVUA 4AOQA 2CV3A 4X6OA 3ZVGA 4WMDA 5PTPA 1MQ6A 3AAVA 1H1BA 3RU4E 3SU4A 1DWBH 3GDUA 3T28A 5F8ZA 1GL0E 2WPIS 3SU2A 4IN2A 1C2EA 1O3OA 1T8MA 1FQ3A 4H6SB 2AERH 4DJZB 1D4PB 2ZECA 1C5UA 4CHAB 1SGDE 2RA0A 2Y5GA 3BTME 4E05H 4ABEA 3L3TA 1J16A 2WPJS 1A4WH 1UCYE 1DANH 3LC3A 1Z8IB 2CF9H 2F9UA 3A81A 4TY6A 8LPRA 2CMYA 3SOSA 3TH4H 1A5HA 1QRXA 3SJ9A 2GTBA 2CXVA 1M9UA 2GV6A 1HAIH 4LZ4B 3O8RA 1YCPH 1VZQH 2J38A 1YCPM 1AKSB 2FOFA 2QXIA 2ESTE 2V6NA 1BTWA 1Z7KA 2GCHG 1V2OT 3ATMA 4ISLA 4YOJA 2PUXB 4BOHA 4X8SH 1GJDB 2Z9JA 1S5SA 3ZZDA 2ZDNA 1N6XA 2V0BA 2GT7A 5LPFA 2K7XA 2OTVA 3BTHE 2QYIA 1ZMJA 3E6PH 3BN9A 2AFQB 2D1JA 1P06A 3QZRA 1OOKB 2OC8A 2BLWA 2RDLA 3KNXA 4GHQA 3TNSA 2VVCA 3CENA 1F0RA 1FPHH 3UWJH 3ZZCA 1E36B 1MUEB 1C5YB 2BLOA 1SMFE 1FN8A 2WPLS 1F2SE 1O2WA 1U6QA 1PPEE 1Q31A 1BBRK 1W14U 1Y5UT 5DP4A 5LH8A 2J95A 1EAWA 4X6NA 2TRMA 1WQSA 2I6QA 1NC6A 4NGAH 1GDNA 1ZJKA 3UQOA 7ESTE 2ZO3H 3RXDA 4E06H 4K1TA 2ZHEH 3Q3XA 3RXOA 1G37A 3FFGA 2BQWB 1HAGE 5GCHF 2ANMH 4XBCA 3SQHE 2G55A 2VIPA 1MAYA 1DM4B 1SPJA 4FUEA 3TITA 3LDXH 3TPIZ 1TGTA 1SGPE 2ZTYA 3P8NA 2ZDMA 1B0FA 1T32A 4GVUA 1Y3WA 5JBCS 1PPHE 1RJXB 1QA0A 1ZRKA 3T62A 4FU8A 4GCHG 4YLUA 2Z3DA 2GGVB 2PTNA 1GHAG 1O3KA 2ZNKH 2ZCKP 1ABIH 4D9QA 5FX6A 2JETC 1Z8JB 1ZTLA 1HAZB 1O3FA 2ZU2A 1F5LA 1AWFH 1FAXA 3ATIA 3EA8A 1THPB 2KAIB 1BRAA 4MLFB 2YOLA 1SOTA 3SV7A 3A85A 4RN6A 1QL8A 2H5DA 3CS0A 1C4Y2 4X6PA 4B76A 4FU7A 3MH5A 3LC5A 2VNTA 3U1JB 1UTPA 4WXVA 2ZGBH 1CSOE 3PLPA 3ZVBA 1TRYA 1OYQA 1N1LA 2ODYB 3U8OH 3U8RH 2FYQA 3SNCA 2FYRA 2ZZUH 5AFZH 3QN7A 4H42U 1LPGB 4ABHA 1DUAA 1AMHA 3GY5A 4MNWA 4VGCB 4U32A 4NA8A 1GBAA 3TIUA 2Z9GA 1WCZA 2F9PA 4Y76A 5FBIA 4DVAU 1C5LH 1NPMA 4ISHH 1F5KU 1HRTH 1RFNA 4FUIA 1A46H 1BMNH 1AQ7A 1NFYA 1V2RT 3JZ2B 4QT8C 1CVWH 4XSKU 2CJIA 1HAVA 4NIXA 1AZZA 3GISB 2CHAB 2QC2A 1OPHB 3ATWA 4X2XA 1NESE 1TFXA 3Q76A 3QGNB 3K9XB 2ZDLA 1IQFA 1T8OA 1V2TT 3GY3A 4Y0YE 2PLXA 5FBEA 2F83A 4THNH 2P3UB 1Z1JA 1EZUC 1SI5H 3B9FH 1FY8E 1XXDA 5LGOA 4UDWH 1FXYA 4Q7ZA 4X0WU 1C5NH 1NM6A 1O2RA 3MFJA 2HNTC 4CBNA 2ZU3A 1O5DH 3KQDA 1FV9A 3PLKA 1V2VT 3P70B 5AHGH 4CH8B 1YLDA 4B74A 1YPHE 1UVTH 2PV9B 2F3CE 3DA9B 2FIRH 3STIA 4GCHF 4WMEA 1C5ZB 2XXLA 9ESTA 1GGDB 1Y5BT 5CHAC 1OWKA 2HNTF 3STJA 1DE7H 4KELA 3FP7E 4WXIA 1ELVA 1K2I1 2A1DB 2LNCA 1DSUA 3MO3A 2P8OB 5EXMA 5EPYA 1GVZA 2R2WU 4JCNA 1WAYB 4I33A 3JZ1B 3MU1A 4YT7H 1A3BH 2AGEX 1UCYH 1BT7A 1LHEH 2R9PA 1EXFA 2OBOA 1ELTA 5FPSA 1L1JA 2BY9X 1TA6A 3U8TH 1W0YH 1EJMA 5C5OA 2VIOA 3ATLA 2WYGA 4CHAC 5JBBS 4DIIH 1BCUH 4XE4A 4CRBA 1H8IH 4X1QU 3URDA 2A5AA 1G32B 4Y0ZE 1O3AA 2PGBB 1D6RA 1SGRE 1GBMA 1O0DH 1RS0A 2A7HA 2B9LA 1HYLA 1NRQH 2AIPA 1XUJA 1C2MA 1DWDH 4X8TH 1ZPZA 1Q2WA 5DP3A 1Y3UA 4JZIA 1SGFG 4J1YA 5SGAE 1D6WA 1GBKA 2ZHWH 4E7RG 1EOJA 5FCKA 1CBWC 5EG4A 2BY5X 3HK6B 1ETRH 1ZJDA 1Y5AT 2PKSC 1P2QA 2W3KA 3OSYA 1KDQA 2Y5HA 3SNBA 4ZAEA 4TPYA 2GZ8A 3E90B 2BVSH 1GL1A 4NCYA 1DWCH 1AB9B 4Q80A 1O2OA 1C1VH 3VXEH 1O2GH 4O3UA 5C2ZA 1GCDA 3KF2A 4ZKOU 1O5GH 4DURA 1TNGA 2BD3A 1UTLM 3RC4A 1DOJA 2FTMA 3M3VA 1BUIA 4JYVH 5LPRA 2G5NA 1K1OA 2O8WA 2VGCC 1XUIA 1BOQA 3UFAA 2ZCHP 3NWUA 1AVWA 4DG4A 3P95A 4AFUA 2H9TH 4ZMAH 3V7TA 1CE5A 1DY9A 3T26A 1MMJN 3QTOH 1C1OA 1O38A 3SORA 1FJSA 2ZDKA 1SB1H 2GCTB 2ZC9H 3TK9A 2SGEE 2VU8E 3TGKE 4BNRA 1QB1A 1HV7A 3FZZA 4FUGA 1KSNA 2BXUH 1C2GA 1F0UA 4X2WA 1CGJE 5JB9S 1EUFA 1SHHB 3UNRA 1TQ0B 1XVMA 1QNJA 1IQJA 1KLIH 1RTLA 1V2ST 1GCTB 3E16B 2PR3A 1GJBB 3DFLA 3S0NA 1MTSA 3RXJA 2VVVA 3EGKH 4OS4A 1C5TA 3MMGA 1ZGVA 4D9RA 3RXAA 4WWYA 1JMOH 3SO3A 5CE1A 1AWHB 3SUEA 1KXAA 3E91A 4YT6H 5DP6A 5L30H 1K9OE 2QAAA 1A0LA 1AD8H 1E38B 1QRZA 3ZZ4A 2BDAA 5B6OA 4CRDA 1MTWA 2ULLA 1UVPA 3P92A 4I31A 1SQOA 2J4IA 8GCHG 1P8VC 5EOKA 4JZDH 1C2KA 3KQCA 4D7GA 2OXSA 4X2VA 5JBAS 2P3TB 3MYWA 3MO9A 1YF4A 3DHKH 5JB8S 2HLCA 4HI3A 1V2NT 1ZSJA 3T25A 1TMBH 2JH5D 4OGYA 1TWXB 4IN1A 1SBWA 3ESTA 4NFFA 1WSSH 2G4TA 3RXPA 2QF0A 1TQ7B 5ESTE 2CHAC 5E0JA 2VWOA 1TGSZ 1TMUH 2GVFA 1HAHH 1MAXA 1OSSA 1TE0A 2A7CA 1LTOA 1O5AB 4FUHA 4OS6A 4OS5A 2VIQA 2SGFE 4FUJA 1TOMH 1O5EH 4JZEH 1UTKA 2BX4A 4FUFA 5A0AE 3B8JA 2ZQ2A 1MD8A 4GAWA 2ZEBA 1GHXH 3FZDA 4R0IA 1O30A 1W0ZU 3E1XB 1F0SA 1N6YA 4ISOA 4X8VH 3RXKA 2OLGA 2P16A 4K1SA 3D62A 4X1PU 1WV7H 2R0KA 2PSYA 3V12A 2OQ5A 5G4BA 3QTVH 3BTTE 2BTCE 1CGIE 1YKTA 1EOLA 3M3TA 2ZHQH 1LVOA 1MZAA 3RMNH 2BZ6H 2XRCA 4H6TA 4Q7XA 2SGPE 3RXSA 1S85A 4K5ZA 5EXLA 1YBWA 1BB0B 3GYLB 2DE8A 1ZMLA 4YZUA 1T8NA 3NXPA 1GI9B 4K69A 1J17T 2Y81A 2ZQ1A 1GI5A 1GHYH 1K1JA 2Y7ZA 2CN0H 2IPHA 5HGGA 1ZZZA 5C3NA 1J15A 2FPZA 1HAOH 1FAKH 1FZZA 2ZU5A 4BAOB 2HPPH 3RXQA 2HPQH 1OP2A 1TPSA 2HWLB 3QDZB 1CA8B 1MKWK 2VB0A 3ZZ7A 4AFSA 1TGBA 2K1QA 1JIRA 1P02A 5L6NH 1RIWC 3E0PB 4BXWA 2ZU1A 2ZGJA 2BY8X 1ZR0A 2A4QA 2ZCLP 2FESH 1BBRE 3P6ZB 1A2CH 6ESTA 2FXRA 1YLCA 3RXGA 2F9VA 1PQ7A 1WQVH 3QLPH 3BTWE 2FI5E 2VIWA 4Y71A 1S6HA 1ZHRA 2WINI 2PKAB 1OS8A 4IS5A 2GMTB 2NU4E 4ABIA 4ZHAA 4YO9A 5BRRE 1PPGE 1Y3VA 1DS2E 1UTOA 2AMQA 1AO5A 2STAE 1HIAB 5EODA 4DW2U 1LPKB 1HGTH 1OX1A 2FS8A 1TBRH 1BHXF 2GD4B 4O97A 1VJ9U 2PTCE 4AGJA 4XBDA 5DP8A 1SGEE 4MVNA 1FY3A 1YPJH 2BD8A 1E37B 4INKA 1SQTA 2SNVA 5AVDA 2XC4A 1IHSH 3IWMA 1G3BA 2H9HA 1AFQB 3P8GA 4BXSA 2VH0A 2BD7A 2Z3EA 2ALVA 3ZVCA 2UUJB 2A4OA 3FAOA 1JRTA 4ZXYH 1NS3A 1C1RA 3M35A 4K2YA 3SNEA 8ESTE 2O9QA 1TRMA 1S0RA 4NG9H 4B2BA 1CO7E 1PPZA 1O2TA 1G3CA 1TONA 3KGPA 1HXEH 2ODPA 1S82A 3C27B 4IC5A 1C1WH 1O2UA 1AUTC 2JH6D 2TPIZ 4AORA 1XKAC 3TJUA 3ZZ6A 3QWCH 2FO9A 3MWIU 1SLVB 4XDEA 2FOAA 3U69H 1QY6A 1KXCA 3TU7H 3Q3YA 3PMHB 4CRFA 1O3NA 3LGUA 1GMHG 4ZROA 1WUNH 4A1XA 3UNSA 2A2QH 3G01A 3VPKA 1ELAA 3KEEA 1VGCB 2ZHDA 2CF8H 1V6DA 1AU8A 1O2JA 3B23B 4JMYA 3BEUA 2FEQH 1GBFA 2AS9A 2M5TA 4SGBE 5DGJA 3TH3H 1UHBA 1WYKA 3N7OA 4YOGA 1DFPA 2ANYA 2ZFTA 3EA9A 3AVZA 4X1RU 3SNAA 2OC1A 2ALPA 1K21H 1SGCA 2F9OA 3MH6A 1GVKB 3M5OA 3GCHB 2ZTXA 2BVRH 4BAQB 1O3CA 2BHGA 2J34A 3PWBA 1QURH 1EAIA 1C9TA 1EZSC 1FPCH 1QJ7B 1XUKA 4OGXA 3F1SB 3A7ZA 1UMAH 1BTHH 1LKBA 1MTNB 2ZGCA 3GICB 2UWPA 1O39A 3GCTG 5IYTA 1UTJA 2Z6BD 5J4QA 4UONA 3RXIA 1DT2A 1BITA 1QJ6B 3SI3H 4TY7A 1TNIA 3SJIA 1TABE 1GBEA 1NROH 3SU1A 2AGGX 2EI8A 2WV5A 5C67A 1ETSH 3ODFA 4DT7B 3D49H 1P3EA 3LONA 1JBUH 3BTEE 4X8UH 3RXTA 1GJAB 3A7VA 1C5PA 5EQSA 5LPEA 2FWWA 5C1XA 2Z9LA 4I8JA 1ESTA 1GI4A 4ZKSU 1IQHA 1HJAC 2XC0A 1C5RA 1P3CA 1E34B 1YGCH 3MU0A 5FPYA 3GY4A 1SGIB 4IMZA 2G4UA 2BOHB 1TX6A 2BXTH 3SHAH 1GHVH 1TYNA 2JKHA 1CHOG 2BDCA 1TNHA 3MNBA 2EI7A 2GP9B 4HZHA 1B0EA 1NRNH 3VGCB 3DUXH 3HK3B 3PO1B 1T31A 3UQVA 5A09A 2XBVA 2C8ZB 3A83A 4B71A 3RC5A 2B0FA 3GOVB 3T29A 2BDBA 4MPVA 2A4GA 1GI2A 3SNDA 2J2UA 1GMHF 2ANKH 1BZXE 1KXFA 3DT0H 2GCHF 3SU6A 1INCA 3ELAH 1JOUB 6CHAC 2BLVA 4ABBA 4MQAA 2Y7XA 4ABAA 2ZG0H 2ODQA 4IBLH 2ZGXH 3V0XA 1C1NA 1TNJA 1ID5H 2J9NA 4IW4E 4YOIA 1ARBA 3HKIB 5T6FA 1BIOA 2QCYA 4INHA 4B2AA 2D2DA 4Y7AA 4F4OC 1BBRH 4MG3A 1QGFA
chains in the Genus database with same CATH superfamily
1BQYA 2GDEH 4I8GA 1MQ5A 4A7IB 5EJZA 1C2JA 2WPHS 2FX6A 1H8DH 1P10A 2HNTE 3DSOA 2G8TA 2V3MA 3A7XA 2JDID 2TGAA 1PJPA 3PWCA 1GJ5H 3TVJB 2OD3B 1TPAE 3ENSB 3PMJA 2NU1E 5H4IB 1BA8B 2TGDA 3S9AA 3SUDA 3KL6A 4NSVA 2AGIX 4FUBA 4TYDA 3M3SA 5ESBA 1O3BA 1MH0A 5ABWA 1ZPBA 4MTBA 5C1UA 8KME2 1EPTB 1LHFH 4BTIB 1GVLA 1V2KT 1G36A 2ZI2H 4OS7A 4XOJA 5HM2A 1FNIA 1GI0A 4LOYH 2QY0B 1O3EA 3QGJA 2VWLA 1A7SA 1DPOA 1NT1A 3RXRA 4FUDA 1HUTH 2DE9A 3VFEA 4AYVB 1UJ1A 1SGTA 1XVOA 2TIOA 2V3HH 3S9CA 3T27A 1GHAF 3AASA 1OWHA 1PFXC 2XYAA 4ISIH 4LXBH 5AFYH 4RSPA 3T2NA 3SW2B 2IJOB 3AAUA 1P12E 1TX7A 1IQLA 3TH2H 5JYIA 1C1PA 1QFKH 3RXUA 1P04A 1H9IE 1VITG 1ZMNA 1QR3E 4B73A 3GY7A 2QF5A 3PYHA 1E79D 2D26C 3HPTB 3R0FA 1CHOF 1NFUA 5DP7A 1O31A 1A5GH 1F7ZA 5C94A 1YY3A 1CA0B 5F8XA 2F9NA 2ILNA 1C4V2 1C5VA 1K28D 1HB0B 1TNKA 2OQUA 5IDKA 1S81A 3M5LA 5FAHA 5C0TA 4ZHLU 5HYOA 3IG6B 1V2LT 2O8LA 2IJD1 1BRUP 4KTUA 2JH0D 5CHBA 1LHDH 5GIBA 1HBTH 4D76A 2F91A 1LVBA 1LO6A 5J4SA 4YTAA 5K7RA 4WH6A 3M36A 1O34A 3VG8A 1O2PA 1YPGH 2SGDE 3E0NB 1A0HB 4IGDA 5AF9H 4A1TA 2A5IA 5EGMA 1NTPA 4K3JA 3A80A 1H8ED 1O3JA 2IOTA 2XCFA 5E0HA 3AW0A 2UWLA 3AW1A 4U01A 2G81E 2QV1A 3FANA 3SJ8A 3BG4B 5JBTA 2Y80A 1WU1A 2PFEA 1SLWB 2KX4A 1PQ8A 1ACBE 4AX9H 1SGQE 3BEIB 3A7YA 4FXGH 1SVPA 2ZDAH 3LGYA 3OEHD 2SGQE 2ZFFH 3SJOA 2G52A 4I7YH 1AN1E 1BDAA 1KTTB 2YNAA 1OXGA 2BVXH 3P8OA 4LZ1H 4O3TA 1GBTA 1NBMD 3W95A 4WF8A 3SUFA 4AFZA 2KCPA 2CK3D 2AMPA 1NU9A 1N8OB 3K2UA 2YMSD 4Z0KA 1NRSH 5GWZA 3MH4A 2FM2A 2AMDA 4BANB 4CR5A 5C20A 2W3IA 1TRNA 1ELFA 1IHTH 1O2KA 1FLEE 1W13U 4DIHH 4M7GA 5A8YA 1XM1A 1ZGIA 3FKSD 1YLNA 4ASUD 2VWNA 4OS1A 5A0CA 1MTNC 3BSQA 2ZFRH 1FY1A 1YC0A 2A7JA 1QCPA 4AC9A 1Y8TA 4F49A 1ABJH 5EJ1A 2Z94A 3F9EA 3RMOH 5HXFA 1ARCA 1RD3B 2HVXA 2QF3A 1S6LA 3GCNA 1S0QA 1WTGH 4Y8YA 4AB8A 2Y5FA 2VH6A 1G3EA 4ZXXH 1ELDE 1VITF 1O5CB 3KIDU 1SLXB 7GCHG 1HDTH 3LPRA 1MU6B 1H9LB 1K22H 2C3SA 4B1TA 5GXPA 2Q6GA 2ZA5A 2THFB 4NWKA 1PPCE 3OU0A 3TK5A 2BOKA 2LP6A 3LH3A 1D3TB 5DKMA 1IQMA 1RTKA 1O5FH 3VB7A 1E35B 1GDUA 1P2JA 3U9AH 1PPBH 1TAWA 4TWYA 2EC9H 1GI6A 3RXLA 1GBBA 1FI8A 1C9PA 1Z6EA 4TWWA 7KMEH 1VCWA 1C4U2 3O8DA 3SQEE 3CS7A 1TIOA 4I8HA 2ZU4A 1JXPA 5I46H 4A1VA 1GMDG 1O2HA 1ZYOA 4XBBA 1K1MA 3SN8A 3PO1C 1LDTT 3EYDA 2PSXA 2Q6FA 1AKSA 3NUMA 1HAVB 1GI7B 3PLBA 4Y7BA 4AB9A 3LGIA 2UWOA 1WBGB 2RA3A 1XUGA 1BTXA 2FOMB 2Y6TA 3UREA 3LGTA 3NKKA 5EPNA 2KCYA 1UVUH 3KN2A 4VGCC 4GSOA 4UE7H 4NWLA 2NU3E 3HATH 1O33A 3RUOA 4ABJA 2WYJA 1GJCB 1C5OH 3SU0A 1HFDA 3O8BA 1O3IA 2BB4A 4DOQA 4RKJB 3RDZA 1T4VH 1ZHMA 3HGPA 1DSTA 2A45B 2P3FH 1SR5C 2G00A 4CR9A 2A31A 6GCHG 5GJ4B 4ZH8A 1BMMH 2ZPRA 3AK5A 1O5BB 4NIWA 3QZQA 1Y3XA 2HGTH 4MPXA 3R3GB 1XUHA 1SFQB 4YM9A 1NY22 1VR1H 2WPKS 3S9BA 1ZTJA 4MNVA 4K1EA 1IQEA 1W8BH 4Q7YA 2JETB 3F68H 1IQGA 3UUZA 3A86A 3BF6H 1RGQA 1GBIA 1TGNA 1WOFA 4FU9A 1L0ZA 4R8TB 1O2YA 2QXJA 1KMHB 2BQ6B 1OWJA 1IQNA 3A7TA 3BIVH 1HAPH 3KQ5A 1SHYA 1CHGA 3F9GA 2B8OH 5FCRA 3PMAB 1UTMA 2FI4E 1LVMA 1O2MA 4P02A 5DP9A 5F6MA 3OY6U 1L4DA 7GCHF 1SGFA 2GT8A 5C5NA 1GGDC 1OWDA 2XCNA 4KKDA 2BY7X 2KAIA 2K8IA 4CRAA 1P57B 1UVSH 1LHGH 1X7AC 1BJVA 1O3GA 2O8UA 2P8OC 1G9IE 1A0JA 2RG3A 3F6UH 3GDSA 1Y59T 2SNWA 5F03A 3VEQB 2SFAA 1BTYA 1P2NA 3LIWA 4KP0A 4ACBA 4FUCA 3SJKA 1AE8H 5DN6D 3MH7A 5A8XA 1Z71A 1ANBA 2AYWA 3PM3A 4HFPB 4GUXA 3C1KA 1D3DB 4MDSA 3A87A 5DG6A 4ASHA 3RXFA 3ITIA 3SGBE 5EW2H 1GPZA 1ZRBA 3SU5A 4NA7A 8GCHF 1GBLA 3ZV8A 1PQAA 2BD4A 3PV4A 1ELCA 1KDQB 3ZYDA 2VIDA 2QN5T 1V2QT 1YPMH 1C5SA 4ZKNU 4FOUC 1LMWB 1V2MT 1T7CA 1V2UT 1QBNA 2FI3E 1ZLRA 3BG8A 1J8AA 3GS9A 2GZ7A 3RLWH 1B7XB 3K65B 3I78A 1DVAH 4RT1A 4JZ1A 3EAJA 4ACAA 1OWIA 5DK1A 2GX4A 1VITH 2ASUB 5EXNA 2P94A 2BDIA 2WUCA 3SV9A 1MKXK 3MI4A 1GG6B 4GHTA 1KLJH 1AB9C 1TGCA 3UIRA 4TPIZ 5GCHG 2IPQX 3NCLA 1P11E 2XBWA 3Q77A 5DO4H 2OC7A 2W26A 2BLQA 2R0LA 3MU5A 5ETXA 3ZIAD 3SU3A 1DDJA 2FOGA 2G51A 2Z7FE 1O2QA 2J97A 2BDHA 5E8EH 3BTDE 4MNXA 3KHVA 1ZHPA 1TX8A 4X1SU 4IC6A 1Q3XA 4NZQA 1D3PB 4WY3A 1QTFA 3CP7A 1ZTKA 4UD9H 1O3HA 1DLKB 1FIZA 2OCVB 5K0HA 5FPTA 1ANDA 3CNRA 3RXBA 1LHCH 3NZIA 3VXFH 1SL3A 1AIXH 1QQUA 3S7KB 1XUFA 4NSYA 4XRNA 1DITH 2ZPQA 1HXFH 1EZQA 4B2CA 2GCTC 1W3CA 1CU1A 1O37A 2AEIH 3PTBA 3OE7D 1PYTC 3I77A 4CRCA 1LVYA 1OP0A 1BTZA 5L2ZH 1GBDA 1YPEH 3OX7U 2BDGA 2W7UA 2GKVE 3FP6E 1P03A 3F9FA 1ESAA 3VB4A 1KXBA 2A4RA 2J92A 3OYPA 4Y6DA 4F48B 4Z6AH 1ELEE 2P95A 1D3QB 1GCTC 1ZSLA 1JIMA 1MU8B 1MKWH 1CBWB 1P2OA 4KTCA 2PKSB 3RXCA 4BAKB 4KTSA 1HPGA 1AI8H 1FDPA 2XW9A 3ATKA 3TJOA 3U1IB 4P00A 4AFQA 1RXPA 2G5VA 5T6GA 2XNDD 1TALA 3BTQE 1EZXC 1GJ6A 1EP5A 1NO9H 3GDVA 1UTNA 1W0JD 5CMXH 2ZFSA 1C5WB 4FVBA 1TOCB 4KGAA 5HM9A 1BMLA 3SGQE 1W12U 3ZZ8A 1GBHA 1SG8B 4Y8XA 3D23A 3KCGH 5DJ7A 1HJ9A 1W11U 3MNXA 2XBYA 2WUBA 3PTNA 3NK8A 3M37A 2AH4X 3TLOA 1FIWA 3VB3A 2VGCB 4HGCA 1A61H 4X6MA 4D8NA 2C8XB 3RM0H 1AVGH 2FX4A 4MPUA 3SHCH 2YNBA 1MKXH 1UK4A 1O32A 2W6JD 1P9UA 3RC6A 1G2LA 1HJ8A 5EW1H 1QBVH 3BTFE 3QUMP 1A1RA 2ZP0H 1QL9A 2JJ2D 3LOXA 4AG2A 1QHRB 1S83A 2F4LA 3BTKE 3SV6A 4UFDH 3OY5U 1AE5A 1EP6A 4F55A 3KQEA 1EB1H 1GHWH 4HG6A 3K6ZA 5T6DA 4UFGH 4O03A 5DPAA 1AUJA 1DXWA 1T4UH 1O3LA 1VCPA 1P09A 1A5IA 1L1GA 1BMAA 1NN6A 1CT2E 2RCEA 3SBKA 3LKWA 1MCTA 1GBCA 4NIVA 1AGJA 4ZUHA 2BD5A 1UVOA 3UR6A 2ZPSA 1GI1A 4YLQH 5T1VA 9LPRA 3TGJE 3LJOA 1Y3YA 1ANCA 2PHBA 2ZWLH 3TJVA 2Y82A 3V13A 2OBQA 1O3DA 3RP2A 2ZDVH 5E2PA 2BD2A 3ZZ9A 1PQ5A 4I8LA 3FN8A 4J2YB 4Y8ZA 2ZGHA 1UCYK 1GJ4H 3A8DA 2C93B 4GPGA 2FODA 1B5GH 1LQDB 3LU9B 7LPRA 3BV9B 2BYAX 3S7HB 2Q1JA 1A3EH 1ZSKA 2FDAA 2LPRA 2V3OH 2H1UA 1SLUB 1CQQA 3SZNA 4XD7D 4GLYA 3ZZ3A 2ZF0H 6LPRA 2QXHA 1GDQA 1HLTH 4TT3D 2XWAA 4ABGA 2O8TA 4JK5A 1QIXB 4I8KA 1BRCE 4LK4A 3UOPA 4Q63A 3M5NA 2FOBA 3D65E 1IOEA 2ZFPH 3ZVDA 1LCYA 3MTYA 2A2XH 1ZPCA 2PW8H 3ZZBA 3UY9A 3M7TA 2B5TB 2LELA 4SGAE 2VBCA 3S69A 2BM2A 2HRVA 2UUFB 3HGNA 3SV2H 4YESB 3ZV9A 4CREA 3GCTF 3DD2H 2ZFQH 4Y79A 1OKXA 1YM0A 1MTUA 2UUYA 2EA3A 1MTVA 1FN6A 2XWBI 2XBXA 5CDFE 1O35A 1JRSA 1NRPH 3A8CA 1MBQA 3LGWA 1EX3A 4AZ2B 2W5EA 1V2PT 3RXEA 1GHZA 3F9HA 2GMTC 3A82A 4ZHMU 2FP7B 5HIZA 2FLBH 1AHTH 1W2KH 1IAUA 3K6YA 3L6PA 5JPMH 5HKKD 3SGAE 3PROA 3BTGE 4FVDA 5C0UA 3GY8A 2VJ1A 1L4ZA 3PRBA 2ANWA 1C2IA 1E0FD 1HCGA 1GG6C 4HTCH 1GBJA 4JYUH 2Z3CA 1CT4E 2BX3A 3UPEA 3M5MA 2W7SA 1NZQH 1AFQC 3LH1A 1P2IA 2QGRA 1HNEE 2AHME 4I32A 2P93A 4WMFA 1GJ7B 1NU7B 1AY6H 5TCAA 1YPHC 2BQ7B 1BRBE 2STBE 1YP9A 3PMBB 3QK1A 3ZYEA 1PYTD 4ZKRU 3H09A 3RU4D 3LJJA 3MOCA 1C2FA 3MHWU 2GJGA 1GJ9B 5A2MH 1P01A 2VWMA 1RIWB 1O2SA 3LT3A 5GDSH 2VINA 1AFEH 1OP8A 2H2ZA 1QBOA 1SGYE 1UHBB 1NFXA 3UAIC 4WVPE 1MCVA 3M7QA 3RMMH 1BHXB 1KXEA 2GDDA 4MPWA 5T3HA 4WH8A 2HLDD 3URCA 1S6FA 1VGCC 1O36A 3TJNA 2TGTA 2H6MA 1H4WA 3I29A 1QJ1B 3Q00A 5A8ZA 3V3MA 2IN2A 1GHBG 3UWIA 1J14A 1IQIA 3H5CB 1RRKA 1V2JT 1QB6A 2DUCA 2H9EH 3DFJA 3TNTA 2A5KA 1D9IA 1S84A 4O9VA 3GY6A 2HVYB 1TBQH 1J9CH 3SI4H 2NWNA 1SFIA 4OS2A 1C2HA 2PKAA 3GCHC 3ZVAA 3M7UA 1O2XA 4AYYB 2ZKSA 2R3UA 2HOBA 2XTTB 3EBNA 5EQRA 1QA7A 1HIAA 3F2GA 4ESTE 3SUGA 3RM2H 1CGHA 5BPEA 4JZFH 1Z8GA 1O2IA 3RU4T 1SOZA 3M61U 5DP5A 3RXHA 5E0GA 1BTPA 1LKAA 3QO6A 2FZZA 1BTUA 4A6LA 2OINA 1TPOA 2A0QB 1ETTH 3A7WA 2BMGB 1EQ9A 4RKOB 2ZIQH 1EAUA 1H9HE 3T5FH 2TBSA 2WZQA 4E7NA 4XFQA 1SSXA 2V7QD 1P0SH 4CH2B 1UTQA 1OYTH 3LGVA 1XKBC 2PUQH 1GMCG 1C5QA 2M2AA 4AN7A 5GPIB 4PROA 1C1SA 1FUJA 1TB6H 3A8BA 2VIVA 3H7OA 3MU8A 4Q2KA 1Z6JH 3P8FA 1L1NA 4INLA 5C17A 1Z1IA 5E2OA 1FMGA 4X1NU 1P05A 5F8TA 2EEKA 2WPMS 2P59A 4ABFA 3DSGA 3EA7A 1QB9A 2O8MA 1FY5A 2BDYA 4ISNA 4AGKA 1FY4A 2BD9A 3A89A 1KXDA 3VGCC 2HALA 1F5RA 4K8BA 1SC8U 3WY8A 3E3TA 1O3MA 2OUAA 1QRWA 1YPLH 1ZOMA 2V35A 1CT0E 1V2WT 3P17H 4B75A 3VB6A 2F9BH 1G3DA 1DX5M 2FOHA 1YPKH 1W7XH 2BY6X 5FHTA 3MO6A 3OFND 3ZZAA 1DICA 1MABB 1WTHD 2AIQA 1G30B 2XNIA 3ODDA 2FOCA 1L2EA 1YYY1 5KECA 3NPSA 4DGJA 1O2ZA 1TLDA 3MNSA 2NU0E 2C8WB 2QIQA 2YMSB 5JDUB 2Z9KA 3EDXB 1W10U 1GI3A 2ZHFH 4CRGA 1GHBF 3A88A 1DLEA 1C2DA 3MU4A 1HAXB 2ZTZA 3RXMA 1ELGA 1P2KA 1SGNE 2C4FH 3OTJE 3GCOA 5I25A 1EAXA 1O3PB 1THRH 1T8LA 3F3BA 1ELBA 1BJUA 1KY9A 4DCDA 2PGQB 1NRRH 1P9SA 2C90B 1EATA 3E8LA 2A32A 5L2YH 4UFEH 3TGIE 1O2LA 4A92A 3O8CA 1EJNA 1W7GH 1UK2A 1COWD 1RTFB 3UTUH 4JYTA 2FLRH 1Z8RA 1QQ4A 2C8YB 3W94A 1HJAB 1GI8B 1KLTA 3A84A 5HMAA 2FOEA 2J94A 1DUEA 3U98H 1QL7A 3VB5A 1C5XB 1MBMA 1EPTC 1OWEA 3ZZ5A 3EE0B 3SV8A 1C2LA 2R3YA 3MNCA 3GYMA 2PWXA 4Y11E 3KYFA 3FVFB 2NU2E 1F92A 3ZVFA 5C1YA 1F0TA 4NZLA 3PB1E 2TGPZ 1TA2A 4MNYA 2XC5A 3Q3KA 2Z9IA 3A8AA 2GZ9A 1THSH 1ESBA 4AG1A 3UR9A 1O2VA 1UK3A 3PV2A 5A0BA 5TCCA 4A5TS 1LPZB 4U30A 3TK6A 1ANEA 4BAMB 3IITA 4WJG2 2J98A 1HAYB 2GV7A 2I6SA 1GMCF 2D8WA 1SQAA 1C1MA 4M9FA 3BIUH 4K60A 1K1IA 6CHAB 2UUKB 2L6OA 1AVXA 1MZDA 2QXGA 1C1QA 3FOAA 2WV4A 4H4FA 1NFWA 4NA9H 1TMTH 5EU8A 1K1LA 2SGAA 1AZ8A 1KYNA 4IMQA 3UOUA 2FMJA 1EASA 1YCPK 1GMDF 1CA0C 1KTSB 4JK6A 2CGAA 1EB2A 1MD7A 3HKJB 3L33A 3H7TA 2LIZA 2KCAA 3QX5H 3FP8E 5FXLA 2OC0A 2B7DH 1G2MA 1V3XA 2Q6DA 4Y10E 1DY8A 4X2YA 3RMLH 1XX9A 4DY7B 2FTLE 4RI0A 1GWAA 5TJXA 1O2NA 2BZAA 4NIYA 1PPFE 1DWEH 4D7FA 1ORFA 2R2MB 4BAHB 5EQQA 1P2MA 1KIGH 1DXPA 1C1TA 4ABDA 2FS9A 3KQBA 1TPPA 1VCQA 3ZVEA 1SQRA 4UFFH 3GY2A 3MQKC 1XMNB 3BG4C 4K8YA 4NFEA 1GJ8B 2QE7D 1XXFA 6GCHF 4U2WA 4UEHH 3UNQA 3RLYH 1IQKA 2H5CA 1LQEA 1VJAU 1TBZH 5FX5A 1UO6A 4CBOA 1K1NA 3RXVA 1TNLA 5CHAB 2OP9A 2EI6A 1JWTA 1EJAA 1EKBB 1EPTA 2QA9E 3EQ0H 1FONA 4BTTB 4BTUB 5F53A 1C1UH 1K1PA 1C5MD 3BEFB 1N8OC 2VVUA 4AOQA 2CV3A 4X6OA 3ZVGA 4WMDA 5PTPA 1MQ6A 3AAVA 3F2FA 1H1BA 3RU4E 3SU4A 1QZ8A 1DWBH 1E1QD 3GDUA 3T28A 5F8ZA 1GL0E 2WPIS 3EE7A 3SU2A 4IN2A 1C2EA 1O3OA 1T8MA 1FQ3A 4H6SB 2AERH 4DJZB 1D4PB 2ZECA 3NRLA 1C5UA 4CHAB 1SGDE 2RA0A 2Y5GA 3BTME 4E05H 4ABEA 3L3TA 3DSPA 1J16A 2WPJS 1A4WH 1UCYE 1DANH 3LC3A 3SYJA 1Z8IB 2CF9H 1OHHD 2F9UA 3A81A 4TY6A 8LPRA 2CMYA 3SOSA 3TH4H 1A5HA 1QRXA 3SJ9A 2GTBA 2CXVA 1M9UA 2GV6A 1HAIH 4LZ4B 3O8RA 1YCPH 1VZQH 2J38A 1W0KD 1NBME 1YCPM 1AKSB 2FOFA 2QXIA 2ESTE 2V6NA 1BTWA 1Z7KA 2GCHG 1V2OT 3ATMA 4ISLA 4YOJA 2PUXB 4BOHA 4X8SH 1GJDB 2Z9JA 1S5SA 3ZZDA 2ZDNA 1N6XA 2V0BA 2GT7A 5LPFA 2K7XA 2OTVA 3BTHE 2QYIA 1ZMJA 3E6PH 3BN9A 2AFQB 2D1JA 1P06A 1EFRD 3QZRA 1OOKB 2OC8A 2BLWA 2RDLA 3KNXA 4GHQA 3TNSA 2VVCA 3CENA 1F0RA 1FPHH 3FO8D 3UWJH 3ZZCA 1E36B 1MUEB 5IK2D 1C5YB 2BLOA 1SMFE 5KGOA 1FN8A 2WPLS 1F2SE 1O2WA 5HIYA 1U6QA 1PPEE 1Q31A 1BBRK 1W14U 1Y5UT 5DP4A 5LH8A 2J95A 1EAWA 4X6NA 2TRMA 1WQSA 2I6QA 1NC6A 4NGAH 1GDNA 5FL7D 1ZJKA 3UQOA 7ESTE 2ZO3H 3RXDA 4E06H 4K1TA 2ZHEH 3SZEA 3Q3XA 3RXOA 1G37A 3FFGA 2BQWB 1HAGE 1FX0B 5GCHF 2ANMH 2KFWA 4XBCA 3SQHE 2G55A 2VIPA 1MAYA 2WV9A 1DM4B 1SPJA 3OTPA 4FUEA 3TITA 3LDXH 2WSSD 3TPIZ 1TGTA 1SGPE 5EJLA 2ZTYA 3P8NA 2ZDMA 1B0FA 1T32A 4GVUA 1Y3WA 5B6LA 5JBCS 1PPHE 1RJXB 1QA0A 1ZRKA 3T62A 1K0HA 4FU8A 4GCHG 1VKYA 4YLUA 2Z3DA 2GGVB 2PTNA 1GHAG 1O3KA 2ZNKH 2ZCKP 1ABIH 4D9QA 5FX6A 2JETC 1Z8JB 1ZTLA 1HAZB 1O3FA 2ZU2A 1F5LA 1AWFH 1FAXA 3ATIA 3EA8A 1THPB 2KAIB 1BRAA 4MLFB 2YOLA 1SOTA 3SV7A 3A85A 4RN6A 1QL8A 2H5DA 3CS0A 1C4Y2 4X6PA 4B76A 2L74A 3N7DA 3MH5A 4FU7A 3LC5A 2VNTA 3U1JB 1UTPA 4WXVA 2ZGBH 4B6FA 1CSOE 3PLPA 3ZVBA 1TRYA 1OYQA 1N1LA 2ODYB 3U8OH 3U8RH 2FYQA 3SNCA 2FYRA 2PP6A 2ZZUH 5AFZH 3QN7A 4H42U 1LPGB 4ABHA 1DUAA 1AMHA 3GY5A 4MNWA 4VGCB 4U32A 4NA8A 1GBAA 3TIUA 2Z9GA 1WCZA 2F9PA 4Y76A 5FBIA 4DVAU 1C5LH 1NPMA 4ISHH 1F5KU 1HRTH 1RFNA 4FUIA 1A46H 1BMNH 1AQ7A 1NFYA 1V2RT 3JZ2B 4QT8C 1CVWH 4XSKU 2CJIA 1HAVA 4NIXA 1BMFD 1AZZA 3GISB 2CHAB 2QC2A 1OPHB 3ATWA 4X2XA 1NESE 1TFXA 3Q76A 2WHXA 2KR7A 3QGNB 3K9XB 5DSFA 2ZDLA 1IQFA 1T8OA 1V2TT 3GY3A 4Y0YE 2PLXA 5FBEA 2EQNA 2F83A 4THNH 2P3UB 1Z1JA 1EZUC 1SI5H 3B9FH 1FY8E 1XXDA 5LGOA 1WXRA 4UDWH 1FXYA 4Q7ZA 4X0WU 1C5NH 1NM6A 1O2RA 3MFJA 2HNTC 4CBNA 2ZU3A 1O5DH 3KQDA 1FV9A 3PLKA 1V2VT 3P70B 5AHGH 4CH8B 1YLDA 4B74A 1YPHE 1UVTH 2PV9B 2F3CE 3DA9B 2FIRH 3STIA 4GCHF 4WMEA 1C5ZB 2XXLA 9ESTA 1GGDB 1Y5BT 5CHAC 1OWKA 2HNTF 3STJA 2J5UA 1DE7H 4KELA 3FP7E 4WXIA 1ELVA 1K2I1 2A1DB 3OEED 2LNCA 1DSUA 3MO3A 2P8OB 5EXMA 5EPYA 1GVZA 3WW7A 2R2WU 4JCNA 1WAYB 4I33A 3JZ1B 3MU1A 4YT7H 1A3BH 2AGEX 1UCYH 1BT7A 1LHEH 2R9PA 1EXFA 2OBOA 1ELTA 5FPSA 1L1JA 2BY9X 1TA6A 3U8TH 1W0YH 1EJMA 5C5OA 2VIOA 3ATLA 2WYGA 4CHAC 5JBBS 4DIIH 1BCUH 4XE4A 4CRBA 1H8IH 4X1QU 3URDA 2A5AA 1G32B 4Y0ZE 1O3AA 4RT0A 2PGBB 4I86A 1D6RA 1SGRE 1GBMA 1O0DH 1RS0A 2A7HA 2B9LA 1HYLA 1NRQH 2AIPA 1XUJA 1C2MA 1DWDH 4X8TH 1ZPZA 1Q2WA 5DP3A 1Y3UA 4JZIA 1SGFG 4J1YA 5SGAE 1D6WA 1GBKA 2ZHWH 4E7RG 1EOJA 5FCKA 1CBWC 3WWFA 5EG4A 2BY5X 3HK6B 1ETRH 1ZJDA 1Y5AT 2PKSC 1P2QA 2W3KA 3OSYA 1KDQA 2Y5HA 3SNBA 4ZAEA 4TPYA 2GZ8A 3E90B 2BVSH 1GL1A 4NCYA 1DWCH 1AB9B 4Q80A 1O2OA 1C1VH 3VXEH 1O2GH 4O3UA 5C2ZA 1GCDA 3KF2A 4ZKOU 1O5GH 4DURA 1TNGA 2BD3A 1UTLM 3RC4A 1DOJA 2FTMA 3F0OA 3M3VA 1BUIA 4JYVH 5LPRA 2G5NA 1K1OA 2O8WA 2VGCC 1XUIA 1BOQA 3PRDA 3UFAA 2ZCHP 3NWUA 1AVWA 3WWBA 4DG4A 2OK5A 3P95A 4AFUA 2H9TH 4ZMAH 3V7TA 1CE5A 1DY9A 3T26A 1MMJN 3QTOH 1C1OA 1O38A 3SORA 1FJSA 2ZDKA 1SB1H 2GCTB 2ZC9H 3TK9A 2SGEE 2VU8E 3TGKE 4BNRA 1QB1A 1HV7A 3FZZA 4FUGA 1KSNA 2BXUH 1C2GA 1F0UA 4X2WA 1CGJE 5JB9S 1EUFA 5EIYA 1SHHB 3UNRA 1TQ0B 1XVMA 1QNJA 2JIZD 1IQJA 1KLIH 1RTLA 1V2ST 1GCTB 3E16B 5GNDA 2PR3A 1GJBB 3DFLA 3S0NA 3N7EA 1MTSA 3RXJA 2VVVA 3EGKH 4OS4A 1C5TA 3MMGA 2K0QA 1ZGVA 4D9RA 3RXAA 4WWYA 1JMOH 3SO3A 5CE1A 1AWHB 3SUEA 1KXAA 3E91A 4OM9A 4YT6H 5DP6A 5L30H 1K9OE 2QAAA 1A0LA 1AD8H 1E38B 1QRZA 3ZZ4A 2BDAA 5B6OA 4CRDA 1MTWA 2ULLA 1UVPA 3P92A 4I31A 1SQOA 2J4IA 8GCHG 1P8VC 2EY4C 4JZDH 5EOKA 1C2KA 3KQCA 4D7GA 2OXSA 4X2VA 5JBAS 2P3TB 3MYWA 3MO9A 1YF4A 3DHKH 5JB8S 2HLCA 4HI3A 1V2NT 1ZSJA 3T25A 1TMBH 2JH5D 4OGYA 1TWXB 4IN1A 1SBWA 3ESTA 4NFFA 1SKYE 1WSSH 2G4TA 3RXPA 2QF0A 1TQ7B 5ESTE 2CHAC 5E0JA 2VWOA 1TGSZ 1TMUH 2GVFA 1HAHH 1MAXA 1OSSA 1TE0A 2A7CA 1LTOA 1O5AB 4FUHA 4OS6A 4OS5A 2VIQA 2SGFE 4FUJA 1TOMH 1O5EH 4JZEH 1UTKA 2BX4A 4FUFA 5A0AE 3B8JA 2ZQ2A 1MD8A 4GAWA 2ZEBA 3PV5A 1GHXH 3FZDA 4R0IA 1O30A 2XOKD 1W0ZU 3E1XB 1F0SA 1N6YA 4ISOA 4X8VH 3RXKA 2OLGA 2P16A 4K1SA 3D62A 4X1PU 1WV7H 2R0KA 2PSYA 5KEDA 3V12A 2OQ5A 2W6ID 5G4BA 3QTVH 3BTTE 2BTCE 1CGIE 1YKTA 1EOLA 3M3TA 2ZHQH 1LVOA 1MZAA 2WPDD 3RMNH 2BZ6H 2XRCA 4H6TA 4Q7XA 2SGPE 3RXSA 1S85A 4K5ZA 3KYGA 5EXLA 1YBWA 1BB0B 3GYLB 2DE8A 1ZMLA 4YZUA 1T8NA 3NXPA 1GI9B 4K69A 1J17T 2Y81A 2ZQ1A 1GI5A 1GHYH 1K1JA 2Y7ZA 2RDEA 2CN0H 2IPHA 5HGGA 2QF4A 1ZZZA 5C3NA 1J15A 2FPZA 1HAOH 1FAKH 1FZZA 2ZU5A 4BAOB 2HPPH 3RXQA 2HPQH 1OP2A 1TPSA 2HWLB 3QDZB 1CA8B 1MKWK 2VB0A 3ZZ7A 4AFSA 1TGBA 2K1QA 1JIRA 1P02A 5L6NH 1RIWC 3E0PB 4BXWA 2ZU1A 2ZGJA 2BY8X 4YXWD 1ZR0A 2A4QA 2ZCLP 2FESH 1BBRE 3P6ZB 1A2CH 6ESTA 2FXRA 1YLCA 3RXGA 2F9VA 1PQ7A 1WQVH 3QLPH 3BTWE 2FI5E 2VIWA 4Y71A 1S6HA 1ZHRA 2WINI 2F43B 2PKAB 1OS8A 4IS5A 2GMTB 2NU4E 4ABIA 4ZHAA 4YO9A 5BRRE 1PPGE 1Y3VA 1DS2E 1UTOA 2AMQA 1AO5A 2STAE 1HIAB 5EODA 4DW2U 1LPKB 1HGTH 1OX1A 2FS8A 1TBRH 2JJ1D 1BHXF 2GD4B 4O97A 1VJ9U 2PTCE 4AGJA 4XBDA 5DP8A 1SGEE 4MVNA 3F0PA 1FY3A 1YPJH 2BD8A 1E37B 4INKA 1SQTA 2SNVA 5AVDA 2XC4A 1IHSH 3IWMA 1G3BA 2H9HA 1AFQB 3P8GA 4BXSA 2VH0A 2BD7A 2Z3EA 2ALVA 3ZVCA 2UUJB 1H8HD 2A4OA 3FAOA 1JRTA 4ZXYH 1NS3A 1C1RA 3M35A 4K2YA 3SNEA 4B6EA 8ESTE 2O9QA 1TRMA 1S0RA 4NG9H 4B2BA 1CO7E 1PPZA 1O2TA 1G3CA 1TONA 3KGPA 1HXEH 2ODPA 1S82A 3C27B 4Z1MD 1E1RD 4IC5A 1C1WH 1O2UA 1AUTC 2JH6D 2TPIZ 4AORA 1XKAC 3TJUA 3ZZ6A 3QWCH 4Q4LA 2FO9A 3MWIU 1SLVB 4XDEA 2FOAA 3U69H 1QY6A 1KXCA 3TU7H 3Q3YA 3PMHB 4CRFA 1O3NA 3LGUA 1GMHG 4ZROA 1WUNH 4A1XA 3UNSA 2A2QH 3G01A 3VPKA 3U28C 1ELAA 3KEEA 4FETA 1VGCB 2ZHDA 2CF8H 1V6DA 3N99A 1AU8A 1O2JA 3B23B 4JMYA 3BEUA 2FEQH 1GBFA 2AS9A 1YWUA 2M5TA 4SGBE 5DGJA 3TH3H 1UHBA 3W1EA 1WYKA 3N7OA 4YOGA 1DFPA 2ANYA 2ZFTA 3EA9A 3AVZA 4X1RU 3SNAA 2KZ4A 2OC1A 2ALPA 1K21H 1SGCA 2F9OA 3MH6A 1GVKB 3M5OA 3GCHB 2ZTXA 2BVRH 4BAQB 1O3CA 2BHGA 2J34A 3PWBA 1QURH 1EAIA 1C9TA 1EZSC 1FPCH 1QJ7B 1XUKA 4OGXA 3F1SB 3A7ZA 1UMAH 1BTHH 1LKBA 1MTNB 2ZGCA 3GICB 2UWPA 1O39A 2YMSC 3GCTG 5IYTA 3OAAD 1UTJA 2Z6BD 5J4QA 4UONA 3RXIA 1DT2A 1BITA 1QJ6B 3SI3H 4TY7A 1TNIA 3SJIA 1TABE 1GBEA 1NROH 3SU1A 2AGGX 2EI8A 2WV5A 5C67A 1ETSH 3ODFA 4DT7B 3D49H 1P3EA 1WDIA 3LONA 1JBUH 3BTEE 4X8UH 3RXTA 4DT4A 1GJAB 3A7VA 1C5PA 5EQSA 5LPEA 2FWWA 5C1XA 2Z9LA 4I8JA 1ESTA 1GI4A 4ZKSU 1IQHA 1HJAC 2XC0A 1C5RA 1P3CA 1E34B 4TSFD 1YGCH 3MU0A 5FPYA 3GY4A 1SGIB 4IMZA 2J98B 2G4UA 2BOHB 1TX6A 2BXTH 3SHAH 1GHVH 1TYNA 2JKHA 1CHOG 2BDCA 1TNHA 3MNBA 2EI7A 2GP9B 4HZHA 1B0EA 1NRNH 3VGCB 3DUXH 3HK3B 3PO1B 1T31A 3F2HA 3UQVA 5A09A 2XBVA 2C8ZB 3A83A 4B71A 3RC5A 2B0FA 3GOVB 3T29A 2BDBA 4MPVA 2A4GA 1GI2A 3SNDA 1UW7A 2J2UA 1GMHF 2ANKH 1BZXE 1KXFA 4ZCNA 2RFKC 3DT0H 2GCHF 3SU6A 1INCA 3ELAH 1JOUB 6CHAC 2BLVA 4ABBA 4MQAA 2Y7XA 4ABAA 2ZG0H 2ODQA 4IBLH 2ZGXH 3V0XA 1C1NA 1TNJA 3UB0A 1ID5H 2J9NA 4IW4E 4YOIA 1ARBA 2KM0A 2KCOA 3HKIB 3DCLA 5T6FA 1BIOA 2QCYA 4INHA 4B2AA 2D2DA 4Y7AA 4F4OC 1BBRH 4MG3A 1QGFA
chains in the Genus database with same CATH topology
1BQYA 2GDEH 4I8GA 1MQ5A 4A7IB 1C2JA 2WPHS 2FX6A 1H8DH 1P10A 2HNTE 2G8TA 3A7XA 2TGAA 1PJPA 3PWCA 1GJ5H 3TVJB 2OD3B 1TPAE 3ENSB 3PMJA 2NU1E 5H4IB 1BA8B 2TGDA 3S9AA 3SUDA 3KL6A 4NSVA 2AGIX 4FUBA 4TYDA 3M3SA 5ESBA 1O3BA 1MH0A 5ABWA 1ZPBA 4MTBA 5C1UA 8KME2 1EPTB 1LHFH 4BTIB 1GVLA 1V2KT 1G36A 2ZI2H 4OS7A 4XOJA 5HM2A 1FNIA 1GI0A 4LOYH 2QY0B 1O3EA 3QGJA 2VWLA 1A7SA 1DPOA 1NT1A 3RXRA 4FUDA 1HUTH 2DE9A 3VFEA 4AYVB 1UJ1A 1SGTA 1XVOA 2TIOA 2V3HH 3S9CA 3T27A 1GHAF 3AASA 1OWHA 1PFXC 2XYAA 4ISIH 4LXBH 5AFYH 4RSPA 3T2NA 3SW2B 2IJOB 3AAUA 1P12E 1TX7A 1IQLA 3TH2H 5JYIA 1C1PA 1QFKH 3RXUA 1P04A 1H9IE 1VITG 1ZMNA 1QR3E 4B73A 3GY7A 3PYHA 2D26C 3HPTB 3R0FA 1CHOF 1NFUA 5DP7A 1O31A 1A5GH 1F7ZA 1CA0B 5F8XA 2F9NA 2ILNA 1C4V2 1C5VA 1K28D 1HB0B 1TNKA 2OQUA 5IDKA 1S81A 3M5LA 5FAHA 4ZHLU 5HYOA 3IG6B 1V2LT 2O8LA 1BRUP 4KTUA 2JH0D 5GIBA 1LHDH 1HBTH 4D76A 2F91A 1LVBA 1LO6A 5J4SA 4YTAA 5K7RA 4WH6A 3M36A 1O34A 1O2PA 1YPGH 2SGDE 3E0NB 1A0HB 4IGDA 5AF9H 4A1TA 2A5IA 5EGMA 1NTPA 4K3JA 3A80A 1O3JA 2XCFA 2IOTA 5E0HA 3AW0A 2UWLA 3AW1A 4U01A 2G81E 2QV1A 3FANA 3SJ8A 3BG4B 5JBTA 2Y80A 1WU1A 2PFEA 1SLWB 1PQ8A 1ACBE 4AX9H 1SGQE 3BEIB 3A7YA 4FXGH 1SVPA 2ZDAH 3LGYA 2SGQE 2ZFFH 3SJOA 2G52A 4I7YH 1AN1E 1BDAA 1KTTB 2YNAA 1OXGA 2BVXH 3P8OA 4LZ1H 4O3TA 1GBTA 3W95A 4WF8A 3SUFA 4AFZA 2AMPA 1NU9A 1N8OB 3K2UA 4Z0KA 1NRSH 5GWZA 3MH4A 2FM2A 2AMDA 4BANB 4CR5A 5C20A 2W3IA 1TRNA 1ELFA 1IHTH 1O2KA 1FLEE 1W13U 4DIHH 4M7GA 5A8YA 1XM1A 1ZGIA 2VWNA 4OS1A 5A0CA 1MTNC 3BSQA 2ZFRH 1FY1A 1YC0A 2A7JA 1QCPA 1Y8TA 4F49A 1ABJH 5HXFA 2Z94A 3F9EA 3RMOH 1ARCA 1RD3B 2HVXA 2QF3A 3GCNA 1S0QA 1WTGH 4Y8YA 4AB8A 2Y5FA 2VH6A 1G3EA 4ZXXH 1ELDE 1VITF 1O5CB 3KIDU 1SLXB 7GCHG 1HDTH 3LPRA 1MU6B 1H9LB 1K22H 2C3SA 4B1TA 5GXPA 2Q6GA 2ZA5A 2THFB 4NWKA 1PPCE 3OU0A 3TK5A 2BOKA 3LH3A 5DKMA 1D3TB 1IQMA 1RTKA 1O5FH 3VB7A 1E35B 1GDUA 1P2JA 3U9AH 1PPBH 1TAWA 4TWYA 2EC9H 1GI6A 3RXLA 1GBBA 1FI8A 1C9PA 1Z6EA 4TWWA 7KMEH 1VCWA 1C4U2 3O8DA 3SQEE 3CS7A 1TIOA 4I8HA 2ZU4A 1JXPA 5I46H 4A1VA 1GMDG 1O2HA 1ZYOA 4XBBA 1K1MA 3SN8A 3PO1C 1LDTT 3EYDA 2PSXA 2Q6FA 1AKSA 3NUMA 1HAVB 1GI7B 3PLBA 4Y7BA 4AB9A 3LGIA 2UWOA 1WBGB 2RA3A 1XUGA 1BTXA 2FOMB 2Y6TA 3UREA 3LGTA 3NKKA 5EPNA 1UVUH 3KN2A 4VGCC 4GSOA 4UE7H 4NWLA 2NU3E 3HATH 1O33A 3RUOA 4ABJA 2WYJA 1GJCB 1C5OH 3SU0A 1HFDA 3O8BA 1O3IA 2BB4A 4DOQA 4RKJB 3RDZA 1T4VH 1ZHMA 3HGPA 1DSTA 2A45B 2P3FH 1SR5C 2G00A 4CR9A 2A31A 6GCHG 5GJ4B 4ZH8A 1BMMH 2ZPRA 1O5BB 4NIWA 3QZQA 1Y3XA 2HGTH 4MPXA 3R3GB 1XUHA 1SFQB 4YM9A 1NY22 1VR1H 2WPKS 3S9BA 1ZTJA 4MNVA 4K1EA 1IQEA 1W8BH 4Q7YA 2JETB 3F68H 1IQGA 3UUZA 3A86A 3BF6H 1RGQA 1GBIA 1TGNA 1WOFA 4FU9A 1L0ZA 4R8TB 1O2YA 2QXJA 2BQ6B 1OWJA 1IQNA 3A7TA 3BIVH 1HAPH 1SHYA 1CHGA 3F9GA 2B8OH 5FCRA 3PMAB 1UTMA 2FI4E 1LVMA 1O2MA 5DP9A 5F6MA 3OY6U 1L4DA 7GCHF 1SGFA 2GT8A 5C5NA 1GGDC 1OWDA 2XCNA 4KKDA 2BY7X 2KAIA 4CRAA 1P57B 1UVSH 1LHGH 1X7AC 1BJVA 1O3GA 2O8UA 2P8OC 1G9IE 1A0JA 2RG3A 3F6UH 3GDSA 1Y59T 2SNWA 5F03A 3VEQB 2SFAA 1BTYA 1P2NA 3LIWA 4KP0A 4FUCA 3SJKA 1AE8H 3MH7A 5A8XA 1Z71A 1ANBA 2AYWA 3PM3A 4HFPB 4GUXA 3C1KA 1D3DB 4MDSA 3A87A 5DG6A 4ASHA 3RXFA 3ITIA 3SGBE 5EW2H 1GPZA 1ZRBA 3SU5A 4NA7A 8GCHF 1GBLA 3ZV8A 1PQAA 2BD4A 3PV4A 1ELCA 1KDQB 3ZYDA 2VIDA 2QN5T 1V2QT 1YPMH 1C5SA 4ZKNU 1LMWB 1V2MT 1T7CA 1V2UT 1QBNA 2FI3E 1ZLRA 3BG8A 1J8AA 2GZ7A 3RLWH 1B7XB 3K65B 3I78A 1DVAH 4JZ1A 3EAJA 1OWIA 5DK1A 2GX4A 1VITH 2ASUB 5EXNA 2P94A 2BDIA 2WUCA 3SV9A 1MKXK 3MI4A 1GG6B 4GHTA 1KLJH 1AB9C 1TGCA 3UIRA 4TPIZ 5GCHG 3NCLA 1P11E 2XBWA 3Q77A 5DO4H 2OC7A 2W26A 2BLQA 2R0LA 3MU5A 5ETXA 3SU3A 1DDJA 2G51A 2FOGA 2Z7FE 1O2QA 2BDHA 5E8EH 3BTDE 4MNXA 3KHVA 1ZHPA 1TX8A 4X1SU 4IC6A 1Q3XA 4NZQA 1D3PB 4WY3A 1QTFA 3CP7A 1ZTKA 4UD9H 1O3HA 1DLKB 1FIZA 2OCVB 5K0HA 5FPTA 1ANDA 3RXBA 1LHCH 3NZIA 3VXFH 1SL3A 1AIXH 1QQUA 3S7KB 1XUFA 4NSYA 1DITH 2ZPQA 1HXFH 1EZQA 4B2CA 2GCTC 1W3CA 1CU1A 1O37A 2AEIH 3PTBA 1PYTC 3I77A 4CRCA 1LVYA 1OP0A 1BTZA 5L2ZH 1GBDA 1YPEH 3OX7U 2BDGA 2W7UA 2GKVE 3FP6E 1P03A 3F9FA 1ESAA 3VB4A 1KXBA 2A4RA 2J92A 3OYPA 4Y6DA 4Z6AH 1ELEE 2P95A 1D3QB 1GCTC 1ZSLA 1JIMA 1MU8B 1MKWH 1CBWB 1P2OA 4KTCA 2PKSB 3RXCA 4BAKB 4KTSA 1HPGA 1AI8H 1FDPA 2XW9A 3ATKA 3TJOA 3U1IB 4AFQA 1RXPA 2G5VA 5T6GA 1TALA 3BTQE 1EZXC 1GJ6A 1EP5A 1NO9H 3GDVA 1UTNA 5CMXH 2ZFSA 1C5WB 4FVBA 1TOCB 4KGAA 5HM9A 1BMLA 3SGQE 1W12U 3ZZ8A 1GBHA 1SG8B 4Y8XA 3D23A 3KCGH 5DJ7A 1HJ9A 1W11U 3MNXA 2XBYA 2WUBA 3PTNA 3NK8A 3M37A 2AH4X 3TLOA 1FIWA 3VB3A 2VGCB 4HGCA 1A61H 4X6MA 4D8NA 2C8XB 3RM0H 1AVGH 2FX4A 4MPUA 3SHCH 2YNBA 1MKXH 1UK4A 1O32A 1P9UA 3RC6A 1G2LA 1HJ8A 5EW1H 1QBVH 3BTFE 3QUMP 1A1RA 2ZP0H 1QL9A 3LOXA 4AG2A 1QHRB 1S83A 3BTKE 3SV6A 4UFDH 3OY5U 1AE5A 1EP6A 3KQEA 1EB1H 1GHWH 3K6ZA 5T6DA 4UFGH 4O03A 5DPAA 1AUJA 1DXWA 1T4UH 1O3LA 1VCPA 1P09A 1A5IA 1L1GA 1BMAA 1NN6A 1CT2E 2RCEA 3SBKA 3LKWA 1MCTA 1GBCA 4NIVA 1AGJA 4ZUHA 2BD5A 1UVOA 3UR6A 2ZPSA 1GI1A 4YLQH 9LPRA 3TGJE 3LJOA 1Y3YA 1ANCA 2PHBA 2ZWLH 3TJVA 2Y82A 3V13A 2OBQA 1O3DA 3RP2A 2ZDVH 5E2PA 2BD2A 3ZZ9A 1PQ5A 4I8LA 4J2YB 4Y8ZA 2ZGHA 1UCYK 1GJ4H 3A8DA 2C93B 4GPGA 2FODA 1B5GH 1LQDB 3LU9B 7LPRA 3BV9B 2BYAX 3S7HB 2Q1JA 1A3EH 1ZSKA 2FDAA 2LPRA 2V3OH 2H1UA 1SLUB 1CQQA 3SZNA 4GLYA 3ZZ3A 2ZF0H 6LPRA 2QXHA 1GDQA 1HLTH 2XWAA 4ABGA 2O8TA 4JK5A 1QIXB 4I8KA 1BRCE 4LK4A 3UOPA 3M5NA 2FOBA 3D65E 1IOEA 2ZFPH 3ZVDA 1LCYA 3MTYA 2A2XH 1ZPCA 2PW8H 3ZZBA 3UY9A 3M7TA 2B5TB 4SGAE 3S69A 2BM2A 2HRVA 2UUFB 3HGNA 3SV2H 4YESB 3ZV9A 4CREA 3GCTF 3DD2H 2ZFQH 4Y79A 1OKXA 1YM0A 1MTUA 2UUYA 2EA3A 1MTVA 1FN6A 2XWBI 2XBXA 1O35A 1JRSA 1NRPH 3A8CA 1MBQA 3LGWA 1EX3A 4AZ2B 2W5EA 1V2PT 3RXEA 1GHZA 3F9HA 2GMTC 3A82A 4ZHMU 2FP7B 2FLBH 1AHTH 1W2KH 1IAUA 3K6YA 3L6PA 5JPMH 3SGAE 3PROA 3BTGE 4FVDA 3GY8A 2VJ1A 1L4ZA 2ANWA 1C2IA 1E0FD 1HCGA 1GG6C 4HTCH 1GBJA 4JYUH 2Z3CA 1CT4E 2BX3A 3UPEA 3M5MA 2W7SA 1NZQH 1AFQC 3LH1A 1P2IA 2QGRA 1HNEE 4I32A 2P93A 4WMFA 1GJ7B 1NU7B 1AY6H 5TCAA 1YPHC 2BQ7B 1BRBE 2STBE 1YP9A 3PMBB 3QK1A 3ZYEA 1PYTD 4ZKRU 3RU4D 3LJJA 3MOCA 1C2FA 3MHWU 1GJ9B 5A2MH 1P01A 2VWMA 1RIWB 1O2SA 3LT3A 5GDSH 2VINA 1AFEH 1OP8A 2H2ZA 1QBOA 1SGYE 1UHBB 1NFXA 4WVPE 1MCVA 3M7QA 3RMMH 1BHXB 1KXEA 2GDDA 4MPWA 5T3HA 4WH8A 3URCA 1S6FA 1VGCC 1O36A 3TJNA 2TGTA 2H6MA 1H4WA 3I29A 1QJ1B 3Q00A 5A8ZA 3V3MA 2IN2A 1GHBG 3UWIA 1J14A 1IQIA 3H5CB 1RRKA 1V2JT 1QB6A 2DUCA 2H9EH 3DFJA 3TNTA 2A5KA 1D9IA 1S84A 4O9VA 3GY6A 1TBQH 1J9CH 3SI4H 2NWNA 1SFIA 4OS2A 1C2HA 2PKAA 3GCHC 3ZVAA 3M7UA 1O2XA 4AYYB 2ZKSA 2R3UA 2HOBA 2XTTB 3EBNA 5EQRA 1QA7A 1HIAA 4ESTE 3SUGA 3RM2H 1CGHA 5BPEA 4JZFH 1Z8GA 1O2IA 3RU4T 1SOZA 3M61U 5DP5A 3RXHA 5E0GA 1BTPA 1LKAA 3QO6A 2FZZA 1BTUA 4A6LA 2OINA 1TPOA 2A0QB 1ETTH 3A7WA 2BMGB 1EQ9A 4RKOB 2ZIQH 1EAUA 1H9HE 3T5FH 2TBSA 4E7NA 4XFQA 1SSXA 1P0SH 4CH2B 1UTQA 1OYTH 3LGVA 1XKBC 2PUQH 1GMCG 1C5QA 4AN7A 5GPIB 4PROA 1C1SA 1FUJA 1TB6H 3A8BA 2VIVA 3H7OA 3MU8A 4Q2KA 1Z6JH 3P8FA 1L1NA 4INLA 1Z1IA 5E2OA 1FMGA 4X1NU 1P05A 5F8TA 2EEKA 2WPMS 2P59A 4ABFA 3EA7A 1QB9A 2O8MA 1FY5A 2BDYA 4ISNA 4AGKA 1FY4A 2BD9A 3A89A 1KXDA 3VGCC 2HALA 1F5RA 4K8BA 1SC8U 3WY8A 3E3TA 1O3MA 2OUAA 1QRWA 1YPLH 1ZOMA 2V35A 1CT0E 1V2WT 3P17H 4B75A 3VB6A 2F9BH 1G3DA 1DX5M 2FOHA 1YPKH 1W7XH 2BY6X 5FHTA 3MO6A 3ZZAA 1DICA 1WTHD 2AIQA 1G30B 2XNIA 3ODDA 2FOCA 1L2EA 1YYY1 3NPSA 4DGJA 1O2ZA 1TLDA 3MNSA 2NU0E 2C8WB 2QIQA 5JDUB 2Z9KA 3EDXB 1W10U 1GI3A 2ZHFH 4CRGA 1GHBF 3A88A 1DLEA 1C2DA 3MU4A 1HAXB 2ZTZA 3RXMA 1ELGA 1P2KA 1SGNE 2C4FH 3OTJE 3GCOA 5I25A 1EAXA 1O3PB 1THRH 1T8LA 1ELBA 1BJUA 1KY9A 4DCDA 2PGQB 1NRRH 1P9SA 2C90B 1EATA 3E8LA 2A32A 5L2YH 4UFEH 3TGIE 1O2LA 4A92A 3O8CA 1EJNA 1W7GH 1UK2A 1RTFB 3UTUH 4JYTA 2FLRH 1Z8RA 1QQ4A 2C8YB 3W94A 1HJAB 1GI8B 1KLTA 3A84A 5HMAA 2FOEA 2J94A 1DUEA 3U98H 1QL7A 3VB5A 1C5XB 1MBMA 1EPTC 1OWEA 3ZZ5A 3EE0B 3SV8A 1C2LA 2R3YA 3MNCA 3GYMA 2PWXA 4Y11E 3FVFB 2NU2E 1F92A 3ZVFA 5C1YA 1F0TA 4NZLA 3PB1E 2TGPZ 1TA2A 4MNYA 2XC5A 3Q3KA 2Z9IA 3A8AA 2GZ9A 1THSH 1ESBA 4AG1A 3UR9A