4TX5A

Crystal structure of smac-diablo (in space group p65)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
SEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLREDLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The activator of apoptosis Smac-DIABLO acts as a tetramer in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Diablo homolog, mitochondrial
total genus 90
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tx5A00
1HS7A 4JEUB 1S94A 1FIOA 3C98B 5M4YA 4JEHB 4TX5A 3LG7A 5LG4A 1BR0A 1G73A 1EZ3A 2XHEB 1FEWA 2DNXA
chains in the Genus database with same CATH superfamily
1S94A 1ZKEA 3QUJA 2XQAA 3C50A 2AE9A 5L3EB 1WRDA 1MNEA 1WLXA 2D2SA 1UURA 2HH7A 3PURA 4O4JE 2PBIA 2YINA 4X65T 5J2UE 3AE7A 4IHJE 2YK0A 3N9OA 3PUWF 3DTOA 5L3BB 4ILCA 3FZFB 4PAGA 5HEGA 4XBFB 4LMJA 2DWKA 3EDUA 2XM1A 4DR3T 5JVDE 3ZMZB 3TLTA 1UX4A 3VR9A 5AQUB 4LF6T 1N36T 2VKJA 3RHWA 3J9X1 3RGLA 4JYAT 3RIAA 2I59A 2YDQA 3AXJA 3E08A 3KV6A 5JDFA 2BS3A 4DMWA 4ZI7E 4GYRA 2L3LA 5JR9C 2Z6EA 4H9OC 2ODVA 3AECA 4YSZA 2MAWA 2QA7A 3ZT6A 2WY2A 5CB4E 3ZCIA 3O4XE 2LKGA 3LG7A 1WR0A 4A98A 5LYJE 2UXBT 5IYZE 3UULA 2WCAA 2WS3A 4ZXLA 5FL1A 2NTXA 2JQHA 2XASB 5JDLA 1IAPA 4DV1T 1MIYA 2IMLA 3FBZA 3HI2A 3FZKB 5KX5E 3N9LA 5AQPB 5HXEA 2YN6A 2LOSA 2IC6A 2KNDA 3CX6B 3QOFA 4HTEA 3ZN0B 1IZNB 2YOEA 1T7SA 1FIOA 5LHHB 1KNZA 2LE8A 4GYSA 3RQWA 4O8SA 4HFCA 5CA0E 2W63A 4ILUA 2W67A 3RYIE 3MA9A 4ZI2C 1XMQT 2AXDS 1V9DA 2LRLA 3GA8A 2MPKA 3RIUC 5J0ZA 4DV4T 1SA0E 3I0OA 2X66A 1UK5A 2L9QA 5IHYA 4DR5T 3UU4A 3PJAJ 4ANJA 3Q5XA 3EUHA 2BKOA 2QRXA 2DL1A 4HFIA 3G06A 3ZMSB 3VHLA 4BJMA 4IL9A 5ABFA 3MACA 1IBLT 4B3MT 2N1GA 4U7YA 2LM9A 2IUBA 2N2NA 3WAKA 4CN4A 2UUCT 5FY1A 5DQWA 5FVLA 2JQQA 4CXXA 1VCSA 2HPLA 5L3DB 1OEDE 4Z8XA 4TV8E 4JLEA 3ZKRA 1XNRT 2DLRA 5CA1E 1QUUA 3E0ZA 2WAUA 4DV0T 2A9UA 3UU3A 3PUSA 4P0BA 5HEUA 2JQ9A 2CEAA 2J1DG 4JI1T 3HKBE 1H7CA 4DUYT 2LOPA 5M4YA 2K3WA 4P1NA 3RF1A 3AEFA 3MK7C 4CN6A 4PK6A 4HWDA 5L3CB 3VU7H 1KFYA 2QGSA 3UU6A 4IL4A 5LMNT 3MKDA 2BG9A 3EHZA 2RPAA 5FVKA 3FZHB 4FI5A 5AQKB 3PU8A 4B6XA 5ABEA 5IUXA 4AXPA 2PFVA 2KT9A 5AQNB 2WB5A 3TKLB 3KBTA 1WYBA 5DABA 1M7KA 3RIFA 1T8BA 4UVBB 3DJBA 3CKDA 3RH3A 3PUQA 4MHCA 2V6XA 4B3TT 5AQQB 3KV9A 5HEHA 3GN5B 2W66A 2WU5A 5JR9B 1CHUA 2LSJA 5AQSB 3AE5A 2WDRA 3PJAA 3WAJA 2LT3A 2VL0A 5KDMC 4JI3T 5ETWA 2LM2A 3EDVA 4U33A 3ZC0A 4L0RA 1D0YA 3S4UA 4LF5T 3OPCA 3F2EA 2CLYC 2W61A 5LG4A 1GQEA 3T1YT 4HN9A 2XUEA 4U3CA 2VB6A 2W0GA 4U31A 1XZYA 3C51A 5FXXA 2WM9A 5C8YE 3FXDB 5AFUL 1MMAA 1OEDB 2V6YB 4X1KE 5LMUT 1YXRA 5AQIB 4O2BE 3WI3A 4EB6E 4YT0A 4ZZCA 3AB3B 3HR0A 3AAEB 3V5SA 2YEVC 4EEDA 5LXTE 2XM2A 2NW9A 1S35A 4A5XA 2C5IT 3EVYA 2CRBA 3P8CD 5AQLB 2XJ7A 2V1DB 2BS4A 1KNRA 3JC6C 1XNQT 2E8IA 4OYKA 1FMVA 2EHOC 2H7OA 2UUBT 2ZM8A 3CWZB 3CX8B 2JJ9A 1W09A 2MYSA 2A3DA 3ESLA 1ZOYA 3FBLA 3H3MA 5LNKA 2J4GA 3CQXC 2EHOD 3GWHA 1J1JA 3ANWA 4I55E 4XAXB 5FY7A 3UUMA 4DBQA 1HS7A 5JDHA 4KUMB 5DJQC 1N34T 3AVRA 1JNZA 3PUVF 4L5GA 5JDQA 4PJNA 3O1IA 4MBQA 4UV9B 3LDQB 2CMRA 4HFDA 5E0OA 4DV5T 4HFHA 2K48A 2ACXA 2MOZA 4PK4A 3SRZA 3LBXB 4TUYE 5HEJA 2VK9A 1W0BA 2CPTA 2YU2A 3RYCE 5LOVE 4DNDA 4AQYT 4AKIA 2HN2A 4P0AA 5L47A 4YJ3E 1N33T 3P4QA 4GIWA 3ZYMA 4EGWA 1W9RA 3ZSSA 3ZT5A 2D0UA 5ABGA 4KI0F 5L4HA 2KXPB 4UEMA 3ZJ2A 2KWHA 4YTMA 3ZLIA 2NP9A 1HCIA 4QH4A 3RC3A 4AI6A 2VASA 4EIWA 3OYXA 3FZMB 4AQFC 2C5JA 1MMNA 2E9XB 4DR4T 2XQ9A 3P4PA 2BG9E 4H63H 4TWHA 4AKRB 4ZI3D 2VL8A 3A5XA 5FXVA 2VKHA 2LKHA 4DIDB 5JREA 4DR6T 2CBJA 3OBVE 5JDGA 3QB5K 5HXSA 1HFAA 1X79A 3HKEE 1G8XA 4M1PA 4PJJA 2VKDA 2YDRA 4DBRA 3VRBA 1OXZA 4KHZF 4LMLA 2IC9A 3N9PA 1HNXT 4PFPA 4CN1A 2I6HA 4BA9A 1HG5A 3Q2MA 3PDYA 5LCYA 2XSBA 4HFBA 3N2GE 4O4HE 5AQGB 4I0UA 3UFEA 3UT5E 1BR0A 3JCFA 3PTRB 4PK5A 3H37A 5FNVE 4ADZA 4LFAT 3CIRA 3BQLA 4PFOA 1NWMX 3ZMTB 3EAMA 4GK0E 1NENA 2BS2A 3NWIA 4QKNA 4EXTA 3NZPA 3EABA 2UXDT 2P9BA 2Q9QA 3E22E 4IT4A 4X62T 5J1GA 2DCFA 2G0UA 2R6GF 2XQ3A 3L3PA 4IIJE 3PUGA 2M6BA 2X9YA 2XY8B 3KINB 4IDNA 4U7IA 4WBOA 5LA6E 5AQOB 5A1LA 1HNZT 4H9SE 2XAFB 5JQGE 1D1AA 2LJLA 2HPJA 1HF8A 2KWIB 5AQHB 2WZIA 4QXCB 4L9IA 2UUAT 1OEDC 4U2ZA 3EI0A 5HXCA 5EK2A 2NW8A 2XZEA 4IDQA 5FYMA 3L8RA 1YQ3A 4JI7T 3CPZA 3P4RA 4WBNE 1ZHCA 1LRZA 4PNIA 4QXBB 1XDOA 2X9HA 2V5CA 3C4ZA 4ILBA 4ILAA 4UELA 3BQIA 2C5KT 3A7MA 3IBPA 1US7B 3Q5WA 1WYCA 4NUUA 3AAIA 3UQ7A 1KNPA 3MXZA 3FXEB 2LLYA 3RC8A 3ZCJA 4IDPA 3RRCA 3Q9DA 4PJLA 4YHHT 2X9WA 4N78D 2XAQB 3CK6A 3AE2A 4DO0A 4H9RC 1IBKT 3KVAA 3ETVA 3ZMUB 1LVFA 2L8KA 2CA5A 1O3XA 1FJGT 2A72A 4U74A 5LGTB 3VKHA 2V7JA 2QYWA 3K3NA 4ZZBA 4DV7T 1I94T 2E5LT 2FJDA 3OJAA 4DR1T 4HWCA 2FJAA 4HE8A 4IE6A 4KHPT 5DQVA 4QX8B 2VURA 3B13A 2X67A 2ZM2A 2JRKA 4HFEA 4EAHA 3CMLA 4HEAA 3O9XA 3AE4A 1VCTA 1T72A 2IHR1 3RI5A 5LG3A 3HKDE 4IGUA 4G63A 5AQJB 2BVLA 2X9XA 4IDZA 3ZYLA 2WQYA 3ONXA 1YW0A 5FY0A 4HWFA 4HGAA 2BKPA 5FKYA 2IW5B 4EZ4A 1SUMB 4X5TA 3FHNA 3O1HA 4QX7B 3RYFE 4AQFA 3MJXA 2I0MA 3C4XA 3Q5EA 4EZHA 4F8HA 2E9XC 2IAKA 3ABVA 4AKGA 3JAFA 5F8PA 1B7TA 1UX5A 4UF0A 1BR2A 3AVSA 1IJ5A 4UVAB 1MIWA 2RA1A 3MZKB 3K8PC 2E5VA 3SOLA 2XPKA 3AA0B 2ACZA 2BBJA 3Q5DA 1L0VA 4MALA 4CXWA 3T1HT 2BKNA 2HHHT 1HNWT 5JRCA 2GK9A 3OYZA 3AEEA 3LFMA 3QK6A 3RX6A 1HTJF 4IREA 1OWAA 2H3RA 2CXFA 4CI1B 4KBMB 2EHOB 2WWUA 4YXDA 2WMOA 1U5PA 2JQKA 3C98B 4EEBA 3ZJ1A 1QSDA 2K9AA 2LHRA 3CQCB 4OFZA 3W15B 4ASKA 2DNXA 1YKHB 2LSGA 2Q9QC 3AE6A 3ZSTA 4QHOA 2UU9T 5ADXL 2CHOA 4LFBT 3AE3A 2CXLA 3HKCE 3PE0A 5KXJA 2JMKA 4Q25A 3JAEA 5FXZA 4TZ4C 4BJNA 4TN7B 5L3GB 2BDEA 2EHOA 4CI3B 3R6NA 4AKLA 1BR1A 1ZP0A 1M62A 1LKXA 4KMCA 5L2LA 4LF7T 3K3OA 5BMVE 2JMHA 2CCQA 3F31A 3M3ZB 4V1Av 1T98A 3AXJB 3U3IA 3P4SA 3AEBA 2PJQA 2XSAA 2ZMAA 3N9MA 1D0ZA 2E9XA 2VWAA 3NRYA 2Q9QD 3KV5A 2KMFA 3SFEA 5ABFB 2CBIA 3OVUA 3TLSA 3KBUA 2LSYA 4IE5A 3QNUA 5AQTB 5LHGB 2CE7A 3C4WA 5LGNB 2FJEA 4JI5T 2YKSA 4YFSA 3SS1A 1HG2A 2XQYA 5FP3A 1SHZC 1X9BA 4EYYR 2WBLA 3AAAB 5H6RB 5HAXA 4X1IE 2V8SV 3DP7A 1YQ4A 5JR9A 3R84B 2BVMA 1D0XA 1E2AA 2XQ8A 3ETUA 2B76A 3U78A 2F4VT 1LVKA 1Z0PA 4O4LE 4B3RT 4CZZB 3AA7B 1KK7A 4I43B 3RKGA 4HKAA 3RQUA 3BQKA 3T8OA 3ZMVB 4WYVA 4U72A 5H6QB 3LK3B 5J2TE 2ES0A 2D5UA 2W4XA 2Y6XA 4UV8B 2XAJB 3TLUA 4DUZT 4G2AA 2B1EA 2SPCA 3M65A 2XHEB 4H9QC 5AQVB 1J5ET 2CXDA 3AEGA 2CLYB 5HEOA 4JI6T 2PTFA 1U4QA 5FMNA 3UU8A 5TAOA 3ZN1B 1N32T 4OK0A 2BBHA 5LB7B 3RKOA 2H7VC 2V7IA 1IBMT 4KX6A 5LJMA 2YDSA 1ZV4X 3FZLB 4U2YA 4JI2T 4CQIA 2NWBA 4JBWF 2M67A 2WU2A 3NBXX 4A56A 5C2TA 3C64A 2BG9C 4LF9T 4H63V 4NXMT 1AJ3A 4X1YE 3IA3A 5LJNA 2A2FX 2M6IA 4TWDA 2OLTA 5HYAA 4WZXA 4TWFA 3N5LA 1NEKA 3OTOT 5CFBA 2X0HA 3TLVA 4C90A 3ZEFB 2V7KA 1Y01A 3J7Yq 5LP6E 2UXNB 1W0AA 3K3QC 1MNDA 1WCRA 3RLFF 3NVOA 4MFRA 4K0UA 2J62A 3UUBA 1D1CA 5F5WA 3ZYKA 3CVRA 1MIVA 3I9WA 4JEUB 3UUNA 2RP4A 2XAHB 2WZHA 3A8YC 4QXHB 4X20E 3RYHE 3PUYF 4NXNT 1ZEEA 1VOMA 2NTYA 3N2KE 4ISTA 4COFA 4EOZB 2VQET 4PJMA 3LSVA 2MTQA 4UR9A 4QWNB 3LBXA 5EK3A 2DI4A 5C3JA 4F6RC 1DU2A 1JNRA 3AA6B 3N2OA 2C0SA 3BK9A 4FJOA 3UFGA 1E7PA 1OEDA 2V6YA 1BR4A 2DHRA 4YJ2E 5JDNA 2K5BB 3PU3A 4CXYA 2E2AA 2Y8DA 5EK4A 3VR8A 3NKZA 1FMWA 2KINB 3PUXF 1IJ6A 4CI2B 5KMGP 2CWOA 4ZI3C 2XQ6A 2LRKA 5AQFB 3P4WA 2CWYA 2VVNA 4HWHA 1XDPA 5IWAT 4HWIB 2UXXB 2V7LA 4LF8T 3TLWA 2LSIA 4JV5T 1D1BA 3B5MA 3PV0F 2D0TA 2KLQA 4JEHB 3ZPOA 2XQ7A 4X66T 3GN5A 3N9NA 3RIUA 1Y64B 4E7SA 1I6ZA 3CX7B 3KVBA 2H88A 4QH5A 4YSXA 4DR7T 3UTKA 2PG8A 5ABHA 2JIWA 2X0LB 4YTPA 4LFCT 1FEWA 4A97A 4Z90A 2X0YA 4NUVA 4TNVA 5L4EA 3QC9A 4UF0B 5LGUB 1UUSA 4UXNB 2ZM0A 2DWGA 4AIUA 3H3AA 1G73A 1EZ3A 2E9XD 3HA4A 3JADA 5HXRA 5LHIB 1J5WA 3VKGA 4IE4A 4DV2T 2D9DA 3UUXB 3K1SA 3KDSE 2NOXA 4O4IE 2CM0A 3AE8A 3I9YA 4IDOA 3NZQA 4ZOLE 2MBGA 4GKJT 4XZCA 4DR2T 2W00A 3UQ4A 4GOUA 4JI0T 2X68A 3AE9A 4PW8A 4JI8T 3IF8B 4JUYA 2QVAA 4Z91A 4O2AE 3AA1B 2XAGB 4LF4T 4E7ZA 4ZHQE 2ZM6T 3KFWX 1XWMA 2H89A 2WWVA 2WDVA 2VKOA 2WDQA 2ZLYA 3ZT7A 4DMVA 5BR8T 3FB2A 3IEEA 1E1HB 2WSSV 3ANWB 1WFDA 4ISSA 3X1DA 4EYUA 3SFDA 1NAFA 4MLKA 1SE7A 1HX8A 4ZI2D 1XMOT 3QB5A 2IDOB 2J47A 1YD8G 2BZBA 5HWYA 4X64T 5GONE 1HX1B 4TNWA 4GKKT 2WP9A 3IHRA 2XTLA 3ZC1A 2XQ4A 5L3FB 2K24A 2W62A 4C91A 2LEHA 2Y48B 3LK42 1KEYA 2CHNA 5AQRB 5JH7E 3PUAA 4HFVA 2V7MA 4P09A 5HXHA 3B57A 4YLHA 3AEAA 4AQGA 2UXCT 1UCUA 5F3JA 3V5UA 3LJCA 5LBMA 3AEDA 2IIUA 4I50E 4IE7A 5CJ5A 2NR4A 2Q9QB 2FUPA 3P7IA 2BG9B 2N9DA 4KP3C 3CQGB 4B3ST 2V5DA 4EV6A 1MMDA 3ONLC 3VRAA 4AISA 4DV6T 4ERRA 4K0KT 4NPPA 2FJBA 5AQMB 2KZ7B 3GMIA 3NRXA 3JC6D 3F57A 4IE0A 5EZYE 4BAYB 4DV3T 3LK2B 4TV9E 1UGOA 4H9NC 3N9QA 2WMNA 2LHNA 2W2UA 2OA5A 2HN1A 5HCJA 4ZEYA 4J2CA 1KF6A 3O1JA 3KV4A 4OYJA 2ODUA 2X51A 2XQ5A 4OHFA 3ONJA 1CUNA 4QH1A 3UU5A 1WR6A 4ZS3A 3SWHA 3P50A 4LMKA 4YTNA 4GK5E 4I4TE 4OX9T 3L09A 5JDMA 3RRWA 1MMGA 2VVSA 3I0QA 5JTGA 3PUZF 4YHJA 3HL6A 4JI4T 4UVCB 3RPUA 4H9PC 2JPFA 2YU1A 4TX5A 1R8IA 3D0TA 2OV9A 1VRBA 2LSKA 3I1AA 5FXWA 1Z8UA 2KSRA 2V26A 4YY3T 3AE1A 2VQFT 5HCMA 4YSYA 4DVDA 1YKEB 1HR0T 2NW7A 5FL0A 4WNKA 3OKQA 4UIGA 3L39A 5CGMA 2FBWA 4NIQA 4ZS2A 5JRCB 4AKHA 4WW0A 5LBQB 5HWXA 1QLBA
chains in the Genus database with same CATH topology
1S94A 1ZKEA 3QUJA 3C50A 5L3EB 1WRDA 1MNEA 1WLXA 2D2SA 2HH7A 3PURA 4O4JE 2PBIA 2YINA 5J2UE 4IHJE 2YK0A 3N9OA 3DTOA 5L3BB 4PAGA 4XBFB 2DWKA 3EDUA 5JVDE 3ZMZB 1UX4A 2VKJA 3J9X1 2I59A 3E08A 5JDFA 3KV6A 4DMWA 4ZI7E 4GYRA 2L3LA 5JR9C 2Z6EA 4H9OC 2ODVA 2QA7A 5CB4E 3ZCIA 3O4XE 3LG7A 5LYJE 5IYZE 3UULA 2NTXA 2XASB 5JDLA 1IAPA 1MIYA 3FBZA 3HI2A 5KX5E 3N9LA 5HXEA 2LOSA 2IC6A 3CX6B 2KNDA 4HTEA 3ZN0B 1IZNB 1FIOA 5LHHB 2LE8A 4GYSA 5CA0E 4O8SA 2W63A 4ILUA 3RYIE 4ZI2C 3MA9A 3GA8A 1V9DA 1SA0E 3I0OA 2X66A 2L9QA 5IHYA 4ANJA 3Q5XA 3EUHA 4BJMA 3ZMSB 3VHLA 3MACA 2N1GA 2LM9A 3WAKA 2N2NA 5FY1A 5DQWA 4CXXA 2JQQA 2HPLA 5L3DB 4Z8XA 4TV8E 4JLEA 2DLRA 5CA1E 1QUUA 3E0ZA 2WAUA 3PUSA 4P0BA 2CEAA 2J1DG 3HKBE 1H7CA 2LOPA 5M4YA 3MK7C 4PK6A 5L3CB 3VU7H 2QGSA 3MKDA 4FI5A 3PU8A 4B6XA 4AXPA 2PFVA 2KT9A 3TKLB 3KBTA 1WYBA 5DABA 4UVBB 3DJBA 3CKDA 3RH3A 3PUQA 4MHCA 3KV9A 3GN5B 5JR9B 2LSJA 3WAJA 2LT3A 5KDMC 5ETWA 3ZC0A 3EDVA 4L0RA 1D0YA 3S4UA 3F2EA 2CLYC 2W61A 5LG4A 4HN9A 2XUEA 5FXXA 2VB6A 2W0GA 3C51A 2WM9A 5C8YE 3FXDB 5AFUL 1MMAA 4X1KE 3WI3A 4O2BE 4EB6E 3AB3B 3HR0A 3AAEB 3V5SA 2YEVC 5LXTE 2NW9A 1S35A 2C5IT 3EVYA 3P8CD 2V1DB 3JC6C 2E8IA 4OYKA 1FMVA 2EHOC 2H7OA 2ZM8A 3CWZB 3CX8B 2JJ9A 2MYSA 2A3DA 3ESLA 3FBLA 5LNKA 3CQXC 5FY7A 2EHOD 3GWHA 3UUMA 3ANWA 4I55E 4XAXB 4DBQA 1HS7A 5JDHA 4KUMB 5DJQC 3AVRA 4L5GA 5JDQA 4PJNA 3O1IA 4MBQA 4UV9B 2CMRA 5E0OA 2K48A 2ACXA 2MOZA 4PK4A 3SRZA 3LBXB 4TUYE 2VK9A 2YU2A 3RYCE 4DNDA 5LOVE 4AKIA 4P0AA 4YJ3E 4GIWA 3ZYMA 2D0UA 5JDGA 3ZLIA 2KXPB 4UEMA 3ZJ2A 2KWHA 2NP9A 1HCIA 3RC3A 4AI6A 2VASA 4EIWA 3OYXA 4AQFC 2C5JA 1MMNA 2E9XB 4H63H 4AKRB 4ZI3D 2VL8A 3A5XA 5FXVA 2VKHA 5JREA 3OBVE 5HXSA 1HFAA 1X79A 3HKEE 1G8XA 4M1PA 4PJJA 2VKDA 4DBRA 1OXZA 2IC9A 3N9PA 4PFPA 4BA9A 1HG5A 3Q2MA 3PDYA 5LCYA 3N2GE 4O4HE 3UT5E 1BR0A 3PTRB 4PK5A 3H37A 5FNVE 4ADZA 3ZMTB 3BQLA 4PFOA 1NWMX 4GK0E 4QKNA 3NZPA 2P9BA 2Q9QA 3E22E 5J1GA 2DCFA 2G0UA 3L3PA 4IIJE 3PUGA 2X9YA 5LA6E 3KINB 3UFEA 4WBOA 5A1LA 4H9SE 2XAFB 5JQGE 1D1AA 2LJLA 2HPJA 1HF8A 2KWIB 4QXCB 4L9IA 5HXCA 5EK2A 2NW8A 5FYMA 3CPZA 4WBNE 1ZHCA 1LRZA 4PNIA 4QXBB 4UELA 2X9HA 5LBMA 3C4ZA 4AQGA 4CQIA 3BQIA 2C5KT 3IBPA 3Q5WA 1US7B 4NUUA 1WYCA 3AAIA 3MXZA 3FXEB 3RC8A 3ZCJA 3RRCA 3Q9DA 4PJLA 2X9WA 4N78D 2XAQB 4DO0A 4H9RC 3KVAA 3ETVA 3ZMUB 1LVFA 2L8KA 2CA5A 1O3XA 2A72A 4U74A 5LGTB 3VKHA 2V7JA 3K3NA 3OJAA 4HE8A 4IE6A 5DQVA 4QX8B 3B13A 2X67A 2ZM2A 2JRKA 4EAHA 3CMLA 4HEAA 3O9XA 3HKDE 4IGUA 4G63A 3ZYLA 2BVLA 2X9XA 4IDZA 3ONXA 1YW0A 5FY0A 4HGAA 2IW5B 4EZ4A 3FHNA 3O1HA 4QX7B 3RYFE 4AQFA 3MJXA 3C4XA 4EZHA 2E9XC 2IAKA 4AKGA 5F8PA 1B7TA 1UX5A 4UF0A 1BR2A 3AVSA 1IJ5A 4UVAB 1MIWA 2RA1A 3MZKB 3K8PC 3SOLA 3AA0B 4CXWA 4MALA 5JRCA 2GK9A 3OYZA 3LFMA 3QK6A 3RX6A 1HTJF 1OWAA 2H3RA 2CXFA 4CI1B 4KBMB 2EHOB 2WWUA 2WMOA 1U5PA 3C98B 3ZJ1A 1QSDA 2K9AA 2LHRA 3CQCB 4OFZA 3W15B 4ASKA 2DNXA 1YKHB 2LSGA 2Q9QC 5HWXA 4QHOA 5ADXL 3HKCE 2CXLA 3PE0A 2JMKA 5FXZA 4TZ4C 4BJNA 4TN7B 5L3GB 2BDEA 2EHOA 4CI3B 3R6NA 4AKLA 1BR1A 4KMCA 1LKXA 5L2LA 3K3OA 5BMVE 2JMHA 2CCQA 3F31A 4V1Av 1T98A 3U3IA 2PJQA 2ZMAA 3N9MA 1D0ZA 2E9XA 2VWAA 3NRYA 2Q9QD 3KV5A 2KMFA 3KBUA 2LSYA 4IE5A 5LHGB 2CE7A 3C4WA 5LGNB 3SS1A 4YFSA 1HG2A 2XQYA 5FP3A 1SHZC 4EYYR 2WBLA 3AAAB 5H6RB 5HAXA 4X1IE 3DP7A 5JR9A 3R84B 5KMGP 2BVMA 1D0XA 3ETUA 3U78A 1LVKA 1Z0PA 4O4LE 4CZZB 3AA7B 1KK7A 4I43B 3ZMVB 4HKAA 3T8OA 3BQKA 4U72A 5H6QB 3LK3B 5J2TE 2ES0A 2D5UA 2Y6XA 4UV8B 2XAJB 4G2AA 2B1EA 2SPCA 3M65A 2XHEB 4H9QC 2CXDA 2CLYB 5FMNA 1U4QA 3ZN1B 5TAOA 4OK0A 3RKOA 2H7VC 2V7IA 5LJMA 1ZV4X 2NWBA 2M67A 3NBXX 4A56A 1AJ3A 3C64A 4H63V 4X1YE 5LJNA 2A2FX 5HYAA 3N5LA 4C90A 3ZEFB 2V7KA 3J7Yq 5LP6E 2UXNB 3K3QC 1MNDA 4MFRA 4K0UA 1D1CA 3ZYKA 3CVRA 1MIVA 3I9WA 4JEUB 3UUNA 2RP4A 2XAHB 4QXHB 4X20E 3RYHE 1ZEEA 1VOMA 2NTYA 3N2KE 4ISTA 4EOZB 4PJMA 2MTQA 4QWNB 3LBXA 5EK3A 2DI4A 4F6RC 3AA6B 3N2OA 2C0SA 3BK9A 4FJOA 2DHRA 1BR4A 4YJ2E 5JDNA 2K5BB 3PU3A 4CXYA 5EK4A 2Y8DA 1FMWA 2KINB 4CI2B 1IJ6A 2CWOA 4ZI3C 2CWYA 2UXXB 2V7LA 2LSIA 1D1BA 4JEHB 3ZPOA 2D0TA 2KLQA 3GN5A 3N9NA 1Y64B 4E7SA 3CX7B 3KVBA 3UTKA 2PG8A 2X0LB 1FEWA 4NUVA 3QC9A 4UF0B 5LGUB 4UXNB 2ZM0A 2DWGA 3H3AA 1G73A 1EZ3A 2E9XD 3HA4A 5HXRA 5LHIB 3VKGA 4IE4A 3UUXB 3KDSE 2NOXA 4O4IE 2CM0A 3I9YA 4ZOLE 3NZQA 2MBGA 4XZCA 2W00A 4GOUA 2X68A 4PW8A 3IF8B 4JUYA 4O2AE 3AA1B 2XAGB 4E7ZA 4ZHQE 3KFWX 4DMVA 2VKOA 2ZLYA 3FB2A 3IEEA 1E1HB 3ANWB 2WSSV 4EYUA 4ISSA 4ZI2D 1NAFA 4MLKA 1HX8A 1YD8G 2BZBA 5HWYA 5GONE 3IHRA 5L3FB 2XTLA 3ZC1A 2K24A 2W62A 4C91A 2LEHA 2Y48B 3LK42 5JH7E 3PUAA 4HFVA 2V7MA 4P09A 5HXHA 3B57A 4YLHA 1UCUA 5F3JA 3V5UA 3LJCA 4I50E 4IE7A 2Q9QB 3P7IA 2N9DA 4KP3C 3CQGB 1MMDA 4ERRA 4EXTA 2KZ7B 3GMIA 3NRXA 3JC6D 3F57A 4IE0A 5EZYE 4BAYB 3LK2B 4TV9E 4H9NC 3N9QA 2WMNA 2LHNA 2OA5A 4J2CA 3O1JA 3KV4A 4OYJA 2ODUA 2X51A 4OHFA 1CUNA 1WR6A 4ZS3A 3SWHA 4GK5E 4I4TE 3L09A 5JDMA 3RRWA 1MMGA 3I0QA 4YHJA 3HL6A 4UVCB 3RPUA 4H9PC 2JPFA 2YU1A 4TX5A 5FXWA 3D0TA 1VRBA 2LSKA 3I1AA 1KNZA 2V26A 4DVDA 1YKEB 2NW7A 4WNKA 3OKQA 4UIGA 5JRCB 4AKHA 4ZS2A 4WW0A 5LBQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HS7 A;  4JEU B;  1S94 A;  1FIO A;  3C98 B;  5M4Y A;  4JEH B;  4TX5 A;  3LG7 A;  5LG4 A;  1BR0 A;  1G73 A;  1EZ3 A;  2XHE B;  1FEW A;  2DNX A; 
#chains in the Genus database with same CATH topology
 1S94 A;  1ZKE A;  3QUJ A;  2XQA A;  3C50 A;  2AE9 A;  5L3E B;  1WRD A;  1MNE A;  1WLX A;  2D2S A;  1UUR A;  2HH7 A;  3PUR A;  4O4J E;  2PBI A;  2YIN A;  4X65 T;  5J2U E;  3AE7 A;  4IHJ E;  2YK0 A;  3N9O A;  3PUW F;  3DTO A;  5L3B B;  4ILC A;  3FZF B;  4PAG A;  5HEG A;  4XBF B;  4LMJ A;  2DWK A;  3EDU A;  2XM1 A;  4DR3 T;  5JVD E;  3ZMZ B;  3TLT A;  1UX4 A;  3VR9 A;  5AQU B;  4LF6 T;  1N36 T;  2VKJ A;  3RHW A;  3J9X 1;  3RGL A;  4JYA T;  3RIA A;  2I59 A;  2YDQ A;  3AXJ A;  3E08 A;  3KV6 A;  5JDF A;  2BS3 A;  4DMW A;  4ZI7 E;  4GYR A;  2L3L A;  5JR9 C;  2Z6E A;  4H9O C;  2ODV A;  3AEC A;  4YSZ A;  2MAW A;  2QA7 A;  3ZT6 A;  2WY2 A;  5CB4 E;  3ZCI A;  3O4X E;  2LKG A;  3LG7 A;  1WR0 A;  4A98 A;  5LYJ E;  2UXB T;  5IYZ E;  3UUL A;  2WCA A;  2WS3 A;  4ZXL A;  5FL1 A;  2NTX A;  2JQH A;  2XAS B;  5JDL A;  1IAP A;  4DV1 T;  1MIY A;  2IML A;  3FBZ A;  3HI2 A;  3FZK B;  5KX5 E;  3N9L A;  5AQP B;  5HXE A;  2YN6 A;  2LOS A;  2IC6 A;  2KND A;  3CX6 B;  3QOF A;  4HTE A;  3ZN0 B;  1IZN B;  2YOE A;  1T7S A;  1FIO A;  5LHH B;  1KNZ A;  2LE8 A;  4GYS A;  3RQW A;  4O8S A;  4HFC A;  5CA0 E;  2W63 A;  4ILU A;  2W67 A;  3RYI E;  3MA9 A;  4ZI2 C;  1XMQ T;  2AXD S;  1V9D A;  2LRL A;  3GA8 A;  2MPK A;  3RIU C;  5J0Z A;  4DV4 T;  1SA0 E;  3I0O A;  2X66 A;  1UK5 A;  2L9Q A;  5IHY A;  4DR5 T;  3UU4 A;  3PJA J;  4ANJ A;  3Q5X A;  3EUH A;  2BKO A;  2QRX A;  2DL1 A;  4HFI A;  3G06 A;  3ZMS B;  3VHL A;  4BJM A;  4IL9 A;  5ABF A;  3MAC A;  1IBL T;  4B3M T;  2N1G A;  4U7Y A;  2LM9 A;  2IUB A;  2N2N A;  3WAK A;  4CN4 A;  2UUC T;  5FY1 A;  5DQW A;  5FVL A;  2JQQ A;  4CXX A;  1VCS A;  2HPL A;  5L3D B;  1OED E;  4Z8X A;  4TV8 E;  4JLE A;  3ZKR A;  1XNR T;  2DLR A;  5CA1 E;  1QUU A;  3E0Z A;  2WAU A;  4DV0 T;  2A9U A;  3UU3 A;  3PUS A;  4P0B A;  5HEU A;  2JQ9 A;  2CEA A;  2J1D G;  4JI1 T;  3HKB E;  1H7C A;  4DUY T;  2LOP A;  5M4Y A;  2K3W A;  4P1N A;  3RF1 A;  3AEF A;  3MK7 C;  4CN6 A;  4PK6 A;  4HWD A;  5L3C B;  3VU7 H;  1KFY A;  2QGS A;  3UU6 A;  4IL4 A;  5LMN T;  3MKD A;  2BG9 A;  3EHZ A;  2RPA A;  5FVK A;  3FZH B;  4FI5 A;  5AQK B;  3PU8 A;  4B6X A;  5ABE A;  5IUX A;  4AXP A;  2PFV A;  2KT9 A;  5AQN B;  2WB5 A;  3TKL B;  3KBT A;  1WYB A;  5DAB A;  1M7K A;  3RIF A;  1T8B A;  4UVB B;  3DJB A;  3CKD A;  3RH3 A;  3PUQ A;  4MHC A;  2V6X A;  4B3T T;  5AQQ B;  3KV9 A;  5HEH A;  3GN5 B;  2W66 A;  2WU5 A;  5JR9 B;  1CHU A;  2LSJ A;  5AQS B;  3AE5 A;  2WDR A;  3PJA A;  3WAJ A;  2LT3 A;  2VL0 A;  5KDM C;  4JI3 T;  5ETW A;  2LM2 A;  3EDV A;  4U33 A;  3ZC0 A;  4L0R A;  1D0Y A;  3S4U A;  4LF5 T;  3OPC A;  3F2E A;  2CLY C;  2W61 A;  5LG4 A;  1GQE A;  3T1Y T;  4HN9 A;  2XUE A;  4U3C A;  2VB6 A;  2W0G A;  4U31 A;  1XZY A;  3C51 A;  5FXX A;  2WM9 A;  5C8Y E;  3FXD B;  5AFU L;  1MMA A;  1OED B;  2V6Y B;  4X1K E;  5LMU T;  1YXR A;  5AQI B;  4O2B E;  3WI3 A;  4EB6 E;  4YT0 A;  4ZZC A;  3AB3 B;  3HR0 A;  3AAE B;  3V5S A;  2YEV C;  4EED A;  5LXT E;  2XM2 A;  2NW9 A;  1S35 A;  4A5X A;  2C5I T;  3EVY A;  2CRB A;  3P8C D;  5AQL B;  2XJ7 A;  2V1D B;  2BS4 A;  1KNR A;  3JC6 C;  1XNQ T;  2E8I A;  4OYK A;  1FMV A;  2EHO C;  2H7O A;  2UUB T;  2ZM8 A;  3CWZ B;  3CX8 B;  2JJ9 A;  1W09 A;  2MYS A;  2A3D A;  3ESL A;  1ZOY A;  3FBL A;  3H3M A;  5LNK A;  2J4G A;  3CQX C;  2EHO D;  3GWH A;  1J1J A;  3ANW A;  4I55 E;  4XAX B;  5FY7 A;  3UUM A;  4DBQ A;  1HS7 A;  5JDH A;  4KUM B;  5DJQ C;  1N34 T;  3AVR A;  1JNZ A;  3PUV F;  4L5G A;  5JDQ A;  4PJN A;  3O1I A;  4MBQ A;  4UV9 B;  3LDQ B;  2CMR A;  4HFD A;  5E0O A;  4DV5 T;  4HFH A;  2K48 A;  2ACX A;  2MOZ A;  4PK4 A;  3SRZ A;  3LBX B;  4TUY E;  5HEJ A;  2VK9 A;  1W0B A;  2CPT A;  2YU2 A;  3RYC E;  5LOV E;  4DND A;  4AQY T;  4AKI A;  2HN2 A;  4P0A A;  5L47 A;  4YJ3 E;  1N33 T;  3P4Q A;  4GIW A;  3ZYM A;  4EGW A;  1W9R A;  3ZSS A;  3ZT5 A;  2D0U A;  5ABG A;  4KI0 F;  5L4H A;  2KXP B;  4UEM A;  3ZJ2 A;  2KWH A;  4YTM A;  3ZLI A;  2NP9 A;  1HCI A;  4QH4 A;  3RC3 A;  4AI6 A;  2VAS A;  4EIW A;  3OYX A;  3FZM B;  4AQF C;  2C5J A;  1MMN A;  2E9X B;  4DR4 T;  2XQ9 A;  3P4P A;  2BG9 E;  4H63 H;  4TWH A;  4AKR B;  4ZI3 D;  2VL8 A;  3A5X A;  5FXV A;  2VKH A;  2LKH A;  4DID B;  5JRE A;  4DR6 T;  2CBJ A;  3OBV E;  5JDG A;  3QB5 K;  5HXS A;  1HFA A;  1X79 A;  3HKE E;  1G8X A;  4M1P A;  4PJJ A;  2VKD A;  2YDR A;  4DBR A;  3VRB A;  1OXZ A;  4KHZ F;  4LML A;  2IC9 A;  3N9P A;  1HNX T;  4PFP A;  4CN1 A;  2I6H A;  4BA9 A;  1HG5 A;  3Q2M A;  3PDY A;  5LCY A;  2XSB A;  4HFB A;  3N2G E;  4O4H E;  5AQG B;  4I0U A;  3UFE A;  3UT5 E;  1BR0 A;  3JCF A;  3PTR B;  4PK5 A;  3H37 A;  5FNV E;  4ADZ A;  4LFA T;  3CIR A;  3BQL A;  4PFO A;  1NWM X;  3ZMT B;  3EAM A;  4GK0 E;  1NEN A;  2BS2 A;  3NWI A;  4QKN A;  4EXT A;  3NZP A;  3EAB A;  2UXD T;  2P9B A;  2Q9Q A;  3E22 E;  4IT4 A;  4X62 T;  5J1G A;  2DCF A;  2G0U A;  2R6G F;  2XQ3 A;  3L3P A;  4IIJ E;  3PUG A;  2M6B A;  2X9Y A;  2XY8 B;  3KIN B;  4IDN A;  4U7I A;  4WBO A;  5LA6 E;  5AQO B;  5A1L A;  1HNZ T;  4H9S E;  2XAF B;  5JQG E;  1D1A A;  2LJL A;  2HPJ A;  1HF8 A;  2KWI B;  5AQH B;  2WZI A;  4QXC B;  4L9I A;  2UUA T;  1OED C;  4U2Z A;  3EI0 A;  5HXC A;  5EK2 A;  2NW8 A;  2XZE A;  4IDQ A;  5FYM A;  3L8R A;  1YQ3 A;  4JI7 T;  3CPZ A;  3P4R A;  4WBN E;  1ZHC A;  1LRZ A;  4PNI A;  4QXB B;  1XDO A;  2X9H A;  2V5C A;  3C4Z A;  4ILB A;  4ILA A;  4UEL A;  3BQI A;  2C5K T;  3A7M A;  3IBP A;  1US7 B;  3Q5W A;  1WYC A;  4NUU A;  3AAI A;  3UQ7 A;  1KNP A;  3MXZ A;  3FXE B;  2LLY A;  3RC8 A;  3ZCJ A;  4IDP A;  3RRC A;  3Q9D A;  4PJL A;  4YHH T;  2X9W A;  4N78 D;  2XAQ B;  3CK6 A;  3AE2 A;  4DO0 A;  4H9R C;  1IBK T;  3KVA A;  3ETV A;  3ZMU B;  1LVF A;  2L8K A;  2CA5 A;  1O3X A;  1FJG T;  2A72 A;  4U74 A;  5LGT B;  3VKH A;  2V7J A;  2QYW A;  3K3N A;  4ZZB A;  4DV7 T;  1I94 T;  2E5L T;  2FJD A;  3OJA A;  4DR1 T;  4HWC A;  2FJA A;  4HE8 A;  4IE6 A;  4KHP T;  5DQV A;  4QX8 B;  2VUR A;  3B13 A;  2X67 A;  2ZM2 A;  2JRK A;  4HFE A;  4EAH A;  3CML A;  4HEA A;  3O9X A;  3AE4 A;  1VCT A;  1T72 A;  2IHR 1;  3RI5 A;  5LG3 A;  3HKD E;  4IGU A;  4G63 A;  5AQJ B;  2BVL A;  2X9X A;  4IDZ A;  3ZYL A;  2WQY A;  3ONX A;  1YW0 A;  5FY0 A;  4HWF A;  4HGA A;  2BKP A;  5FKY A;  2IW5 B;  4EZ4 A;  1SUM B;  4X5T A;  3FHN A;  3O1H A;  4QX7 B;  3RYF E;  4AQF A;  3MJX A;  2I0M A;  3C4X A;  3Q5E A;  4EZH A;  4F8H A;  2E9X C;  2IAK A;  3ABV A;  4AKG A;  3JAF A;  5F8P A;  1B7T A;  1UX5 A;  4UF0 A;  1BR2 A;  3AVS A;  1IJ5 A;  4UVA B;  1MIW A;  2RA1 A;  3MZK B;  3K8P C;  2E5V A;  3SOL A;  2XPK A;  3AA0 B;  2ACZ A;  2BBJ A;  3Q5D A;  1L0V A;  4MAL A;  4CXW A;  3T1H T;  2BKN A;  2HHH T;  1HNW T;  5JRC A;  2GK9 A;  3OYZ A;  3AEE A;  3LFM A;  3QK6 A;  3RX6 A;  1HTJ F;  4IRE A;  1OWA A;  2H3R A;  2CXF A;  4CI1 B;  4KBM B;  2EHO B;  2WWU A;  4YXD A;  2WMO A;  1U5P A;  2JQK A;  3C98 B;  4EEB A;  3ZJ1 A;  1QSD A;  2K9A A;  2LHR A;  3CQC B;  4OFZ A;  3W15 B;  4ASK A;  2DNX A;  1YKH B;  2LSG A;  2Q9Q C;  3AE6 A;  3ZST A;  4QHO A;  2UU9 T;  5ADX L;  2CHO A;  4LFB T;  3AE3 A;  2CXL A;  3HKC E;  3PE0 A;  5KXJ A;  2JMK A;  4Q25 A;  3JAE A;  5FXZ A;  4TZ4 C;  4BJN A;  4TN7 B;  5L3G B;  2BDE A;  2EHO A;  4CI3 B;  3R6N A;  4AKL A;  1BR1 A;  1ZP0 A;  1M62 A;  1LKX A;  4KMC A;  5L2L A;  4LF7 T;  3K3O A;  5BMV E;  2JMH A;  2CCQ A;  3F31 A;  3M3Z B;  4V1A v;  1T98 A;  3AXJ B;  3U3I A;  3P4S A;  3AEB A;  2PJQ A;  2XSA A;  2ZMA A;  3N9M A;  1D0Z A;  2E9X A;  2VWA A;  3NRY A;  2Q9Q D;  3KV5 A;  2KMF A;  3SFE A;  5ABF B;  2CBI A;  3OVU A;  3TLS A;  3KBU A;  2LSY A;  4IE5 A;  3QNU A;  5AQT B;  5LHG B;  2CE7 A;  3C4W A;  5LGN B;  2FJE A;  4JI5 T;  2YKS A;  4YFS A;  3SS1 A;  1HG2 A;  2XQY A;  5FP3 A;  1SHZ C;  1X9B A;  4EYY R;  2WBL A;  3AAA B;  5H6R B;  5HAX A;  4X1I E;  2V8S V;  3DP7 A;  1YQ4 A;  5JR9 A;  3R84 B;  2BVM A;  1D0X A;  1E2A A;  2XQ8 A;  3ETU A;  2B76 A;  3U78 A;  2F4V T;  1LVK A;  1Z0P A;  4O4L E;  4B3R T;  4CZZ B;  3AA7 B;  1KK7 A;  4I43 B;  3RKG A;  4HKA A;  3RQU A;  3BQK A;  3T8O A;  3ZMV B;  4WYV A;  4U72 A;  5H6Q B;  3LK3 B;  5J2T E;  2ES0 A;  2D5U A;  2W4X A;  2Y6X A;  4UV8 B;  2XAJ B;  3TLU A;  4DUZ T;  4G2A A;  2B1E A;  2SPC A;  3M65 A;  2XHE B;  4H9Q C;  5AQV B;  1J5E T;  2CXD A;  3AEG A;  2CLY B;  5HEO A;  4JI6 T;  2PTF A;  1U4Q A;  5FMN A;  3UU8 A;  5TAO A;  3ZN1 B;  1N32 T;  4OK0 A;  2BBH A;  5LB7 B;  3RKO A;  2H7V C;  2V7I A;  1IBM T;  4KX6 A;  5LJM A;  2YDS A;  1ZV4 X;  3FZL B;  4U2Y A;  4JI2 T;  4CQI A;  2NWB A;  4JBW F;  2M67 A;  2WU2 A;  3NBX X;  4A56 A;  5C2T A;  3C64 A;  2BG9 C;  4LF9 T;  4H63 V;  4NXM T;  1AJ3 A;  4X1Y E;  3IA3 A;  5LJN A;  2A2F X;  2M6I A;  4TWD A;  2OLT A;  5HYA A;  4WZX A;  4TWF A;  3N5L A;  1NEK A;  3OTO T;  5CFB A;  2X0H A;  3TLV A;  4C90 A;  3ZEF B;  2V7K A;  1Y01 A;  3J7Y q;  5LP6 E;  2UXN B;  1W0A A;  3K3Q C;  1MND A;  1WCR A;  3RLF F;  3NVO A;  4MFR A;  4K0U A;  2J62 A;  3UUB A;  1D1C A;  5F5W A;  3ZYK A;  3CVR A;  1MIV A;  3I9W A;  4JEU B;  3UUN A;  2RP4 A;  2XAH B;  2WZH A;  3A8Y C;  4QXH B;  4X20 E;  3RYH E;  3PUY F;  4NXN T;  1ZEE A;  1VOM A;  2NTY A;  3N2K E;  4IST A;  4COF A;  4EOZ B;  2VQE T;  4PJM A;  3LSV A;  2MTQ A;  4UR9 A;  4QWN B;  3LBX A;  5EK3 A;  2DI4 A;  5C3J A;  4F6R C;  1DU2 A;  1JNR A;  3AA6 B;  3N2O A;  2C0S A;  3BK9 A;  4FJO A;  3UFG A;  1E7P A;  1OED A;  2V6Y A;  1BR4 A;  2DHR A;  4YJ2 E;  5JDN A;  2K5B B;  3PU3 A;  4CXY A;  2E2A A;  2Y8D A;  5EK4 A;  3VR8 A;  3NKZ A;  1FMW A;  2KIN B;  3PUX F;  1IJ6 A;  4CI2 B;  5KMG P;  2CWO A;  4ZI3 C;  2XQ6 A;  2LRK A;  5AQF B;  3P4W A;  2CWY A;  2VVN A;  4HWH A;  1XDP A;  5IWA T;  4HWI B;  2UXX B;  2V7L A;  4LF8 T;  3TLW A;  2LSI A;  4JV5 T;  1D1B A;  3B5M A;  3PV0 F;  2D0T A;  2KLQ A;  4JEH B;  3ZPO A;  2XQ7 A;  4X66 T;  3GN5 A;  3N9N A;  3RIU A;  1Y64 B;  4E7S A;  1I6Z A;  3CX7 B;  3KVB A;  2H88 A;  4QH5 A;  4YSX A;  4DR7 T;  3UTK A;  2PG8 A;  5ABH A;  2JIW A;  2X0L B;  4YTP A;  4LFC T;  1FEW A;  4A97 A;  4Z90 A;  2X0Y A;  4NUV A;  4TNV A;  5L4E A;  3QC9 A;  4UF0 B;  5LGU B;  1UUS A;  4UXN B;  2ZM0 A;  2DWG A;  4AIU A;  3H3A A;  1G73 A;  1EZ3 A;  2E9X D;  3HA4 A;  3JAD A;  5HXR A;  5LHI B;  1J5W A;  3VKG A;  4IE4 A;  4DV2 T;  2D9D A;  3UUX B;  3K1S A;  3KDS E;  2NOX A;  4O4I E;  2CM0 A;  3AE8 A;  3I9Y A;  4IDO A;  3NZQ A;  4ZOL E;  2MBG A;  4GKJ T;  4XZC A;  4DR2 T;  2W00 A;  3UQ4 A;  4GOU A;  4JI0 T;  2X68 A;  3AE9 A;  4PW8 A;  4JI8 T;  3IF8 B;  4JUY A;  2QVA A;  4Z91 A;  4O2A E;  3AA1 B;  2XAG B;  4LF4 T;  4E7Z A;  4ZHQ E;  2ZM6 T;  3KFW X;  1XWM A;  2H89 A;  2WWV A;  2WDV A;  2VKO A;  2WDQ A;  2ZLY A;  3ZT7 A;  4DMV A;  5BR8 T;  3FB2 A;  3IEE A;  1E1H B;  2WSS V;  3ANW B;  1WFD A;  4ISS A;  3X1D A;  4EYU A;  3SFD A;  1NAF A;  4MLK A;  1SE7 A;  1HX8 A;  4ZI2 D;  1XMO T;  3QB5 A;  2IDO B;  2J47 A;  1YD8 G;  2BZB A;  5HWY A;  4X64 T;  5GON E;  1HX1 B;  4TNW A;  4GKK T;  2WP9 A;  3IHR A;  2XTL A;  3ZC1 A;  2XQ4 A;  5L3F B;  2K24 A;  2W62 A;  4C91 A;  2LEH A;  2Y48 B;  3LK4 2;  1KEY A;  2CHN A;  5AQR B;  5JH7 E;  3PUA A;  4HFV A;  2V7M A;  4P09 A;  5HXH A;  3B57 A;  4YLH A;  3AEA A;  4AQG A;  2UXC T;  1UCU A;  5F3J A;  3V5U A;  3LJC A;  5LBM A;  3AED A;  2IIU A;  4I50 E;  4IE7 A;  5CJ5 A;  2NR4 A;  2Q9Q B;  2FUP A;  3P7I A;  2BG9 B;  2N9D A;  4KP3 C;  3CQG B;  4B3S T;  2V5D A;  4EV6 A;  1MMD A;  3ONL C;  3VRA A;  4AIS A;  4DV6 T;  4ERR A;  4K0K T;  4NPP A;  2FJB A;  5AQM B;  2KZ7 B;  3GMI A;  3NRX A;  3JC6 D;  3F57 A;  4IE0 A;  5EZY E;  4BAY B;  4DV3 T;  3LK2 B;  4TV9 E;  1UGO A;  4H9N C;  3N9Q A;  2WMN A;  2LHN A;  2W2U A;  2OA5 A;  2HN1 A;  5HCJ A;  4ZEY A;  4J2C A;  1KF6 A;  3O1J A;  3KV4 A;  4OYJ A;  2ODU A;  2X51 A;  2XQ5 A;  4OHF A;  3ONJ A;  1CUN A;  4QH1 A;  3UU5 A;  1WR6 A;  4ZS3 A;  3SWH A;  3P50 A;  4LMK A;  4YTN A;  4GK5 E;  4I4T E;  4OX9 T;  3L09 A;  5JDM A;  3RRW A;  1MMG A;  2VVS A;  3I0Q A;  5JTG A;  3PUZ F;  4YHJ A;  3HL6 A;  4JI4 T;  4UVC B;  3RPU A;  4H9P C;  2JPF A;  2YU1 A;  4TX5 A;  1R8I A;  3D0T A;  2OV9 A;  1VRB A;  2LSK A;  3I1A A;  5FXW A;  1Z8U A;  2KSR A;  2V26 A;  4YY3 T;  3AE1 A;  2VQF T;  5HCM A;  4YSY A;  4DVD A;  1YKE B;  1HR0 T;  2NW7 A;  5FL0 A;  4WNK A;  3OKQ A;  4UIG A;  3L39 A;  5CGM A;  2FBW A;  4NIQ A;  4ZS2 A;  5JRC B;  4AKH A;  4WW0 A;  5LBQ B;  5HWX A;  1QLB A; 
#chains in the Genus database with same CATH homology
 1S94 A;  1ZKE A;  3QUJ A;  3C50 A;  5L3E B;  1WRD A;  1MNE A;  1WLX A;  2D2S A;  2HH7 A;  3PUR A;  4O4J E;  2PBI A;  2YIN A;  5J2U E;  4IHJ E;  2YK0 A;  3N9O A;  3DTO A;  5L3B B;  4PAG A;  4XBF B;  2DWK A;  3EDU A;  5JVD E;  3ZMZ B;  1UX4 A;  2VKJ A;  3J9X 1;  2I59 A;  3E08 A;  5JDF A;  3KV6 A;  4DMW A;  4ZI7 E;  4GYR A;  2L3L A;  5JR9 C;  2Z6E A;  4H9O C;  2ODV A;  2QA7 A;  5CB4 E;  3ZCI A;  3O4X E;  3LG7 A;  5LYJ E;  5IYZ E;  3UUL A;  2NTX A;  2XAS B;  5JDL A;  1IAP A;  1MIY A;  3FBZ A;  3HI2 A;  5KX5 E;  3N9L A;  5HXE A;  2LOS A;  2IC6 A;  3CX6 B;  2KND A;  4HTE A;  3ZN0 B;  1IZN B;  1FIO A;  5LHH B;  2LE8 A;  4GYS A;  5CA0 E;  4O8S A;  2W63 A;  4ILU A;  3RYI E;  4ZI2 C;  3MA9 A;  3GA8 A;  1V9D A;  1SA0 E;  3I0O A;  2X66 A;  2L9Q A;  5IHY A;  4ANJ A;  3Q5X A;  3EUH A;  4BJM A;  3ZMS B;  3VHL A;  3MAC A;  2N1G A;  2LM9 A;  3WAK A;  2N2N A;  5FY1 A;  5DQW A;  4CXX A;  2JQQ A;  2HPL A;  5L3D B;  4Z8X A;  4TV8 E;  4JLE A;  2DLR A;  5CA1 E;  1QUU A;  3E0Z A;  2WAU A;  3PUS A;  4P0B A;  2CEA A;  2J1D G;  3HKB E;  1H7C A;  2LOP A;  5M4Y A;  3MK7 C;  4PK6 A;  5L3C B;  3VU7 H;  2QGS A;  3MKD A;  4FI5 A;  3PU8 A;  4B6X A;  4AXP A;  2PFV A;  2KT9 A;  3TKL B;  3KBT A;  1WYB A;  5DAB A;  4UVB B;  3DJB A;  3CKD A;  3RH3 A;  3PUQ A;  4MHC A;  3KV9 A;  3GN5 B;  5JR9 B;  2LSJ A;  3WAJ A;  2LT3 A;  5KDM C;  5ETW A;  3ZC0 A;  3EDV A;  4L0R A;  1D0Y A;  3S4U A;  3F2E A;  2CLY C;  2W61 A;  5LG4 A;  4HN9 A;  2XUE A;  5FXX A;  2VB6 A;  2W0G A;  3C51 A;  2WM9 A;  5C8Y E;  3FXD B;  5AFU L;  1MMA A;  4X1K E;  3WI3 A;  4O2B E;  4EB6 E;  3AB3 B;  3HR0 A;  3AAE B;  3V5S A;  2YEV C;  5LXT E;  2NW9 A;  1S35 A;  2C5I T;  3EVY A;  3P8C D;  2V1D B;  3JC6 C;  2E8I A;  4OYK A;  1FMV A;  2EHO C;  2H7O A;  2ZM8 A;  3CWZ B;  3CX8 B;  2JJ9 A;  2MYS A;  2A3D A;  3ESL A;  3FBL A;  5LNK A;  3CQX C;  5FY7 A;  2EHO D;  3GWH A;  3UUM A;  3ANW A;  4I55 E;  4XAX B;  4DBQ A;  1HS7 A;  5JDH A;  4KUM B;  5DJQ C;  3AVR A;  4L5G A;  5JDQ A;  4PJN A;  3O1I A;  4MBQ A;  4UV9 B;  2CMR A;  5E0O A;  2K48 A;  2ACX A;  2MOZ A;  4PK4 A;  3SRZ A;  3LBX B;  4TUY E;  2VK9 A;  2YU2 A;  3RYC E;  4DND A;  5LOV E;  4AKI A;  4P0A A;  4YJ3 E;  4GIW A;  3ZYM A;  2D0U A;  5JDG A;  3ZLI A;  2KXP B;  4UEM A;  3ZJ2 A;  2KWH A;  2NP9 A;  1HCI A;  3RC3 A;  4AI6 A;  2VAS A;  4EIW A;  3OYX A;  4AQF C;  2C5J A;  1MMN A;  2E9X B;  4H63 H;  4AKR B;  4ZI3 D;  2VL8 A;  3A5X A;  5FXV A;  2VKH A;  5JRE A;  3OBV E;  5HXS A;  1HFA A;  1X79 A;  3HKE E;  1G8X A;  4M1P A;  4PJJ A;  2VKD A;  4DBR A;  1OXZ A;  2IC9 A;  3N9P A;  4PFP A;  4BA9 A;  1HG5 A;  3Q2M A;  3PDY A;  5LCY A;  3N2G E;  4O4H E;  3UT5 E;  1BR0 A;  3PTR B;  4PK5 A;  3H37 A;  5FNV E;  4ADZ A;  3ZMT B;  3BQL A;  4PFO A;  1NWM X;  4GK0 E;  4QKN A;  3NZP A;  2P9B A;  2Q9Q A;  3E22 E;  5J1G A;  2DCF A;  2G0U A;  3L3P A;  4IIJ E;  3PUG A;  2X9Y A;  5LA6 E;  3KIN B;  3UFE A;  4WBO A;  5A1L A;  4H9S E;  2XAF B;  5JQG E;  1D1A A;  2LJL A;  2HPJ A;  1HF8 A;  2KWI B;  4QXC B;  4L9I A;  5HXC A;  5EK2 A;  2NW8 A;  5FYM A;  3CPZ A;  4WBN E;  1ZHC A;  1LRZ A;  4PNI A;  4QXB B;  4UEL A;  2X9H A;  5LBM A;  3C4Z A;  4AQG A;  4CQI A;  3BQI A;  2C5K T;  3IBP A;  3Q5W A;  1US7 B;  4NUU A;  1WYC A;  3AAI A;  3MXZ A;  3FXE B;  3RC8 A;  3ZCJ A;  3RRC A;  3Q9D A;  4PJL A;  2X9W A;  4N78 D;  2XAQ B;  4DO0 A;  4H9R C;  3KVA A;  3ETV A;  3ZMU B;  1LVF A;  2L8K A;  2CA5 A;  1O3X A;  2A72 A;  4U74 A;  5LGT B;  3VKH A;  2V7J A;  3K3N A;  3OJA A;  4HE8 A;  4IE6 A;  5DQV A;  4QX8 B;  3B13 A;  2X67 A;  2ZM2 A;  2JRK A;  4EAH A;  3CML A;  4HEA A;  3O9X A;  3HKD E;  4IGU A;  4G63 A;  3ZYL A;  2BVL A;  2X9X A;  4IDZ A;  3ONX A;  1YW0 A;  5FY0 A;  4HGA A;  2IW5 B;  4EZ4 A;  3FHN A;  3O1H A;  4QX7 B;  3RYF E;  4AQF A;  3MJX A;  3C4X A;  4EZH A;  2E9X C;  2IAK A;  4AKG A;  5F8P A;  1B7T A;  1UX5 A;  4UF0 A;  1BR2 A;  3AVS A;  1IJ5 A;  4UVA B;  1MIW A;  2RA1 A;  3MZK B;  3K8P C;  3SOL A;  3AA0 B;  4CXW A;  4MAL A;  5JRC A;  2GK9 A;  3OYZ A;  3LFM A;  3QK6 A;  3RX6 A;  1HTJ F;  1OWA A;  2H3R A;  2CXF A;  4CI1 B;  4KBM B;  2EHO B;  2WWU A;  2WMO A;  1U5P A;  3C98 B;  3ZJ1 A;  1QSD A;  2K9A A;  2LHR A;  3CQC B;  4OFZ A;  3W15 B;  4ASK A;  2DNX A;  1YKH B;  2LSG A;  2Q9Q C;  5HWX A;  4QHO A;  5ADX L;  3HKC E;  2CXL A;  3PE0 A;  2JMK A;  5FXZ A;  4TZ4 C;  4BJN A;  4TN7 B;  5L3G B;  2BDE A;  2EHO A;  4CI3 B;  3R6N A;  4AKL A;  1BR1 A;  4KMC A;  1LKX A;  5L2L A;  3K3O A;  5BMV E;  2JMH A;  2CCQ A;  3F31 A;  4V1A v;  1T98 A;  3U3I A;  2PJQ A;  2ZMA A;  3N9M A;  1D0Z A;  2E9X A;  2VWA A;  3NRY A;  2Q9Q D;  3KV5 A;  2KMF A;  3KBU A;  2LSY A;  4IE5 A;  5LHG B;  2CE7 A;  3C4W A;  5LGN B;  3SS1 A;  4YFS A;  1HG2 A;  2XQY A;  5FP3 A;  1SHZ C;  4EYY R;  2WBL A;  3AAA B;  5H6R B;  5HAX A;  4X1I E;  3DP7 A;  5JR9 A;  3R84 B;  5KMG P;  2BVM A;  1D0X A;  3ETU A;  3U78 A;  1LVK A;  1Z0P A;  4O4L E;  4CZZ B;  3AA7 B;  1KK7 A;  4I43 B;  3ZMV B;  4HKA A;  3T8O A;  3BQK A;  4U72 A;  5H6Q B;  3LK3 B;  5J2T E;  2ES0 A;  2D5U A;  2Y6X A;  4UV8 B;  2XAJ B;  4G2A A;  2B1E A;  2SPC A;  3M65 A;  2XHE B;  4H9Q C;  2CXD A;  2CLY B;  5FMN A;  1U4Q A;  3ZN1 B;  5TAO A;  4OK0 A;  3RKO A;  2H7V C;  2V7I A;  5LJM A;  1ZV4 X;  2NWB A;  2M67 A;  3NBX X;  4A56 A;  1AJ3 A;  3C64 A;  4H63 V;  4X1Y E;  5LJN A;  2A2F X;  5HYA A;  3N5L A;  4C90 A;  3ZEF B;  2V7K A;  3J7Y q;  5LP6 E;  2UXN B;  3K3Q C;  1MND A;  4MFR A;  4K0U A;  1D1C A;  3ZYK A;  3CVR A;  1MIV A;  3I9W A;  4JEU B;  3UUN A;  2RP4 A;  2XAH B;  4QXH B;  4X20 E;  3RYH E;  1ZEE A;  1VOM A;  2NTY A;  3N2K E;  4IST A;  4EOZ B;  4PJM A;  2MTQ A;  4QWN B;  3LBX A;  5EK3 A;  2DI4 A;  4F6R C;  3AA6 B;  3N2O A;  2C0S A;  3BK9 A;  4FJO A;  2DHR A;  1BR4 A;  4YJ2 E;  5JDN A;  2K5B B;  3PU3 A;  4CXY A;  5EK4 A;  2Y8D A;  1FMW A;  2KIN B;  4CI2 B;  1IJ6 A;  2CWO A;  4ZI3 C;  2CWY A;  2UXX B;  2V7L A;  2LSI A;  1D1B A;  4JEH B;  3ZPO A;  2D0T A;  2KLQ A;  3GN5 A;  3N9N A;  1Y64 B;  4E7S A;  3CX7 B;  3KVB A;  3UTK A;  2PG8 A;  2X0L B;  1FEW A;  4NUV A;  3QC9 A;  4UF0 B;  5LGU B;  4UXN B;  2ZM0 A;  2DWG A;  3H3A A;  1G73 A;  1EZ3 A;  2E9X D;  3HA4 A;  5HXR A;  5LHI B;  3VKG A;  4IE4 A;  3UUX B;  3KDS E;  2NOX A;  4O4I E;  2CM0 A;  3I9Y A;  4ZOL E;  3NZQ A;  2MBG A;  4XZC A;  2W00 A;  4GOU A;  2X68 A;  4PW8 A;  3IF8 B;  4JUY A;  4O2A E;  3AA1 B;  2XAG B;  4E7Z A;  4ZHQ E;  3KFW X;  4DMV A;  2VKO A;  2ZLY A;  3FB2 A;  3IEE A;  1E1H B;  3ANW B;  2WSS V;  4EYU A;  4ISS A;  4ZI2 D;  1NAF A;  4MLK A;  1HX8 A;  1YD8 G;  2BZB A;  5HWY A;  5GON E;  3IHR A;  5L3F B;  2XTL A;  3ZC1 A;  2K24 A;  2W62 A;  4C91 A;  2LEH A;  2Y48 B;  3LK4 2;  5JH7 E;  3PUA A;  4HFV A;  2V7M A;  4P09 A;  5HXH A;  3B57 A;  4YLH A;  1UCU A;  5F3J A;  3V5U A;  3LJC A;  4I50 E;  4IE7 A;  2Q9Q B;  3P7I A;  2N9D A;  4KP3 C;  3CQG B;  1MMD A;  4ERR A;  4EXT A;  2KZ7 B;  3GMI A;  3NRX A;  3JC6 D;  3F57 A;  4IE0 A;  5EZY E;  4BAY B;  3LK2 B;  4TV9 E;  4H9N C;  3N9Q A;  2WMN A;  2LHN A;  2OA5 A;  4J2C A;  3O1J A;  3KV4 A;  4OYJ A;  2ODU A;  2X51 A;  4OHF A;  1CUN A;  1WR6 A;  4ZS3 A;  3SWH A;  4GK5 E;  4I4T E;  3L09 A;  5JDM A;  3RRW A;  1MMG A;  3I0Q A;  4YHJ A;  3HL6 A;  4UVC B;  3RPU A;  4H9P C;  2JPF A;  2YU1 A;  4TX5 A;  5FXW A;  3D0T A;  1VRB A;  2LSK A;  3I1A A;  1KNZ A;  2V26 A;  4DVD A;  1YKE B;  2NW7 A;  4WNK A;  3OKQ A;  4UIG A;  5JRC B;  4AKH A;  4ZS2 A;  4WW0 A;  5LBQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...