4TX5A

Crystal structure of smac-diablo (in space group p65)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
SEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLREDLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diablo homolog, mitochondrial
publication title The activator of apoptosis Smac-DIABLO acts as a tetramer in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 90
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tx5A00
3C98B 1EZ3A 5M4YA 2XHEB 5LG4A 1FEWA 3LG7A 4JEUB 1G73A 4TX5A 1HS7A 1FIOA 1S94A 4JEHB 1BR0A 2DNXA
chains in the Genus database with same CATH superfamily
2C5KT 4MFRA 1UGOA 3PTRB 4NPPA 3UU5A 1SHZC 4KX6A 3ZT5A 5AQJB 2M67A 2V7IA 3CX7B 3RYFE 4ERRA 3VKHA 3J7Yq 3QUJA 4JI0T 4WNKA 5L4EA 2JIWA 4H9QC 2E9XB 3ONLC 3NRYA 1US7B 5HEHA 4B3RT 2I59A 2X9YA 4YHJA 2L8KA 5CJ5A 3JC6C 2Q9QC 4UEMA 1U4QA 5DQVA 3ETVA 3PDYA 1M7KA 4OYJA 5FMNA 4EV6A 3P4WA 4HWCA 4YHHT 5HXEA 4KUMB 2WSSV 1HX1B 2CCQA 3Q5DA 3FZMB 5KXJA 1IBKT 3N2KE 1NEKA 2LSJA 3AAEB 2A3DA 4EIWA 2F4VT 4DUZT 2X51A 4TZ4C 4ZHQE 3Q5WA 3TLTA 1BR0A 2J62A 2A72A 4EAHA 1FEWA 4UV9B 2LOPA 5IUXA 4QH1A 4WBNE 2E9XA 5JDLA 2BS3A 5HWYA 3LK42 5EZYE 2B76A 3C51A 4H63H 3ZMTB 3E22E 5IYZE 1XDOA 3N2GE 4M1PA 2XQAA 4K0KT 5JREA 5AQQB 2CXLA 4O2AE 3AEDA 4QHOA 2CBJA 5LHGB 4ILAA 3MXZA 2OLTA 4DR7T 3PU3A 2Y48B 2VK9A 1XDPA 2LSKA 3WAJA 3AAAB 2PJQA 3AA1B 3MACA 3AE2A 1ZHCA 3B5MA 3ZN1B 5HXCA 2CHOA 2PTFA 3DP7A 4PJNA 3N9MA 2E9XD 1DU2A 3ZN0B 3KDSE 4YT0A 3ESLA 4FI5A 4AKIA 5J2TE 1N33T 3RX6A 2CPTA 1HCIA 4U2YA 3UUNA 4IT4A 1MIVA 4X64T 3A8YC 4AQFA 4Q25A 4PK4A 2JMKA 4EYUA 4OYKA 2IUBA 5KX5E 1JNRA 2AE9A 4JV5T 4H9OC 3HKCE 5FXVA 2DLRA 2B1EA 3ZT6A 4U7YA 1QSDA 2ZM6T 2KT9A 1IJ6A 1HG2A 2FJBA 2LT3A 1XNRT 1YW0A 2VURA 2KZ7B 1W0AA 4LMKA 1T98A 3AB3B 2WDQA 1IJ5A 2LEHA 5LMUT 3QNUA 4YJ3E 2Z6EA 4WYVA 4P1NA 1HG5A 3RKOA 2JQHA 1U5PA 4JUYA 5BR8T 1WR0A 3F2EA 4JI8T 2XQYA 4U3CA 4PAGA 2H88A 1HS7A 3RHWA 4HFIA 3KV4A 3JAFA 4TNWA 3ZJ1A 4O4JE 5AQHB 3RIUC 2X9XA 5LG3A 5CA0E 3L39A 2NP9A 2CE7A 2WAUA 3L8RA 4LFCT 4DMWA 3PURA 5H6QB 2V5CA 2XHEB 1NWMX 4CI2B 3EAMA 4QWNB 3S4UA 4AKRB 3QB5K 4HWFA 4IDZA 4I43B 3SWHA 3VRAA 3RYHE 3CQCB 1QUUA 3PV0F 3QC9A 2P9BA 4QX8B 2CA5A 2X9HA 1UURA 5KMGP 3KBTA 2XQ6A 5JDMA 1W0BA 1O3XA 5AQTB 4HFDA 3ZMSB 4HWDA 1V9DA 3QB5A 4ISTA 2YINA 3T1HT 2X0YA 3AE8A 4NXMT 4UR9A 2WQYA 2V7KA 2KSRA 1MMNA 4KBMB 2XAGB 4G63A 4GKKT 1YXRA 4IE0A 3H3MA 1D0ZA 2QGSA 2L3LA 5JVDE 1M62A 2WU2A 4B3MT 2W63A 5HEGA 2LHNA 3LBXB 4UVBB 2JPFA 5L2LA 3O1IA 1ZEEA 4ILBA 4TX5A 4C90A 2Q9QB 1MNEA 4ZEYA 5L3CB 1X9BA 3ZPOA 2XZEA 3NBXX 3AA0B 1WCRA 1XNQT 2V6YB 4XBFB 1UX4A 2FJDA 5ABFB 3ZSSA 2W4XA 4HTEA 2XSBA 4WW0A 3AEGA 1UX5A 2VB6A 2ZMAA 4JLEA 4NUVA 4EEBA 2E5LT 5L3GB 2VKHA 3FZHB 3RIAA 4ZS3A 4V1Av 3K3OA 3PU8A 3AEBA 4LFBT 1MMGA 4YSZA 3ONXA 4DBRA 1D0XA 2G0UA 3UUXB 3LBXA 1G8XA 2I6HA 3N9QA 4I55E 2XAQB 2HPLA 3ZMZB 4HFBA 2Q9QA 2N2NA 3U3IA 2SPCA 5AQMB 4HKAA 5ADXL 3U78A 5AQVB 3CPZA 1BR4A 5L3DB 2V6YA 1MMDA 2JQQA 5FYMA 3T1YT 5JDQA 1XMOT 1IBMT 1KF6A 3MKDA 4NXNT 4C91A 5L3EB 4IDQA 3N9OA 4X62T 5FL0A 2KLQA 4HN9A 5AQGB 4I0UA 3ZMVB 3ZJ2A 2WDRA 4YFSA 4EB6E 3A7MA 5LHIB 2IAKA 2GK9A 3SFDA 2V7JA 2LJLA 2CHNA 1KK7A 4B6XA 3C4XA 1S94A 1FMWA 4JI3T 1KNPA 5FXXA 4DVDA 2XAJB 2D9DA 4JI5T 4AISA 3UU6A 4E7SA 4JEUB 1LVKA 2X66A 2XASB 1IAPA 5EK2A 4OFZA 4CI1B 2AXDS 3DJBA 2IW5B 2Y8DA 3K8PC 4O4LE 3K1SA 4PJJA 3Q2MA 1AJ3A 3SOLA 3C50A 2BS4A 2RPAA 2OA5A 4BJMA 3F57A 4KI0F 2J4GA 1HFAA 4H9SE 3F31A 2JMHA 1WLXA 2YU2A 1H7CA 4IL4A 4HFEA 3L09A 4CXWA 1IBLT 2CRBA 2XPKA 3UULA 1MMAA 2DI4A 2VASA 5LG4A 3CK6A 4O8SA 1X79A 2IC9A 2UUCT 4DUYT 1I6ZA 2KNDA 3UQ7A 3M65A 1I94T 3I9YA 3AE5A 5M4YA 1HX8A 2K24A 2W66A 4ZI3C 3RRWA 2K9AA 5CB4E 3FXDB 4DR2T 3C64A 1S35A 3IA3A 2H3RA 1D0YA 2KWIB 1Y01A 4DNDA 5L47A 1FIOA 3GA8A 1LVFA 2QYWA 2H7OA 3UQ4A 3P4RA 2DWKA 2IC6A 3LDQB 4WBOA 2UUBT 4YTMA 5IHYA 2JJ9A 1XMQT 2NW7A 3N9LA 2KINB 3UUBA 2LRLA 3CIRA 2NW9A 3UT5E 2HPJA 2YOEA 5CFBA 5LBQB 3ZYLA 3CX6B 4X20E 4HE8A 2BVMA 5TAOA 3FBZA 2WBLA 2EHOD 4Z91A 4HFHA 3AE6A 2YDRA 1J5WA 2V7LA 3PUWF 3ABVA 3HKBE 5LMNT 2QRXA 3RIUA 3HR0A 3SFEA 2W00A 4ANJA 2CXFA 3OTOT 2VVSA 2LOSA 4OHFA 2MTQA 4IGUA 4LF5T 4L0RA 2CM0A 4IE6A 3HA4A 3MJXA 2CWYA 2KMFA 5FVLA 2FBWA 5HEJA 1VCTA 2UUAT 2WDVA 3MZKB 4DV5T 4X1KE 4PFPA 3CMLA 2EHOC 4ASKA 5CA1E 2HN2A 5CGMA 5DJQC 3UFGA 3C4WA 3ZKRA 2XM1A 3QOFA 3AXJB 3B13A 1BR2A 1R8IA 5GONE 5FXZA 3KBUA 2RP4A 1CUNA 5C8YE 3VR8A 1OXZA 4P0BA 3W15B 2X0HA 2V5DA 1EZ3A 2BKNA 3RC8A 4IE5A 4DV1T 1SUMB 4H63V 1SE7A 5F5WA 3AEAA 3JCFA 2IMLA 1E2AA 4QXCB 4DR3T 4JI1T 3ZCJA 2CLYC 2ZLYA 4A56A 4G2AA 3O1HA 3PE0A 3P4PA 4GIWA 4GK5E 3EUHA 2UU9T 1HR0T 4X65T 2MYSA 3UU3A 1WRDA 5FY7A 2VWAA 4IE4A 4P0AA 3FZKB 5LGUB 3GN5B 5L3BB 3LSVA 3AA6B 4ZI2C 4JI6T 5LYJE 4MLKA 3EVYA 3AXJA 4X1YE 2V1DB 4NUUA 1ZV4X 3SRZA 1D1AA 4UXNB 2XQ8A 3P4QA 4HEAA 4CQIA 4DIDB 3K3NA 4TUYE 2WS3A 5LXTE 4ZI7E 3UUMA 2PG8A 5LBMA 4U72A 4TWHA 3H3AA 1VOMA 4BA9A 5LA6E 1N34T 4H9NC 2W2UA 3AECA 3CWZB 1YKHB 3AE3A 2XTLA 3JAEA 5AQNB 4YSYA 1IZNB 4GOUA 3ZMUB 4HWIB 2XQ4A 2LSYA 3RH3A 5JRCB 3AAIA 2VKJA 3GN5A 3PUYF 4J2CA 4UELA 2JQKA 5C2TA 4DV4T 4YLHA 4X5TA 5HYAA 2FUPA 3HKEE 4COFA 4QX7B 4UF0B 3P4SA 4ZOLE 2BKPA 2MBGA 2WU5A 2UXXB 1WR6A 3KFWX 3T8OA 5ABGA 4PJLA 4CN4A 3L3PA 3A5XA 5FY1A 2ACZA 3ANWB 3PUXF 4Z8XA 2WZHA 3RLFF 3KVAA 4I50E 2IDOB 2WY2A 4HFCA 2YU1A 1FJGT 2I0MA 2XJ7A 3QK6A 3ZLIA 2E8IA 3ZCIA 3PUZF 1OEDC 2J47A 4U31A 2VVNA 4CZZB 3HL6A 5H6RB 1HF8A 1KFYA 2VKOA 5HCMA 3AE7A 2W62A 2BKOA 4MALA 5HXRA 1ZOYA 4KMCA 4I4TE 3BQLA 2D0UA 4UVAB 3IHRA 4GYSA 2MOZA 1E7PA 3C98B 4ILUA 3LK2B 1BR1A 2X9WA 3UU4A 5JTGA 3VRBA 2UXCT 2LM9A 4MBQA 1OEDE 2IHR1 2LRKA 3UTKA 3NVOA 5AQIB 3LK3B 3CVRA 3BQKA 3ANWA 3CX8B 1G73A 2XM2A 1XWMA 4QKNA 3I0QA 2XQ7A 5L3FB 1YQ4A 5FXWA 3MA9A 5AQOB 3GWHA 4IIJE 2NOXA 3RPUA 5LGTB 5ABFA 2YK0A 5HEOA 2K48A 5LCYA 2D5UA 2CEAA 5C3JA 1SA0E 5AQSB 1WFDA 2DCFA 4KP3C 4YTNA 2D2SA 3ZC0A 3UU8A 2J1DG 3RGLA 4UIGA 5AQRB 3SS1A 2E5VA 1YKEB 3OPCA 4CI3B 4DR1T 4DV3T 4L5GA 3EDUA 1ZKEA 4GKJT 3ZYMA 2BG9C 3ETUA 2WM9A 2BDEA 3FZLB 4HGAA 3X1DA 2C5IT 2WWVA 2OV9A 4H9PC 3JADA 2EHOB 2HN1A 2X68A 2JQ9A 3PUSA 1UCUA 2CBIA 1B7TA 4LMLA 1W9RA 4GYRA 2NTXA 4ZZBA 5LB7B 2LKHA 4MHCA 4AQYT 2ZM8A 4GK0E 3RKGA 1MNDA 2BG9E 4HWHA 4PNIA 3ZSTA 2C5JA 4IDOA 4ZI3D 1JNZA 1VRBA 2KWHA 4IHJE 4IDNA 4LMJA 3RIFA 3RI5A 2HH7A 3KV9A 4WZXA 5AFUL 1T7SA 2FJAA 3MK7C 2IIUA 3R84B 1N36T 5BMVE 4AKHA 3EI0A 5ETWA 5JQGE 2CWOA 3OKQA 4UV8B 2XY8B 2CLYB 4LF4T 4EYYR 3CQXC 1MIYA 4U74A 2UXBT 4KHZF 1J5ET 2WWUA 2W61A 2N1GA 3N9NA 3RC3A 2EHOA 3NZPA 2X67A 2BVLA 4BJNA 3PUVF 2YEVC 4IL9A 2VL0A 3HI2A 1Y64B 4OK0A 2BBJA 3E0ZA 5HEUA 4QH4A 3RYCE 4X1IE 3NKZA 5DQWA 4LF7T 2LE8A 3EHZA 5AQLB 3PJAJ 4O4HE 4IREA 2X0LB 4QXBB 3O9XA 4XAXB 2VKDA 5LHHB 4TV9E 3NWIA 1NENA 5JR9C 3BQIA 3J9X1 2QVAA 1HNZT 4H9RC 2XAFB 1T8BA 5J1GA 5LGNB 4F8HA 1HNWT 3VU7H 2E2AA 4IE7A 4LF8T 2ODUA 4AKLA 4JEHB 1UK5A 3Q9DA 4TWFA 5HXSA 2V7MA 3CQGB 3BK9A 3FHNA 2LKGA 2YN6A 4YXDA 2DNXA 3P7IA 3EABA 4JYAT 1YQ3A 1E1HB 1N32T 4AKGA 5F8PA 2W0GA 2LHRA 4TN7B 3AVRA 3RQUA 3ONJA 3VKGA 4CN1A 5J2UE 4QH5A 5HAXA 4ILCA 4FJOA 4YSXA 4DR4T 1UUSA 4DMVA 5ABHA 2YDSA 3RYIE 5EK4A 1OEDB 2V6XA 2D0TA 5JDFA 4AI6A 4ZI2D 3FBLA 5DABA 3G06A 3Q5XA 2DHRA 4DO0A 2WZIA 4ISSA 1WYCA 2DL1A 5F3JA 5J0ZA 4EXTA 2ACXA 3ZYKA 2ZM2A 3KINB 1GQEA 2NR4A 3PUQA 2H89A 1YD8G 4TV8E 2BZBA 4YTPA 3PJAA 1W09A 2E9XC 4JI7T 1T72A 4CN6A 2VQFT 4DV6T 4A5XA 4TWDA 3LG7A 3WI3A 5AQUB 5E0OA 1Z8UA 3LFMA 5FL1A 4U7IA 1D1CA 3V5SA 2ODVA 4XZCA 3E08A 4E7ZA 3NZQA 2L9QA 3HKDE 5HXHA 1OEDA 3IF8B 2XUEA 2QA7A 3GMIA 2BBHA 2MPKA 2H7VC 4YJ2E 4ZZCA 3TLVA 5LJMA 4ADZA 1QLBA 5HWXA 4EZ4A 1J1JA 3TKLB 3AE4A 1HNXT 3RRCA 4N78D 4JBWF 4HFVA 2XSAA 3C4ZA 4EOZB 4AIUA 2BG9B 3V5UA 3D0TA 5LJNA 1NAFA 3I1AA 3ZEFB 2ES0A 3H37A 5AQKB 3ZC1A 5AQPB 2MAWA 2WMNA 4EGWA 3N5LA 2V26A 2YKSA 2K3WA 2CMRA 4AQFC 3KV6A 3O4XE 1MIWA 1KNZA 3OBVE 4DV7T 3OVUA 2YDQA 3NRXA 2LSIA 1D1BA 5KDMC 4PK5A 4F6RC 4PK6A 4ZXLA 2PFVA 4ZS2A 4JI4T 2WB5A 2RA1A 2VL8A 5AQFB 5FNVE 2FJEA 2V8SV 2KXPB 4O4IE 3KV5A 3N2OA 3LJCA 4AXPA 4JI2T 4OX9T 2LM2A 4EEDA 2XQ9A 4A97A 1LRZA 2C0SA 3AEFA 3WAKA 5A1LA 2BG9A 2NTYA 2R6GF 5FP3A 2XQ5A 2LSGA 5FVKA 2WP9A 2BS2A 4DBQA 5JDNA 5JDHA 1OWAA 5JDGA 2ZM0A 5JH7E 4LF9T 5L4HA 5JRCA 4DV2T 2K5BB 5FKYA 2Y6XA 5FY0A 3IBPA 4Z90A 4KHPT 2JRKA 3TLSA 3AE1A 3O1JA 4UF0A 4PJMA 3RQWA 2UXDT 1KEYA 2M6IA 3PUGA 5IWAT 2A9UA 3Q5EA 2LLYA 1Z0PA 5HCJA 4LFAT 3P50A 3PUAA 4AQGA 3RF1A 2HHHT 4CXYA 1KNRA 5JR9B 3I0OA 3AVSA 3P8CD 4LF6T 4U2ZA 4QXHB 1ZP0A 2DWGA 5LNKA 3M3ZB 3FXEB 3OYXA 4L9IA 3VHLA 3K3QC 3I9WA 2NW8A 2NWBA 3OJAA 1VCSA 1WYBA 5LOVE 4DV0T 4P09A 4NIQA 4O2BE 3B57A 4PW8A 1L0VA 3KVBA 1HTJF 4A98A 3N9PA 3EDVA 4UVCB 3DTOA 3CKDA 4IDPA 2XQ3A 1XZYA 4YY3T 3AEEA 3FZFB 2M6BA 1CHUA 2UXNB 3R6NA 5LP6E 4DR6T 4EZHA 3AE9A 1FMVA 4BAYB 4PFOA 2VQET 4CXXA 2WCAA 2N9DA 4DR5T 3OYZA 2A2FX 5JR9A 3FB2A 2XAHB 3UFEA 4X66T 3IEEA 4U33A 3JC6D 4B3TT 3TLWA 2Q9QD 2CXDA 5ABEA 3AA7B 4K0UA 2WMOA 3ZT7A 3VR9A 1LKXA 4TNVA 2PBIA 5EK3A 2W67A 3TLUA 4B3ST
chains in the Genus database with same CATH topology
3Q9DA 2C5KT 4MFRA 3EVYA 5HXSA 3PTRB 2VB6A 2ZMAA 2V7MA 3CQGB 4X1YE 1SHZC 4JLEA 3BK9A 3FHNA 4NUVA 2V1DB 4NUUA 2M67A 1ZV4X 2V7IA 3SRZA 2DNXA 1D1AA 3CX7B 3RYFE 4UXNB 3P7IA 4ERRA 5L3GB 2VKHA 3VKHA 4ZS3A 3J7Yq 1E1HB 3QUJA 4HEAA 4V1Av 4CQIA 4AKGA 4WNKA 3K3NA 4H9QC 2E9XB 3K3OA 3PU8A 4TUYE 5F8PA 1MMGA 2LHRA 2W0GA 3NRYA 4TN7B 1US7B 3ONXA 4DBRA 1D0XA 5LXTE 4ZI7E 3AVRA 2G0UA 3UUXB 3UUMA 2I59A 3LBXA 1G8XA 2X9YA 2PG8A 4YHJA 5LBMA 2L8KA 3VKGA 4U72A 3N9QA 4I55E 3H3AA 2XAQB 1VOMA 3JC6C 4BA9A 5J2UE 2HPLA 5LA6E 2Q9QC 5HAXA 3ZMZB 4FJOA 4H9NC 4UEMA 2Q9QA 2N2NA 1U4QA 5DQVA 3ETVA 3CWZB 3U3IA 1YKHB 2SPCA 2XTLA 4HKAA 3PDYA 4DMVA 5ADXL 4OYJA 3U78A 5FMNA 3CPZA 1BR4A 3RYIE 5EK4A 5L3DB 1IZNB 4GOUA 1MMDA 5HXEA 3ZMUB 4KUMB 2D0TA 2JQQA 2LSYA 3RH3A 5FYMA 5JDFA 5JRCB 4AI6A 2WSSV 3AAIA 2VKJA 5JDQA 3GN5A 4J2CA 4ZI2D 2CCQA 3FBLA 4UELA 5DABA 3N2KE 3Q5XA 3MKDA 2DHRA 4DO0A 4ISSA 4C91A 1WYCA 5F3JA 5L3EB 4YLHA 2LSJA 4EXTA 3AAEB 2ACXA 5HYAA 3ZYKA 3N9OA 2A3DA 4EIWA 2ZM2A 3HKEE 3KINB 4QX7B 4UF0B 2X51A 4TZ4C 2KLQA 3PUQA 4ZOLE 2MBGA 4ZHQE 3Q5WA 1YD8G 4TV8E 2BZBA 1BR0A 2A72A 2UXXB 4EAHA 1FEWA 1WR6A 3KFWX 3T8OA 4HN9A 4UV9B 2E9XC 4PJLA 3ZMVB 2LOPA 3ZJ2A 4YFSA 4EB6E 4WBNE 2E9XA 3L3PA 5LHIB 3A5XA 5FY1A 5JDLA 3ANWB 2IAKA 2GK9A 5HWYA 3LG7A 3LK42 5EZYE 2V7JA 4Z8XA 2LJLA 3C51A 4H63H 3ZMTB 1KK7A 3WI3A 4B6XA 5E0OA 3E22E 5IYZE 3N2GE 4M1PA 3C4XA 3LFMA 1S94A 1FMWA 5JREA 3KVAA 4I50E 5FXXA 4DVDA 2XAJB 2CXLA 4O2AE 1D1CA 4E7SA 4JEUB 2YU1A 3V5SA 4QHOA 5LHGB 3QK6A 3ZLIA 1LVKA 2E8IA 2X66A 2XASB 3ZCIA 2ODVA 3MXZA 4XZCA 3E08A 1IAPA 3NZQA 4CZZB 3HL6A 4OFZA 4E7ZA 5EK2A 2L9QA 4CI1B 3HKDE 5H6RB 1HF8A 2VKOA 5HXHA 3DJBA 3PU3A 3IF8B 2Y48B 2XUEA 2VK9A 2IW5B 2QA7A 2Y8DA 2W62A 3K8PC 4O4LE 2LSKA 3GMIA 3WAJA 4PJJA 4MALA 5HXRA 2H7VC 3Q2MA 3AAAB 3SOLA 1AJ3A 2PJQA 4KMCA 4YJ2E 3C50A 3AA1B 4I4TE 3MACA 1ZHCA 3BQLA 2OA5A 2D0UA 4BJMA 4UVAB 3IHRA 3F57A 5LJMA 4ADZA 5HWXA 4GYSA 4EZ4A 2MOZA 3TKLB 3ZN1B 1HFAA 4H9SE 3C98B 3RRCA 4ILUA 4N78D 5HXCA 3LK2B 1BR1A 4HFVA 2X9WA 2JMHA 3C4ZA 1WLXA 3F31A 3DP7A 2LM9A 2YU2A 4MBQA 4EOZB 1H7CA 4PJNA 3N9MA 3V5UA 2E9XD 3D0TA 3L09A 4CXWA 3ZN0B 5LJNA 3KDSE 1NAFA 3I1AA 3UTKA 3ZEFB 2ES0A 3ESLA 4FI5A 4AKIA 3H37A 3ZC1A 5J2TE 3LK3B 3RX6A 3UULA 3CVRA 1MMAA 2DI4A 3BQKA 1HCIA 2WMNA 3ANWA 2VASA 3N5LA 2V26A 3UUNA 5LG4A 3CX8B 1G73A 2CMRA 4AQFC 4O8SA 3KV6A 4QKNA 3I0QA 1X79A 2IC9A 1MIVA 3O4XE 5L3FB 2KNDA 1MIWA 4AQFA 1KNZA 3OBVE 5FXWA 3MA9A 3GWHA 4IIJE 4PK4A 3M65A 2JMKA 2NOXA 3RPUA 4EYUA 5LGTB 4OYKA 5KX5E 2YK0A 3NRXA 2LSIA 2K48A 3I9YA 1D1BA 5LCYA 4H9OC 2D5UA 2CEAA 3HKCE 5M4YA 1HX8A 5KDMC 2K24A 5FXVA 2DLRA 2B1EA 1SA0E 4ZI3C 3RRWA 4PK5A 2DCFA 4KP3C 4F6RC 2K9AA 5CB4E 3FXDB 3C64A 1S35A 2D2SA 1QSDA 2PFVA 4PK6A 3ZC0A 4ZS2A 2H3RA 2J1DG 1D0YA 2KWIB 4DNDA 4UIGA 2RA1A 2VL8A 5FNVE 3SS1A 2KT9A 1FIOA 2KXPB 3GA8A 4O4IE 3KV5A 1LVFA 1YKEB 4CI3B 2H7OA 1IJ6A 3N2OA 3LJCA 4AXPA 4L5GA 3EDUA 1HG2A 1ZKEA 2DWKA 2LT3A 2IC6A 1YW0A 4WBOA 1LRZA 2KZ7B 3ZYMA 1T98A 2C0SA 3AB3B 3WAKA 5A1LA 1IJ5A 5IHYA 2LEHA 3ETUA 2JJ9A 2WM9A 4YJ3E 2BDEA 2NTYA 2NW7A 2Z6EA 5FP3A 4HGAA 1HG5A 3RKOA 2C5IT 3N9LA 1U5PA 2KINB 4JUYA 2LSGA 4H9PC 2NW9A 3UT5E 2EHOB 2X68A 2HPJA 3PUSA 5LBQB 3ZYLA 3F2EA 1UCUA 4DBQA 2XQYA 3CX6B 1B7TA 4GYRA 4X20E 5JDNA 4HE8A 5JDHA 1OWAA 5JDGA 2BVMA 2ZM0A 4PAGA 2NTXA 5TAOA 3FBZA 5JH7E 2WBLA 2EHOD 1HS7A 5JRCA 3KV4A 4MHCA 3ZJ1A 2V7LA 2ZM8A 4GK0E 4O4JE 2K5BB 1MNDA 2X9XA 5CA0E 2Y6XA 4PNIA 5FY0A 3IBPA 3HKBE 2NP9A 3HR0A 2CE7A 2C5JA 2WAUA 4ZI3D 4DMWA 2JRKA 2W00A 4ANJA 2CXFA 3PURA 5H6QB 1VRBA 2KWHA 3O1JA 4IHJE 4UF0A 2LOSA 2XHEB 1NWMX 4PJMA 4CI2B 4OHFA 2MTQA 2HH7A 4IGUA 4QWNB 4L0RA 3S4UA 2CM0A 4AKRB 3KV9A 4IE6A 3PUGA 5AFUL 3HA4A 3MK7C 3MJXA 2CWYA 3R84B 1Z0PA 4IDZA 4I43B 3SWHA 5BMVE 4AKHA 2KMFA 3PUAA 5ETWA 4AQGA 5JQGE 2CWOA 3CQCB 3RYHE 1QUUA 3OKQA 4CXYA 3QC9A 2P9BA 4QX8B 4UV8B 2CA5A 3I0OA 3AVSA 5JR9B 2CLYB 3MZKB 2X9HA 5KMGP 4EYYR 3CQXC 3P8CD 1MIYA 3KBTA 4U74A 4PFPA 4X1KE 4QXHB 3CMLA 5JDMA 2DWGA 2WWUA 2W61A 2N1GA 1O3XA 5LNKA 3N9NA 2EHOC 3RC3A 4ASKA 5CA1E 3FXEB 3OYXA 3ZMSB 4L9IA 5DJQC 1V9DA 2EHOA 3C4WA 4ISTA 2YINA 2X67A 3NZPA 3VHLA 2BVLA 3K3QC 3I9WA 4BJNA 2NW8A 2NWBA 3OJAA 2V7KA 1MMNA 2YEVC 4KBMB 2XAGB 3B13A 4G63A 1WYBA 5LOVE 4P09A 3HI2A 1Y64B 1BR2A 4OK0A 4O2BE 3B57A 3E0ZA 4PW8A 5GONE 5FXZA 3KVBA 1HTJF 3RYCE 3KBUA 4IE0A 2RP4A 4X1IE 1CUNA 5DQWA 5C8YE 2LE8A 1D0ZA 2QGSA 2L3LA 1OXZA 4P0BA 3W15B 5JVDE 3N9PA 3EDVA 4UVCB 3DTOA 3CKDA 4O4HE 1EZ3A 2X0LB 3RC8A 4QXBB 2W63A 2UXNB 4IE5A 3R6NA 3O9XA 4H63V 5LP6E 2LHNA 4XAXB 3LBXB 4UVBB 4EZHA 2JPFA 2VKDA 1FMVA 5LHHB 5L2LA 4TV9E 4BAYB 3O1IA 1ZEEA 4PFOA 4QXCB 4TX5A 4CXXA 4C90A 3ZCJA 2N9DA 5JR9C 2Q9QB 2CLYC 3BQIA 1MNEA 2ZLYA 4A56A 3OYZA 2A2FX 3J9X1 5JR9A 3FB2A 4G2AA 2XAHB 3O1HA 3UFEA 3PE0A 4H9RC 3IEEA 3ZPOA 5L3CB 2XAFB 4GIWA 3NBXX 4GK5E 3AA0B 5J1GA 3EUHA 3JC6D 5LGNB 2Q9QD 2CXDA 2MYSA 1WRDA 5FY7A 2VWAA 4IE4A 3VU7H 3AA7B 4K0UA 4P0AA 2WMOA 4IE7A 5LGUB 4XBFB 1UX4A 1LKXA 3GN5B 5L3BB 2PBIA 5EK3A 3AA6B 4ZI2C 5LYJE 2ODUA 4AKLA 4HTEA 4JEHB 4WW0A 4MLKA 1UX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C98 B;  1EZ3 A;  5M4Y A;  2XHE B;  5LG4 A;  1FEW A;  3LG7 A;  4JEU B;  1G73 A;  4TX5 A;  1HS7 A;  1FIO A;  1S94 A;  4JEH B;  1BR0 A;  2DNX A; 
#chains in the Genus database with same CATH topology
 2C5K T;  4MFR A;  1UGO A;  3PTR B;  4NPP A;  3UU5 A;  1SHZ C;  4KX6 A;  3ZT5 A;  5AQJ B;  2M67 A;  2V7I A;  3CX7 B;  3RYF E;  4ERR A;  3VKH A;  3J7Y q;  3QUJ A;  4JI0 T;  4WNK A;  5L4E A;  2JIW A;  4H9Q C;  2E9X B;  3ONL C;  3NRY A;  1US7 B;  5HEH A;  4B3R T;  2I59 A;  2X9Y A;  4YHJ A;  2L8K A;  5CJ5 A;  3JC6 C;  2Q9Q C;  4UEM A;  1U4Q A;  5DQV A;  3ETV A;  3PDY A;  1M7K A;  4OYJ A;  5FMN A;  4EV6 A;  3P4W A;  4HWC A;  4YHH T;  5HXE A;  4KUM B;  2WSS V;  1HX1 B;  2CCQ A;  3Q5D A;  3FZM B;  5KXJ A;  1IBK T;  3N2K E;  1NEK A;  2LSJ A;  3AAE B;  2A3D A;  4EIW A;  2F4V T;  4DUZ T;  2X51 A;  4TZ4 C;  4ZHQ E;  3Q5W A;  3TLT A;  1BR0 A;  2J62 A;  2A72 A;  4EAH A;  1FEW A;  4UV9 B;  2LOP A;  5IUX A;  4QH1 A;  4WBN E;  2E9X A;  5JDL A;  2BS3 A;  5HWY A;  3LK4 2;  5EZY E;  2B76 A;  3C51 A;  4H63 H;  3ZMT B;  3E22 E;  5IYZ E;  1XDO A;  3N2G E;  4M1P A;  2XQA A;  4K0K T;  5JRE A;  5AQQ B;  2CXL A;  4O2A E;  3AED A;  4QHO A;  2CBJ A;  5LHG B;  4ILA A;  3MXZ A;  2OLT A;  4DR7 T;  3PU3 A;  2Y48 B;  2VK9 A;  1XDP A;  2LSK A;  3WAJ A;  3AAA B;  2PJQ A;  3AA1 B;  3MAC A;  3AE2 A;  1ZHC A;  3B5M A;  3ZN1 B;  5HXC A;  2CHO A;  2PTF A;  3DP7 A;  4PJN A;  3N9M A;  2E9X D;  1DU2 A;  3ZN0 B;  3KDS E;  4YT0 A;  3ESL A;  4FI5 A;  4AKI A;  5J2T E;  1N33 T;  3RX6 A;  2CPT A;  1HCI A;  4U2Y A;  3UUN A;  4IT4 A;  1MIV A;  4X64 T;  3A8Y C;  4AQF A;  4Q25 A;  4PK4 A;  2JMK A;  4EYU A;  4OYK A;  2IUB A;  5KX5 E;  1JNR A;  2AE9 A;  4JV5 T;  4H9O C;  3HKC E;  5FXV A;  2DLR A;  2B1E A;  3ZT6 A;  4U7Y A;  1QSD A;  2ZM6 T;  2KT9 A;  1IJ6 A;  1HG2 A;  2FJB A;  2LT3 A;  1XNR T;  1YW0 A;  2VUR A;  2KZ7 B;  1W0A A;  4LMK A;  1T98 A;  3AB3 B;  2WDQ A;  1IJ5 A;  2LEH A;  5LMU T;  3QNU A;  4YJ3 E;  2Z6E A;  4WYV A;  4P1N A;  1HG5 A;  3RKO A;  2JQH A;  1U5P A;  4JUY A;  5BR8 T;  1WR0 A;  3F2E A;  4JI8 T;  2XQY A;  4U3C A;  4PAG A;  2H88 A;  1HS7 A;  3RHW A;  4HFI A;  3KV4 A;  3JAF A;  4TNW A;  3ZJ1 A;  4O4J E;  5AQH B;  3RIU C;  2X9X A;  5LG3 A;  5CA0 E;  3L39 A;  2NP9 A;  2CE7 A;  2WAU A;  3L8R A;  4LFC T;  4DMW A;  3PUR A;  5H6Q B;  2V5C A;  2XHE B;  1NWM X;  4CI2 B;  3EAM A;  4QWN B;  3S4U A;  4AKR B;  3QB5 K;  4HWF A;  4IDZ A;  4I43 B;  3SWH A;  3VRA A;  3RYH E;  3CQC B;  1QUU A;  3PV0 F;  3QC9 A;  2P9B A;  4QX8 B;  2CA5 A;  2X9H A;  1UUR A;  5KMG P;  3KBT A;  2XQ6 A;  5JDM A;  1W0B A;  1O3X A;  5AQT B;  4HFD A;  3ZMS B;  4HWD A;  1V9D A;  3QB5 A;  4IST A;  2YIN A;  3T1H T;  2X0Y A;  3AE8 A;  4NXM T;  4UR9 A;  2WQY A;  2V7K A;  2KSR A;  1MMN A;  4KBM B;  2XAG B;  4G63 A;  4GKK T;  1YXR A;  4IE0 A;  3H3M A;  1D0Z A;  2QGS A;  2L3L A;  5JVD E;  1M62 A;  2WU2 A;  4B3M T;  2W63 A;  5HEG A;  2LHN A;  3LBX B;  4UVB B;  2JPF A;  5L2L A;  3O1I A;  1ZEE A;  4ILB A;  4TX5 A;  4C90 A;  2Q9Q B;  1MNE A;  4ZEY A;  5L3C B;  1X9B A;  3ZPO A;  2XZE A;  3NBX X;  3AA0 B;  1WCR A;  1XNQ T;  2V6Y B;  4XBF B;  1UX4 A;  2FJD A;  5ABF B;  3ZSS A;  2W4X A;  4HTE A;  2XSB A;  4WW0 A;  3AEG A;  1UX5 A;  2VB6 A;  2ZMA A;  4JLE A;  4NUV A;  4EEB A;  2E5L T;  5L3G B;  2VKH A;  3FZH B;  3RIA A;  4ZS3 A;  4V1A v;  3K3O A;  3PU8 A;  3AEB A;  4LFB T;  1MMG A;  4YSZ A;  3ONX A;  4DBR A;  1D0X A;  2G0U A;  3UUX B;  3LBX A;  1G8X A;  2I6H A;  3N9Q A;  4I55 E;  2XAQ B;  2HPL A;  3ZMZ B;  4HFB A;  2Q9Q A;  2N2N A;  3U3I A;  2SPC A;  5AQM B;  4HKA A;  5ADX L;  3U78 A;  5AQV B;  3CPZ A;  1BR4 A;  5L3D B;  2V6Y A;  1MMD A;  2JQQ A;  5FYM A;  3T1Y T;  5JDQ A;  1XMO T;  1IBM T;  1KF6 A;  3MKD A;  4NXN T;  4C91 A;  5L3E B;  4IDQ A;  3N9O A;  4X62 T;  5FL0 A;  2KLQ A;  4HN9 A;  5AQG B;  4I0U A;  3ZMV B;  3ZJ2 A;  2WDR A;  4YFS A;  4EB6 E;  3A7M A;  5LHI B;  2IAK A;  2GK9 A;  3SFD A;  2V7J A;  2LJL A;  2CHN A;  1KK7 A;  4B6X A;  3C4X A;  1S94 A;  1FMW A;  4JI3 T;  1KNP A;  5FXX A;  4DVD A;  2XAJ B;  2D9D A;  4JI5 T;  4AIS A;  3UU6 A;  4E7S A;  4JEU B;  1LVK A;  2X66 A;  2XAS B;  1IAP A;  5EK2 A;  4OFZ A;  4CI1 B;  2AXD S;  3DJB A;  2IW5 B;  2Y8D A;  3K8P C;  4O4L E;  3K1S A;  4PJJ A;  3Q2M A;  1AJ3 A;  3SOL A;  3C50 A;  2BS4 A;  2RPA A;  2OA5 A;  4BJM A;  3F57 A;  4KI0 F;  2J4G A;  1HFA A;  4H9S E;  3F31 A;  2JMH A;  1WLX A;  2YU2 A;  1H7C A;  4IL4 A;  4HFE A;  3L09 A;  4CXW A;  1IBL T;  2CRB A;  2XPK A;  3UUL A;  1MMA A;  2DI4 A;  2VAS A;  5LG4 A;  3CK6 A;  4O8S A;  1X79 A;  2IC9 A;  2UUC T;  4DUY T;  1I6Z A;  2KND A;  3UQ7 A;  3M65 A;  1I94 T;  3I9Y A;  3AE5 A;  5M4Y A;  1HX8 A;  2K24 A;  2W66 A;  4ZI3 C;  3RRW A;  2K9A A;  5CB4 E;  3FXD B;  4DR2 T;  3C64 A;  1S35 A;  3IA3 A;  2H3R A;  1D0Y A;  2KWI B;  1Y01 A;  4DND A;  5L47 A;  1FIO A;  3GA8 A;  1LVF A;  2QYW A;  2H7O A;  3UQ4 A;  3P4R A;  2DWK A;  2IC6 A;  3LDQ B;  4WBO A;  2UUB T;  4YTM A;  5IHY A;  2JJ9 A;  1XMQ T;  2NW7 A;  3N9L A;  2KIN B;  3UUB A;  2LRL A;  3CIR A;  2NW9 A;  3UT5 E;  2HPJ A;  2YOE A;  5CFB A;  5LBQ B;  3ZYL A;  3CX6 B;  4X20 E;  4HE8 A;  2BVM A;  5TAO A;  3FBZ A;  2WBL A;  2EHO D;  4Z91 A;  4HFH A;  3AE6 A;  2YDR A;  1J5W A;  2V7L A;  3PUW F;  3ABV A;  3HKB E;  5LMN T;  2QRX A;  3RIU A;  3HR0 A;  3SFE A;  2W00 A;  4ANJ A;  2CXF A;  3OTO T;  2VVS A;  2LOS A;  4OHF A;  2MTQ A;  4IGU A;  4LF5 T;  4L0R A;  2CM0 A;  4IE6 A;  3HA4 A;  3MJX A;  2CWY A;  2KMF A;  5FVL A;  2FBW A;  5HEJ A;  1VCT A;  2UUA T;  2WDV A;  3MZK B;  4DV5 T;  4X1K E;  4PFP A;  3CML A;  2EHO C;  4ASK A;  5CA1 E;  2HN2 A;  5CGM A;  5DJQ C;  3UFG A;  3C4W A;  3ZKR A;  2XM1 A;  3QOF A;  3AXJ B;  3B13 A;  1BR2 A;  1R8I A;  5GON E;  5FXZ A;  3KBU A;  2RP4 A;  1CUN A;  5C8Y E;  3VR8 A;  1OXZ A;  4P0B A;  3W15 B;  2X0H A;  2V5D A;  1EZ3 A;  2BKN A;  3RC8 A;  4IE5 A;  4DV1 T;  1SUM B;  4H63 V;  1SE7 A;  5F5W A;  3AEA A;  3JCF A;  2IML A;  1E2A A;  4QXC B;  4DR3 T;  4JI1 T;  3ZCJ A;  2CLY C;  2ZLY A;  4A56 A;  4G2A A;  3O1H A;  3PE0 A;  3P4P A;  4GIW A;  4GK5 E;  3EUH A;  2UU9 T;  1HR0 T;  4X65 T;  2MYS A;  3UU3 A;  1WRD A;  5FY7 A;  2VWA A;  4IE4 A;  4P0A A;  3FZK B;  5LGU B;  3GN5 B;  5L3B B;  3LSV A;  3AA6 B;  4ZI2 C;  4JI6 T;  5LYJ E;  4MLK A;  3EVY A;  3AXJ A;  4X1Y E;  2V1D B;  4NUU A;  1ZV4 X;  3SRZ A;  1D1A A;  4UXN B;  2XQ8 A;  3P4Q A;  4HEA A;  4CQI A;  4DID B;  3K3N A;  4TUY E;  2WS3 A;  5LXT E;  4ZI7 E;  3UUM A;  2PG8 A;  5LBM A;  4U72 A;  4TWH A;  3H3A A;  1VOM A;  4BA9 A;  5LA6 E;  1N34 T;  4H9N C;  2W2U A;  3AEC A;  3CWZ B;  1YKH B;  3AE3 A;  2XTL A;  3JAE A;  5AQN B;  4YSY A;  1IZN B;  4GOU A;  3ZMU B;  4HWI B;  2XQ4 A;  2LSY A;  3RH3 A;  5JRC B;  3AAI A;  2VKJ A;  3GN5 A;  3PUY F;  4J2C A;  4UEL A;  2JQK A;  5C2T A;  4DV4 T;  4YLH A;  4X5T A;  5HYA A;  2FUP A;  3HKE E;  4COF A;  4QX7 B;  4UF0 B;  3P4S A;  4ZOL E;  2BKP A;  2MBG A;  2WU5 A;  2UXX B;  1WR6 A;  3KFW X;  3T8O A;  5ABG A;  4PJL A;  4CN4 A;  3L3P A;  3A5X A;  5FY1 A;  2ACZ A;  3ANW B;  3PUX F;  4Z8X A;  2WZH A;  3RLF F;  3KVA A;  4I50 E;  2IDO B;  2WY2 A;  4HFC A;  2YU1 A;  1FJG T;  2I0M A;  2XJ7 A;  3QK6 A;  3ZLI A;  2E8I A;  3ZCI A;  3PUZ F;  1OED C;  2J47 A;  4U31 A;  2VVN A;  4CZZ B;  3HL6 A;  5H6R B;  1HF8 A;  1KFY A;  2VKO A;  5HCM A;  3AE7 A;  2W62 A;  2BKO A;  4MAL A;  5HXR A;  1ZOY A;  4KMC A;  4I4T E;  3BQL A;  2D0U A;  4UVA B;  3IHR A;  4GYS A;  2MOZ A;  1E7P A;  3C98 B;  4ILU A;  3LK2 B;  1BR1 A;  2X9W A;  3UU4 A;  5JTG A;  3VRB A;  2UXC T;  2LM9 A;  4MBQ A;  1OED E;  2IHR 1;  2LRK A;  3UTK A;  3NVO A;  5AQI B;  3LK3 B;  3CVR A;  3BQK A;  3ANW A;  3CX8 B;  1G73 A;  2XM2 A;  1XWM A;  4QKN A;  3I0Q A;  2XQ7 A;  5L3F B;  1YQ4 A;  5FXW A;  3MA9 A;  5AQO B;  3GWH A;  4IIJ E;  2NOX A;  3RPU A;  5LGT B;  5ABF A;  2YK0 A;  5HEO A;  2K48 A;  5LCY A;  2D5U A;  2CEA A;  5C3J A;  1SA0 E;  5AQS B;  1WFD A;  2DCF A;  4KP3 C;  4YTN A;  2D2S A;  3ZC0 A;  3UU8 A;  2J1D G;  3RGL A;  4UIG A;  5AQR B;  3SS1 A;  2E5V A;  1YKE B;  3OPC A;  4CI3 B;  4DR1 T;  4DV3 T;  4L5G A;  3EDU A;  1ZKE A;  4GKJ T;  3ZYM A;  2BG9 C;  3ETU A;  2WM9 A;  2BDE A;  3FZL B;  4HGA A;  3X1D A;  2C5I T;  2WWV A;  2OV9 A;  4H9P C;  3JAD A;  2EHO B;  2HN1 A;  2X68 A;  2JQ9 A;  3PUS A;  1UCU A;  2CBI A;  1B7T A;  4LML A;  1W9R A;  4GYR A;  2NTX A;  4ZZB A;  5LB7 B;  2LKH A;  4MHC A;  4AQY T;  2ZM8 A;  4GK0 E;  3RKG A;  1MND A;  2BG9 E;  4HWH A;  4PNI A;  3ZST A;  2C5J A;  4IDO A;  4ZI3 D;  1JNZ A;  1VRB A;  2KWH A;  4IHJ E;  4IDN A;  4LMJ A;  3RIF A;  3RI5 A;  2HH7 A;  3KV9 A;  4WZX A;  5AFU L;  1T7S A;  2FJA A;  3MK7 C;  2IIU A;  3R84 B;  1N36 T;  5BMV E;  4AKH A;  3EI0 A;  5ETW A;  5JQG E;  2CWO A;  3OKQ A;  4UV8 B;  2XY8 B;  2CLY B;  4LF4 T;  4EYY R;  3CQX C;  1MIY A;  4U74 A;  2UXB T;  4KHZ F;  1J5E T;  2WWU A;  2W61 A;  2N1G A;  3N9N A;  3RC3 A;  2EHO A;  3NZP A;  2X67 A;  2BVL A;  4BJN A;  3PUV F;  2YEV C;  4IL9 A;  2VL0 A;  3HI2 A;  1Y64 B;  4OK0 A;  2BBJ A;  3E0Z A;  5HEU A;  4QH4 A;  3RYC E;  4X1I E;  3NKZ A;  5DQW A;  4LF7 T;  2LE8 A;  3EHZ A;  5AQL B;  3PJA J;  4O4H E;  4IRE A;  2X0L B;  4QXB B;  3O9X A;  4XAX B;  2VKD A;  5LHH B;  4TV9 E;  3NWI A;  1NEN A;  5JR9 C;  3BQI A;  3J9X 1;  2QVA A;  1HNZ T;  4H9R C;  2XAF B;  1T8B A;  5J1G A;  5LGN B;  4F8H A;  1HNW T;  3VU7 H;  2E2A A;  4IE7 A;  4LF8 T;  2ODU A;  4AKL A;  4JEH B;  1UK5 A;  3Q9D A;  4TWF A;  5HXS A;  2V7M A;  3CQG B;  3BK9 A;  3FHN A;  2LKG A;  2YN6 A;  4YXD A;  2DNX A;  3P7I A;  3EAB A;  4JYA T;  1YQ3 A;  1E1H B;  1N32 T;  4AKG A;  5F8P A;  2W0G A;  2LHR A;  4TN7 B;  3AVR A;  3RQU A;  3ONJ A;  3VKG A;  4CN1 A;  5J2U E;  4QH5 A;  5HAX A;  4ILC A;  4FJO A;  4YSX A;  4DR4 T;  1UUS A;  4DMV A;  5ABH A;  2YDS A;  3RYI E;  5EK4 A;  1OED B;  2V6X A;  2D0T A;  5JDF A;  4AI6 A;  4ZI2 D;  3FBL A;  5DAB A;  3G06 A;  3Q5X A;  2DHR A;  4DO0 A;  2WZI A;  4ISS A;  1WYC A;  2DL1 A;  5F3J A;  5J0Z A;  4EXT A;  2ACX A;  3ZYK A;  2ZM2 A;  3KIN B;  1GQE A;  2NR4 A;  3PUQ A;  2H89 A;  1YD8 G;  4TV8 E;  2BZB A;  4YTP A;  3PJA A;  1W09 A;  2E9X C;  4JI7 T;  1T72 A;  4CN6 A;  2VQF T;  4DV6 T;  4A5X A;  4TWD A;  3LG7 A;  3WI3 A;  5AQU B;  5E0O A;  1Z8U A;  3LFM A;  5FL1 A;  4U7I A;  1D1C A;  3V5S A;  2ODV A;  4XZC A;  3E08 A;  4E7Z A;  3NZQ A;  2L9Q A;  3HKD E;  5HXH A;  1OED A;  3IF8 B;  2XUE A;  2QA7 A;  3GMI A;  2BBH A;  2MPK A;  2H7V C;  4YJ2 E;  4ZZC A;  3TLV A;  5LJM A;  4ADZ A;  1QLB A;  5HWX A;  4EZ4 A;  1J1J A;  3TKL B;  3AE4 A;  1HNX T;  3RRC A;  4N78 D;  4JBW F;  4HFV A;  2XSA A;  3C4Z A;  4EOZ B;  4AIU A;  2BG9 B;  3V5U A;  3D0T A;  5LJN A;  1NAF A;  3I1A A;  3ZEF B;  2ES0 A;  3H37 A;  5AQK B;  3ZC1 A;  5AQP B;  2MAW A;  2WMN A;  4EGW A;  3N5L A;  2V26 A;  2YKS A;  2K3W A;  2CMR A;  4AQF C;  3KV6 A;  3O4X E;  1MIW A;  1KNZ A;  3OBV E;  4DV7 T;  3OVU A;  2YDQ A;  3NRX A;  2LSI A;  1D1B A;  5KDM C;  4PK5 A;  4F6R C;  4PK6 A;  4ZXL A;  2PFV A;  4ZS2 A;  4JI4 T;  2WB5 A;  2RA1 A;  2VL8 A;  5AQF B;  5FNV E;  2FJE A;  2V8S V;  2KXP B;  4O4I E;  3KV5 A;  3N2O A;  3LJC A;  4AXP A;  4JI2 T;  4OX9 T;  2LM2 A;  4EED A;  2XQ9 A;  4A97 A;  1LRZ A;  2C0S A;  3AEF A;  3WAK A;  5A1L A;  2BG9 A;  2NTY A;  2R6G F;  5FP3 A;  2XQ5 A;  2LSG A;  5FVK A;  2WP9 A;  2BS2 A;  4DBQ A;  5JDN A;  5JDH A;  1OWA A;  5JDG A;  2ZM0 A;  5JH7 E;  4LF9 T;  5L4H A;  5JRC A;  4DV2 T;  2K5B B;  5FKY A;  2Y6X A;  5FY0 A;  3IBP A;  4Z90 A;  4KHP T;  2JRK A;  3TLS A;  3AE1 A;  3O1J A;  4UF0 A;  4PJM A;  3RQW A;  2UXD T;  1KEY A;  2M6I A;  3PUG A;  5IWA T;  2A9U A;  3Q5E A;  2LLY A;  1Z0P A;  5HCJ A;  4LFA T;  3P50 A;  3PUA A;  4AQG A;  3RF1 A;  2HHH T;  4CXY A;  1KNR A;  5JR9 B;  3I0O A;  3AVS A;  3P8C D;  4LF6 T;  4U2Z A;  4QXH B;  1ZP0 A;  2DWG A;  5LNK A;  3M3Z B;  3FXE B;  3OYX A;  4L9I A;  3VHL A;  3K3Q C;  3I9W A;  2NW8 A;  2NWB A;  3OJA A;  1VCS A;  1WYB A;  5LOV E;  4DV0 T;  4P09 A;  4NIQ A;  4O2B E;  3B57 A;  4PW8 A;  1L0V A;  3KVB A;  1HTJ F;  4A98 A;  3N9P A;  3EDV A;  4UVC B;  3DTO A;  3CKD A;  4IDP A;  2XQ3 A;  1XZY A;  4YY3 T;  3AEE A;  3FZF B;  2M6B A;  1CHU A;  2UXN B;  3R6N A;  5LP6 E;  4DR6 T;  4EZH A;  3AE9 A;  1FMV A;  4BAY B;  4PFO A;  2VQE T;  4CXX A;  2WCA A;  2N9D A;  4DR5 T;  3OYZ A;  2A2F X;  5JR9 A;  3FB2 A;  2XAH B;  3UFE A;  4X66 T;  3IEE A;  4U33 A;  3JC6 D;  4B3T T;  3TLW A;  2Q9Q D;  2CXD A;  5ABE A;  3AA7 B;  4K0U A;  2WMO A;  3ZT7 A;  3VR9 A;  1LKX A;  4TNV A;  2PBI A;  5EK3 A;  2W67 A;  3TLU A;  4B3S T; 
#chains in the Genus database with same CATH homology
 3Q9D A;  2C5K T;  4MFR A;  3EVY A;  5HXS A;  3PTR B;  2VB6 A;  2ZMA A;  2V7M A;  3CQG B;  4X1Y E;  1SHZ C;  4JLE A;  3BK9 A;  3FHN A;  4NUV A;  2V1D B;  4NUU A;  2M67 A;  1ZV4 X;  2V7I A;  3SRZ A;  2DNX A;  1D1A A;  3CX7 B;  3RYF E;  4UXN B;  3P7I A;  4ERR A;  5L3G B;  2VKH A;  3VKH A;  4ZS3 A;  3J7Y q;  1E1H B;  3QUJ A;  4HEA A;  4V1A v;  4CQI A;  4AKG A;  4WNK A;  3K3N A;  4H9Q C;  2E9X B;  3K3O A;  3PU8 A;  4TUY E;  5F8P A;  1MMG A;  2LHR A;  2W0G A;  3NRY A;  4TN7 B;  1US7 B;  3ONX A;  4DBR A;  1D0X A;  5LXT E;  4ZI7 E;  3AVR A;  2G0U A;  3UUX B;  3UUM A;  2I59 A;  3LBX A;  1G8X A;  2X9Y A;  2PG8 A;  4YHJ A;  5LBM A;  2L8K A;  3VKG A;  4U72 A;  3N9Q A;  4I55 E;  3H3A A;  2XAQ B;  1VOM A;  3JC6 C;  4BA9 A;  5J2U E;  2HPL A;  5LA6 E;  2Q9Q C;  5HAX A;  3ZMZ B;  4FJO A;  4H9N C;  4UEM A;  2Q9Q A;  2N2N A;  1U4Q A;  5DQV A;  3ETV A;  3CWZ B;  3U3I A;  1YKH B;  2SPC A;  2XTL A;  4HKA A;  3PDY A;  4DMV A;  5ADX L;  4OYJ A;  3U78 A;  5FMN A;  3CPZ A;  1BR4 A;  3RYI E;  5EK4 A;  5L3D B;  1IZN B;  4GOU A;  1MMD A;  5HXE A;  3ZMU B;  4KUM B;  2D0T A;  2JQQ A;  2LSY A;  3RH3 A;  5FYM A;  5JDF A;  5JRC B;  4AI6 A;  2WSS V;  3AAI A;  2VKJ A;  5JDQ A;  3GN5 A;  4J2C A;  4ZI2 D;  2CCQ A;  3FBL A;  4UEL A;  5DAB A;  3N2K E;  3Q5X A;  3MKD A;  2DHR A;  4DO0 A;  4ISS A;  4C91 A;  1WYC A;  5F3J A;  5L3E B;  4YLH A;  2LSJ A;  4EXT A;  3AAE B;  2ACX A;  5HYA A;  3ZYK A;  3N9O A;  2A3D A;  4EIW A;  2ZM2 A;  3HKE E;  3KIN B;  4QX7 B;  4UF0 B;  2X51 A;  4TZ4 C;  2KLQ A;  3PUQ A;  4ZOL E;  2MBG A;  4ZHQ E;  3Q5W A;  1YD8 G;  4TV8 E;  2BZB A;  1BR0 A;  2A72 A;  2UXX B;  4EAH A;  1FEW A;  1WR6 A;  3KFW X;  3T8O A;  4HN9 A;  4UV9 B;  2E9X C;  4PJL A;  3ZMV B;  2LOP A;  3ZJ2 A;  4YFS A;  4EB6 E;  4WBN E;  2E9X A;  3L3P A;  5LHI B;  3A5X A;  5FY1 A;  5JDL A;  3ANW B;  2IAK A;  2GK9 A;  5HWY A;  3LG7 A;  3LK4 2;  5EZY E;  2V7J A;  4Z8X A;  2LJL A;  3C51 A;  4H63 H;  3ZMT B;  1KK7 A;  3WI3 A;  4B6X A;  5E0O A;  3E22 E;  5IYZ E;  3N2G E;  4M1P A;  3C4X A;  3LFM A;  1S94 A;  1FMW A;  5JRE A;  3KVA A;  4I50 E;  5FXX A;  4DVD A;  2XAJ B;  2CXL A;  4O2A E;  1D1C A;  4E7S A;  4JEU B;  2YU1 A;  3V5S A;  4QHO A;  5LHG B;  3QK6 A;  3ZLI A;  1LVK A;  2E8I A;  2X66 A;  2XAS B;  3ZCI A;  2ODV A;  3MXZ A;  4XZC A;  3E08 A;  1IAP A;  3NZQ A;  4CZZ B;  3HL6 A;  4OFZ A;  4E7Z A;  5EK2 A;  2L9Q A;  4CI1 B;  3HKD E;  5H6R B;  1HF8 A;  2VKO A;  5HXH A;  3DJB A;  3PU3 A;  3IF8 B;  2Y48 B;  2XUE A;  2VK9 A;  2IW5 B;  2QA7 A;  2Y8D A;  2W62 A;  3K8P C;  4O4L E;  2LSK A;  3GMI A;  3WAJ A;  4PJJ A;  4MAL A;  5HXR A;  2H7V C;  3Q2M A;  3AAA B;  3SOL A;  1AJ3 A;  2PJQ A;  4KMC A;  4YJ2 E;  3C50 A;  3AA1 B;  4I4T E;  3MAC A;  1ZHC A;  3BQL A;  2OA5 A;  2D0U A;  4BJM A;  4UVA B;  3IHR A;  3F57 A;  5LJM A;  4ADZ A;  5HWX A;  4GYS A;  4EZ4 A;  2MOZ A;  3TKL B;  3ZN1 B;  1HFA A;  4H9S E;  3C98 B;  3RRC A;  4ILU A;  4N78 D;  5HXC A;  3LK2 B;  1BR1 A;  4HFV A;  2X9W A;  2JMH A;  3C4Z A;  1WLX A;  3F31 A;  3DP7 A;  2LM9 A;  2YU2 A;  4MBQ A;  4EOZ B;  1H7C A;  4PJN A;  3N9M A;  3V5U A;  2E9X D;  3D0T A;  3L09 A;  4CXW A;  3ZN0 B;  5LJN A;  3KDS E;  1NAF A;  3I1A A;  3UTK A;  3ZEF B;  2ES0 A;  3ESL A;  4FI5 A;  4AKI A;  3H37 A;  3ZC1 A;  5J2T E;  3LK3 B;  3RX6 A;  3UUL A;  3CVR A;  1MMA A;  2DI4 A;  3BQK A;  1HCI A;  2WMN A;  3ANW A;  2VAS A;  3N5L A;  2V26 A;  3UUN A;  5LG4 A;  3CX8 B;  1G73 A;  2CMR A;  4AQF C;  4O8S A;  3KV6 A;  4QKN A;  3I0Q A;  1X79 A;  2IC9 A;  1MIV A;  3O4X E;  5L3F B;  2KND A;  1MIW A;  4AQF A;  1KNZ A;  3OBV E;  5FXW A;  3MA9 A;  3GWH A;  4IIJ E;  4PK4 A;  3M65 A;  2JMK A;  2NOX A;  3RPU A;  4EYU A;  5LGT B;  4OYK A;  5KX5 E;  2YK0 A;  3NRX A;  2LSI A;  2K48 A;  3I9Y A;  1D1B A;  5LCY A;  4H9O C;  2D5U A;  2CEA A;  3HKC E;  5M4Y A;  1HX8 A;  5KDM C;  2K24 A;  5FXV A;  2DLR A;  2B1E A;  1SA0 E;  4ZI3 C;  3RRW A;  4PK5 A;  2DCF A;  4KP3 C;  4F6R C;  2K9A A;  5CB4 E;  3FXD B;  3C64 A;  1S35 A;  2D2S A;  1QSD A;  2PFV A;  4PK6 A;  3ZC0 A;  4ZS2 A;  2H3R A;  2J1D G;  1D0Y A;  2KWI B;  4DND A;  4UIG A;  2RA1 A;  2VL8 A;  5FNV E;  3SS1 A;  2KT9 A;  1FIO A;  2KXP B;  3GA8 A;  4O4I E;  3KV5 A;  1LVF A;  1YKE B;  4CI3 B;  2H7O A;  1IJ6 A;  3N2O A;  3LJC A;  4AXP A;  4L5G A;  3EDU A;  1HG2 A;  1ZKE A;  2DWK A;  2LT3 A;  2IC6 A;  1YW0 A;  4WBO A;  1LRZ A;  2KZ7 B;  3ZYM A;  1T98 A;  2C0S A;  3AB3 B;  3WAK A;  5A1L A;  1IJ5 A;  5IHY A;  2LEH A;  3ETU A;  2JJ9 A;  2WM9 A;  4YJ3 E;  2BDE A;  2NTY A;  2NW7 A;  2Z6E A;  5FP3 A;  4HGA A;  1HG5 A;  3RKO A;  2C5I T;  3N9L A;  1U5P A;  2KIN B;  4JUY A;  2LSG A;  4H9P C;  2NW9 A;  3UT5 E;  2EHO B;  2X68 A;  2HPJ A;  3PUS A;  5LBQ B;  3ZYL A;  3F2E A;  1UCU A;  4DBQ A;  2XQY A;  3CX6 B;  1B7T A;  4GYR A;  4X20 E;  5JDN A;  4HE8 A;  5JDH A;  1OWA A;  5JDG A;  2BVM A;  2ZM0 A;  4PAG A;  2NTX A;  5TAO A;  3FBZ A;  5JH7 E;  2WBL A;  2EHO D;  1HS7 A;  5JRC A;  3KV4 A;  4MHC A;  3ZJ1 A;  2V7L A;  2ZM8 A;  4GK0 E;  4O4J E;  2K5B B;  1MND A;  2X9X A;  5CA0 E;  2Y6X A;  4PNI A;  5FY0 A;  3IBP A;  3HKB E;  2NP9 A;  3HR0 A;  2CE7 A;  2C5J A;  2WAU A;  4ZI3 D;  4DMW A;  2JRK A;  2W00 A;  4ANJ A;  2CXF A;  3PUR A;  5H6Q B;  1VRB A;  2KWH A;  3O1J A;  4IHJ E;  4UF0 A;  2LOS A;  2XHE B;  1NWM X;  4PJM A;  4CI2 B;  4OHF A;  2MTQ A;  2HH7 A;  4IGU A;  4QWN B;  4L0R A;  3S4U A;  2CM0 A;  4AKR B;  3KV9 A;  4IE6 A;  3PUG A;  5AFU L;  3HA4 A;  3MK7 C;  3MJX A;  2CWY A;  3R84 B;  1Z0P A;  4IDZ A;  4I43 B;  3SWH A;  5BMV E;  4AKH A;  2KMF A;  3PUA A;  5ETW A;  4AQG A;  5JQG E;  2CWO A;  3CQC B;  3RYH E;  1QUU A;  3OKQ A;  4CXY A;  3QC9 A;  2P9B A;  4QX8 B;  4UV8 B;  2CA5 A;  3I0O A;  3AVS A;  5JR9 B;  2CLY B;  3MZK B;  2X9H A;  5KMG P;  4EYY R;  3CQX C;  3P8C D;  1MIY A;  3KBT A;  4U74 A;  4PFP A;  4X1K E;  4QXH B;  3CML A;  5JDM A;  2DWG A;  2WWU A;  2W61 A;  2N1G A;  1O3X A;  5LNK A;  3N9N A;  2EHO C;  3RC3 A;  4ASK A;  5CA1 E;  3FXE B;  3OYX A;  3ZMS B;  4L9I A;  5DJQ C;  1V9D A;  2EHO A;  3C4W A;  4IST A;  2YIN A;  2X67 A;  3NZP A;  3VHL A;  2BVL A;  3K3Q C;  3I9W A;  4BJN A;  2NW8 A;  2NWB A;  3OJA A;  2V7K A;  1MMN A;  2YEV C;  4KBM B;  2XAG B;  3B13 A;  4G63 A;  1WYB A;  5LOV E;  4P09 A;  3HI2 A;  1Y64 B;  1BR2 A;  4OK0 A;  4O2B E;  3B57 A;  3E0Z A;  4PW8 A;  5GON E;  5FXZ A;  3KVB A;  1HTJ F;  3RYC E;  3KBU A;  4IE0 A;  2RP4 A;  4X1I E;  1CUN A;  5DQW A;  5C8Y E;  2LE8 A;  1D0Z A;  2QGS A;  2L3L A;  1OXZ A;  4P0B A;  3W15 B;  5JVD E;  3N9P A;  3EDV A;  4UVC B;  3DTO A;  3CKD A;  4O4H E;  1EZ3 A;  2X0L B;  3RC8 A;  4QXB B;  2W63 A;  2UXN B;  4IE5 A;  3R6N A;  3O9X A;  4H63 V;  5LP6 E;  2LHN A;  4XAX B;  3LBX B;  4UVB B;  4EZH A;  2JPF A;  2VKD A;  1FMV A;  5LHH B;  5L2L A;  4TV9 E;  4BAY B;  3O1I A;  1ZEE A;  4PFO A;  4QXC B;  4TX5 A;  4CXX A;  4C90 A;  3ZCJ A;  2N9D A;  5JR9 C;  2Q9Q B;  2CLY C;  3BQI A;  1MNE A;  2ZLY A;  4A56 A;  3OYZ A;  2A2F X;  3J9X 1;  5JR9 A;  3FB2 A;  4G2A A;  2XAH B;  3O1H A;  3UFE A;  3PE0 A;  4H9R C;  3IEE A;  3ZPO A;  5L3C B;  2XAF B;  4GIW A;  3NBX X;  4GK5 E;  3AA0 B;  5J1G A;  3EUH A;  3JC6 D;  5LGN B;  2Q9Q D;  2CXD A;  2MYS A;  1WRD A;  5FY7 A;  2VWA A;  4IE4 A;  3VU7 H;  3AA7 B;  4K0U A;  4P0A A;  2WMO A;  4IE7 A;  5LGU B;  4XBF B;  1UX4 A;  1LKX A;  3GN5 B;  5L3B B;  2PBI A;  5EK3 A;  3AA6 B;  4ZI2 C;  5LYJ E;  2ODU A;  4AKL A;  4HTE A;  4JEH B;  4WW0 A;  4MLK A;  1UX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...