4TX5A

Crystal structure of smac-diablo (in space group p65)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
SEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLREDLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The activator of apoptosis Smac-DIABLO acts as a tetramer in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Diablo homolog, mitochondrial
total genus 90
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tx5A00
2XHEB 3C98B 4JEUB 5LG4A 4JEHB 1FIOA 1G73A 1FEWA 5M4YA 1EZ3A 1BR0A 4TX5A 1HS7A 2DNXA 1S94A 3LG7A
chains in the Genus database with same CATH superfamily
4OFZA 3NBXX 5LJMA 4LF6T 3RKOA 1N32T 2DLRA 3UU4A 3AAAB 3N5LA 5JREA 3CKDA 3L39A 2WM9A 3ZKRA 2BG9C 2YN6A 4LF4T 1U5PA 4YXDA 4LF5T 3SOLA 4ERRA 5L3FB 2DWKA 3UU6A 1QSDA 2PJQA 5CB4E 2WWVA 2H88A 1VCTA 2F4VT 4EZHA 1WR0A 4UR9A 4DV6T 3PUWF 2XAJB 4MFRA 2C0SA 2CLYC 2E9XD 5LCYA 1SHZC 3U78A 2XZEA 4C90A 2W0GA 4X1IE 4QKNA 4DBRA 3JC6C 2D0UA 4IHJE 1HNZT 2UXNB 4PK5A 3UUMA 2MOZA 1KNPA 2ZMAA 4TUYE 3J9X1 1VRBA 2K5BB 4IL9A 4ASKA 3AE7A 5HXRA 2XM2A 4GOUA 2XAHB 4HFCA 4HFIA 4IDNA 3AE5A 3IF8B 3K8PC 3F57A 4H9NC 1D1BA 4IE5A 3JAEA 4IE7A 4ILCA 4MALA 4H9OC 3Q9DA 3AEFA 4LFCT 4EAHA 2HPLA 3KV5A 2M6BA 4IE0A 3L3PA 4O2AE 2QGSA 3LBXB 4TWFA 2E8IA 2Z6EA 4O4HE 4U33A 5FXWA 5FNVE 2WMOA 4H9RC 5HXCA 1M62A 4P09A 2H3RA 3PV0F 1G73A 4O4JE 5L4HA 4CZZB 2CA5A 3MJXA 1ZEEA 3FZKB 2XQ7A 1T72A 2DNXA 3QNUA 4IE4A 4UF0B 2XQ5A 3AEDA 5HWYA 3SS1A 4JI8T 1D1CA 2NP9A 3UU8A 4ZI2D 3TLWA 2L9QA 5J1GA 3ZMTB 2IUBA 3TLTA 3EDUA 5EK4A 3AAIA 3ANWB 3RIUA 5EK2A 2XUEA 2H7OA 4AKIA 3AE1A 3KDSE 4U31A 1QUUA 3S4UA 3JCFA 4AKLA 1YW0A 2WU2A 2EHOC 4MLKA 3KINB 2CXFA 2JRKA 1HX8A 4IDPA 4DR1T 4ZOLE 3O1HA 3BQIA 2A72A 1N36T 5JRCA 4AQFC 3CPZA 1ZV4X 5ABGA 1D0ZA 2CEAA 3H3AA 3IHRA 3CX6B 3OKQA 5JH7E 3MACA 3CIRA 4U2YA 5FY1A 3RRCA 1BR0A 5J0ZA 3EDVA 2WSSV 2FBWA 3ZJ1A 2FUPA 1LVFA 5JR9B 2KXPB 4H9SE 3RC3A 4U3CA 3V5SA 1XNQT 4AKRB 3A7MA 4GIWA 4IREA 3AE9A 4ILBA 5HAXA 1HG5A 1E1HB 4ILAA 2FJEA 4ZHQE 1YKEB 2NWBA 2UXXB 5FL1A 4NUVA 2LOSA 5DABA 2XQAA 1D0XA 3QK6A 3GN5A 4AISA 3CX8B 1IBLT 2CHOA 4L5GA 4DV2T 1IBMT 2DWGA 2LRKA 2BG9A 4ZZCA 2W67A 3UQ4A 2BKOA 2HN1A 5LBMA 3ZN1B 1OWAA 5ADXL 2KSRA 3FZHB 2WDRA 4I0UA 5HXHA 3T1YT 2V7MA 4DUYT 3MA9A 3ETVA 2KLQA 3HKEE 4HTEA 5M4YA 4QH4A 5JQGE 4MBQA 3RYFE 2UXDT 1J5ET 2Y48B 1WFDA 1MNDA 2J4GA 4GKJT 5JDLA 2D5UA 3C98B 4UEMA 1IZNB 2JPFA 4P0BA 4BJNA 1ZKEA 4DBQA 2CXDA 1US7B 4AXPA 3N9PA 5HWXA 3C4WA 4COFA 3ETUA 3P4WA 4KHZF 1LRZA 2BKNA 2IHR1 2LSIA 5F5WA 2ZM6T 1W0AA 2Q9QA 3OTOT 2E9XA 3NWIA 3JC6D 1MIWA 3A8YC 4ZZBA 1EZ3A 3HA4A 1OEDB 1ZHCA 3AE2A 3IEEA 5AQTB 3VRBA 4P0AA 3B5MA 1ZOYA 4CXXA 4E7ZA 4YY3T 5JR9C 4U2ZA 3VKGA 2XQ8A 1Y64B 2V26A 4U7IA 3UUXB 3ZSTA 4LF7T 4UVCB 3WI3A 5FVLA 3Q5WA 4YSYA 2XM1A 2E5VA 4KP3C 4ADZA 4DNDA 2VL8A 3OYXA 3DTOA 4HFEA 4QX7B 1J5WA 2VWAA 1XDOA 3LK2B 4QHOA 5FMNA 2VB6A 3A5XA 3ONXA 3X1DA 1FMWA 3QB5K 2GK9A 5LNKA 2X51A 3PUGA 4JI4T 2XSAA 2NW8A 3DP7A 1JNRA 4CI2B 4EV6A 1YQ3A 5FL0A 5KXJA 4DV1T 3C4XA 2D0TA 5J2TE 5JTGA 5H6RB 3I9WA 2WCAA 5HCJA 4EB6E 3P4PA 4YSZA 2UUAT 4AKHA 4ISSA 3UUBA 3C50A 5AQIB 5ETWA 2LEHA 3LK3B 5FY0A 3EI0A 3CK6A 4HFDA 5JDFA 1E2AA 2BG9B 2CWYA 2WBLA 4B6XA 1HS7A 2LSJA 1YD8G 3VR9A 2B76A 3HKCE 3SWHA 4B3RT 1KNZA 2YDSA 2XASB 3TLVA 2YKSA 3HKBE 4N78D 3O1JA 3RGLA 2X66A 4M1PA 1MMDA 3ZN0B 3ZT6A 2EHOA 2V5CA 2IDOB 3AA6B 3EAMA 3QC9A 4GYRA 5TAOA 3UFEA 2CCQA 4QH1A 2G0UA 4ZI3D 3MXZA 5DQWA 4OHFA 3PE0A 5IYZE 4ZS3A 3VU7H 3I0OA 3P4QA 1W9RA 3UTKA 1HNWT 2RP4A 3QUJA 4QXHB 2M6IA 4IDQA 4PFOA 3TLSA 3ANWA 3GMIA 3H37A 2JJ9A 2W63A 4YT0A 3FXDB 5ABFA 3KBUA 4B3TT 2V1DB 3MK7C 4K0UA 4A97A 4JV5T 1HNXT 4H9QC 4YJ2E 5L2LA 3RC8A 5E0OA 2KWHA 2ODUA 3ZYLA 4BA9A 2CM0A 1NAFA 5JDHA 4IE6A 4F8HA 1XMQT 1I6ZA 4KMCA 3AXJB 5CA1E 3F2EA 3C4ZA 2V7KA 4FI5A 2WZIA 4I4TE 4U74A 3UULA 1OEDA 2C5JA 3AE4A 3FZFB 4YHHT 2DCFA 2EHOD 1WRDA 1FIOA 3GA8A 1HCIA 4LMJA 4X20E 4TX5A 4V1Av 4JI5T 3FB2A 4EYYR 3OBVE 2Q9QB 1S94A 2CLYB 4NPPA 4PJLA 2HPJA 4CXWA 3KV4A 3ONLC 4LFBT 4TZ4C 1LKXA 2WDQA 2DI4A 2XQYA 1FEWA 3H3MA 3VKHA 2UXCT 2XQ4A 4O8SA 1WR6A 2LKHA 3KV6A 2VKHA 4YFSA 1WYBA 4OYJA 4NUUA 3AEAA 2W62A 3I9YA 3LDQB 4WYVA 4YHJA 2KINB 5L3DB 3PUVF 4X64T 2XAFB 3PUSA 1N34T 2HN2A 2N1GA 2Q9QD 2SPCA 1BR2A 2X68A 1YQ4A 2WB5A 1MNEA 1FMVA 2ZLYA 3K3OA 4PW8A 4Q25A 3U3IA 3JAFA 4E7SA 2XPKA 5AQLB 1WYCA 4YLHA 4EZ4A 3ZMSB 3GN5B 3OPCA 2PBIA 2IIUA 1ZP0A 2BBHA 3KVBA 3N2GE 5HEGA 2WZHA 2B1EA 3B13A 2K48A 4JI0T 1XDPA 3O4XE 4GKKT 5C8YE 1Z8UA 4HE8A 2FJDA 2IMLA 5BMVE 5JDNA 3IBPA 4I55E 2WS3A 1IBKT 2CE7A 2XY8B 4I50E 4DV7T 2W61A 3AB3B 3M65A 3ZMZB 4A5XA 4LF8T 4TNWA 2DHRA 2BG9E 2VKJA 2KZ7B 5LP6E 2BS4A 2V5DA 4L9IA 2XQ6A 2V6XA 5AQUB 2LE8A 3PU8A 4G2AA 2V6YA 4HEAA 2VL0A 2WDVA 1FJGT 1IJ6A 3NZQA 1U4QA 1MIVA 1SUMB 2XAGB 1HR0T 4JLEA 5AQVB 4K0KT 2VKDA 3G06A 2NR4A 4NIQA 5AQMB 3P50A 4PJNA 3FBZA 5A1LA 5FXZA 3PUZF 3O9XA 3ZC0A 5ABHA 3RYCE 1QLBA 3ZT7A 2XQ3A 3PTRB 3ZLIA 3C64A 2YDRA 4TN7B 1XZYA 5LG3A 4ZI3C 3FHNA 1W09A 2V6YB 4IGUA 1BR1A 1UK5A 2WU5A 3EHZA 4ANJA 3CQGB 4EIWA 5LMNT 4AIUA 2XJ7A 4CI3B 1O3XA 2PG8A 3RHWA 4EEBA 2KNDA 1X79A 4KUMB 3CX7B 3PUQA 4PK6A 5DQVA 4CN6A 4JUYA 4DR2T 4BJMA 4QXCB 3K3QC 4NXMT 2WY2A 3QOFA 3Q5EA 3T8OA 4YJ3E 2K3WA 5IWAT 3KFWX 5LYJE 2MTQA 3I0QA 4O4IE 1KNRA 4TV9E 1W0BA 2MAWA 2X9HA 4AQGA 4NXNT 2A9UA 2MBGA 4UXNB 1MMNA 5FVKA 3AEGA 4DIDB 4BAYB 3PUYF 3N9LA 5LBQB 2ACZA 4C91A 3PDYA 2LSKA 4TV8E 4IDOA 4DVDA 5HEOA 5J2UE 2UUBT 5FXXA 4LMLA 5EK3A 5L3BB 3EABA 1UX5A 1B7TA 1MIYA 1IJ5A 3MKDA 2ZM2A 4QXBB 3ZPOA 2A2FX 4AQYT 4MHCA 3RH3A 1I94T 5LHHB 2BS3A 4P1NA 4HWCA 2C5IT 4XBFB 2X0HA 4J2CA 4TWDA 5LXTE 1KFYA 5HXSA 4PK4A 2HHHT 1OEDC 3PJAA 4CI1B 3V5UA 2QVAA 2VQET 4HWFA 5CFBA 3QB5A 2YU1A 3PU3A 3T1HT 3PUXF 2VKOA 4Z91A 5BR8T 3HKDE 3D0TA 5IUXA 5JDQA 2Q9QC 4B3MT 3O1IA 5H6QB 1GQEA 3UFGA 2NW7A 1NWMX 5L47A 2H7VC 3NZPA 4GYSA 4OYKA 4DR7T 2BZBA 2K9AA 5GONE 3B57A 4UIGA 4WBNE 5FXVA 2V7IA 2E9XB 4X62T 3BQKA 4DR5T 2BDEA 2E5LT 4YTNA 2VK9A 3EVYA 1XWMA 3F31A 4XAXB 2AE9A 5LB7B 2W2UA 1CHUA 5JDMA 4AKGA 3OVUA 2JQHA 2I0MA 3PURA 2X0LB 5AQRB 3RQUA 1V9DA 4CN4A 3AECA 3RLFF 3RIUC 4PAGA 1JNZA 1YXRA 2JMHA 4YTMA 3I1AA 3LG7A 5CA0E 3WAJA 3P4SA 4JI1T 2ZM8A 4U7YA 1XNRT 4FJOA 4O2BE 3CQCB 1T8BA 4HFBA 4DV4T 4Z90A 2RA1A 5AQQB 5FP3A 2CMRA 3RX6A 1T98A 5CJ5A 3NRXA 4UVAB 1E7PA 3R6NA 5AQOB 5KMGP 5FYMA 3AVSA 2CRBA 5KX5E 4HGAA 4IT4A 5LHIB 1D1AA 2WQYA 5LGUB 2RPAA 2XTLA 3E08A 3IA3A 4IDZA 4JYAT 2CWOA 2NTXA 4Z8XA 1YKHB 3LFMA 3LK42 4H63H 3C51A 2IC9A 2LJLA 4HWIB 4OK0A 4UV8B 5F3JA 4X66T 2JMKA 2QYWA 2VURA 2YEVC 4UF0A 4JI6T 4DR4T 4AI6A 3AEBA 1OXZA 1J1JA 2YK0A 4HKAA 5F8PA 5C2TA 2LRLA 4KX6A 3N9MA 2X9WA 3NRYA 4DV3T 2L3LA 2W66A 4TNVA 3AAEB 4DMWA 2LHNA 3RRWA 3ZT5A 2ZM0A 3RYHE 3R84B 4EOZB 1AJ3A 2KT9A 4HFHA 3UU5A 3ZYMA 2OLTA 5KDMC 2YU2A 2V7LA 5IHYA 1HF8A 3BQLA 2PFVA 4ILUA 2H89A 1H7CA 1HFAA 3ESLA 2FJBA 3BK9A 3N9OA 2L8KA 2YOEA 4PNIA 5LGNB 5HEJA 5EZYE 3TLUA 4QX8B 1KK7A 3PJAJ 3ZC1A 1MMGA 2AXDS 3KVAA 3L09A 3LSVA 1KEYA 4UVBB 2X9XA 4X65T 3P4RA 3J7Yq 4JI2T 4PFPA 4JI7T 4DV5T 1XMOT 3N9NA 4GK5E 2MYSA 3CWZB 5AFUL 2UXBT 4PJMA 2XAQB 5JRCB 2E9XC 3AEEA 4JEUB 1CUNA 2X0YA 3ZSSA 4TWHA 4UV9B 2LSGA 2WAUA 2KWIB 3AE6A 4IIJE 5AQNB 4EEDA 4DV0T 3SRZA 2KMFA 3E22E 2XSBA 1N33T 1SE7A 4X1YE 3RIAA 3ZMVB 2V8SV 3AA7B 2BBJA 3E0ZA 2JQ9A 2LSYA 2VVSA 5DJQC 2V7JA 1UGOA 2ODVA 2W4XA 5HEHA 2FJAA 3AVRA 4H9PC 3FZLB 1MMAA 5L4EA 4YTPA 2ES0A 4DO0A 2WP9A 3MZKB 4JEHB 1VOMA 3PUAA 4U72A 4PJJA 5HCMA 2C5KT 4GK0E 2W00A 1L0VA 2JQKA 5CGMA 5JDGA 2BS2A 3OYZA 3L8RA 3Q5DA 2D2SA 4QWNB 4WW0A 2NTYA 2CBIA 2LM9A 3HR0A 3K3NA 3TKLB 2UU9T 1VCSA 4CN1A 3N9QA 3UQ7A 3SFEA 2P9BA 4O4LE 2HH7A 2LKGA 2D9DA 3ABVA 4G63A 5AQGB 4ZEYA 2NOXA 5FKYA 2N2NA 1WCRA 4B3ST 3N2OA 1M7KA 1HG2A 2Y8DA 4WNKA 4X1KE 2QA7A 3ZJ2A 2CPTA 1HX1B 5AQSB 2WMNA 2VASA 3FZMB 1HTJF 4ZXLA 3VR8A 5L3GB 3CQXC 4QH5A 4CXYA 2LHRA 4KBMB 1G8XA 2LT3A 3HL6A 5ABEA 4HFVA 1UURA 2VQFT 3CVRA 3SFDA 2IC6A 2IAKA 4DUZT 2I59A 2BVLA 2R6GF 5AQFB 5AQJB 3P7IA 5LMUT 4A98A 3RQWA 2J62A 2N9DA 2XQ9A 3RYIE 2VVNA 3LJCA 4LMKA 4EXTA 5L3EB 4ISTA 3KV9A 1UUSA 1LVKA 3GWHA 2EHOB 1UX4A 4HN9A 2XHEB 3FBLA 4F6RC 3LBXA 4EYUA 2Y6XA 4I43B 5FY7A 3N2KE 1D0YA 3M3ZB 5JVDE 4CQIA 1Y01A 2YDQA 4JBWF 5ABFB 2JIWA 1UCUA 2LM2A 3ONJA 5LHGB 5HYAA 3HI2A 4WBOA 2OV9A 2QRXA 1OEDE 1R8IA 2K24A 3W15B 3ZCIA 2M67A 4LFAT 2WWUA 5HEUA 3VRAA 2E2AA 2BVMA 3RPUA 3ZYKA 4IL4A 4ZI2C 4HWHA 1IAPA 2A3DA 2LLYA 2LOPA 4UELA 3Q5XA 3P8CD 1NENA 1SA0E 2J1DG 1DU2A 1Z0PA 5AQKB 4WZXA 2BKPA 2OA5A 3Q2MA 3ZCJA 4DMVA 4KHPT 5LA6E 4ZS2A 1S35A 2CBJA 3AXJA 4YSXA 3RKGA 4OX9T 1X9BA 2IW5B 2I6HA 2PTFA 4HWDA 4L0RA 5AQHB 3FXEB 2CXLA 5AQPB 2DL1A 3K1SA 2J47A 3RI5A 2JQQA 3ZMUB 4H63V 1T7SA 2ACXA 4X5TA 2YINA 1NEKA 2CHNA 5LGTB 4AQFA 2UUCT 5L3CB 3KBTA 3RIFA 3UT5E 3OJAA 3RF1A 3EUHA 5LOVE 4EGWA 4ZI7E 3UU3A 4XZCA 5C3JA 2NW9A 4A56A 4DR6T 4DR3T 3AA1B 3AA0B 4KI0F 3JADA 2MPKA 2X9YA 3VHLA 4JI3T 5LJNA 3NKZA 1KF6A 1WLXA 3AE3A 3DJBA 3UUNA 1BR4A 5HXEA 5LG4A 2X67A 5JR9A 3WAKA 3CMLA 3AE8A 3NVOA 3ZEFB 4LF9T
chains in the Genus database with same CATH topology
4OFZA 3NBXX 5LJMA 3RKOA 2DLRA 3AAAB 3N5LA 5JREA 3CKDA 2WM9A 1U5PA 3SOLA 4ERRA 5L3FB 2DWKA 1QSDA 2PJQA 5CB4E 4EZHA 2XAJB 4MFRA 2C0SA 2CLYC 2E9XD 5LCYA 1SHZC 3U78A 4C90A 4DBRA 2W0GA 4X1IE 4QKNA 3JC6C 2D0UA 4IHJE 2UXNB 4PK5A 3UUMA 2MOZA 2ZMAA 4TUYE 3J9X1 1VRBA 2K5BB 4ASKA 5HXRA 4GOUA 2XAHB 4PFOA 4UF0A 3IF8B 3K8PC 3F57A 4H9NC 1D1BA 4IE5A 4IE7A 4MALA 5EZYE 4AQGA 4H9OC 3Q9DA 4EAHA 2HPLA 3KV5A 4IE0A 3L3PA 4O2AE 2QGSA 3LBXB 2E8IA 2Z6EA 4O4HE 5FXWA 5FNVE 2WMOA 4H9RC 5HXCA 4P09A 4EB6E 2H3RA 4E7SA 1G73A 4O4JE 4CZZB 2CA5A 3MJXA 1ZEEA 4UF0B 2DNXA 4IE4A 5HWYA 3SS1A 1D1CA 2NP9A 4ZI2D 3ZMTB 2L9QA 5J1GA 3EDUA 5EK4A 3AAIA 3ANWB 5EK2A 2XUEA 2H7OA 4AKIA 3KDSE 1QUUA 3S4UA 4AKLA 1YW0A 2EHOC 4MLKA 3KINB 2CXFA 2JRKA 1HX8A 4ZOLE 3O1HA 3BQIA 2A72A 5JRCA 4AQFC 3CPZA 1ZV4X 1D0ZA 2CEAA 3H3AA 3IHRA 3CX6B 3OKQA 5JH7E 3MACA 5FY1A 3RRCA 1BR0A 3EDVA 2WSSV 3ZJ1A 5JR9B 1LVFA 2KXPB 4H9SE 3RC3A 3V5SA 4AKRB 4GIWA 5HAXA 1HG5A 1E1HB 4ZHQE 1YKEB 2NWBA 2UXXB 4NUVA 2LOSA 5DABA 1D0XA 3GN5A 3CX8B 4L5GA 2DWGA 5ADXL 5L3DB 5LBMA 3ZN1B 1OWAA 5HXHA 2V7MA 3MA9A 3ETVA 2KLQA 3HKEE 4HTEA 5M4YA 5JQGE 4MBQA 3RYFE 2Y48B 1MNDA 5JDLA 2D5UA 3C98B 4UEMA 1IZNB 2JPFA 4P0BA 4BJNA 1ZKEA 4DBQA 2CXDA 1US7B 4AXPA 3N9PA 5HWXA 3C4WA 3ETUA 1LRZA 2LSIA 2Q9QA 2E9XA 3JC6D 1MIWA 1EZ3A 3HA4A 1ZHCA 3IEEA 4P0AA 4CXXA 4E7ZA 5JR9C 3VKGA 1Y64B 2V26A 3UUXB 4UVCB 3WI3A 3Q5WA 4DNDA 4KP3C 4ADZA 2VL8A 3OYXA 3DTOA 4QX7B 2VWAA 3LK2B 4QHOA 5FMNA 2VB6A 3A5XA 3ONXA 5LNKA 1FMWA 2GK9A 2X51A 3PUGA 2NW8A 3DP7A 4CI2B 3C4XA 2D0TA 5J2TE 5H6RB 3I9WA 4AKHA 4ISSA 3C50A 5ETWA 2LEHA 3LK3B 5FY0A 5JDFA 2CWYA 1HS7A 2WBLA 4B6XA 2LSJA 1YD8G 3HKCE 3SWHA 1KNZA 2XASB 3HKBE 4N78D 3O1JA 2X66A 4M1PA 1MMDA 3ZN0B 2EHOA 3AA6B 3QC9A 4GYRA 5TAOA 3UFEA 2CCQA 2G0UA 4ZI3D 3MXZA 5DQWA 4OHFA 3PE0A 5IYZE 4ZS3A 3VU7H 3I0OA 3UTKA 2RP4A 3QUJA 4QXHB 3ANWA 3GMIA 3H37A 2JJ9A 2W63A 3FXDB 3KBUA 2V1DB 3MK7C 4K0UA 4H9QC 4YJ2E 5L2LA 3RC8A 5E0OA 2KWHA 2ODUA 3ZYLA 4BA9A 2CM0A 1NAFA 5JDHA 4IE6A 4KMCA 5CA1E 3F2EA 3C4ZA 2V7KA 4FI5A 4I4TE 4U74A 3UULA 2C5JA 2DCFA 2EHOD 1WRDA 1FIOA 3GA8A 1HCIA 4X20E 4TX5A 4V1Av 4EYYR 3FB2A 3OBVE 2Q9QB 1S94A 2CLYB 4CXWA 4PJLA 2HPJA 3KV4A 4TZ4C 1LKXA 2DI4A 2XQYA 1FEWA 3VKHA 4O8SA 1WR6A 3KV6A 2VKHA 4YFSA 1WYBA 4OYJA 4NUUA 2W62A 3I9YA 4YHJA 2KINB 2XAFB 3PUSA 2X68A 2N1GA 2Q9QD 1BR2A 2SPCA 4PW8A 2ZLYA 1MNEA 1FMVA 3K3OA 3U3IA 5L3BB 1WYCA 4YLHA 4EZ4A 3ZMSB 3GN5B 2PBIA 3N2GE 3KVBA 2B1EA 3B13A 2K48A 3O4XE 5C8YE 4HE8A 5BMVE 5JDNA 3IBPA 4I55E 2CE7A 4I50E 2W61A 3AB3B 3M65A 2DHRA 2VKJA 5LP6E 2KZ7B 4L9IA 2LE8A 3PU8A 4G2AA 4HEAA 1IJ6A 3NZQA 2XAGB 1U4QA 1MIVA 4JLEA 2VKDA 5A1LA 3O9XA 4PJNA 3ZC0A 3FBZA 5FXZA 3RYCE 3PTRB 3ZLIA 3C64A 4TN7B 4ZI3C 3FHNA 4IGUA 1BR1A 4ANJA 3CQGB 4EIWA 4CI3B 1O3XA 2PG8A 2KNDA 1X79A 4KUMB 3CX7B 3PUQA 4PK6A 5DQVA 4JUYA 4BJMA 4QXCB 3K3QC 3T8OA 4YJ3E 3KFWX 5LYJE 2MTQA 3I0QA 4O4IE 4TV9E 2X9HA 2MBGA 4UXNB 1MMNA 4BAYB 3N9LA 5LBQB 4C91A 4DVDA 3PDYA 2LSKA 4TV8E 5J2UE 5FXXA 5EK3A 1UX5A 1B7TA 1MIYA 1IJ5A 3MKDA 2ZM2A 4QXBB 3ZPOA 2A2FX 4MHCA 3RH3A 5LHHB 2C5IT 4XBFB 4J2CA 5LXTE 5HXSA 4PK4A 4CI1B 3V5UA 2YU1A 3PU3A 2VKOA 3HKDE 3D0TA 5JDQA 2Q9QC 3O1IA 5H6QB 2NW7A 1NWMX 2H7VC 3NZPA 4GYSA 4OYKA 2BZBA 2K9AA 5GONE 3B57A 4UIGA 4WBNE 5FXVA 2V7IA 2E9XB 3BQKA 2BDEA 2VK9A 3EVYA 3F31A 4XAXB 5JDMA 4AKGA 3PURA 2X0LB 1V9DA 4PAGA 2JMHA 3I1AA 3LG7A 5CA0E 3WAJA 2ZM8A 4FJOA 4O2BE 3CQCB 2RA1A 5FP3A 3RX6A 2CMRA 1T98A 3NRXA 4UVAB 3R6NA 5KMGP 5FYMA 3AVSA 5KX5E 4HGAA 5LHIB 1D1AA 5LGUB 3E08A 2XTLA 4IDZA 2CWOA 2NTXA 4Z8XA 1YKHB 3LFMA 3LK42 4H63H 3C51A 2IC9A 2LJLA 4OK0A 4UV8B 5F3JA 2JMKA 2YEVC 4AI6A 1OXZA 2YK0A 4HKAA 5F8PA 3N9MA 2X9WA 3NRYA 2L3LA 3AAEB 4DMWA 2LHNA 3RRWA 2ZM0A 3RYHE 3R84B 4EOZB 1AJ3A 2KT9A 3ZYMA 5KDMC 2YU2A 2V7LA 5IHYA 1HF8A 3BQLA 2PFVA 4ILUA 3ZMZB 3ESLA 1H7CA 1HFAA 5LGNB 3BK9A 3N9OA 2L8KA 4PNIA 4QX8B 1KK7A 3ZC1A 1MMGA 3KVAA 3L09A 4UVBB 2X9XA 3J7Yq 4PFPA 3N9NA 4GK5E 2MYSA 3CWZB 5AFUL 4PJMA 2XAQB 5JRCB 2E9XC 4JEUB 1CUNA 4UV9B 2LSGA 2WAUA 2KWIB 4IIJE 3SRZA 2KMFA 3E22E 4X1YE 3ZMVB 3AA7B 3E0ZA 2LSYA 5DJQC 2V7JA 2ODVA 3AVRA 4H9PC 1MMAA 2ES0A 4DO0A 3MZKB 4JEHB 1VOMA 3PUAA 4U72A 4PJJA 2C5KT 4GK0E 2W00A 5JDGA 3OYZA 2D2SA 4QWNB 4WW0A 2NTYA 3HR0A 2LM9A 3K3NA 3TKLB 3N9QA 2P9BA 4O4LE 2HH7A 4G63A 2NOXA 2N2NA 3N2OA 2Y8DA 1HG2A 4WNKA 4X1KE 3ZJ2A 2QA7A 2WMNA 2VASA 4CXYA 1HTJF 5L3GB 3CQXC 2LHRA 4KBMB 1G8XA 2LT3A 3HL6A 4HFVA 3CVRA 2IC6A 2IAKA 2I59A 2BVLA 3P7IA 2N9DA 3RYIE 3LJCA 5L3EB 4EXTA 4ISTA 3KV9A 3GWHA 1LVKA 2EHOB 1UX4A 4HN9A 2XHEB 3FBLA 4F6RC 3LBXA 4EYUA 2Y6XA 4I43B 5FY7A 3N2KE 1D0YA 5JVDE 4CQIA 1UCUA 5LHGB 5HYAA 3HI2A 4WBOA 3W15B 2K24A 3ZCIA 2M67A 2WWUA 2BVMA 3RPUA 3ZYKA 4ZI2C 1IAPA 2A3DA 2LOPA 4UELA 3Q5XA 3P8CD 1SA0E 2J1DG 1Z0PA 2OA5A 3Q2MA 3ZCJA 4DMVA 5LA6E 4ZS2A 1S35A 2IW5B 4L0RA 3FXEB 2CXLA 3ZMUB 2JQQA 4H63V 2ACXA 2YINA 5LGTB 4AQFA 5L3CB 3KBTA 3UT5E 4ZI7E 3OJAA 3EUHA 5LOVE 4XZCA 2NW9A 4A56A 3AA1B 3AA0B 2X9YA 3VHLA 5LJNA 1WLXA 3DJBA 3UUNA 1BR4A 5HXEA 5LG4A 2X67A 5JR9A 3WAKA 3CMLA 3QK6A 3ZEFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHE B;  3C98 B;  4JEU B;  5LG4 A;  4JEH B;  1FIO A;  1G73 A;  1FEW A;  5M4Y A;  1EZ3 A;  1BR0 A;  4TX5 A;  1HS7 A;  2DNX A;  1S94 A;  3LG7 A; 
#chains in the Genus database with same CATH topology
 4OFZ A;  3NBX X;  5LJM A;  4LF6 T;  3RKO A;  1N32 T;  2DLR A;  3UU4 A;  3AAA B;  3N5L A;  5JRE A;  3CKD A;  3L39 A;  2WM9 A;  3ZKR A;  2BG9 C;  2YN6 A;  4LF4 T;  1U5P A;  4YXD A;  4LF5 T;  3SOL A;  4ERR A;  5L3F B;  2DWK A;  3UU6 A;  1QSD A;  2PJQ A;  5CB4 E;  2WWV A;  2H88 A;  1VCT A;  2F4V T;  4EZH A;  1WR0 A;  4UR9 A;  4DV6 T;  3PUW F;  2XAJ B;  4MFR A;  2C0S A;  2CLY C;  2E9X D;  5LCY A;  1SHZ C;  3U78 A;  2XZE A;  4C90 A;  2W0G A;  4X1I E;  4QKN A;  4DBR A;  3JC6 C;  2D0U A;  4IHJ E;  1HNZ T;  2UXN B;  4PK5 A;  3UUM A;  2MOZ A;  1KNP A;  2ZMA A;  4TUY E;  3J9X 1;  1VRB A;  2K5B B;  4IL9 A;  4ASK A;  3AE7 A;  5HXR A;  2XM2 A;  4GOU A;  2XAH B;  4HFC A;  4HFI A;  4IDN A;  3AE5 A;  3IF8 B;  3K8P C;  3F57 A;  4H9N C;  1D1B A;  4IE5 A;  3JAE A;  4IE7 A;  4ILC A;  4MAL A;  4H9O C;  3Q9D A;  3AEF A;  4LFC T;  4EAH A;  2HPL A;  3KV5 A;  2M6B A;  4IE0 A;  3L3P A;  4O2A E;  2QGS A;  3LBX B;  4TWF A;  2E8I A;  2Z6E A;  4O4H E;  4U33 A;  5FXW A;  5FNV E;  2WMO A;  4H9R C;  5HXC A;  1M62 A;  4P09 A;  2H3R A;  3PV0 F;  1G73 A;  4O4J E;  5L4H A;  4CZZ B;  2CA5 A;  3MJX A;  1ZEE A;  3FZK B;  2XQ7 A;  1T72 A;  2DNX A;  3QNU A;  4IE4 A;  4UF0 B;  2XQ5 A;  3AED A;  5HWY A;  3SS1 A;  4JI8 T;  1D1C A;  2NP9 A;  3UU8 A;  4ZI2 D;  3TLW A;  2L9Q A;  5J1G A;  3ZMT B;  2IUB A;  3TLT A;  3EDU A;  5EK4 A;  3AAI A;  3ANW B;  3RIU A;  5EK2 A;  2XUE A;  2H7O A;  4AKI A;  3AE1 A;  3KDS E;  4U31 A;  1QUU A;  3S4U A;  3JCF A;  4AKL A;  1YW0 A;  2WU2 A;  2EHO C;  4MLK A;  3KIN B;  2CXF A;  2JRK A;  1HX8 A;  4IDP A;  4DR1 T;  4ZOL E;  3O1H A;  3BQI A;  2A72 A;  1N36 T;  5JRC A;  4AQF C;  3CPZ A;  1ZV4 X;  5ABG A;  1D0Z A;  2CEA A;  3H3A A;  3IHR A;  3CX6 B;  3OKQ A;  5JH7 E;  3MAC A;  3CIR A;  4U2Y A;  5FY1 A;  3RRC A;  1BR0 A;  5J0Z A;  3EDV A;  2WSS V;  2FBW A;  3ZJ1 A;  2FUP A;  1LVF A;  5JR9 B;  2KXP B;  4H9S E;  3RC3 A;  4U3C A;  3V5S A;  1XNQ T;  4AKR B;  3A7M A;  4GIW A;  4IRE A;  3AE9 A;  4ILB A;  5HAX A;  1HG5 A;  1E1H B;  4ILA A;  2FJE A;  4ZHQ E;  1YKE B;  2NWB A;  2UXX B;  5FL1 A;  4NUV A;  2LOS A;  5DAB A;  2XQA A;  1D0X A;  3QK6 A;  3GN5 A;  4AIS A;  3CX8 B;  1IBL T;  2CHO A;  4L5G A;  4DV2 T;  1IBM T;  2DWG A;  2LRK A;  2BG9 A;  4ZZC A;  2W67 A;  3UQ4 A;  2BKO A;  2HN1 A;  5LBM A;  3ZN1 B;  1OWA A;  5ADX L;  2KSR A;  3FZH B;  2WDR A;  4I0U A;  5HXH A;  3T1Y T;  2V7M A;  4DUY T;  3MA9 A;  3ETV A;  2KLQ A;  3HKE E;  4HTE A;  5M4Y A;  4QH4 A;  5JQG E;  4MBQ A;  3RYF E;  2UXD T;  1J5E T;  2Y48 B;  1WFD A;  1MND A;  2J4G A;  4GKJ T;  5JDL A;  2D5U A;  3C98 B;  4UEM A;  1IZN B;  2JPF A;  4P0B A;  4BJN A;  1ZKE A;  4DBQ A;  2CXD A;  1US7 B;  4AXP A;  3N9P A;  5HWX A;  3C4W A;  4COF A;  3ETU A;  3P4W A;  4KHZ F;  1LRZ A;  2BKN A;  2IHR 1;  2LSI A;  5F5W A;  2ZM6 T;  1W0A A;  2Q9Q A;  3OTO T;  2E9X A;  3NWI A;  3JC6 D;  1MIW A;  3A8Y C;  4ZZB A;  1EZ3 A;  3HA4 A;  1OED B;  1ZHC A;  3AE2 A;  3IEE A;  5AQT B;  3VRB A;  4P0A A;  3B5M A;  1ZOY A;  4CXX A;  4E7Z A;  4YY3 T;  5JR9 C;  4U2Z A;  3VKG A;  2XQ8 A;  1Y64 B;  2V26 A;  4U7I A;  3UUX B;  3ZST A;  4LF7 T;  4UVC B;  3WI3 A;  5FVL A;  3Q5W A;  4YSY A;  2XM1 A;  2E5V A;  4KP3 C;  4ADZ A;  4DND A;  2VL8 A;  3OYX A;  3DTO A;  4HFE A;  4QX7 B;  1J5W A;  2VWA A;  1XDO A;  3LK2 B;  4QHO A;  5FMN A;  2VB6 A;  3A5X A;  3ONX A;  3X1D A;  1FMW A;  3QB5 K;  2GK9 A;  5LNK A;  2X51 A;  3PUG A;  4JI4 T;  2XSA A;  2NW8 A;  3DP7 A;  1JNR A;  4CI2 B;  4EV6 A;  1YQ3 A;  5FL0 A;  5KXJ A;  4DV1 T;  3C4X A;  2D0T A;  5J2T E;  5JTG A;  5H6R B;  3I9W A;  2WCA A;  5HCJ A;  4EB6 E;  3P4P A;  4YSZ A;  2UUA T;  4AKH A;  4ISS A;  3UUB A;  3C50 A;  5AQI B;  5ETW A;  2LEH A;  3LK3 B;  5FY0 A;  3EI0 A;  3CK6 A;  4HFD A;  5JDF A;  1E2A A;  2BG9 B;  2CWY A;  2WBL A;  4B6X A;  1HS7 A;  2LSJ A;  1YD8 G;  3VR9 A;  2B76 A;  3HKC E;  3SWH A;  4B3R T;  1KNZ A;  2YDS A;  2XAS B;  3TLV A;  2YKS A;  3HKB E;  4N78 D;  3O1J A;  3RGL A;  2X66 A;  4M1P A;  1MMD A;  3ZN0 B;  3ZT6 A;  2EHO A;  2V5C A;  2IDO B;  3AA6 B;  3EAM A;  3QC9 A;  4GYR A;  5TAO A;  3UFE A;  2CCQ A;  4QH1 A;  2G0U A;  4ZI3 D;  3MXZ A;  5DQW A;  4OHF A;  3PE0 A;  5IYZ E;  4ZS3 A;  3VU7 H;  3I0O A;  3P4Q A;  1W9R A;  3UTK A;  1HNW T;  2RP4 A;  3QUJ A;  4QXH B;  2M6I A;  4IDQ A;  4PFO A;  3TLS A;  3ANW A;  3GMI A;  3H37 A;  2JJ9 A;  2W63 A;  4YT0 A;  3FXD B;  5ABF A;  3KBU A;  4B3T T;  2V1D B;  3MK7 C;  4K0U A;  4A97 A;  4JV5 T;  1HNX T;  4H9Q C;  4YJ2 E;  5L2L A;  3RC8 A;  5E0O A;  2KWH A;  2ODU A;  3ZYL A;  4BA9 A;  2CM0 A;  1NAF A;  5JDH A;  4IE6 A;  4F8H A;  1XMQ T;  1I6Z A;  4KMC A;  3AXJ B;  5CA1 E;  3F2E A;  3C4Z A;  2V7K A;  4FI5 A;  2WZI A;  4I4T E;  4U74 A;  3UUL A;  1OED A;  2C5J A;  3AE4 A;  3FZF B;  4YHH T;  2DCF A;  2EHO D;  1WRD A;  1FIO A;  3GA8 A;  1HCI A;  4LMJ A;  4X20 E;  4TX5 A;  4V1A v;  4JI5 T;  3FB2 A;  4EYY R;  3OBV E;  2Q9Q B;  1S94 A;  2CLY B;  4NPP A;  4PJL A;  2HPJ A;  4CXW A;  3KV4 A;  3ONL C;  4LFB T;  4TZ4 C;  1LKX A;  2WDQ A;  2DI4 A;  2XQY A;  1FEW A;  3H3M A;  3VKH A;  2UXC T;  2XQ4 A;  4O8S A;  1WR6 A;  2LKH A;  3KV6 A;  2VKH A;  4YFS A;  1WYB A;  4OYJ A;  4NUU A;  3AEA A;  2W62 A;  3I9Y A;  3LDQ B;  4WYV A;  4YHJ A;  2KIN B;  5L3D B;  3PUV F;  4X64 T;  2XAF B;  3PUS A;  1N34 T;  2HN2 A;  2N1G A;  2Q9Q D;  2SPC A;  1BR2 A;  2X68 A;  1YQ4 A;  2WB5 A;  1MNE A;  1FMV A;  2ZLY A;  3K3O A;  4PW8 A;  4Q25 A;  3U3I A;  3JAF A;  4E7S A;  2XPK A;  5AQL B;  1WYC A;  4YLH A;  4EZ4 A;  3ZMS B;  3GN5 B;  3OPC A;  2PBI A;  2IIU A;  1ZP0 A;  2BBH A;  3KVB A;  3N2G E;  5HEG A;  2WZH A;  2B1E A;  3B13 A;  2K48 A;  4JI0 T;  1XDP A;  3O4X E;  4GKK T;  5C8Y E;  1Z8U A;  4HE8 A;  2FJD A;  2IML A;  5BMV E;  5JDN A;  3IBP A;  4I55 E;  2WS3 A;  1IBK T;  2CE7 A;  2XY8 B;  4I50 E;  4DV7 T;  2W61 A;  3AB3 B;  3M65 A;  3ZMZ B;  4A5X A;  4LF8 T;  4TNW A;  2DHR A;  2BG9 E;  2VKJ A;  2KZ7 B;  5LP6 E;  2BS4 A;  2V5D A;  4L9I A;  2XQ6 A;  2V6X A;  5AQU B;  2LE8 A;  3PU8 A;  4G2A A;  2V6Y A;  4HEA A;  2VL0 A;  2WDV A;  1FJG T;  1IJ6 A;  3NZQ A;  1U4Q A;  1MIV A;  1SUM B;  2XAG B;  1HR0 T;  4JLE A;  5AQV B;  4K0K T;  2VKD A;  3G06 A;  2NR4 A;  4NIQ A;  5AQM B;  3P50 A;  4PJN A;  3FBZ A;  5A1L A;  5FXZ A;  3PUZ F;  3O9X A;  3ZC0 A;  5ABH A;  3RYC E;  1QLB A;  3ZT7 A;  2XQ3 A;  3PTR B;  3ZLI A;  3C64 A;  2YDR A;  4TN7 B;  1XZY A;  5LG3 A;  4ZI3 C;  3FHN A;  1W09 A;  2V6Y B;  4IGU A;  1BR1 A;  1UK5 A;  2WU5 A;  3EHZ A;  4ANJ A;  3CQG B;  4EIW A;  5LMN T;  4AIU A;  2XJ7 A;  4CI3 B;  1O3X A;  2PG8 A;  3RHW A;  4EEB A;  2KND A;  1X79 A;  4KUM B;  3CX7 B;  3PUQ A;  4PK6 A;  5DQV A;  4CN6 A;  4JUY A;  4DR2 T;  4BJM A;  4QXC B;  3K3Q C;  4NXM T;  2WY2 A;  3QOF A;  3Q5E A;  3T8O A;  4YJ3 E;  2K3W A;  5IWA T;  3KFW X;  5LYJ E;  2MTQ A;  3I0Q A;  4O4I E;  1KNR A;  4TV9 E;  1W0B A;  2MAW A;  2X9H A;  4AQG A;  4NXN T;  2A9U A;  2MBG A;  4UXN B;  1MMN A;  5FVK A;  3AEG A;  4DID B;  4BAY B;  3PUY F;  3N9L A;  5LBQ B;  2ACZ A;  4C91 A;  3PDY A;  2LSK A;  4TV8 E;  4IDO A;  4DVD A;  5HEO A;  5J2U E;  2UUB T;  5FXX A;  4LML A;  5EK3 A;  5L3B B;  3EAB A;  1UX5 A;  1B7T A;  1MIY A;  1IJ5 A;  3MKD A;  2ZM2 A;  4QXB B;  3ZPO A;  2A2F X;  4AQY T;  4MHC A;  3RH3 A;  1I94 T;  5LHH B;  2BS3 A;  4P1N A;  4HWC A;  2C5I T;  4XBF B;  2X0H A;  4J2C A;  4TWD A;  5LXT E;  1KFY A;  5HXS A;  4PK4 A;  2HHH T;  1OED C;  3PJA A;  4CI1 B;  3V5U A;  2QVA A;  2VQE T;  4HWF A;  5CFB A;  3QB5 A;  2YU1 A;  3PU3 A;  3T1H T;  3PUX F;  2VKO A;  4Z91 A;  5BR8 T;  3HKD E;  3D0T A;  5IUX A;  5JDQ A;  2Q9Q C;  4B3M T;  3O1I A;  5H6Q B;  1GQE A;  3UFG A;  2NW7 A;  1NWM X;  5L47 A;  2H7V C;  3NZP A;  4GYS A;  4OYK A;  4DR7 T;  2BZB A;  2K9A A;  5GON E;  3B57 A;  4UIG A;  4WBN E;  5FXV A;  2V7I A;  2E9X B;  4X62 T;  3BQK A;  4DR5 T;  2BDE A;  2E5L T;  4YTN A;  2VK9 A;  3EVY A;  1XWM A;  3F31 A;  4XAX B;  2AE9 A;  5LB7 B;  2W2U A;  1CHU A;  5JDM A;  4AKG A;  3OVU A;  2JQH A;  2I0M A;  3PUR A;  2X0L B;  5AQR B;  3RQU A;  1V9D A;  4CN4 A;  3AEC A;  3RLF F;  3RIU C;  4PAG A;  1JNZ A;  1YXR A;  2JMH A;  4YTM A;  3I1A A;  3LG7 A;  5CA0 E;  3WAJ A;  3P4S A;  4JI1 T;  2ZM8 A;  4U7Y A;  1XNR T;  4FJO A;  4O2B E;  3CQC B;  1T8B A;  4HFB A;  4DV4 T;  4Z90 A;  2RA1 A;  5AQQ B;  5FP3 A;  2CMR A;  3RX6 A;  1T98 A;  5CJ5 A;  3NRX A;  4UVA B;  1E7P A;  3R6N A;  5AQO B;  5KMG P;  5FYM A;  3AVS A;  2CRB A;  5KX5 E;  4HGA A;  4IT4 A;  5LHI B;  1D1A A;  2WQY A;  5LGU B;  2RPA A;  2XTL A;  3E08 A;  3IA3 A;  4IDZ A;  4JYA T;  2CWO A;  2NTX A;  4Z8X A;  1YKH B;  3LFM A;  3LK4 2;  4H63 H;  3C51 A;  2IC9 A;  2LJL A;  4HWI B;  4OK0 A;  4UV8 B;  5F3J A;  4X66 T;  2JMK A;  2QYW A;  2VUR A;  2YEV C;  4UF0 A;  4JI6 T;  4DR4 T;  4AI6 A;  3AEB A;  1OXZ A;  1J1J A;  2YK0 A;  4HKA A;  5F8P A;  5C2T A;  2LRL A;  4KX6 A;  3N9M A;  2X9W A;  3NRY A;  4DV3 T;  2L3L A;  2W66 A;  4TNV A;  3AAE B;  4DMW A;  2LHN A;  3RRW A;  3ZT5 A;  2ZM0 A;  3RYH E;  3R84 B;  4EOZ B;  1AJ3 A;  2KT9 A;  4HFH A;  3UU5 A;  3ZYM A;  2OLT A;  5KDM C;  2YU2 A;  2V7L A;  5IHY A;  1HF8 A;  3BQL A;  2PFV A;  4ILU A;  2H89 A;  1H7C A;  1HFA A;  3ESL A;  2FJB A;  3BK9 A;  3N9O A;  2L8K A;  2YOE A;  4PNI A;  5LGN B;  5HEJ A;  5EZY E;  3TLU A;  4QX8 B;  1KK7 A;  3PJA J;  3ZC1 A;  1MMG A;  2AXD S;  3KVA A;  3L09 A;  3LSV A;  1KEY A;  4UVB B;  2X9X A;  4X65 T;  3P4R A;  3J7Y q;  4JI2 T;  4PFP A;  4JI7 T;  4DV5 T;  1XMO T;  3N9N A;  4GK5 E;  2MYS A;  3CWZ B;  5AFU L;  2UXB T;  4PJM A;  2XAQ B;  5JRC B;  2E9X C;  3AEE A;  4JEU B;  1CUN A;  2X0Y A;  3ZSS A;  4TWH A;  4UV9 B;  2LSG A;  2WAU A;  2KWI B;  3AE6 A;  4IIJ E;  5AQN B;  4EED A;  4DV0 T;  3SRZ A;  2KMF A;  3E22 E;  2XSB A;  1N33 T;  1SE7 A;  4X1Y E;  3RIA A;  3ZMV B;  2V8S V;  3AA7 B;  2BBJ A;  3E0Z A;  2JQ9 A;  2LSY A;  2VVS A;  5DJQ C;  2V7J A;  1UGO A;  2ODV A;  2W4X A;  5HEH A;  2FJA A;  3AVR A;  4H9P C;  3FZL B;  1MMA A;  5L4E A;  4YTP A;  2ES0 A;  4DO0 A;  2WP9 A;  3MZK B;  4JEH B;  1VOM A;  3PUA A;  4U72 A;  4PJJ A;  5HCM A;  2C5K T;  4GK0 E;  2W00 A;  1L0V A;  2JQK A;  5CGM A;  5JDG A;  2BS2 A;  3OYZ A;  3L8R A;  3Q5D A;  2D2S A;  4QWN B;  4WW0 A;  2NTY A;  2CBI A;  2LM9 A;  3HR0 A;  3K3N A;  3TKL B;  2UU9 T;  1VCS A;  4CN1 A;  3N9Q A;  3UQ7 A;  3SFE A;  2P9B A;  4O4L E;  2HH7 A;  2LKG A;  2D9D A;  3ABV A;  4G63 A;  5AQG B;  4ZEY A;  2NOX A;  5FKY A;  2N2N A;  1WCR A;  4B3S T;  3N2O A;  1M7K A;  1HG2 A;  2Y8D A;  4WNK A;  4X1K E;  2QA7 A;  3ZJ2 A;  2CPT A;  1HX1 B;  5AQS B;  2WMN A;  2VAS A;  3FZM B;  1HTJ F;  4ZXL A;  3VR8 A;  5L3G B;  3CQX C;  4QH5 A;  4CXY A;  2LHR A;  4KBM B;  1G8X A;  2LT3 A;  3HL6 A;  5ABE A;  4HFV A;  1UUR A;  2VQF T;  3CVR A;  3SFD A;  2IC6 A;  2IAK A;  4DUZ T;  2I59 A;  2BVL A;  2R6G F;  5AQF B;  5AQJ B;  3P7I A;  5LMU T;  4A98 A;  3RQW A;  2J62 A;  2N9D A;  2XQ9 A;  3RYI E;  2VVN A;  3LJC A;  4LMK A;  4EXT A;  5L3E B;  4IST A;  3KV9 A;  1UUS A;  1LVK A;  3GWH A;  2EHO B;  1UX4 A;  4HN9 A;  2XHE B;  3FBL A;  4F6R C;  3LBX A;  4EYU A;  2Y6X A;  4I43 B;  5FY7 A;  3N2K E;  1D0Y A;  3M3Z B;  5JVD E;  4CQI A;  1Y01 A;  2YDQ A;  4JBW F;  5ABF B;  2JIW A;  1UCU A;  2LM2 A;  3ONJ A;  5LHG B;  5HYA A;  3HI2 A;  4WBO A;  2OV9 A;  2QRX A;  1OED E;  1R8I A;  2K24 A;  3W15 B;  3ZCI A;  2M67 A;  4LFA T;  2WWU A;  5HEU A;  3VRA A;  2E2A A;  2BVM A;  3RPU A;  3ZYK A;  4IL4 A;  4ZI2 C;  4HWH A;  1IAP A;  2A3D A;  2LLY A;  2LOP A;  4UEL A;  3Q5X A;  3P8C D;  1NEN A;  1SA0 E;  2J1D G;  1DU2 A;  1Z0P A;  5AQK B;  4WZX A;  2BKP A;  2OA5 A;  3Q2M A;  3ZCJ A;  4DMV A;  4KHP T;  5LA6 E;  4ZS2 A;  1S35 A;  2CBJ A;  3AXJ A;  4YSX A;  3RKG A;  4OX9 T;  1X9B A;  2IW5 B;  2I6H A;  2PTF A;  4HWD A;  4L0R A;  5AQH B;  3FXE B;  2CXL A;  5AQP B;  2DL1 A;  3K1S A;  2J47 A;  3RI5 A;  2JQQ A;  3ZMU B;  4H63 V;  1T7S A;  2ACX A;  4X5T A;  2YIN A;  1NEK A;  2CHN A;  5LGT B;  4AQF A;  2UUC T;  5L3C B;  3KBT A;  3RIF A;  3UT5 E;  3OJA A;  3RF1 A;  3EUH A;  5LOV E;  4EGW A;  4ZI7 E;  3UU3 A;  4XZC A;  5C3J A;  2NW9 A;  4A56 A;  4DR6 T;  4DR3 T;  3AA1 B;  3AA0 B;  4KI0 F;  3JAD A;  2MPK A;  2X9Y A;  3VHL A;  4JI3 T;  5LJN A;  3NKZ A;  1KF6 A;  1WLX A;  3AE3 A;  3DJB A;  3UUN A;  1BR4 A;  5HXE A;  5LG4 A;  2X67 A;  5JR9 A;  3WAK A;  3CML A;  3AE8 A;  3NVO A;  3ZEF B;  4LF9 T; 
#chains in the Genus database with same CATH homology
 4OFZ A;  3NBX X;  5LJM A;  3RKO A;  2DLR A;  3AAA B;  3N5L A;  5JRE A;  3CKD A;  2WM9 A;  1U5P A;  3SOL A;  4ERR A;  5L3F B;  2DWK A;  1QSD A;  2PJQ A;  5CB4 E;  4EZH A;  2XAJ B;  4MFR A;  2C0S A;  2CLY C;  2E9X D;  5LCY A;  1SHZ C;  3U78 A;  4C90 A;  4DBR A;  2W0G A;  4X1I E;  4QKN A;  3JC6 C;  2D0U A;  4IHJ E;  2UXN B;  4PK5 A;  3UUM A;  2MOZ A;  2ZMA A;  4TUY E;  3J9X 1;  1VRB A;  2K5B B;  4ASK A;  5HXR A;  4GOU A;  2XAH B;  4PFO A;  4UF0 A;  3IF8 B;  3K8P C;  3F57 A;  4H9N C;  1D1B A;  4IE5 A;  4IE7 A;  4MAL A;  5EZY E;  4AQG A;  4H9O C;  3Q9D A;  4EAH A;  2HPL A;  3KV5 A;  4IE0 A;  3L3P A;  4O2A E;  2QGS A;  3LBX B;  2E8I A;  2Z6E A;  4O4H E;  5FXW A;  5FNV E;  2WMO A;  4H9R C;  5HXC A;  4P09 A;  4EB6 E;  2H3R A;  4E7S A;  1G73 A;  4O4J E;  4CZZ B;  2CA5 A;  3MJX A;  1ZEE A;  4UF0 B;  2DNX A;  4IE4 A;  5HWY A;  3SS1 A;  1D1C A;  2NP9 A;  4ZI2 D;  3ZMT B;  2L9Q A;  5J1G A;  3EDU A;  5EK4 A;  3AAI A;  3ANW B;  5EK2 A;  2XUE A;  2H7O A;  4AKI A;  3KDS E;  1QUU A;  3S4U A;  4AKL A;  1YW0 A;  2EHO C;  4MLK A;  3KIN B;  2CXF A;  2JRK A;  1HX8 A;  4ZOL E;  3O1H A;  3BQI A;  2A72 A;  5JRC A;  4AQF C;  3CPZ A;  1ZV4 X;  1D0Z A;  2CEA A;  3H3A A;  3IHR A;  3CX6 B;  3OKQ A;  5JH7 E;  3MAC A;  5FY1 A;  3RRC A;  1BR0 A;  3EDV A;  2WSS V;  3ZJ1 A;  5JR9 B;  1LVF A;  2KXP B;  4H9S E;  3RC3 A;  3V5S A;  4AKR B;  4GIW A;  5HAX A;  1HG5 A;  1E1H B;  4ZHQ E;  1YKE B;  2NWB A;  2UXX B;  4NUV A;  2LOS A;  5DAB A;  1D0X A;  3GN5 A;  3CX8 B;  4L5G A;  2DWG A;  5ADX L;  5L3D B;  5LBM A;  3ZN1 B;  1OWA A;  5HXH A;  2V7M A;  3MA9 A;  3ETV A;  2KLQ A;  3HKE E;  4HTE A;  5M4Y A;  5JQG E;  4MBQ A;  3RYF E;  2Y48 B;  1MND A;  5JDL A;  2D5U A;  3C98 B;  4UEM A;  1IZN B;  2JPF A;  4P0B A;  4BJN A;  1ZKE A;  4DBQ A;  2CXD A;  1US7 B;  4AXP A;  3N9P A;  5HWX A;  3C4W A;  3ETU A;  1LRZ A;  2LSI A;  2Q9Q A;  2E9X A;  3JC6 D;  1MIW A;  1EZ3 A;  3HA4 A;  1ZHC A;  3IEE A;  4P0A A;  4CXX A;  4E7Z A;  5JR9 C;  3VKG A;  1Y64 B;  2V26 A;  3UUX B;  4UVC B;  3WI3 A;  3Q5W A;  4DND A;  4KP3 C;  4ADZ A;  2VL8 A;  3OYX A;  3DTO A;  4QX7 B;  2VWA A;  3LK2 B;  4QHO A;  5FMN A;  2VB6 A;  3A5X A;  3ONX A;  5LNK A;  1FMW A;  2GK9 A;  2X51 A;  3PUG A;  2NW8 A;  3DP7 A;  4CI2 B;  3C4X A;  2D0T A;  5J2T E;  5H6R B;  3I9W A;  4AKH A;  4ISS A;  3C50 A;  5ETW A;  2LEH A;  3LK3 B;  5FY0 A;  5JDF A;  2CWY A;  1HS7 A;  2WBL A;  4B6X A;  2LSJ A;  1YD8 G;  3HKC E;  3SWH A;  1KNZ A;  2XAS B;  3HKB E;  4N78 D;  3O1J A;  2X66 A;  4M1P A;  1MMD A;  3ZN0 B;  2EHO A;  3AA6 B;  3QC9 A;  4GYR A;  5TAO A;  3UFE A;  2CCQ A;  2G0U A;  4ZI3 D;  3MXZ A;  5DQW A;  4OHF A;  3PE0 A;  5IYZ E;  4ZS3 A;  3VU7 H;  3I0O A;  3UTK A;  2RP4 A;  3QUJ A;  4QXH B;  3ANW A;  3GMI A;  3H37 A;  2JJ9 A;  2W63 A;  3FXD B;  3KBU A;  2V1D B;  3MK7 C;  4K0U A;  4H9Q C;  4YJ2 E;  5L2L A;  3RC8 A;  5E0O A;  2KWH A;  2ODU A;  3ZYL A;  4BA9 A;  2CM0 A;  1NAF A;  5JDH A;  4IE6 A;  4KMC A;  5CA1 E;  3F2E A;  3C4Z A;  2V7K A;  4FI5 A;  4I4T E;  4U74 A;  3UUL A;  2C5J A;  2DCF A;  2EHO D;  1WRD A;  1FIO A;  3GA8 A;  1HCI A;  4X20 E;  4TX5 A;  4V1A v;  4EYY R;  3FB2 A;  3OBV E;  2Q9Q B;  1S94 A;  2CLY B;  4CXW A;  4PJL A;  2HPJ A;  3KV4 A;  4TZ4 C;  1LKX A;  2DI4 A;  2XQY A;  1FEW A;  3VKH A;  4O8S A;  1WR6 A;  3KV6 A;  2VKH A;  4YFS A;  1WYB A;  4OYJ A;  4NUU A;  2W62 A;  3I9Y A;  4YHJ A;  2KIN B;  2XAF B;  3PUS A;  2X68 A;  2N1G A;  2Q9Q D;  1BR2 A;  2SPC A;  4PW8 A;  2ZLY A;  1MNE A;  1FMV A;  3K3O A;  3U3I A;  5L3B B;  1WYC A;  4YLH A;  4EZ4 A;  3ZMS B;  3GN5 B;  2PBI A;  3N2G E;  3KVB A;  2B1E A;  3B13 A;  2K48 A;  3O4X E;  5C8Y E;  4HE8 A;  5BMV E;  5JDN A;  3IBP A;  4I55 E;  2CE7 A;  4I50 E;  2W61 A;  3AB3 B;  3M65 A;  2DHR A;  2VKJ A;  5LP6 E;  2KZ7 B;  4L9I A;  2LE8 A;  3PU8 A;  4G2A A;  4HEA A;  1IJ6 A;  3NZQ A;  2XAG B;  1U4Q A;  1MIV A;  4JLE A;  2VKD A;  5A1L A;  3O9X A;  4PJN A;  3ZC0 A;  3FBZ A;  5FXZ A;  3RYC E;  3PTR B;  3ZLI A;  3C64 A;  4TN7 B;  4ZI3 C;  3FHN A;  4IGU A;  1BR1 A;  4ANJ A;  3CQG B;  4EIW A;  4CI3 B;  1O3X A;  2PG8 A;  2KND A;  1X79 A;  4KUM B;  3CX7 B;  3PUQ A;  4PK6 A;  5DQV A;  4JUY A;  4BJM A;  4QXC B;  3K3Q C;  3T8O A;  4YJ3 E;  3KFW X;  5LYJ E;  2MTQ A;  3I0Q A;  4O4I E;  4TV9 E;  2X9H A;  2MBG A;  4UXN B;  1MMN A;  4BAY B;  3N9L A;  5LBQ B;  4C91 A;  4DVD A;  3PDY A;  2LSK A;  4TV8 E;  5J2U E;  5FXX A;  5EK3 A;  1UX5 A;  1B7T A;  1MIY A;  1IJ5 A;  3MKD A;  2ZM2 A;  4QXB B;  3ZPO A;  2A2F X;  4MHC A;  3RH3 A;  5LHH B;  2C5I T;  4XBF B;  4J2C A;  5LXT E;  5HXS A;  4PK4 A;  4CI1 B;  3V5U A;  2YU1 A;  3PU3 A;  2VKO A;  3HKD E;  3D0T A;  5JDQ A;  2Q9Q C;  3O1I A;  5H6Q B;  2NW7 A;  1NWM X;  2H7V C;  3NZP A;  4GYS A;  4OYK A;  2BZB A;  2K9A A;  5GON E;  3B57 A;  4UIG A;  4WBN E;  5FXV A;  2V7I A;  2E9X B;  3BQK A;  2BDE A;  2VK9 A;  3EVY A;  3F31 A;  4XAX B;  5JDM A;  4AKG A;  3PUR A;  2X0L B;  1V9D A;  4PAG A;  2JMH A;  3I1A A;  3LG7 A;  5CA0 E;  3WAJ A;  2ZM8 A;  4FJO A;  4O2B E;  3CQC B;  2RA1 A;  5FP3 A;  3RX6 A;  2CMR A;  1T98 A;  3NRX A;  4UVA B;  3R6N A;  5KMG P;  5FYM A;  3AVS A;  5KX5 E;  4HGA A;  5LHI B;  1D1A A;  5LGU B;  3E08 A;  2XTL A;  4IDZ A;  2CWO A;  2NTX A;  4Z8X A;  1YKH B;  3LFM A;  3LK4 2;  4H63 H;  3C51 A;  2IC9 A;  2LJL A;  4OK0 A;  4UV8 B;  5F3J A;  2JMK A;  2YEV C;  4AI6 A;  1OXZ A;  2YK0 A;  4HKA A;  5F8P A;  3N9M A;  2X9W A;  3NRY A;  2L3L A;  3AAE B;  4DMW A;  2LHN A;  3RRW A;  2ZM0 A;  3RYH E;  3R84 B;  4EOZ B;  1AJ3 A;  2KT9 A;  3ZYM A;  5KDM C;  2YU2 A;  2V7L A;  5IHY A;  1HF8 A;  3BQL A;  2PFV A;  4ILU A;  3ZMZ B;  3ESL A;  1H7C A;  1HFA A;  5LGN B;  3BK9 A;  3N9O A;  2L8K A;  4PNI A;  4QX8 B;  1KK7 A;  3ZC1 A;  1MMG A;  3KVA A;  3L09 A;  4UVB B;  2X9X A;  3J7Y q;  4PFP A;  3N9N A;  4GK5 E;  2MYS A;  3CWZ B;  5AFU L;  4PJM A;  2XAQ B;  5JRC B;  2E9X C;  4JEU B;  1CUN A;  4UV9 B;  2LSG A;  2WAU A;  2KWI B;  4IIJ E;  3SRZ A;  2KMF A;  3E22 E;  4X1Y E;  3ZMV B;  3AA7 B;  3E0Z A;  2LSY A;  5DJQ C;  2V7J A;  2ODV A;  3AVR A;  4H9P C;  1MMA A;  2ES0 A;  4DO0 A;  3MZK B;  4JEH B;  1VOM A;  3PUA A;  4U72 A;  4PJJ A;  2C5K T;  4GK0 E;  2W00 A;  5JDG A;  3OYZ A;  2D2S A;  4QWN B;  4WW0 A;  2NTY A;  3HR0 A;  2LM9 A;  3K3N A;  3TKL B;  3N9Q A;  2P9B A;  4O4L E;  2HH7 A;  4G63 A;  2NOX A;  2N2N A;  3N2O A;  2Y8D A;  1HG2 A;  4WNK A;  4X1K E;  3ZJ2 A;  2QA7 A;  2WMN A;  2VAS A;  4CXY A;  1HTJ F;  5L3G B;  3CQX C;  2LHR A;  4KBM B;  1G8X A;  2LT3 A;  3HL6 A;  4HFV A;  3CVR A;  2IC6 A;  2IAK A;  2I59 A;  2BVL A;  3P7I A;  2N9D A;  3RYI E;  3LJC A;  5L3E B;  4EXT A;  4IST A;  3KV9 A;  3GWH A;  1LVK A;  2EHO B;  1UX4 A;  4HN9 A;  2XHE B;  3FBL A;  4F6R C;  3LBX A;  4EYU A;  2Y6X A;  4I43 B;  5FY7 A;  3N2K E;  1D0Y A;  5JVD E;  4CQI A;  1UCU A;  5LHG B;  5HYA A;  3HI2 A;  4WBO A;  3W15 B;  2K24 A;  3ZCI A;  2M67 A;  2WWU A;  2BVM A;  3RPU A;  3ZYK A;  4ZI2 C;  1IAP A;  2A3D A;  2LOP A;  4UEL A;  3Q5X A;  3P8C D;  1SA0 E;  2J1D G;  1Z0P A;  2OA5 A;  3Q2M A;  3ZCJ A;  4DMV A;  5LA6 E;  4ZS2 A;  1S35 A;  2IW5 B;  4L0R A;  3FXE B;  2CXL A;  3ZMU B;  2JQQ A;  4H63 V;  2ACX A;  2YIN A;  5LGT B;  4AQF A;  5L3C B;  3KBT A;  3UT5 E;  4ZI7 E;  3OJA A;  3EUH A;  5LOV E;  4XZC A;  2NW9 A;  4A56 A;  3AA1 B;  3AA0 B;  2X9Y A;  3VHL A;  5LJN A;  1WLX A;  3DJB A;  3UUN A;  1BR4 A;  5HXE A;  5LG4 A;  2X67 A;  5JR9 A;  3WAK A;  3CML A;  3QK6 A;  3ZEF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...