4TX5A

Crystal structure of smac-diablo (in space group p65)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
SEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLREDLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The activator of apoptosis Smac-DIABLO acts as a tetramer in solution.
pubmed doi rcsb
molecule keywords Diablo homolog, mitochondrial
molecule tags Apoptosis
source organism Homo sapiens
total genus 90
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tx5A00
1EZ3A 1S94A 5M4YA 1HS7A 4JEHB 4JEUB 1G73A 2DNXA 1BR0A 3C98B 5LG4A 4TX5A 1FIOA 1FEWA 3LG7A 2XHEB
chains in the Genus database with same CATH superfamily
5LBMA 3IA3A 3P8CD 2IIUA 3PUAA 1IAPA 2UXBT 1B7TA 1D1BA 4O4JE 4BJMA 3E0ZA 2XQ8A 4IDNA 3HKBE 3HA4A 5L3DB 1I94T 3Q2MA 1N33T 4OYJA 2YDSA 3DTOA 5EZYE 1IBMT 3AE6A 5HEUA 4DR2T 4PK5A 2BVLA 3UFEA 2V7JA 5GONE 3LBXB 4DBRA 4YHJA 3P4WA 4XZCA 2NTYA 2HN1A 5L2LA 2BBHA 2WDQA 2V8SV 5HXSA 4IIJE 1G8XA 1XNRT 4X1YE 4AKRB 3LSVA 4DUYT 3QB5A 3R84B 3AEAA 4HWFA 1SA0E 4X66T 4LMKA 3UFGA 2V26A 4WBOA 2Y48B 4NUVA 2LJLA 5DJQC 3C64A 4UF0A 5L3EB 4I4TE 3L39A 4GIWA 1HNWT 2CWOA 2FJEA 2YINA 4LF7T 2LSIA 2WSSV 5C8YE 3AA7B 4DVDA 3FZFB 4AXPA 2WZHA 3T8OA 4DR6T 3L8RA 2KSRA 2WDVA 4XAXB 5LJNA 4P1NA 3FBLA 3ANWB 3I0QA 5HWXA 3CX8B 4DIDB 4U74A 3KV6A 4TN7B 2ZM0A 4QX8B 4ISSA 2D5UA 4ERRA 3RYHE 3N2GE 2LM2A 4CN4A 3WAKA 2AE9A 4COFA 4DV7T 4G2AA 2K48A 3O9XA 3C4WA 2UU9T 2CEAA 4UV8B 3O1JA 2J4GA 1W0AA 4HWCA 1S94A 4OX9T 5CGMA 4J2CA 3MJXA 2X51A 3PUSA 4MBQA 4Z90A 5FL1A 5LGNB 5HEHA 2YN6A 3MKDA 5C3JA 2YU1A 3HKCE 1ZKEA 5LP6E 2OV9A 3RRCA 5IYZE 1BR2A 3P50A 1WYCA 5LHIB 2L3LA 1CUNA 5JREA 1T98A 3Q5WA 4AI6A 2J1DG 3N2KE 3ETVA 3N9MA 2CXLA 3AB3B 4HWIB 2LRLA 4DV2T 3CQCB 4JUYA 1YW0A 4CXWA 3RYFE 2BZBA 3ESLA 3N2OA 4L5GA 4K0KT 4YSXA 1OXZA 3H3AA 1HNZT 4CXXA 2F4VT 4HFVA 4PFOA 4DMWA 4TV9E 1WYBA 4U7YA 3VR8A 4DR3T 2W62A 1FIOA 4MHCA 5ADXL 3T1YT 3VHLA 3RIAA 4O2AE 4DR7T 2JPFA 2I59A 3ZCIA 2M6IA 4IGUA 3P7IA 4CI2B 2XQAA 4PJNA 2XSAA 1KF6A 2WAUA 4FI5A 5LBQB 1ZHCA 1ZOYA 3HR0A 4AIUA 1Z0PA 4N78D 1MNEA 5H6QB 2CRBA 4IE6A 3G06A 3ANWA 3B5MA 1X9BA 4IE7A 4HWHA 5CA0E 2W2UA 4PJLA 4JBWF 1U4QA 3PU3A 3F31A 3EVYA 1FJGT 4I55E 3ZJ2A 1D0XA 4I50E 5J1GA 2XQ7A 2VKJA 3RF1A 4UVAB 2X9XA 1J5ET 4ZZCA 2PFVA 5LHHB 2KZ7B 1N36T 3MK7C 3FHNA 2E5VA 1NEKA 3TKLB 4CN1A 3GWHA 3I9WA 2E2AA 1UURA 4KI0F 4HFDA 3GA8A 2A2FX 4O8SA 2XAHB 2K3WA 5AQQB 1MIWA 2FJDA 1Z8UA 2YKSA 4QXBB 4PAGA 2KWIB 4YTNA 5LMNT 1IJ6A 2EHOB 3AAAB 2FJBA 2XTLA 2BKPA 2UXNB 2RA1A 3VRAA 1W0BA 3EDVA 1R8IA 5AQNB 3RKOA 1DU2A 4AKHA 2VASA 4HFBA 1J1JA 3V5UA 2DI4A 4O4LE 2VB6A 3QK6A 3P4RA 2CLYC 5AQRB 2X0YA 3HL6A 3W15B 2DWKA 3X1DA 4EZHA 4EGWA 1HNXT 5JDFA 1E2AA 5CFBA 3ZC1A 3ZMTB 2MYSA 3ONXA 4Q25A 1WR6A 2IC6A 2CMRA 4V1Av 4IDPA 4LFAT 5ABEA 5LNKA 4EB6E 1MIVA 3UULA 4JLEA 5ABFA 4UEMA 4X20E 1T7SA 4B3MT 3UU4A 1JNZA 1XDPA 4TNVA 5J2TE 2FUPA 2BS2A 2RPAA 1HG2A 5FY0A 5JDQA 2E9XD 4HKAA 4AKLA 2CWYA 3N9NA 3SS1A 2XQ5A 4CN6A 2JIWA 2DNXA 2XQ9A 3EI0A 5J0ZA 4ZS2A 4AQGA 2LHRA 2X66A 2LHNA 3NWIA 5LA6E 4MFRA 1HF8A 3SRZA 3MA9A 2CM0A 2XAFB 5LCYA 3CQXC 5KDMC 5LOVE 4JI4T 2WZIA 2D9DA 2MBGA 2UXDT 1MIYA 1UX5A 5L3FB 5CB4E 4NPPA 3FB2A 3FXDB 3RQWA 4C91A 4U31A 1M62A 2K24A 1ZP0A 5EK4A 3GMIA 2D2SA 2HPLA 3OPCA 5HEJA 2V6XA 2EHOA 3RC3A 2EHOC 1I6ZA 2C5JA 1MMDA 2L9QA 4LF9T 3EHZA 1HS7A 3B57A 5ABGA 4EZ4A 3ZC0A 5HEGA 1GQEA 5HCJA 4HGAA 2G0UA 5JRCB 4DV0T 4CXYA 5F5WA 4C90A 3GN5B 5L3CB 4QXCB 2AXDS 3SFEA 1T72A 4U72A 3AE8A 2VKOA 1KK7A 5AFUL 2LSKA 4DO0A 3OBVE 3ZYKA 5BMVE 4ILAA 3QUJA 4TV8E 2JQKA 3UQ4A 4CI3B 2B76A 2I0MA 3P4PA 2Z6EA 2V7LA 3NBXX 1T8BA 2Q9QA 2KINB 1NENA 4GK5E 4TWDA 2Q9QC 2LEHA 5M4YA 4EXTA 2LLYA 4WBNE 5KXJA 2YEVC 2VKDA 1UGOA 1BR4A 4EEBA 1HG5A 3RIUC 4MLKA 4DV3T 3KVBA 2LOSA 3DP7A 5EK3A 2XHEB 4ZI3D 3RI5A 3ZT6A 4PJJA 1NAFA 3LK42 2JQ9A 4UVBB 4DR5T 2N1GA 2V7MA 2ZMAA 2QRXA 4F6RC 3PUQA 4X1IE 2I6HA 2PJQA 2BS3A 4MALA 4KBMB 2M6BA 2V7IA 3CX7B 5ABHA 2MPKA 3JC6C 3EUHA 4DR1T 2MTQA 4JEHB 4HFCA 1YXRA 1MMNA 2BS4A 5FP3A 4YSZA 2XY8B 3M3ZB 2DL1A 4YY3T 3O1IA 4U3CA 3AVRA 1N32T 4JI1T 3UT5E 2N9DA 4OYKA 3D0TA 1XMOT 3AAEB 2D0UA 3AE7A 5H6RB 3WAJA 3K3NA 5AQOB 4E7ZA 3CIRA 2LKGA 2KNDA 5HCMA 1MMAA 3ZMUB 2IW5B 2IC9A 5C2TA 4P0AA 2W0GA 4ZXLA 5LGUB 4LF4T 4WNKA 1ZEEA 2ODVA 5JRCA 4B3TT 3AEDA 3I1AA 5AQJB 4A97A 2QGSA 3BQLA 4I43B 2Y8DA 3GN5A 4ZHQE 2WWVA 3TLWA 4A5XA 4QH5A 4AQFA 3KV4A 3ZT5A 3FZLB 5AQSB 4AQFC 1HCIA 2XAGB 4I0UA 2OLTA 3ZN0B 2YDRA 1FEWA 1IJ5A 3VKGA 3OYZA 4U2YA 3ZKRA 2CLYB 3CWZB 2BBJA 3UTKA 1J5WA 4DUZT 2V5DA 2IHR1 5AQUB 2W67A 1N34T 2UUCT 3J7Yq 3CPZA 2Y6XA 4QH1A 4AKIA 4ZI2D 4G63A 4IREA 1QUUA 3JAFA 4JI7T 4H63V 4B3RT 3UU6A 2JQHA 5KMGP 4WZXA 4IE4A 4UV9B 4EYYR 3AE3A 5ABFB 3PUVF 3L3PA 3EAMA 4P09A 1HFAA 2WMOA 5E0OA 4AISA 3C98B 4NXNT 2IUBA 1KEYA 4UVCB 1KNZA 3RQUA 5JTGA 1D1CA 3RKGA 4PW8A 2XAJB 3OTOT 2HN2A 3NZQA 4EIWA 1UUSA 2LSYA 5IHYA 3KV5A 2XAQB 5FNVE 4KX6A 4L9IA 2W66A 4JYAT 1LRZA 3UUMA 4IDZA 3N9QA 4JI5T 1VOMA 2ES0A 1E7PA 4NUUA 2CHNA 2NW8A 4KP3C 3N9LA 1M7KA 2M67A 3NRXA 3HI2A 4HEAA 2UXXB 1QSDA 3QOFA 2ZLYA 3V5SA 4IE5A 1L0VA 4TUYE 3A8YC 4CZZB 2XJ7A 1WCRA 2WCAA 3PUZF 4B6XA 3RHWA 3ZEFB 5FVLA 5EK2A 3QNUA 5L3GB 4XBFB 3CQGB 3EABA 3PJAJ 2VVNA 5FY7A 2P9BA 2XM1A 1VCSA 2C5KT 3ZMZB 3PUWF 2BVMA 1SE7A 1LVFA 3HKDE 4Z91A 3FZMB 5AQHB 1UCUA 2WBLA 3I0OA 4A98A 4H63H 2LKHA 4JI8T 4B3ST 1JNRA 3KBTA 4ADZA 4Z8XA 3NZPA 3AE4A 2UUAT 2KT9A 4DV4T 3EDUA 3ZT7A 4M1PA 2WP9A 4QXHB 3UUNA 3LJCA 3NVOA 1LVKA 3PTRB 4H9NC 5JH7E 4YJ2E 2Q9QB 5HXCA 1E1HB 3ZSSA 5FYMA 5ETWA 5HWYA 3TLUA 2NR4A 1VRBA 4WYVA 4LMJA 5FVKA 5FY1A 4NIQA 2LRKA 2XASB 4PFPA 4HWDA 5F3JA 3QB5K 4KMCA 2L8KA 5LG4A 5JDLA 1MMGA 4IE0A 2LM9A 4UR9A 4IL9A 4IT4A 4GYRA 2NOXA 3ZCJA 4EOZB 3AEBA 4U7IA 4ILUA 3AE9A 4PNIA 2UUBT 3AECA 2A9UA 4UELA 2ZM8A 5TAOA 4HFHA 4KHZF 3PU8A 1OWAA 2YOEA 1XDOA 2IAKA 1HX8A 3OVUA 4OK0A 2BDEA 5LXTE 2RP4A 2JRKA 3LDQB 1W09A 3AE2A 4JI3T 2NWBA 4DV1T 4DNDA 3ZSTA 2A72A 3LK2B 4NXMT 2X67A 3AEEA 1IZNB 5HYAA 3AVSA 5AQLB 4KHPT 3VU7H 2IDOB 4JEUB 2VK9A 3SWHA 5AQGB 2LT3A 5FXXA 3ZJ1A 4F8HA 1IBLT 1XNQT 3I9YA 2H7OA 3J9X1 5IUXA 4WW0A 4X65T 3ZPOA 2CXDA 3PV0F 3Q9DA 5JDNA 3CKDA 2E8IA 2DCFA 2PBIA 2MOZA 2E9XB 3LFMA 3RGLA 1YQ3A 2H88A 3IBPA 2X9HA 2LOPA 5JR9B 2WWUA 5FXWA 3CK6A 2XQ4A 5DABA 3AA6B 3MACA 3WI3A 1BR0A 1XZYA 3LG7A 5JDGA 4UIGA 2CE7A 3NRYA 3VKHA 4ANJA 3LK3B 5LYJE 2XM2A 1YD8G 2JQQA 2J62A 4DV6T 2DLRA 2DWGA 4X1KE 3RH3A 1WR0A 3ONJA 2CBJA 1H7CA 1US7B 5AQIB 4GYSA 4H9SE 1G73A 1YKHB 1S35A 4DMVA 2NP9A 3RLFF 4YT0A 3BK9A 4H9QC 4OHFA 2YU2A 3SOLA 2JMKA 1AJ3A 4H9RC 3PJAA 2WMNA 3M65A 3HKEE 4IL4A 5LB7B 3RIUA 2LSJA 4QH4A 1OEDB 5AQVB 5CJ5A 2HHHT 1BR1A 2WQYA 4CI1B 5AQTB 2N2NA 2WB5A 4LF5T 3ABVA 1QLBA 2KLQA 3AE1A 4HTEA 2WM9A 1U5PA 4EAHA 4TNWA 4X62T 3Q5DA 3N5LA 1EZ3A 5FXZA 1HR0T 5JQGE 3O4XE 3ETUA 4TWFA 1V9DA 2CBIA 3C50A 3PURA 2K5BB 5JDHA 2ACXA 5CA1E 3A7MA 3OKQA 4K0UA 3ONLC 4YJ3E 2H7VC 2XQYA 3E08A 1D0ZA 2FJAA 1IBKT 2MAWA 2QA7A 2V1DB 3KBUA 3KINB 3UQ7A 5LG3A 2V5CA 3IHRA 4JI6T 3K3QC 2JJ9A 1UX4A 2X9YA 2WY2A 4ASKA 2VVSA 3QC9A 3RIFA 1OEDE 3FZHB 3MZKB 5LJMA 3JAEA 3TLTA 1KNPA 4DBQA 1WFDA 2SPCA 3ZYLA 5F8PA 3T1HT 3CX6B 3FZKB 5A1LA 2E9XA 2XQ3A 3AEFA 3CMLA 1SHZC 3AXJB 2E9XC 5JR9A 5BR8T 5JR9C 5L4HA 4ISTA 1NWMX 5HXEA 2VL8A 3AA0B 3Q5XA 5LMUT 3F57A 2BG9B 5LHGB 2HPJA 3N9PA 3UU3A 4TX5A 3PDYA 5AQMB 4GOUA 3PUGA 5HEOA 2XZEA 2V7KA 2H89A 4CQIA 3O1HA 1XMQT 2JMHA 3RC8A 4YSYA 3C4ZA 2NTXA 2ODUA 2R6GF 4YFSA 4E7SA 4H9PC 3UUBA 3LBXA 1WLXA 5FMNA 4JI0T 5DQVA 4LMLA 1OEDA 3P4QA 1OEDC 3BQIA 3ZYMA 2QYWA 3JADA 4PJMA 5FL0A 4U2ZA 1X79A 2BG9E 3JCFA 4X64T 3RRWA 1HTJF 2XQ6A 3ZN1B 3K8PC 1WRDA 3PE0A 2VQFT 4YXDA 2QVAA 4YLHA 3P4SA 3ZMVB 3C51A 5FXVA 4GKKT 2VL0A 4O2BE 4IDQA 4ZOLE 2LSGA 3KV9A 3DJBA 2ZM6T 4LFCT 2EHOD 5IWAT 5AQPB 4GKJT 4HFEA 4BJNA 2NW7A 1YKEB 2VURA 3Q5EA 5KX5E 4OFZA 3L09A 3IEEA 3H37A 3C4XA 3KDSE 2OA5A 5HXHA 2J47A 3MXZA 4JI2T 4ZI3C 4H9OC 3N9OA 1MNDA 3AXJA 1ZV4X 3OYXA 1YQ4A 2CA5A 2W63A 2H3RA 3AEGA 4FJOA 3ZMSB 4BAYB 4IDOA 4O4IE 2BG9A 2V6YB 4LF8T 2CXFA 3VR9A 2WU5A 2A3DA 2BG9C 4ZEYA 2Q9QD 4KUMB 2C5IT 2W4XA 4QWNB 2B1EA 5J2UE 3KVAA 3F2EA 2WU2A 3S4UA 4YHHT 1FMVA 5L4EA 4O4HE 4AKGA 2YK0A 3R6NA 2HH7A 5DQWA 3U3IA 4X5TA 2LE8A 2CHOA 5JVDE 1KNRA 1UK5A 2FBWA 4PK6A 2WS3A 3OJAA 3A5XA 3IF8B 4HN9A 1W9RA 4A56A 3KFWX 3CVRA 4IHJE 4EV6A 3JC6D 5FKYA 2K9AA 3AE5A 4ILBA 2X0LB 2WDRA 2VKHA 4LF6T 4QHOA 2UXCT 3PUYF 4ZI7E 2XUEA 5AQFB 4LFBT 5HAXA 5L47A 2W00A 2NW9A 2PG8A 3RYIE 4QKNA 4QX7B 3B13A 3UU8A 2KXPB 4AQYT 3K1SA 4UF0B 3U78A 4YTMA 4BA9A 1CHUA 3UU5A 3ZLIA 2PTFA 3FBZA 2IMLA 4EYUA 3PUXF 4P0BA 4PK4A 2BKOA 3UUXB 2VWAA 4ZI2C 3E22E 1Y64B 3TLSA 2C0SA 4EEDA 5AQKB 4DV5T 3RYCE 4YTPA 1Y01A 3H3MA 5HXRA 3VRBA 1D1AA 2X68A 2XPKA 4U33A 2ZM2A 5L3BB 4ZS3A 1D0YA 3RPUA 1LKXA 4L0RA 4JV5T 2VQET 4ILCA 3AAIA 2V6YA 2YDQA 2KMFA 3RX6A 3BQKA 1FMWA 1O3XA 2GK9A 5LGTB 3SFDA 2X9WA 3AA1B 2CPTA 2DHRA 2W61A 2XSBA 4ZZBA 4TWHA 1KFYA 2D0TA 2ACZA 2X0HA 2CCQA 3FXEB 3TLVA 2E5LT 3NKZA 1HX1B 1VCTA 4TZ4C 4HE8A 5JDMA 4UXNB 3K3OA 1XWMA 4GK0E 1SUMB 2BKNA 4DR4T 4HFIA 2KWHA
chains in the Genus database with same CATH topology
3UUMA 4UEMA 5JR9A 5LBMA 4IDZA 3N9QA 3P8CD 4X20E 3PUAA 1IAPA 1VOMA 2ES0A 5JR9C 1B7TA 1D1BA 4O4JE 4NUUA 4BJMA 3E0ZA 4ISTA 1NWMX 5HXEA 2NW8A 3HKBE 3HA4A 2VL8A 5L3DB 3AA0B 3Q5XA 3F57A 4KP3C 3N9LA 5J2TE 2M67A 3Q2MA 3NRXA 3HI2A 4HEAA 2UXXB 5LHGB 1QSDA 2HPJA 4OYJA 3N9PA 2ZLYA 1HG2A 4IE5A 3DTOA 3V5SA 5EZYE 4PK5A 2BVLA 3UFEA 2V7JA 4TX5A 5GONE 4TUYE 3LBXB 5FY0A 5JDQA 4DBRA 2E9XD 4HKAA 4CZZB 4YHJA 3PDYA 4AKLA 2CWYA 3N9NA 3SS1A 4XZCA 4B6XA 2NTYA 2DNXA 4GOUA 3PUGA 5L2LA 4ZS2A 4AQGA 2LHRA 3ZEFB 5HXSA 2X66A 4IIJE 2LHNA 1G8XA 5LA6E 4MFRA 2V7KA 5EK2A 4X1YE 5L3GB 4AKRB 4CQIA 4XBFB 3O1HA 3CQGB 1HF8A 3RC8A 3SRZA 3R84B 3MA9A 5FY7A 2P9BA 1SA0E 3C4ZA 2C5KT 2CM0A 2XAFB 3ZMZB 2BVMA 2NTXA 3CQXC 5LCYA 5KDMC 2V26A 2ODUA 5LOVE 4WBOA 2Y48B 4NUVA 1LVFA 2MBGA 4YFSA 3HKDE 4E7SA 2LJLA 5DJQC 1MIYA 3C64A 1UX5A 4H9PC 5L3FB 4UF0A 5L3EB 5CB4E 3FB2A 3LBXA 1WLXA 3FXDB 4I4TE 1UCUA 5FMNA 2WBLA 4GIWA 3I0OA 4H63H 4C91A 5DQVA 3KBTA 4ADZA 2K24A 4Z8XA 2CWOA 3NZPA 2YINA 3BQIA 5EK4A 3ZYMA 2LSIA 2WSSV 5C8YE 3AA7B 4DVDA 3GMIA 4PJMA 2D2SA 4AXPA 2KT9A 1X79A 3T8OA 3EDUA 2HPLA 4M1PA 3RRWA 1HTJF 2EHOA 3RC3A 4XAXB 4QXHB 2EHOC 3ZN1B 5LJNA 3FBLA 3K8PC 2C5JA 1MMDA 1WRDA 3PE0A 2L9QA 3ANWB 3I0QA 3UUNA 3LJCA 5HWXA 3CX8B 1HS7A 3B57A 4EZ4A 4U74A 3ZC0A 1LVKA 3KV6A 4TN7B 4YLHA 2ZM0A 4QX8B 3PTRB 4ISSA 2D5UA 4H9NC 3ZMVB 3C51A 4HGAA 5FXVA 4ERRA 5JH7E 2G0UA 4O2BE 3RYHE 4YJ2E 5JRCB 4ZOLE 2Q9QB 5HXCA 1E1HB 2LSGA 3N2GE 5FYMA 5ETWA 5HWYA 3WAKA 4CXYA 1VRBA 3KV9A 3DJBA 4C90A 2EHOD 3GN5B 5L3CB 4QXCB 4G2AA 2K48A 5FY1A 4BJNA 3O9XA 2NW7A 2XASB 4PFPA 3C4WA 5F3JA 2CEAA 4KMCA 4UV8B 4U72A 2L8KA 5LG4A 5JDLA 2VKOA 1MMGA 1YKEB 1KK7A 5AFUL 2LSKA 4IE0A 4DO0A 2LM9A 3O1JA 3OBVE 3ZYKA 5BMVE 5KX5E 1S94A 3QUJA 4TV8E 4J2CA 4OFZA 3L09A 3MJXA 3IEEA 4GYRA 3H37A 4CI3B 2X51A 2NOXA 3C4XA 3KDSE 3ZCJA 3PUSA 2KWHA 4MBQA 2OA5A 4EOZB 5HXHA 5LGNB 4ILUA 2Z6EA 2V7LA 3NBXX 4PNIA 2Q9QA 4UELA 2KINB 3MKDA 2ZM8A 3MXZA 4GK5E 5TAOA 2YU1A 3HKCE 2Q9QC 4ZI3C 1ZKEA 4H9OC 5LP6E 3N9OA 3RRCA 1MNDA 2LEHA 5M4YA 5IYZE 1BR2A 4EXTA 1ZV4X 3OYXA 4WBNE 1WYCA 3PU8A 5LHIB 1OWAA 2IAKA 2L3LA 1HX8A 2CA5A 2VKDA 2YEVC 4OK0A 2W63A 2BDEA 5LXTE 2H3RA 1BR4A 2RP4A 2JRKA 1HG5A 4FJOA 3ZMSB 4MLKA 4BAYB 1CUNA 2NWBA 5JREA 1T98A 4O4IE 4DNDA 2CXFA 2A72A 3Q5WA 3LK2B 4AI6A 3KVBA 2LOSA 2A3DA 2J1DG 2X67A 3N2KE 3DP7A 1IZNB 3ETVA 5EK3A 2XHEB 5HYAA 2Q9QD 4ZI3D 3AVSA 3N9MA 4KUMB 2C5IT 2CXLA 4PJJA 1NAFA 3LK42 3AB3B 4UVBB 4QWNB 2B1EA 5J2UE 3KVAA 2N1GA 2V7MA 3VU7H 2ZMAA 3CQCB 3F2EA 4F6RC 3S4UA 4JEUB 2VK9A 4JUYA 3PUQA 3SWHA 1YW0A 4X1IE 4CXWA 2LT3A 3RYFE 2PJQA 1FMVA 2BZBA 3ESLA 4MALA 4O4HE 4KBMB 2YK0A 5FXXA 3R6NA 3ZJ1A 4AKGA 3N2OA 2V7IA 2HH7A 3CX7B 3I9YA 5DQWA 3U3IA 3JC6C 2H7OA 3J9X1 4WW0A 4L5GA 3EUHA 1OXZA 3ZPOA 3H3AA 2CXDA 4CXXA 3Q9DA 5JDNA 2MTQA 2LE8A 4HFVA 3CKDA 4JEHB 4PFOA 1MMNA 5FP3A 2E8IA 2DCFA 2PBIA 1LRZA 2MOZA 4DMWA 4TV9E 1WYBA 2E9XB 5JVDE 3LFMA 2W62A 1FIOA 3IBPA 2X9HA 2LOPA 4PK6A 5JR9B 2WWUA 3O1IA 3OJAA 3A5XA 3IF8B 4HN9A 5FXWA 3AVRA 4MHCA 5ADXL 3VHLA 4A56A 3KFWX 4O2AE 5DABA 3CVRA 2JPFA 4IHJE 2I59A 3ZCIA 3JC6D 3AA6B 3MACA 3UT5E 2N9DA 4IGUA 4OYKA 3P7IA 3D0TA 4CI2B 3WI3A 3AAEB 1BR0A 2D0UA 2K9AA 4PJNA 2WAUA 3LG7A 5JDGA 5H6RB 3WAJA 4UIGA 2CE7A 3K3NA 3NRYA 4FI5A 2X0LB 5LBQB 4E7ZA 1ZHCA 3VKHA 3HR0A 3LK3B 4ANJA 2KNDA 1Z0PA 1MMAA 5LYJE 4N78D 3ZMUB 2IW5B 1MNEA 2IC9A 2VKHA 5H6QB 1YD8G 2JQQA 4IE6A 2DLRA 2DWGA 4QHOA 3ANWA 4X1KE 3RH3A 2XUEA 4ZI7E 4P0AA 4IE7A 2W0GA 5HAXA 5CA0E 4PJLA 2W00A 2NW9A 5LGUB 1H7CA 1US7B 2PG8A 4GYSA 1U4QA 3PU3A 3F31A 4H9SE 3EVYA 4WNKA 3RYIE 1G73A 1YKHB 1ZEEA 2ODVA 5JRCA 4I55E 1S35A 3ZJ2A 3I1AA 1D0XA 4I50E 4DMVA 5J1GA 2NP9A 4QKNA 2QGSA 3BQLA 4I43B 2Y8DA 4QX7B 3B13A 3BK9A 4H9QC 2VKJA 2KXPB 2YU2A 4OHFA 3GN5A 3SOLA 4ZHQE 2JMKA 4UVAB 2X9XA 4H9RC 1AJ3A 2WMNA 4AQFA 3KV4A 3M65A 2PFVA 4UF0B 5LHHB 3U78A 3HKEE 2KZ7B 3MK7C 3FHNA 4AQFC 4BA9A 3TKLB 1HCIA 3GWHA 2XAGB 3ZLIA 2LSJA 3FBZA 3I9WA 3ZN0B 1FEWA 4EYUA 4PK4A 4P0BA 3UUXB 1IJ5A 2VWAA 3GA8A 2A2FX 3VKGA 3OYZA 4ZI2C 1BR1A 3E22E 1Y64B 4O8SA 2XAHB 2CLYB 3CWZB 3UTKA 1MIWA 2C0SA 4QXBB 4PAGA 2KWIB 1IJ6A 3RYCE 4CI1B 2EHOB 3AAAB 2N2NA 2XTLA 5HXRA 2KLQA 1D1AA 2X68A 4HTEA 3J7Yq 2UXNB 2WM9A 3CPZA 2ZM2A 1U5PA 2RA1A 5L3BB 4EAHA 4ZS3A 2Y6XA 1D0YA 3EDVA 1EZ3A 3N5LA 5FXZA 3RPUA 4AKIA 4ZI2D 5JQGE 3O4XE 4G63A 1LKXA 4L0RA 3RKOA 3ETUA 1QUUA 4H63V 1V9DA 3AAIA 4AKHA 5KMGP 2VASA 3C50A 3PURA 2KMFA 3RX6A 3V5UA 4IE4A 2K5BB 2DI4A 3BQKA 1FMWA 4UV9B 1O3XA 5JDHA 4O4LE 2GK9A 2ACXA 2VB6A 3QK6A 5CA1E 5LGTB 3OKQA 4K0UA 4EYYR 2CLYC 4YJ3E 2H7VC 2XQYA 3E08A 3HL6A 2X9WA 1D0ZA 3AA1B 3L3PA 2DHRA 2W61A 3W15B 4P09A 2QA7A 1HFAA 2V1DB 3KBUA 2DWKA 3KINB 4EZHA 2WMOA 2D0TA 5E0OA 5JDFA 3IHRA 3K3QC 2JJ9A 1UX4A 2X9YA 3ZC1A 3ZMTB 2MYSA 4ASKA 3C98B 3ONXA 3QC9A 2CCQA 3FXEB 1WR6A 2IC6A 2CMRA 3MZKB 4UVCB 4V1Av 5LJMA 1KNZA 4DBQA 4TZ4C 5LNKA 4HE8A 4EB6E 4UXNB 5JDMA 1D1CA 3K3OA 4GK0E 4PW8A 2SPCA 2XAJB 1MIVA 3ZYLA 3UULA 4JLEA 5F8PA 3NZQA 3CX6B 4EIWA 2LSYA 5A1LA 2E9XA 5IHYA 3KV5A 2XAQB 3CMLA 5FNVE 1SHZC 4L9IA 2E9XC 2JMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZ3 A;  1S94 A;  5M4Y A;  1HS7 A;  4JEH B;  4JEU B;  1G73 A;  2DNX A;  1BR0 A;  3C98 B;  5LG4 A;  4TX5 A;  1FIO A;  1FEW A;  3LG7 A;  2XHE B; 
#chains in the Genus database with same CATH topology
 5LBM A;  3IA3 A;  3P8C D;  2IIU A;  3PUA A;  1IAP A;  2UXB T;  1B7T A;  1D1B A;  4O4J E;  4BJM A;  3E0Z A;  2XQ8 A;  4IDN A;  3HKB E;  3HA4 A;  5L3D B;  1I94 T;  3Q2M A;  1N33 T;  4OYJ A;  2YDS A;  3DTO A;  5EZY E;  1IBM T;  3AE6 A;  5HEU A;  4DR2 T;  4PK5 A;  2BVL A;  3UFE A;  2V7J A;  5GON E;  3LBX B;  4DBR A;  4YHJ A;  3P4W A;  4XZC A;  2NTY A;  2HN1 A;  5L2L A;  2BBH A;  2WDQ A;  2V8S V;  5HXS A;  4IIJ E;  1G8X A;  1XNR T;  4X1Y E;  4AKR B;  3LSV A;  4DUY T;  3QB5 A;  3R84 B;  3AEA A;  4HWF A;  1SA0 E;  4X66 T;  4LMK A;  3UFG A;  2V26 A;  4WBO A;  2Y48 B;  4NUV A;  2LJL A;  5DJQ C;  3C64 A;  4UF0 A;  5L3E B;  4I4T E;  3L39 A;  4GIW A;  1HNW T;  2CWO A;  2FJE A;  2YIN A;  4LF7 T;  2LSI A;  2WSS V;  5C8Y E;  3AA7 B;  4DVD A;  3FZF B;  4AXP A;  2WZH A;  3T8O A;  4DR6 T;  3L8R A;  2KSR A;  2WDV A;  4XAX B;  5LJN A;  4P1N A;  3FBL A;  3ANW B;  3I0Q A;  5HWX A;  3CX8 B;  4DID B;  4U74 A;  3KV6 A;  4TN7 B;  2ZM0 A;  4QX8 B;  4ISS A;  2D5U A;  4ERR A;  3RYH E;  3N2G E;  2LM2 A;  4CN4 A;  3WAK A;  2AE9 A;  4COF A;  4DV7 T;  4G2A A;  2K48 A;  3O9X A;  3C4W A;  2UU9 T;  2CEA A;  4UV8 B;  3O1J A;  2J4G A;  1W0A A;  4HWC A;  1S94 A;  4OX9 T;  5CGM A;  4J2C A;  3MJX A;  2X51 A;  3PUS A;  4MBQ A;  4Z90 A;  5FL1 A;  5LGN B;  5HEH A;  2YN6 A;  3MKD A;  5C3J A;  2YU1 A;  3HKC E;  1ZKE A;  5LP6 E;  2OV9 A;  3RRC A;  5IYZ E;  1BR2 A;  3P50 A;  1WYC A;  5LHI B;  2L3L A;  1CUN A;  5JRE A;  1T98 A;  3Q5W A;  4AI6 A;  2J1D G;  3N2K E;  3ETV A;  3N9M A;  2CXL A;  3AB3 B;  4HWI B;  2LRL A;  4DV2 T;  3CQC B;  4JUY A;  1YW0 A;  4CXW A;  3RYF E;  2BZB A;  3ESL A;  3N2O A;  4L5G A;  4K0K T;  4YSX A;  1OXZ A;  3H3A A;  1HNZ T;  4CXX A;  2F4V T;  4HFV A;  4PFO A;  4DMW A;  4TV9 E;  1WYB A;  4U7Y A;  3VR8 A;  4DR3 T;  2W62 A;  1FIO A;  4MHC A;  5ADX L;  3T1Y T;  3VHL A;  3RIA A;  4O2A E;  4DR7 T;  2JPF A;  2I59 A;  3ZCI A;  2M6I A;  4IGU A;  3P7I A;  4CI2 B;  2XQA A;  4PJN A;  2XSA A;  1KF6 A;  2WAU A;  4FI5 A;  5LBQ B;  1ZHC A;  1ZOY A;  3HR0 A;  4AIU A;  1Z0P A;  4N78 D;  1MNE A;  5H6Q B;  2CRB A;  4IE6 A;  3G06 A;  3ANW A;  3B5M A;  1X9B A;  4IE7 A;  4HWH A;  5CA0 E;  2W2U A;  4PJL A;  4JBW F;  1U4Q A;  3PU3 A;  3F31 A;  3EVY A;  1FJG T;  4I55 E;  3ZJ2 A;  1D0X A;  4I50 E;  5J1G A;  2XQ7 A;  2VKJ A;  3RF1 A;  4UVA B;  2X9X A;  1J5E T;  4ZZC A;  2PFV A;  5LHH B;  2KZ7 B;  1N36 T;  3MK7 C;  3FHN A;  2E5V A;  1NEK A;  3TKL B;  4CN1 A;  3GWH A;  3I9W A;  2E2A A;  1UUR A;  4KI0 F;  4HFD A;  3GA8 A;  2A2F X;  4O8S A;  2XAH B;  2K3W A;  5AQQ B;  1MIW A;  2FJD A;  1Z8U A;  2YKS A;  4QXB B;  4PAG A;  2KWI B;  4YTN A;  5LMN T;  1IJ6 A;  2EHO B;  3AAA B;  2FJB A;  2XTL A;  2BKP A;  2UXN B;  2RA1 A;  3VRA A;  1W0B A;  3EDV A;  1R8I A;  5AQN B;  3RKO A;  1DU2 A;  4AKH A;  2VAS A;  4HFB A;  1J1J A;  3V5U A;  2DI4 A;  4O4L E;  2VB6 A;  3QK6 A;  3P4R A;  2CLY C;  5AQR B;  2X0Y A;  3HL6 A;  3W15 B;  2DWK A;  3X1D A;  4EZH A;  4EGW A;  1HNX T;  5JDF A;  1E2A A;  5CFB A;  3ZC1 A;  3ZMT B;  2MYS A;  3ONX A;  4Q25 A;  1WR6 A;  2IC6 A;  2CMR A;  4V1A v;  4IDP A;  4LFA T;  5ABE A;  5LNK A;  4EB6 E;  1MIV A;  3UUL A;  4JLE A;  5ABF A;  4UEM A;  4X20 E;  1T7S A;  4B3M T;  3UU4 A;  1JNZ A;  1XDP A;  4TNV A;  5J2T E;  2FUP A;  2BS2 A;  2RPA A;  1HG2 A;  5FY0 A;  5JDQ A;  2E9X D;  4HKA A;  4AKL A;  2CWY A;  3N9N A;  3SS1 A;  2XQ5 A;  4CN6 A;  2JIW A;  2DNX A;  2XQ9 A;  3EI0 A;  5J0Z A;  4ZS2 A;  4AQG A;  2LHR A;  2X66 A;  2LHN A;  3NWI A;  5LA6 E;  4MFR A;  1HF8 A;  3SRZ A;  3MA9 A;  2CM0 A;  2XAF B;  5LCY A;  3CQX C;  5KDM C;  5LOV E;  4JI4 T;  2WZI A;  2D9D A;  2MBG A;  2UXD T;  1MIY A;  1UX5 A;  5L3F B;  5CB4 E;  4NPP A;  3FB2 A;  3FXD B;  3RQW A;  4C91 A;  4U31 A;  1M62 A;  2K24 A;  1ZP0 A;  5EK4 A;  3GMI A;  2D2S A;  2HPL A;  3OPC A;  5HEJ A;  2V6X A;  2EHO A;  3RC3 A;  2EHO C;  1I6Z A;  2C5J A;  1MMD A;  2L9Q A;  4LF9 T;  3EHZ A;  1HS7 A;  3B57 A;  5ABG A;  4EZ4 A;  3ZC0 A;  5HEG A;  1GQE A;  5HCJ A;  4HGA A;  2G0U A;  5JRC B;  4DV0 T;  4CXY A;  5F5W A;  4C90 A;  3GN5 B;  5L3C B;  4QXC B;  2AXD S;  3SFE A;  1T72 A;  4U72 A;  3AE8 A;  2VKO A;  1KK7 A;  5AFU L;  2LSK A;  4DO0 A;  3OBV E;  3ZYK A;  5BMV E;  4ILA A;  3QUJ A;  4TV8 E;  2JQK A;  3UQ4 A;  4CI3 B;  2B76 A;  2I0M A;  3P4P A;  2Z6E A;  2V7L A;  3NBX X;  1T8B A;  2Q9Q A;  2KIN B;  1NEN A;  4GK5 E;  4TWD A;  2Q9Q C;  2LEH A;  5M4Y A;  4EXT A;  2LLY A;  4WBN E;  5KXJ A;  2YEV C;  2VKD A;  1UGO A;  1BR4 A;  4EEB A;  1HG5 A;  3RIU C;  4MLK A;  4DV3 T;  3KVB A;  2LOS A;  3DP7 A;  5EK3 A;  2XHE B;  4ZI3 D;  3RI5 A;  3ZT6 A;  4PJJ A;  1NAF A;  3LK4 2;  2JQ9 A;  4UVB B;  4DR5 T;  2N1G A;  2V7M A;  2ZMA A;  2QRX A;  4F6R C;  3PUQ A;  4X1I E;  2I6H A;  2PJQ A;  2BS3 A;  4MAL A;  4KBM B;  2M6B A;  2V7I A;  3CX7 B;  5ABH A;  2MPK A;  3JC6 C;  3EUH A;  4DR1 T;  2MTQ A;  4JEH B;  4HFC A;  1YXR A;  1MMN A;  2BS4 A;  5FP3 A;  4YSZ A;  2XY8 B;  3M3Z B;  2DL1 A;  4YY3 T;  3O1I A;  4U3C A;  3AVR A;  1N32 T;  4JI1 T;  3UT5 E;  2N9D A;  4OYK A;  3D0T A;  1XMO T;  3AAE B;  2D0U A;  3AE7 A;  5H6R B;  3WAJ A;  3K3N A;  5AQO B;  4E7Z A;  3CIR A;  2LKG A;  2KND A;  5HCM A;  1MMA A;  3ZMU B;  2IW5 B;  2IC9 A;  5C2T A;  4P0A A;  2W0G A;  4ZXL A;  5LGU B;  4LF4 T;  4WNK A;  1ZEE A;  2ODV A;  5JRC A;  4B3T T;  3AED A;  3I1A A;  5AQJ B;  4A97 A;  2QGS A;  3BQL A;  4I43 B;  2Y8D A;  3GN5 A;  4ZHQ E;  2WWV A;  3TLW A;  4A5X A;  4QH5 A;  4AQF A;  3KV4 A;  3ZT5 A;  3FZL B;  5AQS B;  4AQF C;  1HCI A;  2XAG B;  4I0U A;  2OLT A;  3ZN0 B;  2YDR A;  1FEW A;  1IJ5 A;  3VKG A;  3OYZ A;  4U2Y A;  3ZKR A;  2CLY B;  3CWZ B;  2BBJ A;  3UTK A;  1J5W A;  4DUZ T;  2V5D A;  2IHR 1;  5AQU B;  2W67 A;  1N34 T;  2UUC T;  3J7Y q;  3CPZ A;  2Y6X A;  4QH1 A;  4AKI A;  4ZI2 D;  4G63 A;  4IRE A;  1QUU A;  3JAF A;  4JI7 T;  4H63 V;  4B3R T;  3UU6 A;  2JQH A;  5KMG P;  4WZX A;  4IE4 A;  4UV9 B;  4EYY R;  3AE3 A;  5ABF B;  3PUV F;  3L3P A;  3EAM A;  4P09 A;  1HFA A;  2WMO A;  5E0O A;  4AIS A;  3C98 B;  4NXN T;  2IUB A;  1KEY A;  4UVC B;  1KNZ A;  3RQU A;  5JTG A;  1D1C A;  3RKG A;  4PW8 A;  2XAJ B;  3OTO T;  2HN2 A;  3NZQ A;  4EIW A;  1UUS A;  2LSY A;  5IHY A;  3KV5 A;  2XAQ B;  5FNV E;  4KX6 A;  4L9I A;  2W66 A;  4JYA T;  1LRZ A;  3UUM A;  4IDZ A;  3N9Q A;  4JI5 T;  1VOM A;  2ES0 A;  1E7P A;  4NUU A;  2CHN A;  2NW8 A;  4KP3 C;  3N9L A;  1M7K A;  2M67 A;  3NRX A;  3HI2 A;  4HEA A;  2UXX B;  1QSD A;  3QOF A;  2ZLY A;  3V5S A;  4IE5 A;  1L0V A;  4TUY E;  3A8Y C;  4CZZ B;  2XJ7 A;  1WCR A;  2WCA A;  3PUZ F;  4B6X A;  3RHW A;  3ZEF B;  5FVL A;  5EK2 A;  3QNU A;  5L3G B;  4XBF B;  3CQG B;  3EAB A;  3PJA J;  2VVN A;  5FY7 A;  2P9B A;  2XM1 A;  1VCS A;  2C5K T;  3ZMZ B;  3PUW F;  2BVM A;  1SE7 A;  1LVF A;  3HKD E;  4Z91 A;  3FZM B;  5AQH B;  1UCU A;  2WBL A;  3I0O A;  4A98 A;  4H63 H;  2LKH A;  4JI8 T;  4B3S T;  1JNR A;  3KBT A;  4ADZ A;  4Z8X A;  3NZP A;  3AE4 A;  2UUA T;  2KT9 A;  4DV4 T;  3EDU A;  3ZT7 A;  4M1P A;  2WP9 A;  4QXH B;  3UUN A;  3LJC A;  3NVO A;  1LVK A;  3PTR B;  4H9N C;  5JH7 E;  4YJ2 E;  2Q9Q B;  5HXC A;  1E1H B;  3ZSS A;  5FYM A;  5ETW A;  5HWY A;  3TLU A;  2NR4 A;  1VRB A;  4WYV A;  4LMJ A;  5FVK A;  5FY1 A;  4NIQ A;  2LRK A;  2XAS B;  4PFP A;  4HWD A;  5F3J A;  3QB5 K;  4KMC A;  2L8K A;  5LG4 A;  5JDL A;  1MMG A;  4IE0 A;  2LM9 A;  4UR9 A;  4IL9 A;  4IT4 A;  4GYR A;  2NOX A;  3ZCJ A;  4EOZ B;  3AEB A;  4U7I A;  4ILU A;  3AE9 A;  4PNI A;  2UUB T;  3AEC A;  2A9U A;  4UEL A;  2ZM8 A;  5TAO A;  4HFH A;  4KHZ F;  3PU8 A;  1OWA A;  2YOE A;  1XDO A;  2IAK A;  1HX8 A;  3OVU A;  4OK0 A;  2BDE A;  5LXT E;  2RP4 A;  2JRK A;  3LDQ B;  1W09 A;  3AE2 A;  4JI3 T;  2NWB A;  4DV1 T;  4DND A;  3ZST A;  2A72 A;  3LK2 B;  4NXM T;  2X67 A;  3AEE A;  1IZN B;  5HYA A;  3AVS A;  5AQL B;  4KHP T;  3VU7 H;  2IDO B;  4JEU B;  2VK9 A;  3SWH A;  5AQG B;  2LT3 A;  5FXX A;  3ZJ1 A;  4F8H A;  1IBL T;  1XNQ T;  3I9Y A;  2H7O A;  3J9X 1;  5IUX A;  4WW0 A;  4X65 T;  3ZPO A;  2CXD A;  3PV0 F;  3Q9D A;  5JDN A;  3CKD A;  2E8I A;  2DCF A;  2PBI A;  2MOZ A;  2E9X B;  3LFM A;  3RGL A;  1YQ3 A;  2H88 A;  3IBP A;  2X9H A;  2LOP A;  5JR9 B;  2WWU A;  5FXW A;  3CK6 A;  2XQ4 A;  5DAB A;  3AA6 B;  3MAC A;  3WI3 A;  1BR0 A;  1XZY A;  3LG7 A;  5JDG A;  4UIG A;  2CE7 A;  3NRY A;  3VKH A;  4ANJ A;  3LK3 B;  5LYJ E;  2XM2 A;  1YD8 G;  2JQQ A;  2J62 A;  4DV6 T;  2DLR A;  2DWG A;  4X1K E;  3RH3 A;  1WR0 A;  3ONJ A;  2CBJ A;  1H7C A;  1US7 B;  5AQI B;  4GYS A;  4H9S E;  1G73 A;  1YKH B;  1S35 A;  4DMV A;  2NP9 A;  3RLF F;  4YT0 A;  3BK9 A;  4H9Q C;  4OHF A;  2YU2 A;  3SOL A;  2JMK A;  1AJ3 A;  4H9R C;  3PJA A;  2WMN A;  3M65 A;  3HKE E;  4IL4 A;  5LB7 B;  3RIU A;  2LSJ A;  4QH4 A;  1OED B;  5AQV B;  5CJ5 A;  2HHH T;  1BR1 A;  2WQY A;  4CI1 B;  5AQT B;  2N2N A;  2WB5 A;  4LF5 T;  3ABV A;  1QLB A;  2KLQ A;  3AE1 A;  4HTE A;  2WM9 A;  1U5P A;  4EAH A;  4TNW A;  4X62 T;  3Q5D A;  3N5L A;  1EZ3 A;  5FXZ A;  1HR0 T;  5JQG E;  3O4X E;  3ETU A;  4TWF A;  1V9D A;  2CBI A;  3C50 A;  3PUR A;  2K5B B;  5JDH A;  2ACX A;  5CA1 E;  3A7M A;  3OKQ A;  4K0U A;  3ONL C;  4YJ3 E;  2H7V C;  2XQY A;  3E08 A;  1D0Z A;  2FJA A;  1IBK T;  2MAW A;  2QA7 A;  2V1D B;  3KBU A;  3KIN B;  3UQ7 A;  5LG3 A;  2V5C A;  3IHR A;  4JI6 T;  3K3Q C;  2JJ9 A;  1UX4 A;  2X9Y A;  2WY2 A;  4ASK A;  2VVS A;  3QC9 A;  3RIF A;  1OED E;  3FZH B;  3MZK B;  5LJM A;  3JAE A;  3TLT A;  1KNP A;  4DBQ A;  1WFD A;  2SPC A;  3ZYL A;  5F8P A;  3T1H T;  3CX6 B;  3FZK B;  5A1L A;  2E9X A;  2XQ3 A;  3AEF A;  3CML A;  1SHZ C;  3AXJ B;  2E9X C;  5JR9 A;  5BR8 T;  5JR9 C;  5L4H A;  4IST A;  1NWM X;  5HXE A;  2VL8 A;  3AA0 B;  3Q5X A;  5LMU T;  3F57 A;  2BG9 B;  5LHG B;  2HPJ A;  3N9P A;  3UU3 A;  4TX5 A;  3PDY A;  5AQM B;  4GOU A;  3PUG A;  5HEO A;  2XZE A;  2V7K A;  2H89 A;  4CQI A;  3O1H A;  1XMQ T;  2JMH A;  3RC8 A;  4YSY A;  3C4Z A;  2NTX A;  2ODU A;  2R6G F;  4YFS A;  4E7S A;  4H9P C;  3UUB A;  3LBX A;  1WLX A;  5FMN A;  4JI0 T;  5DQV A;  4LML A;  1OED A;  3P4Q A;  1OED C;  3BQI A;  3ZYM A;  2QYW A;  3JAD A;  4PJM A;  5FL0 A;  4U2Z A;  1X79 A;  2BG9 E;  3JCF A;  4X64 T;  3RRW A;  1HTJ F;  2XQ6 A;  3ZN1 B;  3K8P C;  1WRD A;  3PE0 A;  2VQF T;  4YXD A;  2QVA A;  4YLH A;  3P4S A;  3ZMV B;  3C51 A;  5FXV A;  4GKK T;  2VL0 A;  4O2B E;  4IDQ A;  4ZOL E;  2LSG A;  3KV9 A;  3DJB A;  2ZM6 T;  4LFC T;  2EHO D;  5IWA T;  5AQP B;  4GKJ T;  4HFE A;  4BJN A;  2NW7 A;  1YKE B;  2VUR A;  3Q5E A;  5KX5 E;  4OFZ A;  3L09 A;  3IEE A;  3H37 A;  3C4X A;  3KDS E;  2OA5 A;  5HXH A;  2J47 A;  3MXZ A;  4JI2 T;  4ZI3 C;  4H9O C;  3N9O A;  1MND A;  3AXJ A;  1ZV4 X;  3OYX A;  1YQ4 A;  2CA5 A;  2W63 A;  2H3R A;  3AEG A;  4FJO A;  3ZMS B;  4BAY B;  4IDO A;  4O4I E;  2BG9 A;  2V6Y B;  4LF8 T;  2CXF A;  3VR9 A;  2WU5 A;  2A3D A;  2BG9 C;  4ZEY A;  2Q9Q D;  4KUM B;  2C5I T;  2W4X A;  4QWN B;  2B1E A;  5J2U E;  3KVA A;  3F2E A;  2WU2 A;  3S4U A;  4YHH T;  1FMV A;  5L4E A;  4O4H E;  4AKG A;  2YK0 A;  3R6N A;  2HH7 A;  5DQW A;  3U3I A;  4X5T A;  2LE8 A;  2CHO A;  5JVD E;  1KNR A;  1UK5 A;  2FBW A;  4PK6 A;  2WS3 A;  3OJA A;  3A5X A;  3IF8 B;  4HN9 A;  1W9R A;  4A56 A;  3KFW X;  3CVR A;  4IHJ E;  4EV6 A;  3JC6 D;  5FKY A;  2K9A A;  3AE5 A;  4ILB A;  2X0L B;  2WDR A;  2VKH A;  4LF6 T;  4QHO A;  2UXC T;  3PUY F;  4ZI7 E;  2XUE A;  5AQF B;  4LFB T;  5HAX A;  5L47 A;  2W00 A;  2NW9 A;  2PG8 A;  3RYI E;  4QKN A;  4QX7 B;  3B13 A;  3UU8 A;  2KXP B;  4AQY T;  3K1S A;  4UF0 B;  3U78 A;  4YTM A;  4BA9 A;  1CHU A;  3UU5 A;  3ZLI A;  2PTF A;  3FBZ A;  2IML A;  4EYU A;  3PUX F;  4P0B A;  4PK4 A;  2BKO A;  3UUX B;  2VWA A;  4ZI2 C;  3E22 E;  1Y64 B;  3TLS A;  2C0S A;  4EED A;  5AQK B;  4DV5 T;  3RYC E;  4YTP A;  1Y01 A;  3H3M A;  5HXR A;  3VRB A;  1D1A A;  2X68 A;  2XPK A;  4U33 A;  2ZM2 A;  5L3B B;  4ZS3 A;  1D0Y A;  3RPU A;  1LKX A;  4L0R A;  4JV5 T;  2VQE T;  4ILC A;  3AAI A;  2V6Y A;  2YDQ A;  2KMF A;  3RX6 A;  3BQK A;  1FMW A;  1O3X A;  2GK9 A;  5LGT B;  3SFD A;  2X9W A;  3AA1 B;  2CPT A;  2DHR A;  2W61 A;  2XSB A;  4ZZB A;  4TWH A;  1KFY A;  2D0T A;  2ACZ A;  2X0H A;  2CCQ A;  3FXE B;  3TLV A;  2E5L T;  3NKZ A;  1HX1 B;  1VCT A;  4TZ4 C;  4HE8 A;  5JDM A;  4UXN B;  3K3O A;  1XWM A;  4GK0 E;  1SUM B;  2BKN A;  4DR4 T;  4HFI A;  2KWH A; 
#chains in the Genus database with same CATH homology
 3UUM A;  4UEM A;  5JR9 A;  5LBM A;  4IDZ A;  3N9Q A;  3P8C D;  4X20 E;  3PUA A;  1IAP A;  1VOM A;  2ES0 A;  5JR9 C;  1B7T A;  1D1B A;  4O4J E;  4NUU A;  4BJM A;  3E0Z A;  4IST A;  1NWM X;  5HXE A;  2NW8 A;  3HKB E;  3HA4 A;  2VL8 A;  5L3D B;  3AA0 B;  3Q5X A;  3F57 A;  4KP3 C;  3N9L A;  5J2T E;  2M67 A;  3Q2M A;  3NRX A;  3HI2 A;  4HEA A;  2UXX B;  5LHG B;  1QSD A;  2HPJ A;  4OYJ A;  3N9P A;  2ZLY A;  1HG2 A;  4IE5 A;  3DTO A;  3V5S A;  5EZY E;  4PK5 A;  2BVL A;  3UFE A;  2V7J A;  4TX5 A;  5GON E;  4TUY E;  3LBX B;  5FY0 A;  5JDQ A;  4DBR A;  2E9X D;  4HKA A;  4CZZ B;  4YHJ A;  3PDY A;  4AKL A;  2CWY A;  3N9N A;  3SS1 A;  4XZC A;  4B6X A;  2NTY A;  2DNX A;  4GOU A;  3PUG A;  5L2L A;  4ZS2 A;  4AQG A;  2LHR A;  3ZEF B;  5HXS A;  2X66 A;  4IIJ E;  2LHN A;  1G8X A;  5LA6 E;  4MFR A;  2V7K A;  5EK2 A;  4X1Y E;  5L3G B;  4AKR B;  4CQI A;  4XBF B;  3O1H A;  3CQG B;  1HF8 A;  3RC8 A;  3SRZ A;  3R84 B;  3MA9 A;  5FY7 A;  2P9B A;  1SA0 E;  3C4Z A;  2C5K T;  2CM0 A;  2XAF B;  3ZMZ B;  2BVM A;  2NTX A;  3CQX C;  5LCY A;  5KDM C;  2V26 A;  2ODU A;  5LOV E;  4WBO A;  2Y48 B;  4NUV A;  1LVF A;  2MBG A;  4YFS A;  3HKD E;  4E7S A;  2LJL A;  5DJQ C;  1MIY A;  3C64 A;  1UX5 A;  4H9P C;  5L3F B;  4UF0 A;  5L3E B;  5CB4 E;  3FB2 A;  3LBX A;  1WLX A;  3FXD B;  4I4T E;  1UCU A;  5FMN A;  2WBL A;  4GIW A;  3I0O A;  4H63 H;  4C91 A;  5DQV A;  3KBT A;  4ADZ A;  2K24 A;  4Z8X A;  2CWO A;  3NZP A;  2YIN A;  3BQI A;  5EK4 A;  3ZYM A;  2LSI A;  2WSS V;  5C8Y E;  3AA7 B;  4DVD A;  3GMI A;  4PJM A;  2D2S A;  4AXP A;  2KT9 A;  1X79 A;  3T8O A;  3EDU A;  2HPL A;  4M1P A;  3RRW A;  1HTJ F;  2EHO A;  3RC3 A;  4XAX B;  4QXH B;  2EHO C;  3ZN1 B;  5LJN A;  3FBL A;  3K8P C;  2C5J A;  1MMD A;  1WRD A;  3PE0 A;  2L9Q A;  3ANW B;  3I0Q A;  3UUN A;  3LJC A;  5HWX A;  3CX8 B;  1HS7 A;  3B57 A;  4EZ4 A;  4U74 A;  3ZC0 A;  1LVK A;  3KV6 A;  4TN7 B;  4YLH A;  2ZM0 A;  4QX8 B;  3PTR B;  4ISS A;  2D5U A;  4H9N C;  3ZMV B;  3C51 A;  4HGA A;  5FXV A;  4ERR A;  5JH7 E;  2G0U A;  4O2B E;  3RYH E;  4YJ2 E;  5JRC B;  4ZOL E;  2Q9Q B;  5HXC A;  1E1H B;  2LSG A;  3N2G E;  5FYM A;  5ETW A;  5HWY A;  3WAK A;  4CXY A;  1VRB A;  3KV9 A;  3DJB A;  4C90 A;  2EHO D;  3GN5 B;  5L3C B;  4QXC B;  4G2A A;  2K48 A;  5FY1 A;  4BJN A;  3O9X A;  2NW7 A;  2XAS B;  4PFP A;  3C4W A;  5F3J A;  2CEA A;  4KMC A;  4UV8 B;  4U72 A;  2L8K A;  5LG4 A;  5JDL A;  2VKO A;  1MMG A;  1YKE B;  1KK7 A;  5AFU L;  2LSK A;  4IE0 A;  4DO0 A;  2LM9 A;  3O1J A;  3OBV E;  3ZYK A;  5BMV E;  5KX5 E;  1S94 A;  3QUJ A;  4TV8 E;  4J2C A;  4OFZ A;  3L09 A;  3MJX A;  3IEE A;  4GYR A;  3H37 A;  4CI3 B;  2X51 A;  2NOX A;  3C4X A;  3KDS E;  3ZCJ A;  3PUS A;  2KWH A;  4MBQ A;  2OA5 A;  4EOZ B;  5HXH A;  5LGN B;  4ILU A;  2Z6E A;  2V7L A;  3NBX X;  4PNI A;  2Q9Q A;  4UEL A;  2KIN B;  3MKD A;  2ZM8 A;  3MXZ A;  4GK5 E;  5TAO A;  2YU1 A;  3HKC E;  2Q9Q C;  4ZI3 C;  1ZKE A;  4H9O C;  5LP6 E;  3N9O A;  3RRC A;  1MND A;  2LEH A;  5M4Y A;  5IYZ E;  1BR2 A;  4EXT A;  1ZV4 X;  3OYX A;  4WBN E;  1WYC A;  3PU8 A;  5LHI B;  1OWA A;  2IAK A;  2L3L A;  1HX8 A;  2CA5 A;  2VKD A;  2YEV C;  4OK0 A;  2W63 A;  2BDE A;  5LXT E;  2H3R A;  1BR4 A;  2RP4 A;  2JRK A;  1HG5 A;  4FJO A;  3ZMS B;  4MLK A;  4BAY B;  1CUN A;  2NWB A;  5JRE A;  1T98 A;  4O4I E;  4DND A;  2CXF A;  2A72 A;  3Q5W A;  3LK2 B;  4AI6 A;  3KVB A;  2LOS A;  2A3D A;  2J1D G;  2X67 A;  3N2K E;  3DP7 A;  1IZN B;  3ETV A;  5EK3 A;  2XHE B;  5HYA A;  2Q9Q D;  4ZI3 D;  3AVS A;  3N9M A;  4KUM B;  2C5I T;  2CXL A;  4PJJ A;  1NAF A;  3LK4 2;  3AB3 B;  4UVB B;  4QWN B;  2B1E A;  5J2U E;  3KVA A;  2N1G A;  2V7M A;  3VU7 H;  2ZMA A;  3CQC B;  3F2E A;  4F6R C;  3S4U A;  4JEU B;  2VK9 A;  4JUY A;  3PUQ A;  3SWH A;  1YW0 A;  4X1I E;  4CXW A;  2LT3 A;  3RYF E;  2PJQ A;  1FMV A;  2BZB A;  3ESL A;  4MAL A;  4O4H E;  4KBM B;  2YK0 A;  5FXX A;  3R6N A;  3ZJ1 A;  4AKG A;  3N2O A;  2V7I A;  2HH7 A;  3CX7 B;  3I9Y A;  5DQW A;  3U3I A;  3JC6 C;  2H7O A;  3J9X 1;  4WW0 A;  4L5G A;  3EUH A;  1OXZ A;  3ZPO A;  3H3A A;  2CXD A;  4CXX A;  3Q9D A;  5JDN A;  2MTQ A;  2LE8 A;  4HFV A;  3CKD A;  4JEH B;  4PFO A;  1MMN A;  5FP3 A;  2E8I A;  2DCF A;  2PBI A;  1LRZ A;  2MOZ A;  4DMW A;  4TV9 E;  1WYB A;  2E9X B;  5JVD E;  3LFM A;  2W62 A;  1FIO A;  3IBP A;  2X9H A;  2LOP A;  4PK6 A;  5JR9 B;  2WWU A;  3O1I A;  3OJA A;  3A5X A;  3IF8 B;  4HN9 A;  5FXW A;  3AVR A;  4MHC A;  5ADX L;  3VHL A;  4A56 A;  3KFW X;  4O2A E;  5DAB A;  3CVR A;  2JPF A;  4IHJ E;  2I59 A;  3ZCI A;  3JC6 D;  3AA6 B;  3MAC A;  3UT5 E;  2N9D A;  4IGU A;  4OYK A;  3P7I A;  3D0T A;  4CI2 B;  3WI3 A;  3AAE B;  1BR0 A;  2D0U A;  2K9A A;  4PJN A;  2WAU A;  3LG7 A;  5JDG A;  5H6R B;  3WAJ A;  4UIG A;  2CE7 A;  3K3N A;  3NRY A;  4FI5 A;  2X0L B;  5LBQ B;  4E7Z A;  1ZHC A;  3VKH A;  3HR0 A;  3LK3 B;  4ANJ A;  2KND A;  1Z0P A;  1MMA A;  5LYJ E;  4N78 D;  3ZMU B;  2IW5 B;  1MNE A;  2IC9 A;  2VKH A;  5H6Q B;  1YD8 G;  2JQQ A;  4IE6 A;  2DLR A;  2DWG A;  4QHO A;  3ANW A;  4X1K E;  3RH3 A;  2XUE A;  4ZI7 E;  4P0A A;  4IE7 A;  2W0G A;  5HAX A;  5CA0 E;  4PJL A;  2W00 A;  2NW9 A;  5LGU B;  1H7C A;  1US7 B;  2PG8 A;  4GYS A;  1U4Q A;  3PU3 A;  3F31 A;  4H9S E;  3EVY A;  4WNK A;  3RYI E;  1G73 A;  1YKH B;  1ZEE A;  2ODV A;  5JRC A;  4I55 E;  1S35 A;  3ZJ2 A;  3I1A A;  1D0X A;  4I50 E;  4DMV A;  5J1G A;  2NP9 A;  4QKN A;  2QGS A;  3BQL A;  4I43 B;  2Y8D A;  4QX7 B;  3B13 A;  3BK9 A;  4H9Q C;  2VKJ A;  2KXP B;  2YU2 A;  4OHF A;  3GN5 A;  3SOL A;  4ZHQ E;  2JMK A;  4UVA B;  2X9X A;  4H9R C;  1AJ3 A;  2WMN A;  4AQF A;  3KV4 A;  3M65 A;  2PFV A;  4UF0 B;  5LHH B;  3U78 A;  3HKE E;  2KZ7 B;  3MK7 C;  3FHN A;  4AQF C;  4BA9 A;  3TKL B;  1HCI A;  3GWH A;  2XAG B;  3ZLI A;  2LSJ A;  3FBZ A;  3I9W A;  3ZN0 B;  1FEW A;  4EYU A;  4PK4 A;  4P0B A;  3UUX B;  1IJ5 A;  2VWA A;  3GA8 A;  2A2F X;  3VKG A;  3OYZ A;  4ZI2 C;  1BR1 A;  3E22 E;  1Y64 B;  4O8S A;  2XAH B;  2CLY B;  3CWZ B;  3UTK A;  1MIW A;  2C0S A;  4QXB B;  4PAG A;  2KWI B;  1IJ6 A;  3RYC E;  4CI1 B;  2EHO B;  3AAA B;  2N2N A;  2XTL A;  5HXR A;  2KLQ A;  1D1A A;  2X68 A;  4HTE A;  3J7Y q;  2UXN B;  2WM9 A;  3CPZ A;  2ZM2 A;  1U5P A;  2RA1 A;  5L3B B;  4EAH A;  4ZS3 A;  2Y6X A;  1D0Y A;  3EDV A;  1EZ3 A;  3N5L A;  5FXZ A;  3RPU A;  4AKI A;  4ZI2 D;  5JQG E;  3O4X E;  4G63 A;  1LKX A;  4L0R A;  3RKO A;  3ETU A;  1QUU A;  4H63 V;  1V9D A;  3AAI A;  4AKH A;  5KMG P;  2VAS A;  3C50 A;  3PUR A;  2KMF A;  3RX6 A;  3V5U A;  4IE4 A;  2K5B B;  2DI4 A;  3BQK A;  1FMW A;  4UV9 B;  1O3X A;  5JDH A;  4O4L E;  2GK9 A;  2ACX A;  2VB6 A;  3QK6 A;  5CA1 E;  5LGT B;  3OKQ A;  4K0U A;  4EYY R;  2CLY C;  4YJ3 E;  2H7V C;  2XQY A;  3E08 A;  3HL6 A;  2X9W A;  1D0Z A;  3AA1 B;  3L3P A;  2DHR A;  2W61 A;  3W15 B;  4P09 A;  2QA7 A;  1HFA A;  2V1D B;  3KBU A;  2DWK A;  3KIN B;  4EZH A;  2WMO A;  2D0T A;  5E0O A;  5JDF A;  3IHR A;  3K3Q C;  2JJ9 A;  1UX4 A;  2X9Y A;  3ZC1 A;  3ZMT B;  2MYS A;  4ASK A;  3C98 B;  3ONX A;  3QC9 A;  2CCQ A;  3FXE B;  1WR6 A;  2IC6 A;  2CMR A;  3MZK B;  4UVC B;  4V1A v;  5LJM A;  1KNZ A;  4DBQ A;  4TZ4 C;  5LNK A;  4HE8 A;  4EB6 E;  4UXN B;  5JDM A;  1D1C A;  3K3O A;  4GK0 E;  4PW8 A;  2SPC A;  2XAJ B;  1MIV A;  3ZYL A;  3UUL A;  4JLE A;  5F8P A;  3NZQ A;  3CX6 B;  4EIW A;  2LSY A;  5A1L A;  2E9X A;  5IHY A;  3KV5 A;  2XAQ B;  3CML A;  5FNV E;  1SHZ C;  4L9I A;  2E9X C;  2JMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...