4TX8A

Crystal structure of a family gh18 chitinase from chromobacterium violaceum
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
395
structure length
374
Chain Sequence
ACPGWAEGTAYKVGDVVSYNNANYTALVAHTAYVGANWNPAASPTLWTPGGSCGNTVPFAKHALVGYWHNFANPSGSAFPLSQVSADWDVIVVAFADDAGNGNVSFTLDPAAGSAAQFIQDIRAQQAKGKKVVLSLGGQNGSVTLNNATQVQNFVNSLYGILTQYGFDGIDLDLESGSGIVVGAPVVSNLVSAVKQLKAKIGPNFYLSMAPEHPYVQGGFVAYGGNWGAYLPIIDGLRDDLSVIHVQYYNNGGLYTPYSTGVLAEGSADMLVGGSKMLIEGFPIANGASGSFKGLRPDQVAFGVPSGRSSANSGFVTADTVAKALTCLTTLQGCGSVKPAQAYPAFRGVMTWSINWDRRDGYTFSRPVAASLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Family GH18 Chitinase from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
molecule keywords Probable chitinase A
total genus 120
structure length 374
sequence length 395
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4tx8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4tx8A02
4D1IA 4J27A 2VCBA 4MNLA 3FXYA 4J3UA 4B15A 1CXEA 2D24A 2VO5A 1EQPA 3F4VA 1W9XA 4UQCA 3VMOA 1K9EA 4YN5A 5CSYA 4QAWA 3OZOA 5E0FA 2XWEA 2PWHA 1M04A 1R87A 1GJUA 3EDJA 4JAWA 2ZE0A 1GCYA 2O9PA 3VO0A 4OOUA 5BXSA 3CUHA 3GH5A 2Z1SA 1HVQA 4QLKA 2WVVB 4HOZA 1H1NA 3UG4A 3W28A 1UR2A 3A4XA 5I0DA 2ZX5A 3SIMA 2VZTA 4D6FA 1BF2A 1HKKA 2C8NA 1UQYA 3WMSA 4MADA 2G4FA 4AEFA 2CBVA 2PWEA 2O9OA 3CHFA 3WF3A 3PZIA 4FLSA 4U2ZA 3KL0A 1E4LA 3KE0A 4N0RA 5A6SA 4OOZA 4Z2KA 3W27A 4PUEA 4UTFA 4TVUA 1VBUA 1BVNP 1H3GA 4FLQA 4W7UA 5D9MA 3WNLA 4UZUA 1IV8A 1UHVA 2CBJA 2YBTA 3RPMA 1FH9A 1AMYA 4CKQA 3VDBA 4WF7A 1KWGA 2E9MA 1WAWA 2WBGA 2J47A 5D9NA 3I3BA 5A6JA 5FCZA 3M7SA 2GJXA 4CVUA 3M46A 1H49A 5E70A 4OBSA 3RM4A 1OINA 1W1PA 1TVPA 1F4AA 2FGLA 2JFEX 1J01A 1BQCA 3VM7A 2WZIA 3WD2A 5FIPA 1UR8A 4D72A 2VX4A 1TR1A 1CPUA 3CHDA 4E2OA 1VB9A 3VIOA 3VMPA 1E43A 4XUYA 5M5DA 3OZPA 1JZ8A 2G3MA 4XV0A 3S2CA 4AD0A 1BHGA 1DWJM 1MVYA 2WHLA 2OYKA 1TVNA 1OBAA 4MDOA 1BSIA 4P7OA 2ZOXA 4RE3A 4GZIA 2VZOA 1V6XA 4PCSA 2AAAA 4GI6A 4AXNA 3ARXA 4ATDA 1GQKA 1W3JA 3N11A 2IXVA 2XSBA 1W1VA 1LL7A 2VURA 4TTUA 3VU2A 3UCQA 1H5VA 2WC7A 1V3LA 1BVZA 3EYPA 3II1A 4PMDA 1WZAA 1E6ZA 2QF8A 2VZUA 4NF7A 5A6BA 1C93A 4Q7NA 4AIEA 4P8UA 1W9BM 4NSBA 4PMUA 5LYRA 5BCAA 2PB1A 3VGFA 4EAMA 1R7OA 4PMYA 1W9UA 3AICA 4H8UA 1O6IA 3VGGA 3RIKA 2ZUTA 1XGZA 1L8NA 2ZX8A 1D7FA 2FH6A 3K8LA 3WNKA 2EPLX 1E6RA 1GQLA 1V0MA 3BXWA 2BS9A 2DH2A 3HN3A 4S3JA 1AQHA 4BQ3A 2DSWA 3ZSTA 1GOOA 3CUFA 3AI0A 3SCVA 3LPGA 4H04A 4AEEA 3TOPA 2G41A 2XFYA 1DTUA 1ZBKA 2FHFA 2WMKA 1KCKA 4ZENA 4AZCB 2WKGA 3DYMA 1X6LA 1JFHA 1KB3A 1KQZA 1OIMA 3CTTA 1E1EA 1ODZA 4J3XA 1UH4A 2AMGA 2GSJA 3NSMA 1KBBA 3RO8A 1DP0A 3I3DA 4MB1A 1PBGA 4H8HA 1VFMA 3GH7A 1CGTA 5GPRA 3LPOA 3WNPA 2BY0A 2XM2A 3WH7A 1GOKA 3PTQA 4F9DA 4W8LA 1H4PA 3WD0A 3UG5A 3CUGA 1WZKA 1UR0A 4GO9A 1PIFA 4WKHA 4Y7EA 4P7NA 4ACZB 1WP6A 3VIHA 2WMJA 1E72M 2E0PA 2EPOA 5A6LA 4V2XA 3GM8A 1PX4A 1J18A 1F4HA 3ARTA 3CMGA 3FAXA 3AXXA 3OLIA 3NSNA 5EMYA 5ABGA 4W89A 1JFXA 4PYSA 3B8SA 3B9EA 9CGTA 4KWUA 3EMQA 4MB4A 3VD7A 1HIZA 2WVTA 5E6ZA 4Z2IA 2J7CA 1XSJA 1UUQA 5BRQA 1E70M 1UD3A 1LJYA 3BMVA 3W81A 4UQAA 1B30A 1LLOA 1SYTA 1SMDA 5A6MA 1HL9A 1CXKA 2ZIDA 1C92A 1UKSA 3AFBA 5CGMA 4UQ9A 1NP0A 4PN2A 1QHZA 4KRUA 3UERA 1DEDA 5LA0A 1JAKA 1CXHA 3MUAA 1E4NA 3N1AA 2D2OA 5CPTA 1PJ9A 1VJZA 3CH9A 3FNDA 1W2VA 1JNEA 2D23A 3PHAA 2XFFA 4QCEA 2WM0A 4AY1A 2WLZA 1TUXA 3L4ZA 4IPLA 1FP9A 1UWRA 3N17A 3GXIA 4MNKA 3AQUA 4RL3A 1CIUA 4U3CA 4TUFA 5A8QA 3SCPA 2G3NA 3N15A 2XVPA 1K9DA 1E4MM 4LQ1A 5A69A 2W4XA 2ZX9A 5D8WA 3MSDA 4U3AA 4JL1A 3N9KA 4A3HA 5FL1A 4GXPA 4WK9A 5I79A 4UFKA 3WF2A 2WVVA 4FMVA 3BSHA 3SCRA 5HOSA 2WSKA 3CBWA 3AIBA 5A2CA 5FOOA 1V3JA 3OLDA 2WW5A 4HZ8A 3PZNA 2VTFA 1V02E 3W6MA 4PCTA 3UESA 5ECUA 2WC4A 2BY1A 3WQ4A 1JI1A 3WELA 4HOXA 1HL8A 4MNMA 1V08A 3W25A 4URIA 1Z32X 2DSUA 3CUJA 3IJ7A 3VD5A 2VR4A 1H0GA 4LPCA 3WF0A 3VD9A 1QW9A 3VNZA 4MJ4A 1JZ4A 4P7QA 3BAIA 4CCCA 1AQ0A 3G6MA 3ALGA 2XHYA 3AYSA 4KH2A 4B3LA 1V3KA 4P7LA 1OWQA 2DH3A 1HJWA 1KQYA 1C7TA 4PMNA 4ML4A 3ARPA 3SUUA 3U7VA 1GJWA 2D0FA 2CIPA 3WMBA 5IDIA 4M56A 4HZ6A 3AS0A 3KL3A 4BF7A 4W87A 4M80A 1UOKA 3AHZA 3WN6A 6CGTA 1XCXA 1HVXA 3BAWA 5BRPA 3VIJA 3M6DA 3IAQA 4PMXA 3MSGA 3ZT7A 1XCWA 2UY4A 2WB5A 2E8YA 5HPOA 5A2AA 1GONA 1OB0A 2J8FA 3VUPA 2E3ZA 4QCFA 4UFLA 1JG9A 4W8AA 1TMQA 1X1NA 4H7VA 1R8LA 2MANA 3NIYA 4EE9A 4HPHA 2ZWYA 1C8XA 1XH2A 2Z1KA 3AMKA 3WDPP 2BFGA 3UG3A 3RM8A 3GNOA 2WYSA 1EXPA 3LMYA 3PZVA 1EOKA 1M01A 3TTSA 2ZX6A 2OSYA 2WKLA 1GOIA 1BLIA 4NZCA 4B9ZA 4UCFA 1HT6A 8CGTA 1OCQA 2J7EA 5A8PA 3WQ6A 3UR7A 4B9YA 4BA0A 2VNCA 4AZBA 3BAXA 4DWSA 3ZM8A 3MU7A 1JDCA 3WH8A 3U5UA 1V6WA 2CPUA 2X2YA 3MMWA 4W5UA 2J8GA 4WJXA 3WIJA 2OWWA 1MW2A 1CECA 5A8OA 5JBDA 1ISXA 4JFUA 2D3NA 1V03A 1ZL1A 3WMCA 2PI6A 4ATWA 3K46A 3W24A 4AZHA 1JI2A 2AOSA 1B3WA 1WPCA 5D8ZA 3VMNA 2OLHA 3MKKA 3MMUA 1ZS2A 2O92A 4M8UA 5E0CA 1JYNA 1US3A 3GTNA 5DFAA 3S6TA 3WH6A 4OZOA 1E0WA 3RMEA 2CETA 2G3IA 1ESWA 1Y7VA 2XFRA 3F5LA 1XSIA 1ZU8A 3WENA 4BQ2A 4P7RA 5JUVA 4F9JA 3AROA 4P8WA 4KGLA 1N82A 2A3CA 5EFFA 3N12A 1PX3A 2OYLA 5HNNA 4QLJA 3QOMA 5DEZA 4HTYA 3DECA 1KR1A 2W92A 3BAJA 3VGEA 1E3XA 2PC8A 2VVNA 2VQUA 5CPSA 5CLWA 1LL4A 4CD6A 3U57A 1E40A 4Z2LA 1AQMA 1KXHA 4Z2HA 4J7RA 4GQRA 4MAZA 3L2MA 3MUY1 1JYWA 4GI8A 1Q6DA 1FFQA 1J0YA 2YKKA 4ACYA 4JCLA 1VENA 1VBRA 1ZBVA 3EMCA 4J28A 1PPIA 3N18A 1J9YA 3OLEA 3APGA 4D6EA 1ZBCA 2X0YA 5AC5A 2WVUA 1XRVA 4CCEA 1RPKA 1JZ5A 4LGXA 1AIWA 4XB3A 1CLXA 3W37A 2YA2A 1G01A 2ZXQA 3ZQ9A 5M03A 3WDQA 5I77A 2A3AA 1JF5A 3POCA 1E4IA 4BS0A 3UR8A 3HJEA 3VINA 4QDMA 4D6JA 2E9LA 1GHSA 2UY5A 2W91A 2B31A 4A3YA 2J7BA 1BG9A 1EO7A 1HN1A 3T2QA 2BY2A 1QI5A 3O9NA 3T08A 4DWSC 3VPLA 2RGMA 3ZO9A 2W63A 1D3CA 1BYBA 1NWUA 1GQIA 4TTGA 2D3LA 3A3HA 1XSKA 4EKJA 3POHA 1BYDA 4L4PA 3ZJ6A 3WD1A 1C90A 1EQCA 3QHMA 2E4TA 1BPLB 3PZUA 3FHQA 4U2YA 2WHMA 3CGTA 4PTMA 2A3BA 1H11A 5AC4A 3CUIA 2GJRA 2VRQA 2ESCA 3AIRA 4GKLA 4OBRA 1MQPA 2Y2WA 4HA3A 1GPFA 2VQTA 2J4GA 1ZB5A 5D9PA 1OD0A 3FAWA 5A2BA 2HVMA 2XIBA 4XZWA 4PTWA 1UWQA 3MANA 3RJXA 1WDPA 1W3KA 1VF8A 1KGXA 5CXPA 4CD4A 5LA1A 3O2LA 3A4AA 2BV9A 3THCA 4H8VA 3WBAA 2FHCA 3B9DA 3L4TA 2EJ1A 3N04A 1V0KA 1CENA 1C91A 2V3EA 1CGVA 1B3XA 8A3HA 2X0HA 3F5JA 2WBKA 3CPUA 1A3HA 4M82A 3FN9A 4KMQA 1E6SM 1UR4A 1EO5A 2YL9A 3VNYA 4UFJA 2F8QA 1TA3A 4UQEA 1UR1A 1I75A 3AHYA 3CMJA 4CD5A 4JL2A 3EDKA 1XD1A 1NP2A 1JYVA 1LQ0A 1EDQA 2VVSA 2CERA 3KWXA 3OBAA 4DUVA 5ABHA 3AHTA 4JHOA 1GZJA 3J7HA 3WDHA 1ITXA 2E8ZA 2Y8VA 4D6IA 1KR0A 6A3HA 4W85A 2ZUMA 3WNOA 1EH9A 4PRWA 1Q6CA 1TZ7A 3VIGA 3KEHA 5A8MA 2YA0A 3BGAA 4PTXA 5M3WA 3FHAA 5AY7A 4V28A 4YPJA 3PZ9A 2EO7A 3HMCA 3ARUA 3WUEA 1HJXA 2J79A 3PTKA 2VZSA 5FL0A 3BCFA 1VEOA 3A4WA 2TAAA 3K4DA 2UY3A 3GDBA 2PWFA 1XH1A 3ARSA 4MJ2A 4UNIA 1QBBA 2DT3A 4JHZA 1NWSA 1HKJA 2WZEA 1CEOA 2V38A 4U5KA 1Q6FA 2BNJA 5M17A 2RGLA 4A4AA 3AIUA 2JF6A 1U30A 1E1FA 3OIHA 1LL6A 1UQZA 1RP8A 2ZXAA 3RJYA 2GVYA 3KL5A 3OGVA 3WDIA 5CJ5A 1MFVA 1XHGA 3SCOA 3AMDA 4U31A 4WSKA 4X0VA 2QPUA 3EBVA 3EDFA 1WKYA 1XV8A 1CLVA 2DSKA 3EDDA 4IISA 4GIAA 1MW1A 1SR0A 2YLLA 2E9BA 1LG2A 2IXUA 1FHDA 2BXZA 4AD4A 4AD3A 1MW3A 2EQDA 1R85A 1UD5A 2G3JA 3M07A 3SCUA 4PMRA 3ARQA 4GZJA 2BXYA 1U33A 2WCAA 1UG6A 7A3HA 5F7UA 1CNVA 1JDAA 1ECEA 1LWHA 1JZ2A 1XC6A 3AIEA 3WQ8A 1B2YA 1IZJA 3L2LA 3NYDA 5A1AA 2OSXA 2O9TA 1YHTA 2EPNA 4AW7A 2CITA 2BVYA 1M03A 2DQXA 1HJSA 4H2CA 4MB5A 3SUWA 2DT1A 4HMEA 1W9VA 3AJ7A 2Y5EA 2DSZA 3ZJKA 5EB8A 4AYSA 2YJQA 5E6YA 3DHPA 4HP5A 1NWRA 3WEOA 1J11A 4AISA 3W29A 1EGZA 3QHOA 3FW6A 1QNQA 1DHKA 3IJ8A 3MUZ1 4AZGA 3JUGA 1UWTA 3O6AA 3ARZA 1KFWA 3T0AA 5ABEA 1JNDA 2YL6A 4FF5A 5D4YA 3SUVA 2GJXB 5IXEA 4TVCA 1X6NA 3UEQA 1GHRA 4OKDA 1EOMA 4E8CA 1W9DM 1NARA 5FKYA 4W8BA 5IFTA 3AS1A 1ODUA 4UFHA 1CXIA 1UWSA 2EXOA 2WHKA 2WXDM 4BCEA 2J7HA 3MO4A 2V5CA 2DSVA 4PBGA 1VRXA 3RCNA 2D22A 4XZBA 3PZOA 3WSUA 4IM4A 2VR5A 2J75A 2NT0A 4HMCA 4FK9A 5A6BD 5I3DA 3PZQA 5DT7A 1UD8A 4E4PA 1E6NA 4S3KA 1HJUA 4HU0A 2ZUNA 3B9AA 5A95A 7TAAA 1TG7A 2W61A 2IUZA 3VM5A 2FHBA 4B16A 4CD8A 1G5AA 1G9HA 3A47A 3VOCA 2WAGA 1MXDA 4HMDA 4DM1A 2QMJA 3OB8A 4KRTA 3WNMA 2WANA 1QNSA 4BQ5A 3L4YA 1GOMA 1C7SA 1PAMA 4OJYA 4PTVA 2CBIA 4HA4A 4FLOA 1OT1A 2WHJA 1UKQA 5I78A 2WCGA 4ZFMA 3ZOAA 1MQQA 2YBUA 3BAYA 3VIIA 1BGAA 1H0IA 3CHCA 1DWGM 1QI0A 3OGRA 1HKMA 2DEPA 4CU8A 4D6CA 4D1JA 3NCOA 4L4OA 4V27A 2WZHA 4DUWA 4CN6A 4IPNB 4R5EA 2W5FA 3DC0A 1WZMA 2YA1A 1CGUA 2D20A 3GXFA 2ZUUA 4TX6A 3PN8A 3D3AA 2EBNA 4DUXA 1WDQA 1GVYA 3WEMA 4JCMA 2YDQA 4ZXLA 1W2PA 5A6AA 4W86A 3TTYA 1ZJBA 5GQBA 3MV01 1EHNA 1TFVA 1G1YA 4P8XA 1OM0A 1US2A 5I2UA 1HP4A 4DWSB 1KBKA 3WY1A 3ARYA 1CGXA 4WLCA 3GNRA 1JZ7A 2YLAA 2CHOA 1B3YA 1LF1A 4AZ6A 4FLRA 1CDGA 5TD4A 4PMOA 1QI3A 3FY1A 1HKIA 1K9FA 2PWGA 3WBEA 1QVBA 3F5KA 2X05A 3K8KA 1DWAM 1BGGA 3LPPA 3DYOA 4OIFA 1V6UA 3RDKA 1JL8A 5LA2A 1JDDA 3WF1A 3MUIA 4ACZA 2QHAA 1FFRA 2UWFA 1UH3A 1IZKA 1W1YA 3GBDA 1ISZA 3ZSSA 1WNOA 4MAVA 4WKAA 1CTNA 2ZUWA 5EFDA 4M24A 2WSPA 3CZGA 3BMWA 3GH4A 4Z2GA 4LYRA 4R27A 3MMDA 2QMKA 2FDMA 2PBOA 1E5JA 3DYPA 4AZIA 1HNYA 2F61A 3OA5A 3OG2A 4GZEA 5CGTA 1C8QA 1W91A 2XYLA 3PBGA 3WFZA 3VD4A 4F8XA 4GO8A 2VCAA 1JXKA 5DT5A 3W4RA 1KCLA 4C7DA 5A6KA 1G94A 2J78A 1PZ3A 1YQ2A 2YIHA 1U2YA 2VC9A 4QFUA 4TX8A 4AWEA 2V3DA 5I24A 1Q6EA 4M1RA 1ISWA 4BQ4A 3GNPA 2XVKA 2ZXDA 4F79A 1WE5A 1XYZA 1GQJA 4HOWA 1V0LA 5FD0A 5CZKA 1W32A 4UOQA 3THDA 1PZ2A 5BXRA 1J0HA 2VT0A 1E71M 4LXFA 1FH8A 1QOXA 1GUVA 4QP0A 4U33A 2CYGA 4Q22A 3SCTA 2XTKA 3VIFA 1BAGA 2XJ7A 4WKFA 5JIPA 5CG0A 3AXIA 3AHVA 2G8ZA 1UKOA 2X1IA 4CGTA 3QGVA 3AIWA 1OD8A 5JBEA 4ZXOA 2CKSA 1GNXA 4H41A 1L0PA 3W38A 5KEZA 3CZEA 1XD0A 1KGUA 3L4XA 4JFSA 4MB3A 1VAHA 3WKZA 4QLLA 3VIKA 3RM9A 1J0IA 3MS8A 5CSUA 3W26A 3WEZA 1CYGA 4PEEA 1H2JA 1VEPA 1IT0A 1PX8A 4LYPA 1CXLA 3WQVA 4LYQA 4JKMA 1O7AA 4MPKA 2C7FA 1TCMA 3VIMA 4AD1A 3SCSA 2D0HA 4AZ5A 4UZSA 4YHGA 2W66A 3T2OA 4NRSA 3GBEA 2X09A 1OSEA 3WF4A 2W67A 4GQQA 2OYMA 3BC9A 3E1F1 2BHUA 3VDCA 3SURA 2A3EA 3NSXA 1BYCA 1NWTA 5ABFB 2CXGA 4J3SA 1V3MA 2VMFA 5AYIA 3PZMA 4HPGA 1UD2A 3D5HA 3CLWA 4MNJA 2EEXA 2F2HA 2VUYA 1BFNA 2BY3A 3VDHA 5DMYA 4IUGA 3WH9A 1R7AA 1UD4A 3OLGA 3CZLA 2QLYA 2PBGA 2GDUA 1D2KA 3VX1A 1C3FA 3QHNA 3ZMRA 5I23A 2ZICA 3QOKA 2JALA 1BYAA 4W88A 1VIWA 5E9AA 4AD2A 4TVDA 1W3LA 2CKRA 4PMVA 2J62A 5GNXA 1G0CA 1LWJA 4P8VA 2WCSA 5AYBA 3T0BA 3AIVA 1HXJA 2DIJA 3VX0A 1UWUA 3NDZA 3IJ9A 3T09A 1E73M 3AXHA 3K1DA 1EA9C 2XPKA 1MW0A 1NH6A 3IAPA 1ED7A 1H41A 1E55A 1JD9A 4HA1A 3WUFA 1E3ZA 1JGIA 5C8BB 1OT2A 5BXTA 2J7FA 2FGZA 1B3ZA 1CXFA 3WH5A 2EPKX 3AYRA 3ZR5A 4E8DA 2Y4SA 4HZ7A 1GORA 1XYFA 1NM9A 3AHXA 3EMZA 3AOFA 3ECQA 4C7FA 1J0ZA 1WO2A 1NOUA 3W53A 2GJPA 1E0XA 1VJSA 5CQ1A 3N13A 5BXPA 4ZE4A 4W84A 1MFUA 4TOQA 3L4WA 2JEPA 3PTMA 4KGJA 4J3WA 3WUBA 1M53A 3ARRA 3TTQA 2V5DA 1M7XA 4X9YA 1KXQA 3WD3A 1KGWA 2J7DA 1MYRA 4JKKA 2WVSA 1QHPA 3GZAA 1RH9A 2RTSA 2Y8KA 4PSRA 2YDSA 3SEPA 4BZYA 2DIEA 3TA9A 3AS2A 4ZE5A 1BTCA 3VGBA 3ARWA 2WMIB 1B9ZA 2J77A 1UR9A 2JE8A 1JD7A 2E40A 3BSGA 3L4VA 3WFLA 1QW8A 3ZJ8A 4PUDA 2FH8A 2GUYA 4UFIA 4AIOA 1HJQA 2OSWA 3WL1A 1WZLA 4D6HA 1UKTA 2XG9A 1RD6A 2DPEA 2YL5A 3T0DA 2ZUVA 1B31A 2VL4A 4XX6A 1HX0A 3MV11 2JF7A 1WCGA 2ZUSA 2JIEA 5EBAA 4M81A 3W82A 2YL8A 1J10A 4PMZA 1V3HA 1GOQA 2XIIA 3HU7A 4CD7A 1QI4A 2NT1A 1MWOA 1B90A 4OUEA 3GXMA 1DWFM 1B0IA 4AZCA 3AZTA 1E15A 3GYCA 4AZ7A 4ZEPA 6TAAA 2JEQA 5BWFA 4WIWA 2GK1A 5C70A 4WSJA 2J74A 1BG4A 1MQRA 1FP8A 5BROA 3VVGA 1V6VA 1R86A 4NRRA 2YOCA 2CESA 1TE1A 5A8NA 4F66A 4JIEA 1UKPA 4UFMA 5DO8A 3IANA 5D9OA 3U7BA 3WNNA 4EK7A 2XGBA 1VFOA 2Y24A 3NUKA 4RE2A 3AZRA 1CWYA 1VEMA 4UOJA 3BLPX 2XUCA 1HJVA 4JZ5A 3SCQA 2WMGA 2VRKA 3CZJA 1GVIA 3RILA 2JIWA 2J7GA 3SUSA 1QHOA 1QNOA 2DGAA 4CU7A 1WB0A 3WD4A 1C8YA 1AVAA 1WDRA 2DT0A 3ZIZA 3AISA 3WDJA 1E56A 5ABFA 7CGTA 3NDYA 3T2PA 4CVWA 5HDRA 5GNYA 2VX6A 2WK2A 2J25A 3CO4A 3VIPA 5HXMA 2GDVA 1EDGA 4W5ZA 1UD6A 2D49A 3A6OA 3VDAA 2DDXA 1CBGA 4D6DA 5E09A 1W3HA 1OGBA 4W93A 2NW0A 4B3KA 4TXEA 2OWXA 1RP9A 3BLKA 1UZ4A 3ZT5A 1QBAA 1JZ3A 3BH4A 1ZJAA 1V0NA 1JZ6A 3ARVA 1CGYA 1LG1A 3OGSA 3TONA 1KWKA 1JIBA 4PSPA 5I6SA 2WLYA 2O9RA 1GOWA 3K4AA 1XH0A 4JKLA 1VFUA 4J3TA 4GINA 4UOZA 1JXJA 3CZ8A 1E9LA 1ITCA 1FA2A 1UH2A 1WDSA 3KZSA 1H09A 2XVNA 4UQBA 2VRJA 1ISVA 4X0NA 1K6AA 2A3HA 3AIQA 2GFTA 2GK1B 1QI2A 2BVDA 1QNPA 2WMHA 2XSAA 2QPSA 1OGSA 4GI9A 4GPNA 1JAEA 1EDTA 2EPMX 2C0HA 2WWCA 3WQ5A 1J12A 3CZKA 4ATLA 1E0VA 1K9TA 3AMLA 3AZSA 5JBFA 1W9PA 2UY2A 3PZGA 2VCCA 2XVGA 4MTVA 4K68A 5CLTA 4EANA 1KXVA 5DF0A 3VILA 1SFSA 4D6GA 1B1YA 4W7WA 1UA3A 1NQ6A 4CCDA 5HPCA 5I5RA 1FH7A 1J0JA 2CHNA 4YHEA 3BAKA 1GW1A 5A94A 5JIWA 1ZBWA 2CCRA 4UR9A 3VKKA 4AMCA 3SUTA 2VI0A 3ALFA 5IHRA 5C71A 4J3VA 2DT2A 3CIVA 4AC1X 2D1ZA 5CPQA 3I3EA 4CUCA 1E6QM 2XWDA 3ZR6A 2HISA 3VGDA 3TTOA 1NOFA 2CEQA 3W0KA 1KXTA 2VZVA 4D71A 5A3HA 1P6WA 2ZXBA 1I1XA 2WWDA 1W1TA 1NOWA 2W62A 5IFPA 4U5IA 4JFWA 3VD3A 4AIUA 1UWIA 3GXDA 3TP4A 2V3GA 1J0KA 1E5NA 2VOTA 4MDPA 1UYQA 3NJ3A 3PZTA 1DWHM 2D0GA 3EDEA 3UETA 4HU8A 2VX7A 1OGGA 1PEZA 3SCNA 1E6XM 4NI3A 1EIBA 3U5YA 2VJXA 4LX4A 2CNCA 3AMGA 3SCWA 3DHUA 1V02A 1B3VA 1CZ1A 2PF0A 1HF6A 3L4UA 1DWIM 3W6LA 1A47A 3WL0A 1QNRA 3VTRA 3G6LA 4UQDA 2OWCA 4AD5A 1FOBA 1CGWA 4DM2A 3ZT6A 5GNZA 5IHSA 2YDRA 1FHLA 3AS3A 2WPGA 1UZ1A 1V6YA 2Q8XA 3QR3A 4DWSD 2ZX7A 3K8MA 3AMCA 4PMQA 5HBFA 1PIGA 1TA3B 2XM1A 1SMAA 1MXGA 2XVLA 2NSXA 1HP5A 2BHZA 2CBUA 2V3FA 2XGIA 2VX5A 3BCDA 3IK2A 3CHEA 1JYXA 1I1WA 3WDRA 5KZ6A 1UA7A 1JF6A 3VGHA 4JFVA 2WNWA 4M29A 2PWDA 5BYWA 1VFFA 4CN1A 1S46A 1Q4NX 4JFTA 1ISYA 1Q6GA 1QPKA 2WC3A 2ZWZA 4CN4A 2X8RA 2WMFA 1V3IA 4CU6A 1E6PA 1EHAA 4C7GA 2WMIA 3LPFA 4RE4A 2QV4A 4W7VA 3WQWA 1OIFA 2BVTA 4N42A 3ZJ7A 2BHYA 3WUGA 4Z2JA
chains in the Genus database with same CATH superfamily
2EF9A 5C0QA 1UP0A 2VCBA 3FXYA 1A5NC 4QX4A 4Z1AA 1W17A 3KOXA 4ZOAA 4IP4A 1TSIA 2J24A 1EQPA 3H4XA 3N29A 3VMOA 1DIDA 4UTJA 1KFLA 5G1MA 4LB4A 4QAWA 3OZOA 2PWHA 4PUNA 3COTA 1GJUA 4X22A 2O9PA 3VO0A 3QC3A 5BXSA 1HVQA 5TF0A 2I5IA 4C6NA 3W75A 4QLKA 3LGDA 2WVVB 1RAKA 5I0DA 2ZX5A 3SIMA 1REQA 3ES7A 1YPIA 4D6FA 5CPNA 3N2CA 4IMAA 1J5SA 2I14A 4ZODA 1Y5WA 1UQYA 1OFAA 2GVJA 2R1MA 3W1LA 3PWGA 1TX2A 4KIEA 4MIMA 2PWEA 2V67A 2CWNA 3PZIA 2PLMA 2NWSA 2VFFA 1L6WA 4A3RA 3L21A 3MSYA 3H70A 4WGXA 2PAJA 1R0MA 4UTFA 3FLUA 1VBUA 4FLQA 4W7UA 5D9MA 3C2OA 1IV8A 1UHVA 4KETA 3ZWTA 1R5YA 5AB3A 3RPMA 4PGLA 4ZBCA 1YTKA 2F6KA 1AMYA 5J8LA 4UWMA 3VDBA 3TVAA 2WBGA 1XLMA 4XZHA 2H9AB 3M7SA 1R6WA 2NX1A 3SN0A 2IKJA 4CVUA 2SFPA 1VPXA 5HR6A 1EC9A 1OINA 3ZVHB 3GC2A 1J01A 1PVNA 3DGBA 3LK6A 2DUZA 5CZTA 3CUZA 3VC5A 3H7RA 1I2QA 3BCJA 5FIPA 1O1HA 1TR1A 2E6FA 1CPUA 3CO8A 3IPWA 3MCOA 4LG2A 5C7HA 3W85A 2A7PA 2FJUB 5D33A 5BWAA 2OXNA 3S2CA 1HO4A 2NQ9A 2WHLA 4YTRA 4M0XA 4MDOA 3GNNA 3M44A 1EXBA 1V6XA 3DOPA 1SSDA 4Q8VA 4LRTA 3FA5A 3PUEA 2VURA 2YYTA 3VOJA 3II1A 5CGQA 1WZAA 4GISA 1W3IA 1OC7A 1Q6RA 4NF7A 5DXYA 5HNRA 3KWSA 4Q7NA 4NQ1A 4HVXA 1W9BM 2Z00A 5AN7A 1HZYA 1ONEA 2ZZ7A 4XG1A 5BCAA 2F6UA 1OZMA 1TZZA 4EAMA 2HE5A 5D2YA 1W9UA 3AICA 4UTWC 1O6IA 3VGGA 4Q8TA 2P88A 1XGZA 3EEGA 1UASA 2ZX8A 4UTWA 2PDWA 3W1QA 4LUTA 3PC0A 3WQOA 4NUWA 4S3JA 1M41A 1K8XA 4O14A 1F07A 4OU1A 1GOOA 3CUFA 3AI0A 4AEEA 4IICA 3IGUA 1WBHA 1ZBKA 3G0XA 2OQHA 3DYMA 1X6LA 1JFHA 3W87A 1ZHAA 2Z2BA 3NSMA 3LOTA 4IGMA 1DP0A 4M7SA 3UPMA 1PCKA 1VFMA 1TTJA 5F4WA 2QUNA 4E6MA 2BY0A 4G1NA 4LOCA 3UYIA 1ZTVA 2Y88A 3UG5A 3CUGA 4C1KA 4IBJA 1WZKA 4GC3A 1F3XA 2PGFA 3FOKA 3SGGA 4Y7EA 1WP6A 4QNEA 3NPWA 1VD6A 3O6DA 4HT3A 3LHZA 1FCVA 3NQAA 2GQAA 1Z69A 1F4HA 2R6OA 3N25A 3VKBA 3F2BA 1YEYA 2DZVA 2X42A 5EMYA 1QR7A 1VS1A 2CLPA 3B8SA 3M47A 1FKXA 3AWOA 3EWYA 4AHQA 3CYJA 2NLYA 3OEXA 2ZZ6A 4MB4A 3EWBX 1H51A 1HIZA 2WVTA 2OMAA 1AH4A 2PDLA 4L65A 5FJIA 4Z2IA 3GDKA 1GTHA 3KLLA 4E2DA 3SRDA 1E70M 4ML9A 1UD3A 5G4WA 5SWUA 4UQAA 3WLPA 4LAUA 1SMDA 1EF3A 2ZIDA 1XLJA 3UBPC 3T81A 3ZYZA 2E5DA 1NP0A 1QHZA 2ABBA 4B5WA 3EX2A 3UERA 3VA8A 1AMKA 4G5DA 4I6VA 2E77A 3NO1A 3MUAA 1E4NA 4GYPC 1VJIA 3G1XA 1PJ9A 2XFFA 1SFTA 1I60A 4IPLA 4HU3A 3GXIA 2Z7KA 1ML1A 3S9ZA 3TJ4A 5HWNA 4TUFA 4K7VA 1F73A 3UGVA 1JPHA 5D03A 3NG3A 2XVPA 4PB3A 1PKYA 5BRBA 1E4MM 2R91A 4CEXC 4WUIA 4DAFA 4U3AA 1I2RA 5AHEA 4JL1A 3QF0A 3P67A 3M16A 4A6GA 4HMNA 3W7HA 1H7XA 2R1LA 3M5ZA 5FOOA 1V3JA 3OLDA 3PPGA 1UJPA 2WW5A 3HG3A 4PCTA 4AF0A 3WQ4A 2HPMA 2OX1A 2I5QA 4MNMA 1YMYA 4URIA 3ONCA 1MUWA 3ABSA 2DSUA 3GRIA 2PTZA 1H0GA 3VD9A 3WJWA 3P61A 1JZ4A 4F48A 3N9RA 3BAIA 1PCWA 9RUBA 3UP8A 3AYSA 4KH2A 3LRKA 4P7LA 1W1IE 3QV8A 2DH3A 1HJWA 3FKKA 3QRHA 2A85A 4ML4A 4C6LA 2CIPA 3WMBA 4M56A 4M80A 3AHZA 3UZ5A 1XCXA 1HVXA 4JTSA 5I00A 3Q65A 3SBFA 5BMXA 3PNZA 4PMXA 1WAUA 3GHTA 3ZT7A 3GDMA 3PJTA 4DJFA 3DG3A 1A5CA 3VUPA 3BV7A 3EX6A 1TMQA 3P2VA 3FKEA 1R8LA 2MANA 3NIYA 3V1PA 2Z1KA 3AMKA 3GNOA 4DF1A 4G56A 4LUTB 1HKVA 2Y2LA 1HT6A 1R3YA 4HK5A 3GTXA 3LERA 1OCQA 5A8PA 3W74A 3WQ6A 1ONXA 4B9YA 3C2VA 3S5OA 3OG3A 3ZM8A 3MU7A 1JDCA 1V6WA 3KDOA 2CPUA 2YCKX 2O7QA 1ZNNA 4W5UA 4UUIA 3L25A 1MW2A 3H2MA 2CZFA 4ATWA 1XBXA 2WSQA 1BF6A 1YE6A 1ZENA 3RLGA 4POCA 4P2VA 5D32A 4LNCA 2G3IA 1Y7VA 3EWCA 5CZSA 1UZHA 3SDOA 1PB0A 1VYRA 1VCGA 1XSIA 1XLKA 4IUOA 3E9AA 4BHYA 4P8WA 4KGLA 3U48A 4IIGA 2A3CA 3C2EA 3QOMA 3DECA 1KR1A 5FESA 3PB2A 3PANA 4Y9AA 2FZDA 4HNTA 4HZMA 1EEXA 1E3XA 2VVNA 4XAFA 3P60A 4X61A 2QAPA 3FEMA 4BEQA 2QIWA 4Z2HA 1CW2A 2WZTA 4GQRA 3L2MA 3MUY1 4O1BA 1JCYA 2YX0A 1VBRA 1ME9A 1HGWA 3N2XA 2PLJA 1Y5VA 2FB3A 5G2WA 1PPIA 3DEQA 3W1MA 3URQA 1RSCA 3APYA 3AJXA 2ALDA 1ZBCA 3RYSA 4RDZA 1H61A 1XRVA 4F3HA 3M5YA 4NZ1A 1A5MC 1FKWA 4LGXA 2ZXQA 4GUGA 3WDQA 2AQWA 1E9ZB 1OQFA 4IQEA 3B0VC 3UR5A 3UR8A 3KXQA 3W23A 4QDMA 1EAKA 1GHSA 2W91A 2QJJA 4A3YA 2J7BA 1HN1A 3LHYA 5AC8A 1P0NA 2WZMA 3T08A 4L56A 2HRWA 3B4UA 2RGMA 3PF3A 3TC3A 4DVOA 4GG9A 1D3CA 1A5OC 3W00A 1GQIA 4RDYA 4UTTC 3CL7A 2D3LA 1XSKA 4EKJA 4LU0A 2IOUA 3U2ZA 3WD1A 3TW9A 3QHMA 1QK2A 4XUGA 2R94A 3CGTA 5AC4A 3T8LA 2WV8A 2GJRA 2HXTA 4GKLA 5AYYA 4NX0A 4K8HA 1MQPA 4GFIA 4HA3A 1RZMA 2J4GA 2AGKA 3EOOA 4PRTA 5DMNA 1OD0A 3FAWA 5I06A 5LNUA 3RJXA 1WDPA 1W3KA 2YPIA 3E12A 2GJNA 4CQ9A 1TJ0A 3THCA 4H8VA 3N04A 2VWTA 1CENA 1OYCA 4HQVA 1VP5A 3TNBA 1XQKA 2A21A 1VHNA 2CZEA 8A3HA 4FB7A 1XIGA 3EXRA 3QZ6A 2WBKA 1W5OA 3CPUA 1OFBA 1KBLA 4NKCA 3NO5A 4I90A 4RV3A 2I7GA 4UFJA 4UQEA 1UR1A 1I75A 3AHYA 4Z1CA 3W7IA 3WJYA 4EXAA 1EDQA 3V5OA 2VVSA 4AIBA 3SW6A 3KWXA 3IJ6A 3OBAA 4GGBA 4DUVA 5GJPA 3MA8A 5ABHA 4JHOA 4A22A 1RXOB 4J5NA 1KR0A 3E0IA 2ZUMA 4PRWA 1TPDA 3GAKA 1G4TA 3S8HA 1HW6A 3KEHA 4JTHA 4PTXA 1B9BA 4N7QA 3HO8A 4Q4QA 3ABZA 3PZ9A 3GX9A 3KX6A 1HJXA 3AXMA 5FL0A 3BCFA 3BW3A 1POJA 3A4WA 1SO5A 1JULA 4DRSA 3ARSA 4CNUA 4MJ2A 1AW1A 1NWSA 2AKMA 2H90A 4HYWA 5T91A 1FWIC 1SGJA 3SRFA 1I9CB 1QXLA 2RGLA 3AIUA 2JF6A 1U30A 2PP0A 3GIPA 4XBSA 2CLKA 1L6FA 4XVEA 3RJYA 1VQTA 1J93A 3NQFA 3WDIA 1DJIA 4GHAA 2QDEA 1PDZA 4XSMA 1QTWA 2QPUA 4JTRA 3T9PA 4K39A 4IHCA 2DSKA 2YCIX 3EDDA 4OTKA 2FMOA 2YLLA 3WLMA 3C0LA 2OODA 2IXUA 3LXCA 2DW6A 4AD4A 4GVGA 4KIRA 1MW3A 1YLVA 1H5YA 1UD5A 2G3JA 3MCNA 4PMRA 2OELA 1R9XA 2WCAA 2X41A 3PS7A 7A3HA 2OEMA 3KBWA 1CNVA 3NPUA 1ECEA 4EPBC 4B90A 1ME8A 4K37A 2PGRA 1B2YA 1KKRA 1IZJA 3LS9A 3L2LA 3G1VA 2OSXA 4AW7A 2DQXA 4U4MA 1T96A 1HJSA 3KBNA 4UTLA 1HKWA 1Z44A 5FF7A 2HCVA 2DT1A 1NY1A 3SZ8A 4N6FA 2G5WA 1W9VA 3TH6A 2DSZA 4ENLA 1ELSA 3GSMA 2YJQA 3ZFHA 5K4XA 3LUTA 3L26A 2Y7DA 3W7PA 1A80A 3CL8A 4FNUA 2VD8A 4LVDA 1JRCA 3C52A 4ADSA 3O6AA 3ARZA 1L9WA 4FF5A 5D4YA 3PB0A 3BICA 1GHRA 4NAEB 1A5SA 1THFD 3L12A 1CK7A 3KRSA 1GJPA 4TMCA 3WLHA 4W8BA 4LS0A 1UWSA 2XINA 1KTNA 4JDYA 3MO4A 5I3HA 3H12A 4GNJA 4PBGA 1VRXA 4XZBA 4XIAA 4J2MA 3WO8A 3BURA 2NT0A 1DQWA 4ZB0A 4AWSA 4RKAA 2VEKA 2RFGA 3E0FA 3OYZA 1KM6A 4IBEA 1IEVA 1UD8A 1E6NA 4UCGA 4I3GA 1WXZA 4D9PA 4HU0A 1WX0A 2FDSA 4L61A 4AFYA 3G77A 2R1KA 2PS2A 3O7UA 2X1SA 2HV5A 1DV7A 2IUZA 1LRTA 3I6EA 1MXDA 4LSBA 2QVNA 3HPSA 4O15A 5HQMA 3WNMA 2WANA 4BQ5A 4F2UA 4GZ7A 3MBFA 4MGGA 4DLFA 4DELA 3TQKA 2NX9A 4PZVA 4OJYA 3NXFA 2CBIA 4HA4A 4IP7A 4FX8A 2WHJA 4NJGA 1KBIA 3P7YA 4MVAA 3PR2A 4NHVA 1SZNA 1BGAA 4GK8A 3CV6A 4ILSA 2I57A 1Z3NA 4I5XA 1CLKA 4WZHA 1V7YA 2DEPA 3O16A 3CTLA 2O4MA 4V27A 4DUWA 3UR2A 4IPNB 4R5EA 1TPUA 3IARA 2PD5A 2YA1A 3QMRA 1EA0A 3PN8A 1KRBC 3HB9A 3CV2A 3O0KA 3C5QA 3WEMA 1N8WA 4JCMA 1EGVA 4WXYA 1VFLA 2YDQA 3MYOA 1GVEA 2J27A 3G0UA 2OGJA 4P8XA 3LSBA 2E6DA 2X30A 3W1TA 1R3RA 1YU2A 5HQEA 3P5ZA 3WY1A 5JMUA 5I03A 3QJAA 1CGXA 4QSFA 2BVWA 5HMEA 3Q94A 3GHRA 3ZVIA 1AJ0A 4PMOA 3FY1A 4LV9A 1HKIA 1K9FA 4I9TA 3USBA 1XYBA 4DNMA 4ALDA 1DWAM 1BGGA 1EJRC 3QGKC 1JL8A 5LA2A 1QO2A 1WKDA 3MUIA 1QUMA 2QHAA 1FFRA 4JGDA 4B5XA 3GBDA 1ISZA 3ZSSA 1QDSA 3HPAA 1QCWA 1WNOA 4MAVA 4WKAA 3BMWA 2RDXA 3GH4A 4R27A 1ZP3A 1HNYA 2F61A 3OA5A 4ADTA 4GZEA 3ITXA 2POTA 3KOFA 2XYLA 3WFZA 1GYLA 5DBUA 4C7DA 1EKOA 4R34A 2YIHA 2VC9A 1QFEA 2WSYA 4M1RA 3P62A 3WLTA 3W07A 1I0DA 3UVAA 2OTDA 3KLKA 1ADOA 2E25A 4Q4RA 4GACA 4LB3A 2J6VA 4XQ6A 1QOQA 2BLEA 4HOWA 1V0LA 5DN1A 4L1WA 5FA5A 1W32A 4UOQA 1F6YA 2VT0A 4LXFA 3QSTA 4OJ6A 4U33A 3SCTA 3CL6A 1EJUC 4G7EB 2QCEA 3REQA 5CG0A 1F76A 5LGXA 2VDGA 3WQPA 1PTGA 2G8ZA 1XRSA 1DL3A 4R3UA 3QPEA 2Q71A 3S5NA 1UJQA 3EGJA 1XD0A 3PBMA 3KVMA 4JX4A 3WKZA 3QR1A 1J0IA 2ZRZA 1OJXA 1DIOA 3W26A 1SFJA 3V0SA 4O1DA 4Y9NA 1VZWA 1VEPA 1IT0A 4LYQA 4MJMA 1QO5A 4JKMA 1SJBA 1FWFC 4AF0B 4AD1A 2D0HA 1D3HA 4C5ZA 2PC4A 2W66A 2W67A 3S1UA 2BP1A 2BHUA 1NFBA 1EZ2A 1NWTA 1BYCA 1UC4A 3H2AA 4J3SA 2Y70A 5AYIA 3GTIA 4DJEA 5D30A 3CLWA 4JQ4A 4UTMA 3W7RA 1O68A 3GUWA 2QXWA 2AL2B 4IUGA 2I9EA 1UIPA 3ABQA 3OLGA 4DZHA 2PBGA 2EJAA 2ZC8A 4E2VA 4IF2A 1I6NA 5J5RA 4Z1BA 3QOKA 4W88A 1QMLA 4TVDA 1W3LA 2CKRA 4PMVA 4KWWA 4AQLA 3R0UA 3LB0A 3T0BA 3AIVA 2PE4A 4IT1A 2ACSA 3T09A 1EA9C 2XPKA 4KWVA 1NH6A 1H41A 3RCYA 4FNSA 1B4EA 1JD9A 3A23A 3URNA 5C8BB 3SQLA 2FVLA 2J7FA 4WVXA 2G4JA 3AYRA 4E8DA 4HZ7A 4JTUA 3HMJG 3GG7A 4XKMA 3WBWA 3EWUA 4BI5A 1DQUA 3AOFA 4C7FA 4PH6A 2YZ5A 4UTKA 3WX7A 3C3NA 1NOUA 4X2PA 3SJ3A 3CEPA 3ZLFA 3FA3A 4O4VA 3IGHX 5BXPA 4W84A 2PDBA 4TOQA 1DJNA 1DJYA 2JEPA 3PTMA 4L1XA 3UJSA 4MLJA 2X0SA 3TTQA 2V5DA 1KXQA 3WD3A 3QQ0A 4ZVJA 2ZKMX 2PWVA 4AAJA 2YDAA 3IEBA 2FPTA 2P0OA 1RH9A 2RTSA 4EXQA 4PSRA 5I09A 4BZYA 4EAYA 3AS2A 1BTCA 3ARWA 1TPH1 3A3XA 5I3FA 1C9WA 1WDDA 1UR9A 4GCXA 5TIMA 2JE8A 1JD7A 2E40A 3BSGA 5CCZA 2GDQA 1AH0A 5HNTA 2FZNA 3ZJ8A 4PUDA 3TMQA 1AW5A 4I7WA 4UFIA 4C6JA 2OSWA 3WL1A 3IIXA 4DJFD 4D6HA 4H19A 4RDVA 2VL4A 1A5KC 3NGFA 3KDNA 3FGCB 4Q4OA 1JGMA 4WD0A 1E9YB 4ROPA 3GVWA 2C1GA 4M81A 2WJFA 3W82A 4NVTA 2XIIA 1GTEA 5KETA 1QI4A 2NT1A 4R85A 3SECA 4IH3A 5IDZA 3QPYA 3AZTA 1EBGA 1LP6A 4ZEPA 4NG3A 1B4KA 1FWRA 2JEQA 1P43A 4LY8A 2J74A 1BG4A 1FP8A 5BROA 2I16A 3VVGA 3QMTA 2CESA 1JJKA 3HQNA 4FNPA 4F66A 4UFMA 5DO8A 4H01A 1VC4A 3A12A 2XGBA 2XSXA 4GKTA 1KRCC 4LEFA 2DW7A 1HJVA 2WMGA 4WXZA 3H53A 4YLWA 1OC6A 2GWNA 2J7GA 5LNVA 1GQNA 4CU7A 1WB0A 1RV8A 3TROA 3ITCA 3LCFA 2RJGA 4O18A 1WDRA 4UR7A 1SM9A 1TVLA 1GGOA 1KBJA 1BQGA 2Q3OA 3RGTA 3C0QA 2G96A 3WDJA 4JYEA 1YRRA 4B4HA 3NDYA 1M5WA 2QCLA 4IJCA 4FOJA 1NEYA 3TAKA 4AX6A 3CO4A 1UROA 3GW3A 4LF2A 3LRLA 1O12A 3DFOA 3PJXA 3A6OA 3JU2A 2DDXA 3UGRA 4D6DA 1RVKA 3C3UA 5E09A 3KHDA 1W3HA 1OGBA 3ANUA 3APTA 5LZLA 2HK0A 1RP9A 4XZLX 3T05A 3ZT5A 5XIAA 2QCNA 4WSHA 4GHLA 2FGBA 3OGSA 3TONA 4PSPA 2WLYA 3IIVA 2QJHA 1GOWA 3K4AA 3TN3A 4HYVA 4K2SA 2QZRA 3B0UX 1E9LA 3L5AA 4M6QA 2Y5JA 1H09A 3T4WA 2XVNA 4UQBA 4HGXA 4DEFA 1G7VA 2ZBTA 3I4EA 3FDKA 1K6AA 1PTDA 4ZQNA 2WMHA 4O54A 4NJHA 4S23A 4WQ6A 1J12A 5MHBA 3VK5A 3XISA 4ATLA 1N2VA 1K9TA 3AMLA 3AZSA 1S1PA 1VH7A 4OV4A 3YPIA 2XDFA 3THQA 1A4LA 4LS1A 3ENLA 4K68A 4IX0A 1KXVA 5DF0A 1JCJA 1SFSA 3IJLA 1KA9F 3TOYA 2PDQA 1TUFA 1NQ6A 1FDYA 4KCVA 2CHNA 4GXMA 3HA1A 1NAL1 3VKKA 3WBXA 2VI0A 2A3LA 4JTKA 4G8TA 1ZUAX 1O60A 2DT2A 1DKWA 3I3EA 1Z9AA 4LUJA 1O4UA 1GVSA 1Q13A 3MHGA 1KXTA 2VZVA 1FWBC 4I5UA 3UJ2A 1SVDA 3OTRA 3M0HA 1P6WA 4INFA 1Y0EA 2EPHA 2WWDA 3BZJA 3IIPA 1NOWA 3UXLA 4EXBA 3MMTA 4R9OA 1UWIA 3GXDA 3QFWA 1GKQA 1UYQA 3NJ3A 3TEVA 2VYOA 1DWHM 2D0GA 1SO3A 4HU8A 4HB7A 3EPMA 1YDNA 1E6XM 3WLJA 4LX4A 1ZJHA 2R24A 1RCXB 4IJEA 1HF6A 1JQVA 4C6PA 1QNRA 3VTRA 4FO4A 5CBJA 2OWCA 2E5BA 3IUDA 1WDWA 2BDQA 2IKHA 5AYZA 2YDRA 4IMEA 4C6BA 3M64A 1UZ1A 1V6YA 1XLGA 3B0PA 2GVLA 4DWSD 2ZX7A 3K8MA 4GYFA 3V35A 3W72A 1SMAA 2XVLA 4WCJA 1HP5A 3P74A 2CBUA 2VX5A 3O63A 3W1NA 4PULA 2R1PA 1JYXA 1I1WA 3VCNA 1UA7A 3VGHA 4JFVA 4IGHA 5C9ZA 5J5DA 2PU0A 1VFHA 4CN1A 1S46A 3GXPA 4JFTA 5CJMA 3S9YA 2E09A 4O16A 3W76A 4FF7A 2YB4A 3LPFA 3WQWA 1OIFA 2BVTA 1POKA 2BHYA 3T78A 3H22A 4D1IA 4P5UA 3W1PA 3IK4A 4B3ZA 4L7ZA 4C6QA 3PM6A 1LORA 4B5UA 1PHQA 3MTWA 2W0UA 1VIZA 4UQCA 4DO7A 2WM1A 5CSYA 2EKGA 2XWEA 3OHMB 3FYPA 1M04A 5FSEC 4MPQA 3CAWA 1NQKA 1XG3A 3EDJA 2ZE0A 1GCYA 1SUXA 4JAWA 3CUHA 2TRSA 4RNHA 3W02A 4ZO8A 1UR2A 4DNHA 2HNEA 3BANA 3HFYA 5CAKA 1BF2A 2ZTJA 1W37A 4IMCA 3JR2A 4A3QA 2ACRA 6XIMA 4GJIA 1S39A 3HG5A 1SJAA 1EUNA 3GTHA 2H9AA 2CBVA 3UA3A 2O9OA 2QGHA 3CHFA 4O57A 3WF3A 4E8GA 3GVRA 2V82A 1LBLA 5DMLA 1E4LA 4JTDA 4QG8A 4JPGA 4AWTA 5A6SA 4OOZA 3GXNA 3LV6A 2GQ8A 1I2NA 3F4DA 2DZPA 5AHIA 1DJQA 2Z29A 1YYAA 3A9BA 3NYZA 4TVUA 1JPDX 4IGSA 1A3WA 5EMUA 2QUMA 3W22A 1TPFA 2CBJA 1FH9A 2GUUA 3MCMA 1EYWA 1WAWA 2E9MA 2J47A 5D9NA 5A6JA 4JBRA 4HNUA 4QGCA 2Y2JA 1EF2A 3RM4A 3LYEA 1Q8JA 1W1PA 1TVPA 2REQA 2HJPA 4NZ5A 5U7SA 1E1CB 1YUEA 3HG4A 2JFEX 2X16A 1BQCA 3GVGA 3UNDA 3VM7A 2WZIA 1DORA 2Z27A 1AW2A 1UR3M 5HWMA 4XZMX 1UR8A 2VX4A 5AHMA 4E2OA 3N9SA 3VMPA 4OECA 4XUYA 3L0GA 3OZPA 1FHVA 4DF2A 1GVFA 4CQDA 1HL2A 1OBAA 3TN5A 4GZIA 4GI6A 4ATDA 4C60A 3M0ZA 2NZLA 3N73A 1RBOB 1XLAA 4YYCA 4YVXA 1TTPA 3U4FA 1Z6KA 3DFYA 1GPWA 2QF8A 3W7QA 4IOTA 5A6BA 1C93A 1AH3A 4AIEA 2Z6JA 1TIMA 2I56A 4PBEA 3LM7A 5LYRA 5T9CE 1R30A 2HROA 3VGFA 4MMWA 4JN8A 1M65A 4RNFA 3STGA 3R1ZA 2ZUTA 5FJTA 3GZ3A 1L8NA 1IXQA 1D7FA 2FH6A 3EOLA 2ASHA 3WNKA 4W4QA 1E6RA 3DGRA 3BXWA 4TU1A 2BS9A 1JCLA 2DH2A 5DMMA 3N19B 4BQ3A 1W5PA 3ZSTA 3SCVA 2BGSA 2JK2A 1RBAA 3HQ1A 1AUSL 2XFYA 1DTUA 4B4FA 1NF7A 3OPSA 4AZCB 4EPKA 1YX1A 3RF9A 4K8EA 4DJED 3UZZA 2Y8UA 1XIJA 1YPFA 1Q65A 1E1EA 1XLBA 2AMGA 1IIHA 2HXUA 4J2PA 1K02A 2Z1VA 3RO8A 2GWGA 4EPDC 4FHAA 3OVGA 1P4CA 3I3DA 4MB1A 1IWPA 3QEZA 2FVMA 3H23A 1EJ7L 4DJDA 1AODA 3BWWA 3WNPA 4FI4A 3G24A 2XM2A 3R94A 3WH7A 1GOKA 2NV2A 1UW9A 2VD9A 3NL6A 4ZO7A 3H7UA 5ENLA 1V5XA 3EX1A 4BY3A 4IIEA 1W6TA 4B2DA 4WKHA 1FWSA 3C86A 3TCSA 1H60A 2E0PA 2EPOA 1AZ1A 3V7PA 5A6LA 4V2XA 3GM8A 1PX4A 1J18A 4UTUA 4M3PA 3CMGA 3AXXA 5CBBA 1TV7A 2Y7FA 1XXXA 3AWNA 1LCOA 4NYYA 3ZR4A 1XISA 1SQ7A 4LT9A 2AAMA 4R33A 3VD7A 4V1XA 3T1GA 1ZLPA 5DQPA 4N9BA 2OCZA 3T7VA 1XSJA 3IACA 3LBCA 2Q01A 4NYUA 1B30A 2BG5A 4LBUA 5CC3A 1ICQA 5A6MA 1HL9A 3CAKA 4QQUA 4AG0A 2NVDA 3GHSA 4JIQA 5CGMA 3I68A 4WDWA 2RDTA 2OOGA 5T9BG 3TMLA 1W5QA 2QEZA 3MHFA 1CXHA 4LVFA 4Q8PA 2D2OA 1W2VA 3WK3A 3PAOA 3PHAA 5DY2A 1OCNA 4AY1A 2WM0A 5HMSA 4ZTYA 1FP9A 1Z42A 3CQKA 3N17A 4PCNA 3HSHA 3ITLA 2GOUA 1DXFA 4RL3A 3PUGA 1CIUA 3N4AA 4IIBA 5A8QA 3SCPA 2G37A 4RW5A 2QJIA 3NM1A 1K9DA 4US6A 4LQ1A 4I7VA 3NZ1A 3TW6A 3A24A 1MEWA 2W4XA 2ZX9A 3RFAA 3ITGA 1IT7A 2DZTA 3KS5A 1Q4WA 4IQDA 3N9KA 1A53A 4HK6A 4GXPA 1HO1A 5EBUA 4LS2A 3PP7A 4IL2A 4HSOA 3SCRA 3QBUA 3LQGA 1EJVC 3BLIA 5AC7A 1I2PA 1UIOA 2B7OA 2Y62A 4HZ8A 5I3GA 3W6MA 4KEMA 7XIMA 5ECUA 1K7FA 2WC4A 2BY1A 2ZDSA 1QPQA 5H6HA 5D04C 1Y5XA 3M5VA 3VKDA 4XD6A 1V08A 3W25A 1VFTA 1OFDA 3CUJA 3OBEA 3IJ7A 4HTBA 2FFCA 1XCFA 3VD5A 2VR4A 3AYVA 3WF0A 3AUJA 4LCQA 3LZ5A 4N9DA 2Q3RA 3VNZA 3UWVA 3LQLA 1NTHA 6PTDA 1TIWA 4WY0B 2ZA1A 5TAOA 3LLXA 3TU9A 3NL2A 2E1WA 3DG7A 4G2DA 1KQYA 3SUUA 3U7VA 4HZ6A 2F2KA 3AS0A 3VKJA 5EMJA 4H3DA 1UBPC 4XWUA 6CGTA 1S2UA 1DJXA 3WYZA 2EHHA 5EL1A 2INEA 4DXXA 1ONWA 1GONA 1XG4A 5FAJA 1DXEA 4QCFA 4Y9PA 1KM4A 2POZA 3IUHA 4HPHA 1S2WA 4IBGA 3WDPP 3RM8A 1EXPA 1DJWA 3DKLA 4XO6A 3TTSA 1FWGC 1IF2A 2OSYA 1Q3NA 1BLIA 2VFDA 3FYOA 3RX3A 4YS1A 2O7SA 4N9EA 4X9SA 3UR7A 3WLOA 4E4FA 2VNCA 4AZBA 4DWSA 3T4CA 3U5UA 2X2YA 4X60A 4WJXA 4JR5A 5CC7A 2GVEA 4OFCA 2NV1A 4MY8A 3WMCA 1XBYA 4AZHA 3W24A 1PE1A 3MMUA 1TPVA 2O92A 4M8UA 1AD4A 4GE8A 1JYNA 1EEPA 5K2ZA 3GTNA 1XWYA 5DFAA 3TJLA 3RMEA 1RY8A 2CETA 2XFRA 4CQAA 1EPVA 1ZU8A 3IWPA 3B4YA 1LM1A 5CSRA 2Y85A 1FWAC 3MDUA 3S9IA 3AROA 3UT0A 3W9ZA 4QLJA 4ZFCA 5DEZA 3MW7A 1W54A 3M9YA 5DANA 1RALA 5A8GA 2QDGA 4DXKA 1FBAA 2PC8A 1LL4A 3U57A 2O56A 1EB3A 4Z2LA 4GGHA 4DLMA 4MAZA 4WX2A 1Q6DA 4XSLA 3UVIA 4Q4SA 3SI9A 1TV8A 3F1QA 4DYJA 1MNZA 4D6EA 3S2NA 5AC5A 1RPKA 1EIXA 3KBVA 1JZ5A 1VHCA 4EPEC 3BPWA 1Z7AA 4MZYA 1G01A 3KBSA 3ZQ9A 1MI3A 4Q8MA 2A3AA 2MNRA 1JF5A 2HVOA 1E4IA 3W6YA 3VINA 1P0DA 4IPIA 3L27A 3VNKA 2B31A 4KWSA 4IQJA 2AL2A 1BG9A 1EO7A 2VDIA 3T2QA 1QI5A 4DWSC 3WLIA 4GIEA 1H7OA 4DUOA 2W63A 3GUGA 1BYBA 3QGAC 5CSSA 3DHDA 4JN7A 2PRLA 2ZE3A 3A3HA 1XIHA 3SSZA 3F4NA 4MFEA 4JD4A 3W7GA 3PBUA 2ISVA 4L4PA 2PDGA 5I02A 4ZQPA 3IIOA 3ZJ6A 2ZZ5A 1C90A 3OQEA 2QT3A 2E4TA 3PZUA 4U2YA 4PTMA 1FDZA 3TYUA 1E0TA 2ESCA 3BOLA 3P81A 4OBRA 1XDJA 3L66A 1Y8BA 5HJYA 2VQTA 2DFAA 3GAYA 4L9YA 4B91A 1ZB5A 3M0KA 2CLLA 3MPGA 3WQGA 3KVKA 4O4WA 5A2BA 2HVMA 1TZ9A 4XZWA 4KFNA 1VF8A 1KGXA 4CD4A 5LA1A 3WBAA 2HS6A 1EL3A 3C2RA 2V3EA 1CGVA 2J9XA 2OZ8A 3NOYA 1D3GA 4FXSA 2X0HA 3A5VA 1LBFA 1XRTA 3ITOA 1BRLB 4MG4A 1KLYA 4M82A 3FN9A 1E6SM 4OHQA 2YL9A 4PCPA 2PLCA 4TV5A 2F8QA 4XD3A 3PSWA 1TA3A 4CD5A 3DAQA 3B03A 1NP2A 1LQ0A 1W56A 4NZJA 3S46A 5C9XA 5CH9A 5U4NA 1N8IA 3IGXA 1NSJA 2V0TA 4IFKA 3WDHA 2E8ZA 1V51A 3UWZA 2XN1A 3UFYA 2E6YA 2C91A 1TZ7A 5EMKA 3G5EA 1FX6A 3BGAA 4KKXA 3VFLA 5M3WA 1SSGA 1KM2A 4JTCA 3FHAA 2C18A 4JQ1A 1BEUA 4DX3A 3KS8A 3EB2A 3F4WA 3T8QA 1R9ZA 2EO7A 3HOJA 3ARUA 3G22A 3Q2DA 3W01A 3KS6A 3VKAA 2VZSA 3UXIA 3NO3A 1E0UA 1VEOA 3S5ZA 2TAAA 1PKMA 2UY3A 2PWFA 1XH1A 4UNIA 4B5NA 2WZEA 1HKJA 2WOQA 2V38A 5A6TC 2PU1A 3UXDA 3P5YA 2D2JA 5HUPA 1HUVA 2V6AA 3OIHA 4D8LA 3DFSA 1LL6A 5D2TA 2GVYA 3KL5A 3OGVA 3EWWA 4F0KA 3FXGA 5LIKX 4S3CA 2ISFA 4WSKA 3EBVA 2AQVA 2XU2A 3OO2A 4LUYA 2C14A 4MM1A 1CLVA 1MUCA 4WOQA 1LROA 3GVVA 4PRRA 5FEXA 4QIUA 4AU0A 1LG2A 3N2MA 3EEZA 4AD3A 3JZUA 1R85A 3M07A 3SCUA 4FX7A 1V93A 3ARQA 4GZJA 4O1CA 1U33A 4A8RA 1RJQA 2FZ9A 3S3GA 2NQZA 5F7UA 3VCCA 4IWWA 1LWHA 4JTLA 2F7FA 1XC6A 2PCEA 4QDWA 3AU6A 3GIYA 4CNTA 2DUXA 4CNSA 1K03A 4M19A 2CITA 2BVYA 4AMAA 3K4WA 3OOQA 6XIAA 4MB5A 3SUWA 1ZAHA 2YXXA 3TC7A 2O4QA 5AHNA 4JQ2A 4HN8A 4MZ1A 2Y5EA 3M0MA 2OR2A 4IMGA 3ZJKA 5EB8A 3CUXA 1B5TA 1R2TA 5E6YA 4QE5A 3DHPA 4HP5A 1NWRA 5BU6A 4AISA 1VCVA 3LMZA 1K8YA 3QHOA 4NAFB 3BOXA 1QNQA 3S1GA 1DHKA 5LKYA 2Z28A 4AZGA 4MHBA 2O0TA 1GYMA 1PHWA 5ABEA 3QV6A 2CLFA 2BGNE 3SUVA 1YU1A 1F3EA 2OZ0A 3TYCA 4GNVA 3UEQA 5C9WA 5LXEA 4OKDA 3VXGA 5K7JA 4GXWA 5FKYA 3W7MA 4NJIA 4UFHA 2QCFA 1OEPA 3WLKX 5REQB 1CXIA 1J96A 2WHKA 1VPQA 3LCWA 3MDWA 1DE5A 3TW7A 2WXDM 1LRNA 2V5CA 2DSVA 1EWDA 2QQ6A 3SR7A 3G3MA 3WSUA 1JUBA 1MSSA 3FVDA 2DIKA 2J75A 1QJWA 4FK9A 2Y1HA 5A6BD 3MZNA 4JIIX 8XIAA 4MY1A 2PDCA 3QLDA 3B9AA 5LIWX 1PIIA 4ZB5A 5D02A 5K3VA 3DN5A 5HJXA 3CQHA 1MMFA 3VM5A 4CD8A 3A47A 2WAGA 2B4GA 4AVOA 2V9DA 4KRTA 4QNWA 7REQA 7ODCA 5B7YA 1GOMA 1C7SA 1XYMA 1PAMA 5L6UA 4ORMA 4O8AA 4O1AA 3U2OA 1XX1A 1QPOA 1UKQA 5I78A 3VUSA 4ZFMA 3ZOAA 1J79A 3NQCA 1H0IA 1GEHA 3EZ4A 1RJPA 1QI0A 3DFTA 4B5VA 4CU8A 3NCOA 3RHGA 2OX4A 3B3DA 1YBQA 1CGUA 2ZUUA 3GXFA 4TX6A 3W2LA 2HQAA 2EBNA 3MO7A 3HURA 1IZCA 4JS3A 2R82A 3TX9A 3WK0A 1W1B1 1C8VA 4ZXLA 4RZ4A 1ZJBA 1RPXA 1NDVA 1R3WA 3W70A 3NQEA 1PO9A 1OF6A 8RUCA 1OM0A 1US2A 5I2UA 1GVOA 1HP4A 4MFDA 1W1ZA 4RNIA 4IIHA 1KBKA 1SW7A 3W7CA 1S5VA 5G4EA 4OUIA 4WLCA 3GNRA 4AHPA 1XYLA 3LX9A 3K1GA 1LF1A 5D2WA 3QY6A 2H8XA 4NI8A 4H8NA 3QYQA 1IEQA 4H9YA 3WBEA 1ZCCA 3F5KA 1RD5A 4PMJA 2OO6A 3EKLA 5FF2A 1W31A 4OIFA 1V6UA 2QW5A 1VLIA 1XF0A 3NL3A 4O0ZA 1UH3A 2WJZA 3BTNA 2F84A 4ICNA 3TCEA 2YSWA 2HDJA 1IE7C 3LLDA 4XZ9A 4HHMA 2IW0A 1CTNA 4C6OA 3B0XA 2QMKA 1EBHA 1E5JA 1GZ1A 3N2OA 4IMFA 5CGTA 2A6NA 1XYAA 1RR2A 2J8TA 4E0CA 1C8QA 1W91A 4GY7A 1ZP4A 3NL5A 5DT5A 3W4RA 1DHPA 2J78A 1PZ3A 2QCDA 3KP0A 4XTDA 3PBYA 1YXYA 2Y0FA 1CXWA 1EJTC 4AWEA 1PDYA 3CV1A 2V3DA 4LAOA 1Q6EA 3FDGA 1ISWA 3QYSA 4BQ4A 3NZQA 1YKWA 3E2QA 1Q7ZA 2XVKA 4F79A 4ICMA 3VNMA 1WE5A 1X8CA 1XYZA 3KP1A 2ON3A 2JKAA 3SADA 4FIQA 4UXDA 5FD0A 3CWOX 1PZ2A 5BXRA 4DBUA 1FH8A 4KQNA 4QP0A 4Q22A 1LQAA 2P1FA 2OKTA 2XTKA 4LCSA 2XJ7A 1QATA 3V3WA 3EA3A 3VABA 3DERA 3KVLA 4S2BA 3QGVA 1OD8A 3ATYA 1QK0A 3LNPA 4C6DA 3UCDA 4EF9A 3W38A 3CZEA 2YFNA 1KGUA 3L4XA 1VAHA 2JKEA 1XIDA 2XD5A 4B5TA 3RM9A 1WKEA 4S3AA 3S6DA 3VNJA 3MS8A 5CSUA 1G67A 3UWYA 3GKAA 4H7CA 2ZZ4A 3RRAA 3SRHA 3XINA 3WQVA 1TPB1 3C0JA 3W84A 1TCMA 3GQYA 2QGYA 3T2OA 2C15A 4M6UA 2X09A 4GQQA 2OYMA 3BC9A 1V79A 3E1F1 3VDCA 5C2GA 2A3EA 3OYXA 3DHFA 3A13A 2FVKA 1MEIA 2FZMA 1V3MA 2VMFA 1UD2A 2VFIA 2NX3A 3SFKA 2VUYA 3R58A 3UY7A 4GD0A 1TTQA 2Y2KA 1OCBA 1R7AA 4Q8QA 1UD4A 4KRZA 3MUCA 4LUIA 3GFYA 2IQDA 2Z26A 1DQXA 4IGNA 3ZMRA 4NL1A 1UPPA 3D47A 5I23A 2JALA 5E9AA 1GK8A 4AD2A 3OA3A 4FPSA 3P14A 2J62A 5GNXA 1G0CA 2J88A 3TLQA 1B54A 3QTGA 4P8VA 3AALA 4WR3A 3HGOA 5FF3A 3LDVA 4ZZ9A 3VX0A 1FWEC 5H8UA 3FEQA 3AXHA 2P0IA 1MW0A 4DAIA 5GJMA 4HA1A 3WUFA 1FDJA 3WQEA 2FGZA 5C9UA 4Q4KA 3BV4A 2Y4SA 4JYFA 1REQB 4O8RA 1EP3A 1NM9A 4LALA 3EMZA 1XS2A 2OEJA 2JCHA 3ID7A 3USZA 1WO2A 2GJPA 2E68A 1TO3A 4M51A 2PP1A 2BOEX 4RV8A 4S3BA 1TREA 1MFUA 1LT8A 2TYSA 3T42A 4KGJA 4IPJA 2ZRYA 4GQGA 1EC8A 3GY1A 1J4EA 3I7SA 4XAGA 4IG2B 2NQJA 1W8GA 4JKKA 2WVSA 3GZAA 4NNAA 2ZZ3A 2VEMA 5L9FA 3O8AA 4ZE5A 3V5CA 1FWDC 1NVMA 3L4VA 4H6KA 3VOFA 3VZXA 1YE4A 1FCBA 3TZFA 4JEJA 4MWAC 2OLAA 1HJQA 2IMRA 4L64A 2X40A 3N3MA 4C5YA 2XG9A 2YL5A 3T0DA 1XBVA 3NM3A 5D05A 2G95A 6REQB 4IJRA 1HX0A 3MV11 1CCWB 8XIMA 3M0LA 5EBAA 4CQ8A 1M6JA 1KNWA 3GDTA 3LU2A 3BUVA 4IMDA 1V3HA 1GOQA 4HIBA 3VOHA 2C6QA 2KAUC 4AH7A 1MWOA 1B90A 3GXMA 1DWFM 1B0IA 4V1YA 1ITQA 2XH0A 1E15A 2FIQA 1EX5A 6TAAA 4UMAA 2PWUA 5FI8A 2GK1A 4Z1DA 3U4AA 3EWXA 4K36A 1AA1B 1KRMA 1TE1A 4FNQA 5A8NA 3S1WA 1LTDA 4JIEA 1UKPA 3QQWA 4EOUA 3IANA 4UMCA 3R8HA 4EK7A 4IXHA 3NUKA 2Y24A 2CC0A 3KTSA 3LTPA 1VEMA 4UOJA 4ZCWA 3KW3A 4ZMGA 3GE7A 5K9XA 2VRKA 1F3TA 4GIYA 1GVIA 1TPC1 3RILA 3SUSA 2ZRUA 3VE9A 1QNOA 2DGAA 1UOZA 1O1ZA 7ENLA 1VBJA 3AUOA 4M7TA 3K13A 1W5MA 4HKPA 4NNCA 1YNQA 4JTQA 1D9EA 4QTGA 3UW6A 3VC6A 4REQB 1ITUA 5H2ZA 1E56A 2ZVRA 2JE5A 4HPJA 1U5VA 4XAPA 2WNZA 1JCNA 2VX6A 1J6OA 2J25A 1OFPA 4GY1A 4J1OA 3TFXA 4ZOEA 3DKJA 4L6OA 1UD6A 2D49A 3S42A 3VDAA 3NAVA 1CBGA 5AYXA 4W93A 1QRQA 4DWDA 2OWXA 3BLKA 1UZ4A 3UXAA 2Y7GA 1QBAA 3SB0A 3CASA 1ZJAA 1V0NA 3B97A 1JZ6A 4O0QA 2RKXA 1CGYA 3PSVA 4F0LA 1BSLA 1OX4A 2XZ9A 5E5CA 3UD6A 1XH0A 5JH1A 4JKLA 3LI0A 1PUDA 4GX8A 4JTEA 4J3TA 3CZ8A 4AY8A 3SO7A 1RJRA 1ITCA 1UH2A 1KO0A 1WDSA 3W73A 1FXPA 3M4HA 2VRJA 4NY2A 4G7EA 4H9XA 1LWIA 4V33A 1S5MA 1OGSA 2QVHA 1G4SA 2EPMX 3CIXA 1X6UA 2WWCA 2V81A 4KF1A 4Y8FA 3HIJA 1E0VA 1LQ2A 1KTCA 1H63A 3S83A 4N4PA 4OT7A 3W83A 5F4SA 4MTVA 2GUBA 4B2DD 3NZRA 4GIRA 1A5BA 2WJDA 4YHEA 1BWLA 3MQTA 5KMYA 1A5LC 2I5GA 3KRZA 1LOQA 3ALFA 4DJDD 5LHEA 5IHRA 2BGQA 3LLFA 1WOBA 3GC5A 4J3VA 2BBFA 3CIVA 3TNOA 4AXKA 3G0SA 3VGDA 3TTOA 1NOFA 2CEQA 5HWJA 3W0KA 2ANUA 2D2HA 3B8UA 5A3HA 5EYWA 1I1XA 1R2SA 4PE8A 2XFWA 3NQ2A 4AY7A 5IFPA 4J40A 3WK2A 3VD3A 4AIUA 5KTLA 3R89A 1E5NA 2VOTA 4MDPA 4HCHA 1FWTA 3B0YA 3CC1A 3EDEA 3T55A 1XLDA 2JQXA 4DPQA 3RN6A 1FWJC 4LANA 3DCPA 4JX6A 3SCWA 1EFZA 1ADSA 1SO6A 4QAIA 2QNEA 1TPWA 4CCZA 1A47A 4RE0A 1RQEA 3PY2A 1JUEA 4PUWA 1TQXA 1FRBA 4DM2A 3ZT6A 5IRPA 5IHSA 1RLCL 1XIFA 4B5SA 3QR3A 2B81A 2KZHA 3TQPA 5DLCA 3IVUA 5C6MA 3G1SA 1DJZA 4OJOA 3E2SA 3LCGA 3UYCA 3BCDA 3CJPA 3IK2A 3WDRA 4M29A 1JR1A 3M6YA 2PWDA 2G3FA 4H9ZA 2CXEA 1ISYA 3E49A 3VI2A 2X2GA 3DESA 1P0BA 4AYGA 1IIGA 1RBLA 4CU6A 5JXQA 1E6PA 1EHAA 3CPRA 3RX2A 1E1CA 4W7VA 2ATSA 3WUGA 1M1BA 4Z2JA 3OHIA 1AQFA 3DFHA 2FYMA 1GT8A 4J27A 3U8GA 7TIMA 4MNLA 2ZZ2A 4J3UA 1J5TA 4AC7C 4LBSA 1XDLA 5AOUA 4XZNX 3R5EA 4GUFA 3F4VA 1W9XA 2C19A 4LWWA 3GO2A 5E0FA 4HPNA 4U28A 1TR9A 2PSNA 4I8DA 1R87A 5H1WA 1LLZA 2VDHA 3NR0A 3GH5A 3G1RA 2Z1SA 3KOYA 2BXVA 3ITYA 4LBRA 4Y2WA 1C29A 2UBPC 3UG4A 3G1DA 3RR4A 2VZTA 1L2QA 1Q5MA 3WMSA 4MADA 2G4FA 4AEFA 3GYEA 1WV2A 1K6WA 4CNNA 4IFRA 4FLSA 4U2ZA 3KL0A 4K8GA 4NASA 2YW4A 4FSAA 3KE0A 4UB9A 1UB3A 3UU0A 4N0RA 1BVWA 3DI0A 2VUNA 3W27A 2IQ0A 5F2LA 1IGWA 4PUEA 2A4AA 1BVNP 1H3GA 4UZUA 2YBTA 3GG0A 1EZWA 3FKRA 1JCXA 4NP7A 4CKQA 4WF7A 1KWGA 3I3BA 5FCZA 3WBYA 4GI4A 3GFXA 5E70A 4OBSA 2FGLA 2I1OA 3OU8A 4F4RA 1YDVA 3WD2A 4QEEA 4GVIA 3CHDA 1VB9A 1E43A 5M5DA 3DENA 1LOSA 2DQWA 3LA4A 1BHGA 1DWJM 4H00A 1MVYA 2OYKA 1BSIA 4P7OA 4WOZA 2ZOXA 4Q33A 2DZWA 2PD9A 1GQKA 4DIAA 3N11A 2XSBA 1KLZA 4L80A 1LL7A 5T8GA 4YYFA 4TTUA 3KCLA 3VU2A 1W5NA 1H5VA 2WC7A 5AFDA 3EYPA 1GEQA 4PMDA 3BG9A 1E6ZA 1OHLA 3HONA 3KS4A 2VZUA 4Q7IA 5H91A 4NZ4A 3TYZA 4GQBA 3UJEA 3DIPA 2IPWA 2PB1A 4ZOBA 1R7OA 3RIKA 5HULA 3FFSA 4QROA 3REQB 2EPLX 2P8CA 1GQLA 2PPGA 4FXJA 1RUSA 3H2FA 3B8DA 1V0MA 3AXKA 4KFOA 2NUWA 3HN3A 3FJLA 4LF1A 4YCOA 1XGDA 3M1ZA 1AQHA 2DSWA 5ABTA 3PTDA 3LPGA 4H04A 1R3VA 4DYEA 5H8PA 3LHWA 3TOPA 2G41A 3THUA 4PFHA 1KCKA 4ZENA 4UMBA 1W1A1 2WKGA 3W2JA 2PDUA 2I17A 1KB3A 1RQBA 1OIMA 1ODZA 2HMCA 1TPEA 1NDWA 3TA6A 2OKOA 2HBXA 2KX9A 4AWUA 1TWWA 2GL5A 1PBGA 5IM51 3BZGA 5LIYX 3GR7A 1H1YA 3OVRA 4QQ3A 3LPOA 4C6FA 3ME3A 1PKNA 4W8LA 4NXSA 3WD0A 4A8LA 1R9YA 5MF5A 1UZDA 1K3UA 2REQB 1SJDA 4GO9A 4Y6GA 2XD1A 5CJNA 2P8BA 2ZQ0A 4QXIA 5DX7A 3VIHA 1E72M 2XN0A 1GYNA 1AFSA 4TO8A 4LW7A 3EKGA 1RLDA 2C71A 3NQ8A 2ZVIA 3STCA 3ARTA 3FAXA 3NSNA 5ABGA 4W89A 1JFXA 1JDEA 4PYSA 1B3OA 5BOEA 3QY7A 9CGTA 1TCDA 3EMQA 4EACA 4S3GA 5TNVA 4YMZA 1KM0A 3V18A 4ZL1A 3O05A 2J7CA 2YZRA 1W8SA 4L9XA 5BRQA 2BB0A 3HPZA 3N34A 4O1EA 1LJYA 2QS8A 3RLHA 4LRSA 3W81A 2FTPA 1LLOA 2CFFA 1CXKA 4HYRA 1C92A 3R2GA 1UKSA 1TRDA 5J04A 4PN2A 1F61A 4MZ8A 3DBNA 1DEDA 2HK1A 4IFKB 1JAKA 4OVXA 3W7JA 3E0LA 3STEA 2QIIA 1VJZA 3LCLA 5CG7A 3CH9A 3FNDA 1XGEA 3M0JA 3FIGA 1DYSA 4ECLA 2D23A 4QCEA 4A8NA 2V68A 4QISA 3L4ZA 4Y9OA 1CB2A 3UWQA 3UPWA 1X7FA 1CB7B 4MNKA 3TFCA 1RCQA 5H8MA 1PV8A 5I07A 2G3NA 4FR6A 3TV8A 4E38A 3GFZA 4HNLA 1TRIA 3GS6A 3TXVA 4BKNA 4JTJA 3MSDA 1J6PA 4XBKA 2FFIA 1SZFA 3LHTA 2A5HA 2DORA 1TJ1A 4A3HA 5FEPA 4WK9A 4LVAA 4DBWA 1FHUA 4UFKA 1H50A 2OZ3A 2ZZ1A 1G6CA 2FKPA 3EOSA 2OFJA 3WF2A 2ADAA 3G1YA 3BSHA 5HOSA 3CBWA 4GYKA 4F0RA 3BJSA 5A2CA 1BWVA 1LDCA 2VTFA 2Z7GA 5HMFA 1YXDA 3DG6A 2L5HA 3TR9A 4GYJA 3I6TA 4Q6XA 1HL8A 2FTWA 1F05A 3EPOA 5AVNA 5G4HC 1QT1A 3CT2A 5FF4A 3SN1A 4KCUA 4PB4A 1QW9A 4MJ4A 4P7QA 3EB3A 2BMBA 4CCCA 2EAWA 3ALGA 2XHYA 4XISA 3PJWA 3WMLA 3NPVA 3R79A 2ALRA 1OWQA 3URAA 1AD1A 4KPLA 1C7TA 4PMNA 3R13A 2Z0IA 2VEIA 1DVJA 4BF7A 1IYXA 3GDRA 4W87A 1UOKA 3WN6A 3D6NA 4HD5A 5I3IA 3BAWA 5BRPA 3VIJA 3KHJA 3OIXA 5C2CA 1DJGA 5CPOA 2WB5A 2E8YA 5HPOA 5A2AA 1F8IA 5FEZA 2E3ZA 4UFLA 2BZNA 4W8AA 4EE9A 4QE4A 1GOXA 1XH2A 4TIMA 2QJMA 2BFGA 3UG3A 3VE7A 3PZVA 1EOKA 1M01A 3B9OA 2ZX6A 1A0CA 1DIKA 2WKLA 1GOIA 4JTTA 4NZCA 4PUJA 3IJIA 1S5TA 4B9ZA 2VEGA 4IJBA 4MSSA 5CKSA 2J7EA 6REQA 2OOFA 4BA0A 5B7ZA 2DJXA 3BAXA 3CEUA 3G2GA 4MWAD 4M6VA 3BW2A 1F3WA 3WH8A 4HBKA 3BGJA 1Z8AA 3RNDA 1XFBA 3MMWA 4B92A 2J8GA 5JVLA 2OWWA 4QG6A 1CECA 2Z6IA 3P84A 1ISXA 3PWIA 1V03A 3EKZA 3T44A 2PI6A 3K46A 3LTYA 1I8JA 2AOSA 1B3WA 4DBEA 5D8ZA 3VMNA 4ONVA 1SZEA 1F6KA 4AUBA 4ZQRA 2J13A 1US3A 3I7QA 4LC6A 4OZOA 1E0WA 3HG2A 3NEHA 2PRHA 3KBMA 5GJNA 5C7VA 3WENA 1EJSC 5JUVA 4DB7A 4DQWA 2V8ZA 1N82A 3BG5A 4E5TA 5EFFA 1X8FA 3W7DA 5HNNA 5G5IA 3KCOA 2XIJA 1X1ZA 2W92A 3BAJA 1HTIA 1TE6A 1T6MA 1J2BA 4XK2A 4D8ZA 5E93A 3TC6A 3GD6A 2PGWA 4GHRA 2VQUA 5CPSA 4C6IA 4CD6A 2ZA2A 4J7RA 4QRNA 3QMSA 2E1DA 3KM8A 3RXZA 4YXGA 1FFQA 3BQ6A 1J0YA 1VENA 1ZBVA 2ZRVA 4FNTA 4J28A 4NZFA 2EG8A 3N18A 2ODOA 4JX5A 3OLEA 1EC7A 4JHMA 3FJ4A 4I5RA 5LNSA 1Q63A 2WVUA 1S3HA 3CK5A 3GU2A 4XB3A 1AIWA 2C1HA 4TMBA 2YA2A 2Z1WA 3PNUA 3Q45A 1YTEA 2ZA3A 3W2KA 3KAOA 4LY4A 3HJEA 3UZYA 2VEPA 3LG3A 3TYAA 4D6JA 2E9LA 4NAEA 3DDMA 5CC5A 1Q6OA 3CXOA 3ZVHA 1VYPX 3O9NA 2PDYA 3CNYA 3RR1A 2YBVA 1IEIA 1NWUA 2CZDA 4TTGA 3O6YX 3LHUA 4I9AA 1A5AA 1RY0A 4PEKA 1BKHA 3FX4A 2NXHA 1C9DA 1BYDA 1WYIA 2W27A 5EGRA 2BTMA 3GTFA 3P80A 1MRAA 1NELA 3MJYA 3MYPA 1BPLB 1EP1A 4JNZA 4CLMA 4ERIA 2Y2WA 1WBJA 4V15A 3SGZA 4YTUA 3KCJA 1BKSA 2YB1A 1K77A 4PTWA 1CI1A 6ENLA 1L6JA 2HSAA 5CXPA 1XPYA 3A4AA 2VC6A 1A3XA 1XIMA 2FHCA 3L4TA 2EJ1A 1V0KA 3ZZ1A 2PZNA 1S38A 4Z1YA 3H2EA 1B3XA 1KM5A 1RK6A 1U22A 2A1YA 2YR1A 3E0VA 3T0TA 3G1AA 4I9JA 4XTIA 4NAFA 1A3HA 5F2MA 3FCPA 1G69A 4KMQA 1DE6A 3TYEA 1UR4A 3ES8A 1EO5A 4K3ZA 4X3ZA 5K4ZA 3VNYA 3CMJA 3IJQA 4C65A 2ZC1A 4GMEA 1XD1A 3L0KA 1XI3A 1XLCA 2ZFAA 4K1WA 1AZ2A 4MOZA 2CERA 4Z08A 1QWGA 1XLLA 4RX0A 4G1KA 5G1TA 3IUIA 3F03K 5D2VA 3J7HA 1ITXA 5MKGB 4DJDC 3RX4A 1OC5A 4W85A 3H6OA 3S5YA 4KESA 1EH9A 4DO5A 1UC5A 3L67A 3VIGA 3BG3A 4K6AA 1FY6A 5LNRA 3HZ3A 4V28A 1FQ0A 3FA4A 5DCBA 2J79A 3LGGA 3G18A 4LH8A 2RJHA 4G6CA 4KEUA 1S3TC 3GDBA 1KFBA 3JRKA 1XICA 4PFMA 4Q4MA 2DT3A 3TJXA 4C91A 3TK7A 1LOLA 3QC0A 1ZQ5A 1Q6FA 1BD0A 1XFCA 2BNJA 4A4AA 2B7NA 3GHUA 1P5BA 3SSJA 3BDKA 2ZXAA 4DI8A 5CJ5A 2UWXA 2GVGA 3AMDA 3LV5A 5AHFA 3EDFA 1RQHA 2CU0A 1MDLA 1IQ8A 1SR0A 2V30A 1LBMA 2E9BA 1XPGA 4N9CA 1FHDA 4NJKA 1U5JA 2EQDA 4RNJA 1CX9A 4XKYA 1K8CA 1OABA 1UG6A 2P10A 3I4KA 3NQDA 3TQVA 5AHLA 3HGSA 3AIEA 1NDYA 3NQ7A 3B40A 1S5NA 3WQ8A 3EXTA 2PDNA 2O9TA 3IVSA 1YHTA 3MVIA 3H7VA 1M03A 3Q67A 9XIAA 5A5WA 1IT8A 4GLEA 5F4XA 1O5XA 3TUUA 3AJ7A 4AYSA 1X96A 3H2OA 3L5LA 4N4QA 4OV9A 1Q2SA 3H24A 3EOEA 3TLLA 4RCXA 2H3DA 1J11A 1Q45A 2IPGA 4LNYA 4L4MA 2VGBA 3HQPA 3FW6A 3M43A 2WKJA 3HBLA 4TR9A 2TODA 3IJ8A 2QDDA 4Q8NA 2Y2HA 1ZFJA 4FOKA 3LCIA 4MKVA 3JUGA 1SJCA 1UWTA 3DU0A 4LEQA 1U83A