4TX8A

Crystal structure of a family gh18 chitinase from chromobacterium violaceum
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
395
structure length
374
Chain Sequence
b'ACPGWAEGTAYKVGDVVSYNNANYTALVAHTAYVGANWNPAASPTLWTPGGSCGNTVPFAKHALVGYWHNFANPSGSAFPLSQVSADWDVIVVAFADDAGNGNVSFTLDPAAGSAAQFIQDIRAQQAKGKKVVLSLGGQNGSVTLNNATQVQNFVNSLYGILTQYGFDGIDLDLESGSGIVVGAPVVSNLVSAVKQLKAKIGPNFYLSMAPEHPYVQGGFVAYGGNWGAYLPIIDGLRDDLSVIHVQYYNNGGLYTPYSTGVLAEGSADMLVGGSKMLIEGFPIANGASGSFKGLRPDQVAFGVPSGRSSANSGFVTADTVAKALTCLTTLQGCGSVKPAQAYPAFRGVMTWSINWDRRDGYTFSRPVAASLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable chitinase A
publication title Crystal Structure of a Family GH18 Chitinase from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 120
structure length 374
sequence length 395
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4tx8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4tx8A02
2WANA 4LYQA 3AXXA 3RM4A 1US2A 8A3HA 1PJ9A 3WQ6A 2XWEA 3W53A 1OD0A 3WF4A 1H11A 3WUGA 3K8KA 3BAKA 1QHOA 3VNZA 4PTWA 2O9OA 1HT6A 1Y7VA 2WYSA 4IUGA 1KGXA 1R8LA 5DEZA 1FFQA 5D9NA 4PMUA 2VR5A 4MNKA 4D6IA 2W66A 1XGZA 3DECA 4DUXA 1NH6A 1W2PA 4P7QA 2OWCA 1V6XA 2YIHA 3ARWA 3O2LA 1J18A 3PBGA 5I23A 1UWUA 1BAGA 1MW2A 2ZWZA 4W84A 4KGLA 3TA9A 3VKKA 5ABFB 1QNPA 5BRQA 3IAQA 4D6DA 1V03A 1NQ6A 1XSJA 3WDJA 4WKFA 4UFJA 2X0YA 3VIJA 4P7NA 5ABHA 4BS0A 3VD9A 1H09A 1XD1A 1XCXA 2WCGA 3MKKA 5LA2A 4W5ZA 2YA2A 4EK7A 1R87A 3VMNA 2YL6A 4U2YA 5A6KA 4X0NA 2X05A 1AQMA 5BRPA 1FH9A 2J7GA 1E72M 6A3HA 1ISXA 1K9TA 3MUIA 1HJXA 2WCAA 1BLIA 1WDPA 1BSIA 2CBJA 4AIOA 4DWSA 1LL4A 2WSKA 2GK1B 2CBIA 4U2ZA 1M03A 3MSGA 4JL2A 1E4MM 2VT0A 1ODUA 3SCPA 1TCMA 4AZ5A 3VM5A 1JZ4A 3VIOA 3WBAA 1TMQA 1B2YA 2CHOA 1BVNP 5I0DA 4RL3A 1XRVA 4W5UA 1MQPA 4ZEPA 2ZX7A 1M01A 1HJWA 3WF1A 5C71A 2BY1A 1WZMA 3T09A 1GQLA 4MNMA 4UNIA 4MNLA 2VRKA 2ZX6A 3RJXA 2WSPA 4JFWA 1I1WA 2CESA 2G4FA 4QLLA 1AVAA 2FHFA 1LL6A 3WD4A 4AW7A 5E6ZA 1W9XA 4MAVA 2BV9A 1OSEA 1BYCA 4CCDA 2ZUMA 4WJXA 2OSYA 3A47A 1TR1A 2Y5EA 5BXPA 1W32A 1V02E 4BZYA 2GJXA 4XUYA 1WDQA 3T0AA 7A3HA 1RH9A 3N04A 3WDHA 1GOMA 4TXEA 1JL8A 3U57A 2EJ1A 5HDRA 2HISA 1S46A 4OBRA 3WMCA 1JNEA 2YA0A 4RE2A 5IHSA 5A6AA 4J3WA 4HPHA 3CMJA 1OD8A 1XCWA 4HZ7A 1P6WA 1LG1A 1QW9A 3ZJ6A 4B9YA 1CYGA 4B9ZA 4HZ6A 2QLYA 5CLTA 3SUVA 2YDSA 9CGTA 1EHAA 2FHBA 1HF6A 5A6BD 3NUKA 1QI0A 4C7GA 3CUIA 3AS1A 4DWSB 1WCGA 3B9EA 4J3TA 3EMCA 4UQAA 3NSNA 1KGUA 3DYPA 3BAWA 1E3ZA 1OB0A 4F9JA 1PIFA 2E4TA 1A3HA 1UZ1A 4E8CA 4RE4A 2JEQA 3CHFA 2DPEA 3GXDA 3AMDA 3CIVA 4Y7EA 2DSVA 4N0RA 2WLYA 2Y4SA 2WC7A 3EDJA 2PI6A 3VUPA 1BG9A 3B9DA 3WUBA 5CJ5A 3MMDA 3W4RA 1HVQA 1WPCA 3NYDA 2BNJA 3WBEA 1CWYA 1PX8A 2WLZA 1DWFM 3KWXA 1RPKA 1J01A 3CUFA 2QMKA 2EXOA 1VEOA 4OOUA 3IJ7A 3B8SA 2WHJA 1KBKA 1E6SM 3VVGA 4W7WA 3T0DA 3BC9A 1UD6A 4ZENA 2D2OA 2YDRA 4Z2HA 1VB9A 2OSXA 2VVSA 2BY0A 2E9LA 1H1NA 2D49A 3DHPA 3N15A 1UA7A 5FL0A 2XGBA 2F61A 1JZ7A 3VX0A 2E3ZA 1E5JA 1GORA 1VJZA 4QAWA 1E6ZA 5AYIA 3SCQA 3AMGA 5A8NA 2DIEA 3PHAA 2GJXB 2WZIA 1J0KA 2VJXA 1XSKA 1R7OA 4XZBA 4HTYA 4CD5A 1DWIM 2ZXBA 1NARA 4W7UA 4M29A 1OWQA 5KEZA 2UY2A 1GNXA 2WCSA 3L4XA 3BH4A 3F4VA 3SCOA 4DUWA 1GZJA 2EO7A 1C3FA 4U5KA 1VRXA 3AIBA 1GQJA 3CH9A 4HMEA 4MTVA 1CEOA 3FN9A 1OIMA 4WF7A 1V0MA 5DT5A 5A95A 3ARPA 5M17A 1MXGA 5EFFA 1V02A 1NOWA 4L4OA 4JFTA 4D6HA 2VO5A 5DFAA 1W3JA 3M07A 2WC4A 3GNRA 3AS0A 2V3EA 1EO7A 3ZT6A 1FHDA 2WMHA 3G6MA 4PUDA 1V6YA 3AIRA 3W6LA 3MV01 5A6LA 4D6JA 3A3HA 3AHZA 3WD0A 1E73M 3S2CA 4XB3A 3II1A 1W3HA 2VCCA 1CLXA 5IFPA 2D20A 1XHGA 1KCLA 2JALA 3CUGA 2D22A 5JBEA 2EPMX 3VDBA 4GZJA 5FCZA 3K4DA 3AYSA 3ARTA 1JYNA 1JDDA 4AZBA 3GM8A 1B3WA 1XV8A 2D0FA 4QDMA 4TX6A 4AZ6A 4CCEA 1D2KA 3AMKA 2WVVA 3WN6A 1KQZA 2G3IA 2VZTA 3MMUA 3VMOA 1EQCA 3CZGA 3KL3A 4ATDA 1YHTA 2VZOA 2D0GA 3FW6A 4J3XA 1AMYA 1DP0A 1VENA 4M80A 2J47A 1MFVA 2Z1KA 1QI4A 1D3CA 1BG4A 2J7BA 3TTQA 3WNNA 4OIFA 3TTSA 2PBGA 4JCLA 4BF7A 4BA0A 4F9DA 5A6JA 1LG2A 1TVPA 3RPMA 3OLIA 3AFBA 2J8GA 2ZXAA 4F8XA 3IANA 3QHNA 3VOCA 1UD4A 1MW1A 3AYRA 2ZUVA 3AJ7A 2A3EA 5A69A 1F4AA 4GO9A 4PMQA 2WKLA 1OM0A 2C8NA 1BPLB 4LXFA 3RM8A 3QR3A 4PBGA 5D9MA 1MQRA 3M46A 3WD2A 2V38A 3AIWA 4UQEA 2WVUA 3TTYA 5ECUA 1NOFA 2YBUA 5TD4A 1K9EA 2Z1SA 1Q4NX 5BCAA 1WNOA 2OLHA 3K8LA 1GQKA 4DWSD 1H5VA 2XHYA 4DM1A 1GVYA 1TA3A 2JIWA 5HPOA 3WH8A 3SCTA 1UKOA 1C8XA 3AZSA 4UOQA 4HP5A 1VEMA 2XIIA 2J78A 2VMFA 2ZIDA 3WQ5A 1JZ8A 2ZUNA 5I77A 3GH5A 1J0JA 1E6PA 1GJWA 3M7SA 4JKKA 5A6MA 3EMZA 3ZSSA 1G9HA 1B31A 1LJYA 2VL4A 3ZR5A 2DH2A 4PRWA 2RGLA 1X6LA 4CU6A 3UG4A 4S3JA 1UOKA 3BLKA 3W27A 1HX0A 5FIPA 4ZXOA 1UR8A 1J10A 4IPLA 4PMZA 4OBSA 3VX1A 4GI8A 3BGAA 1LL7A 1FA2A 5ABEA 1H2JA 1UQZA 2QPSA 3AHVA 1ISZA 2WBKA 5DF0A 3MO4A 3CUJA 2BXZA 4OZOA 1UWRA 4HA1A 4CD7A 3JUGA 3HU7A 2X2YA 3VGGA 2VOTA 5HXMA 3ZJKA 2FGZA 2JFEX 5DMYA 2O9PA 2VUYA 1KGWA 3DC0A 4EAMA 1W1TA 4JCMA 2E40A 1HXJA 1K9DA 4F66A 1GOOA 2Y2WA 4HA4A 3W25A 4AC1X 4JFSA 3SUSA 1JZ2A 4PTVA 4CD8A 2NSXA 4D1JA 1E3XA 4CN6A 5A8PA 2O92A 1D7FA 2GK1A 1HJSA 4J3UA 3VIMA 2IXUA 4X0VA 3N18A 1UWTA 2D0HA 2E0PA 1JI2A 1CNVA 1WZAA 1NOUA 1CIUA 1B3XA 4ACZA 1JDCA 5CSYA 5C70A 3AIVA 3HMCA 2PWEA 1B3YA 1ISYA 2BY2A 1V3LA 2XFRA 4TUFA 1QHZA 1JF6A 1V0LA 3BAIA 4QFUA 4P8UA 1TA3B 2GVYA 3PZTA 2J7DA 3AMCA 1C93A 4UQDA 4TVCA 2W67A 5HPCA 1FHLA 1ZBCA 5JIPA 3ZR6A 3QHMA 5A8MA 1ZU8A 1O6IA 1ZS2A 4CU7A 2AMGA 4Z2JA 2XPKA 2AAAA 3WNLA 3IJ9A 2PWHA 1JG9A 1Q6GA 4M82A 4W7VA 4XX6A 1E0WA 1FOBA 3RO8A 4W8AA 2J7CA 1UG6A 2WMFA 2W92A 4J28A 1GOKA 5LA0A 4JKLA 1W9PA 1FP9A 2XUCA 1DTUA 4FMVA 2CPUA 2ZX8A 3WMBA 3AIEA 1H49A 1DHKA 3THCA 2EEXA 1K6AA 4HOXA 6CGTA 5A94A 2ZXDA 1JDAA 1HKMA 3W81A 5KZ6A 1LF1A 2V5CA 4D1IA 5CPSA 5E0FA 7TAAA 4PSPA 3UCQA 2XVGA 1UKTA 4M1RA 2BHUA 4GQRA 4JL1A 4UFLA 1KXQA 2VRJA 3NIYA 2VZVA 1GUVA 3VIFA 3A4WA 3NCOA 3MS8A 2Y8KA 4CVWA 3N12A 1PX4A 4Q22A 4XV0A 4GQQA 3WUFA 4EE9A 4UR9A 4DM2A 1JI1A 2WM0A 2WMGA 1SFSA 4H8HA 3VGBA 4Z2IA 1ITXA 2J8FA 4NI3A 1TUXA 4PYSA 3WH7A 3BCFA 1HL8A 4J7RA 3WH9A 2YA1A 1WZLA 2DSUA 3BAXA 2A3BA 1E71M 3VPLA 1JD9A 1DEDA 3BSGA 1W9VA 5AC4A 3RM9A 4ACZB 1UD8A 2UY5A 1ZJAA 1BGAA 1G0CA 2CKSA 5E09A 3VIIA 2CCRA 2Q8XA 3EDFA 4WKHA 3AIUA 3RIKA 1G5AA 1NP0A 2EPKX 4J3SA 3ZJ7A 5BROA 5AYBA 2A3AA 3SCUA 3WY1A 3O9NA 4F79A 4ZE4A 3MSDA 1C8YA 4B3KA 1C8QA 1NWSA 1JAEA 2CBVA 2DSZA 3CZEA 3QOKA 2JF7A 1BQCA 3OZOA 4ZE5A 4M8UA 2GSJA 1I1XA 1MWOA 2DT0A 3NJ3A 3FY1A 2XM1A 4MB3A 5DO8A 3WELA 3GYCA 3B9AA 2B31A 2WMKA 3CLWA 1BFNA 3LPOA 4MB4A 1QW8A 3OGVA 4R27A 5E70A 1OT1A 3ZJ8A 2YOCA 3POHA 4PSRA 3GNPA 3UESA 4PCTA 2DT3A 1WE5A 2JF6A 5IDIA 3MUZ1 3VDHA 3ARUA 4JKMA 4P7OA 3ZMRA 4AD1A 2X8RA 4BQ2A 1PX3A 1QNRA 2NW0A 1DWGM 4PCSA 3LPPA 2XSAA 1GCYA 3W0KA 3MUY1 4D6FA 5I5RA 1DWJM 2VX7A 3SUWA 1JZ6A 1EQPA 3RDKA 1W2VA 2FH6A 3TONA 2OYMA 3VGEA 2GDVA 1WAWA 3AMLA 2W91A 4ZFMA 3VGHA 1W1VA 2Y24A 3ZT5A 1Q6CA 5D4YA 3MANA 3T2PA 4UQ9A 2WKGA 2IXVA 3VIPA 1E70M 3ALGA 1E56A 3WMSA 2DT1A 3GTNA 1QNSA 3RCNA 3T08A 5D8ZA 1XYFA 4CKQA 2QPUA 3GBDA 3WDPP 3KEHA 4AZIA 1MFUA 5EFDA 4P8XA 4PMDA 7CGTA 5CGMA 1HJUA 1RP9A 4W87A 3AHYA 1CPUA 1O7AA 1ED7A 3EDKA 1W9BM 2WHLA 4NSBA 4P8WA 1V3IA 3K4AA 3L4TA 2WAGA 4M24A 3WD1A 3GXIA 1OGGA 1JZ5A 1GOWA 3GNOA 2E8YA 4QCEA 1I75A 3PTQA 4FF5A 4HOWA 1E1EA 1VF8A 3CZJA 3SUUA 4V28A 1V6UA 1KB3A 5I3DA 3SURA 4H41A 2OYKA 4IISA 3K8MA 1GVIA 4WSKA 2VURA 4TVDA 1FFRA 2GFTA 2BY3A 1OCQA 1CZ1A 1RD6A 4AXNA 4PMVA 3W24A 2J25A 2WB5A 4L4PA 1GJUA 4KRUA 3FXYA 1B90A 1JFXA 2BHZA 3AI0A 4CN4A 2WC3A 3CTTA 1UA3A 4AWEA 4P8VA 1WKYA 1HIZA 3OLGA 1R85A 5IFTA 4QP0A 2W63A 1UKQA 3N17A 2CETA 2QMJA 2ZXQA 1V0NA 3F5JA 4EANA 4NRSA 2BVTA 3L4WA 2QHAA 6TAAA 2VQUA 3ZOAA 1WB0A 2DGAA 4NRRA 3PZIA 4CCCA 1ESWA 1VIWA 2FH8A 2WMJA 1CXIA 2V3FA 2XG9A 3DYOA 1WP6A 1PZ2A 5GPRA 1SMAA 4JAWA 1CBGA 3T0BA 1E0VA 4A3HA 1G01A 1GHSA 1JNDA 2CKRA 3VU2A 4KRTA 4HU0A 2VX6A 2VQTA 3UETA 1QHPA 3FAXA 2QF8A 1TE1A 4CUCA 4UOJA 3AROA 4TTUA 1V6WA 2CIPA 1NWRA 4PMRA 3AS3A 3BXWA 3SCRA 3OGRA 3AHXA 3M6DA 1ZL1A 1MW0A 2QV4A 3SCSA 4MDOA 2XJ7A 2C7FA 3UR7A 4B3LA 1UWSA 4KMQA 2JIEA 5CXPA 5LA1A 1YQ2A 5GNYA 2V5DA 3D3AA 1E4IA 4NF7A 1KXHA 4ACYA 2YLLA 1BHGA 1CXHA 4C7DA 3THDA 1E43A 5HNNA 3LPFA 5FL1A 1B3VA 4CD6A 1CGVA 2F2HA 3I3EA 3VD7A 3VINA 1E6RA 1GOQA 3WEOA 4JFVA 4HMDA 3WSUA 5GQBA 3APGA 3ARQA 2ESCA 3PZNA 1PAMA 1JF5A 1CECA 3WQWA 2D23A 1EHNA 4AIEA 1UQYA 1EH9A 1CGWA 2NT0A 3IK2A 3N11A 5D9OA 1KCKA 4YHGA 4H7VA 3VDCA 4HPGA 1Z32X 2WNWA 2DSKA 4UQBA 3OLEA 4OKDA 2E9BA 3GDBA 3SEPA 4PMYA 3ZT7A 3FNDA 1ZB5A 5A2BA 2RGMA 2OWXA 4U33A 2WXDM 2BS9A 4D6CA 3CO4A 5A2AA 1QOXA 1M04A 2G41A 3VGFA 1V08A 3AICA 1WDRA 3SCWA 4AD4A 4IM4A 3KZSA 3J7HA 3WUEA 4Q7NA 3ARZA 1HKKA 2GJPA 2D3LA 4U31A 3K1DA 1VFUA 1J0HA 1E6XM 2G3MA 4W8LA 4MADA 4QLKA 1OGSA 1DWAM 3UR8A 1W9UA 1JAKA 3NDZA 4UQCA 2BFGA 2EQDA 2A3CA 2ZUWA 4D6GA 1BYBA 1FH8A 2GDUA 4WKAA 3WDQA 4CN1A 1N82A 3A6OA 3AHTA 5CZKA 1X6NA 5I24A 5LYRA 2ZUTA 3AZTA 3W38A 1KXVA 1BYDA 1UD3A 1OT2A 1QI5A 1M7XA 3VGDA 3AOFA 1J0IA 1H41A 3W82A 5JBDA 2CBUA 3MMWA 1JYXA 1MXDA 1E6QM 1QI3A 5E6YA 4D71A 1BF2A 3GXMA 4W8BA 3EYPA 3WQVA 3WF0A 2BXYA 2PBOA 2ZX5A 1RP8A 4UOZA 4H8VA 1R7AA 4LPCA 4AZHA 3FAWA 4OUEA 2AOSA 1KR0A 4JZ5A 1CXEA 3F5KA 4YN5A 2VR4A 3D5HA 1V3HA 2J4GA 3CHDA 1R86A 2DIJA 2XVKA 1JYWA 3ARYA 3KE0A 4URIA 4GZEA 3U7BA 1EDQA 3VDAA 3VIKA 2X1IA 3VTRA 4AEEA 5M5DA 1GHRA 1HKIA 1QPKA 4H2CA 2O9RA 2JE8A 4PMNA 3OB8A 3CMGA 1TG7A 1HP5A 1J11A 1ZBWA 1MQQA 3MU7A 1U30A 4GINA 1X1NA 1BTCA 2ZUSA 5EB8A 2YL9A 1LQ0A 3EDEA 3PZOA 4UCFA 1HN1A 1L0PA 2X0HA 4IPNB 3W6MA 4K68A 4W85A 3CPUA 1W1PA 4P7RA 4UFIA 1EOMA 2W4XA 2XIBA 1C7SA 2CHNA 3BAYA 1V3KA 2YL8A 4U3AA 3CGTA 1MVYA 1V3JA 3OA5A 5I6SA 1QVBA 5GNXA 4X9YA 3WDRA 2TAAA 1JD7A 4UZSA 4J27A 1V6VA 2XWDA 1OINA 1WO2A 3ZIZA 1B30A 3TTOA 1A47A 2HVMA 4UFMA 1V3MA 1EA9C 2X09A 3PTMA 4GXPA 3WQ8A 2XM2A 2DDXA 4YHEA 3I3DA 2VVNA 3N13A 3FHQA 3WEZA 1OGBA 4A3YA 1JXJA 1SYTA 3IJ8A 1JFHA 1UWQA 1WZKA 3VIGA 1L8NA 2WWCA 3WIJA 2D1ZA 1V0KA 3SIMA 3LPGA 2XFFA 3T2OA 2YLAA 4UFKA 2G3NA 1JGIA 2D3NA 3AQUA 3WNMA 3QOMA 1HJVA 1UH2A 1ISWA 1UKSA 2J62A 3WH5A 2XFYA 1E1FA 4AY1A 2UWFA 2WBGA 4WSJA 1W3LA 3OG2A 2O9TA 3SUTA 2JEPA 1GW1A 4AMCA 3S6TA 1GONA 4WK9A 2OSWA 3RJYA 1TZ7A 1VEPA 1EOKA 4EKJA 1E15A 3WENA 2WZEA 3POCA 4QCFA 4W88A 2EPOA 3W26A 4TVUA 1LLOA 3VM7A 1W1YA 4JHZA 3BSHA 3ZSTA 3TP4A 3KL5A 4UTFA 3VD3A 2G3JA 3KL0A 3GH4A 3CHCA 1KR1A 3UERA 3MV11 2XVLA 3BMVA 2PWGA 4HOZA 1C7TA 3NSMA 2WHMA 3ZM8A 4FLSA 4ML4A 1JIBA 3VNYA 2J77A 4ATLA 4E8DA 4DUVA 4DWSC 3OLDA 5A1AA 1UR4A 2W62A 4TOQA 3EMQA 4V2XA 1VFMA 4PMXA 1EO5A 1MYRA 4TTGA 1E9LA 5I79A 2V3GA 4C7FA 1KXTA 4BCEA 1QBBA 1WDSA 4AD3A 2VCAA 1G1YA 1VJSA 1C91A 1ZBKA 3GZAA 5FKYA 1CGUA 1UR0A 2VI0A 4N42A 1E4NA 2XGIA 3PZGA 3WF3A 5JBFA 1GPFA 1XC6A 3PZMA 1F4HA 4MNJA 4NZCA 1XH2A 4HZ8A 4W89A 5BXSA 5BYWA 2E8ZA 3SCVA 1EXPA 4E4PA 3K46A 2PF0A 4QLJA 4MAZA 2BVDA 1HP4A 2VTFA 4M56A 1KWGA 2YKKA 5AY7A 3WNPA 2EBNA 4AD0A 3AXIA 2WMIA 1QNOA 1UD2A 1CLVA 4J3VA 1JYVA 5I2UA 1CGXA 4AISA 4U3CA 1NP2A 3W29A 1TFVA 1KWKA 2PWDA 4B16A 4MJ4A 3AZRA 4AD5A 2OWWA 2VX4A 1TVNA 3AXHA 3N9KA 4AZCA 1E40A 1VBRA 3A4AA 3ZQ9A 3AS2A 1C90A 1CXKA 1HKJA 2FDMA 5GNZA 5A3HA 2CERA 1W91A 1U33A 3U5YA 3VILA 4MB5A 2YDQA 1QI2A 3NSXA 2ZOXA 1XSIA 2XTKA 3F5LA 2J74A 4WIWA 3ALFA 3WNOA 1NWTA 2E9MA 5E9AA 5IHRA 1OIFA 2DT2A 1B0IA 2J75A 3GXFA 1ITCA 2CITA 4E2OA 3ARRA 2VCBA 1LWHA 4GZIA 5CGTA 3WEMA 2CNCA 1E55A 3PZUA 1EIBA 4MJ2A 3CZLA 3U5UA 3CZKA 3QGVA 3G6LA 3VO0A 2EPNA 5I78A 1IZKA 1CXLA 3NDYA 2ZE0A 2WVTA 4AZ7A 1Q6EA 3WKZA 1LWJA 2CEQA 1VFFA 2WZHA 3PZ9A 1EDTA 1OBAA 1H4PA 3RILA 2YL5A 4JFUA 3OZPA 3PTKA 4FK9A 3WL0A 2W5FA 1CTNA 5BXRA 1ODZA 3GH7A 5A2CA 2CXGA 1US3A 1ECEA 4R5EA 2ZICA 1W3KA 5D9PA 3W28A 1VFOA 3L4ZA 1BVZA 2NT1A 3L4VA 3AIQA 5FD0A 5E0CA 1C92A 3WFZA 1HNYA 5HBFA 1UR1A 2YJQA 2VNCA 5EBAA 4LX4A 2EPLX 1H0IA 4AYSA 4CGTA 1UYQA 4BQ5A 1KFWA 2PC8A 2WW5A 1IV8A 4GIAA 2J7EA 2WMIB 3FHAA 3L4UA 2Y8VA 3ARVA 3RMEA 3WL1A 3O6AA 2OYLA 4KH2A 2XSBA 2BHYA 4W86A 5AC5A 1J0ZA 1UR2A 1AQ0A 1NM9A 4MPKA 4AZCB 1PPIA 2J79A 2XVNA 2D24A 5JIWA 3CUHA 5M03A 4KGJA 4HU8A 2ZX9A 4V27A 4GI6A 4HA3A 1UWIA 4LGXA 1XH1A 4PMOA 5A8OA 1VAHA 1J12A 2WPGA 1EDGA 4AIUA 1UKPA 4GKLA 3VD4A 3OBAA 4Z2GA 1Q6FA 1UD5A 3UG3A 3L4YA 1B9ZA 1J9YA 4PEEA 3QHOA 2IUZA 4XZWA 3OGSA 3WD3A 4ATWA 3LMYA 4AEFA 1J0YA 4KWUA 1EGZA 2A3HA 2BVYA 2J7FA 3UEQA 5CPQA 1CDGA 1IZJA 1ZJBA 2WWDA 1PBGA 3UG5A 5HOSA 1ISVA 2DH3A 2ZWYA 2W61A 4ZXLA 3BCDA 5M3WA 3WQ4A 1G94A 4LYRA 1UHVA 5JUVA 4BQ3A 2WHKA 1SMDA 2F8QA 2GUYA 4UZUA 5BXTA 2GJRA 2XYLA 5CQ1A 1AIWA 1E5NA 3ARSA 5FOOA 3W37A 5ABGA 2PB1A 3EBVA 4TX8A 5A6BA 4LYPA 2YBTA 2DQXA 1KQYA 4W93A 4GO8A 3L2LA 4A4AA 3BAJA 1PEZA 1U2YA 2V3DA 3PZQA 1UH3A 2VRQA 1Q6DA 3WDIA 5CPTA 1QBAA 1UR9A 3VIHA 5BWFA 1QNQA 3I3BA 1HL9A 1MW3A 4MB1A 3WFLA 4OOZA 1UUQA 3PN8A 5A8QA 3L2MA 2ZUUA 1K9FA 5C8BB 4U5IA 4PUEA 2VX5A 5F7UA 4BQ4A 2DSWA 1JZ3A 1HVXA 5DT7A 2VZUA 1GQIA 1E0XA 4B15A 1M53A 3MUAA 3ARXA 3U7VA 4D6EA 1HJQA 2VZSA 3EDDA 3OIHA 3T2QA 4CVUA 3ECQA 1CENA 4M81A 3N1AA 4YPJA 3WNKA 8CGTA 3DHUA 5A6SA 2C0HA 2UY4A 2G8ZA 5EMYA 3E1F1 1SR0A 4WLCA 3ZO9A 3CZ8A 4JIEA 4GPNA 1PZ3A 2XVPA 3WF2A 4S3KA 4PTXA 4D72A 3VMPA 2UY3A 2MANA 2WVVB 1NWUA 1GOIA 5ABFA 2CYGA 1BYAA 1E6NA 1W9DM 1XD0A 4PTMA 3AISA 4P7LA 3DYMA 3A4XA 4RE3A 4UFHA 1ZBVA 1UH4A 1B1YA 1JXKA 4H8UA 1E4LA 1DWHM 3PZVA 1H0GA 1CGTA 2VC9A 3HN3A 5IXEA 3BLPX 3CHEA 4HMCA 5CG0A 2J7HA 2FHCA 4PN2A 4GI9A 4CD4A 4OJYA 5D8WA 1IT0A 4LQ1A 1XYZA 5CSUA 3VD5A 4FLOA 1FH7A 1FP8A 2WK2A 3WH6A 3HJEA 2PWFA 2DEPA 1H3GA 1KBBA 1BGGA 4CU8A 1AQHA 1PIGA 4FLQA 4Z2LA 3BMWA 4AD2A 3TOPA 4FLRA 5CLWA 4JHOA 2FGLA 3IAPA 4MDPA 4Z2KA 1CGYA 3CBWA 1VBUA 4H04A 1CXFA 1XH0A 1UZ4A 2WVSA 4AZGA 3GBEA 2RTSA 1B3ZA 3SCNA
chains in the Genus database with same CATH superfamily
2ZRYA 2LLEA 8A3HA 1MDLA 5FF7A 1EXBA 1FY6A 5K9CA 4IIHA 3V36A 4NT0A 1TPH1 4PTWA 1HT6A 1J2WA 3S42A 1FFQA 3PPFA 4PMUA 3FOKA 4US5A 2PDGA 3BPWA 3USZA 3DECA 4DUXA 2OWCA 1UC5A 2WSRA 1V6XA 5T9BG 3O2LA 4Q8TA 1J18A 3TN6A 1UWUA 1MW2A 2ZWZA 4MWAB 1YTDA 3N25A 4JIQA 4OT7A 4EPBC 2X0YA 1XBYA 3H4XA 1WKFA 4BS0A 3QTGA 2VC6A 3KS5A 4Z1AA 1O60A 4AFYA 3EKZA 2ZYFA 1FWGC 3B04A 2RFGA 2PDJA 4RKAA 3RLUA 1X96A 3MP4A 2J66A 3G1HA 4QE1A 3NO3A 1D7KA 3T44A 3URQA 2QUMA 4O4WA 3MUIA 2WCAA 1BLIA 3B8TA 1R5YA 4PCNA 1LL4A 1UR3M 2CBIA 3W6YA 3MSGA 4JL2A 4IT1A 2VT0A 1ODUA 3ZXWA 1TPUA 3SCPA 4FX6M 1JULA 2QXWA 4LY8A 3VIOA 5H8PA 1ME7A 1ZCOA 1GOXA 1B2YA 1PTDA 4Z1DA 2GVEA 5I0DA 3IIXA 4W5UA 3UWEA 1MQPA 3JW7A 4ZEPA 3BG5A 3VKDA 2ZX7A 4JNMA 1HJWA 2Y89A 3CC1A 1SO4A 2BP1A 4Q4RA 2V5OA 3T09A 2OKTA 1OYBA 1FWCC 3P61A 3ID7A 5B7ZA 3SY1A 4JFWA 3JZEA 3CHVA 3MCNA 4QTGA 3WD4A 3DBPA 5E6ZA 3FEMA 1JVNA 1R2RA 4FA3A 1XG4A 1ZHAA 1ITQA 4HTBA 3DEQA 2R1MA 4H9VA 1FCQA 1Q85A 3SB0A 2QW5A 4TXEA 4B5NA 3U57A 2NQZA 1T6MA 3MTWA 3GVRA 2YA0A 3G5EA 3T0TA 1S5WA 1UWAA 5A6AA 1U83A 2FZ8A 1RBLA 1OD8A 1XCWA 4HZ7A 4B9YA 3R8RA 2Y7EA 4L65A 2YDSA 3P62A 1HF6A 1XLIA 1YNYA 3BANA 4KEVA 4R7JA 3EAUA 1QI0A 3CIXA 1OFRA 4DO4A 1FX6A 1XIMA 4J3TA 3KW3A 3NSNA 1E3ZA 4F9JA 1PIFA 4NNAA 1TV8A 1UZ1A 3CEUA 4RE4A 2JEQA 2UV8G 3PC0A 3AMDA 2GSHA 4K1WA 2DSVA 4N0RA 4ORMA 2WC7A 3ABQA 2PI6A 3VUPA 1BG9A 2PGWA 3WUBA 3QVQA 1AZ1A 2V30A 2Y8UA 1I0DA 4H01A 1DWFM 1BRLA 4O8RA 3QRHA 3KWXA 4LOCA 2V0TA 2H6RA 1TJ2A 3FIGA 2QMKA 1I60A 2OO6A 3W1TA 2BGNE 3IJ7A 2WHJA 4GH9A 3H7RA 1SFTA 3W7LA 1YNPA 3BC9A 4ZENA 4IL2A 1VB9A 3GWQA 3P5YA 1H1NA 4QE5A 3B9NA 1SM9A 4US6A 4GQBA 3SDOA 2XGBA 4PTNA 2E3ZA 4IFKA 5AYIA 3B4YA 4JIPA 3E0LA 3PG8A 1J0KA 2VJXA 4GHAA 4HTYA 2Z6JA 4CD5A 1LORA 4ENLA 1MRAA 5KEZA 2UY2A 1GNXA 2WCSA 3FCPA 5FJUA 3I65A 2CHRA 3VZXA 1A5KC 2EO7A 1XQKA 1VR6A 4U5KA 1VRXA 3AIBA 1HTIA 1GQJA 2Y6ZA 4R9OA 5BWAA 4IGNA 3H55A 4LW7A 5M17A 5EFFA 3PR2A 3L2IA 4IMGA 4GUGA 3LCLA 3A3XA 2VO5A 4BHYA 2DIKA 3W70A 2NVCA 3O05A 3TQ0A 1U5VA 2Z2UA 3KVJA 5DXXA 3KRZA 4K37A 3ZT6A 1K8XA 4OQVA 4Q6XA 5DANA 5A6LA 4PUMA 3SSJA 4D6JA 2E67A 3A3HA 1E1CB 4GVHA 3V0TA 4O1CA 1F76A 3S9ZA 3GVVA 2VCCA 1CLXA 3W01A 5CSRA 4HVXA 1AL8A 1I6NA 4UMBA 4GZJA 4H83A 3NQCA 3CLMA 4WCJA 4Y6GA 4FOJA 4XZMX 3CEPA 1QPQA 4DJDA 5BMXA 3WG6A 4TX6A 4QDMA 4CCEA 3EWWA 3GAYA 4UTWA 3GAKA 2Q71A 3SN1A 2WVVA 3JRKA 5HULA 1MEIA 3CQJA 2Y70A 3PSVA 2E6YA 2D0GA 3CIWA 4QIUA 3BICA 5HWNA 1ICSA 3FW6A 1Q7ZA 4M80A 4EF8A 4IQEA 5LXXA 1D8WA 1YXCA 2GVGA 2VGBA 1D3CA 3TFCA 1O66A 5K7JA 3TTQA 3D3FA 3WJZA 3TQVA 4F9DA 1XIDA 1TVPA 3K1GA 3LG3A 2CZ5A 4B91A 3TXZA 2J8GA 2F6UA 4XSLA 4F8XA 1YTKA 3TJXA 2BODX 1UD4A 1MW1A 4AVNA 5A69A 4EIVA 1F4AA 4PMQA 1VLWA 1BPLB 1ONXA 4KPLA 3LRMA 1GYLA 1MNZA 4N4PA 3B03A 1NOFA 1MDRA 5TD4A 2Z1SA 3LHUA 4TQTA 5HK4A 3RG6A 3UXIA 1AA1B 1Y65A 2POTA 1EEPA 1EUAA 3K8LA 2G95A 3SI9A 2HE5A 2PCEA 5DMNA 5FF2A 2GOUA 3C3NA 3WH8A 1HL2A 4GISA 3WQ5A 1JZ8A 4PC8A 2QT3A 3STCA 1S2AA 3M7SA 1EGMA 4WGXA 4AC7C 5HAOA 1DJGA 3ITCA 2ASHA 5T8GA 1LJYA 3W7CA 4G7FA 2H90A 5F4WA 1G4SA 1FWNA 2HTMA 2BSLA 4V15A 4ZO9A 1R6WA 3TX9A 4JOMA 1UR8A 4Q8VA 4PMZA 1FWDC 3UXKA 1FA2A 4YNGA 2QPSA 3AHVA 4I9MA 2BXZA 4YTTA 2QCEA 4CD7A 1OFAA 3NEVA 5CPOA 2QCDB 3HU7A 5HNTA 3RR1A 4IIGA 3VGGA 5HXMA 3ZJKA 4I8YA 3UP8A 2NX3A 5DMYA 1KGWA 4EAMA 1SFLA 3FVDA 1K9DA 4HA4A 3W9ZA 4AC1X 4JFSA 5AHEA 1H7PA 2VR2A 4JQ4A 2F38A 4Q33A 1YDYA 1HJSA 1X1ZA 3LN3A 4JGDA 2IXUA 2D0HA 1KM0A 1NOUA 3IIPA 5CSYA 2PWEA 2BY2A 3H8AA 4PL1A 2CC0A 4TUFA 1EB3A 1JF6A 4AX7A 2I5QA 2NUYA 2GVYA 3PZTA 2J8TA 2C15A 2J7DA 4FHAA 3P3BA 1KRAC 3STEA 5KZMA 3NQ6A 1RALA 4IIDA 1XUZA 2W67A 3GRIA 5HPCA 2D2HA 5A8MA 3CUZA 1ZS2A 1KO0A 4F0HA 2AMGA 1VPXA 4Z2JA 4IJFA 2AAAA 4GNVA 5D03A 1JG9A 1Q6GA 3PUGA 1EZWA 3CQIA 1LQAA 5CZSA 2VC5A 2W92A 3DESA 5LA0A 3L67A 1W9PA 1W5OA 4FMVA 3T8QA 4MG4A 3K5XA 2ZX8A 3NQGA 3CB8A 3WMBA 3AIEA 3P74A 1DHKA 5EMJA 1K6AA 6CGTA 1X38A 3BZGA 3W81A 1J93A 3T05A 3S2NA 3KHDA 4Z17A 5CPSA 1OHLA 3N4EA 4BI7A 4DI8A 4J4KA 4JN6A 4PSPA 3UCQA 4L9YA 4H7ZA 2XVGA 5E1QA 3WJXA 4PZVA 2C1GA 4C6JA 1DQWA 4MZ8A 4Z42C 4Y2WA 1KXQA 2VRJA 3NIYA 1GUVA 3NCOA 1W17A 1O1HA 5I3HA 2PDPA 5DLCA 4GQQA 3WUFA 4EE9A 1TE6A 5CAKA 2WM0A 4GQ0A 3ANVA 5JXQA 2WMGA 4YTSA 1IXOA 3EOLA 1UOZA 4H8HA 1OQFA 3VGBA 3BW2A 4PULA 4Z2IA 1TUXA 1J7MA 3IVSA 1GG1A 1VYSX 2PP1A 3ES8A 1JCMP 5FJJA 2Z2BA 1TV7A 3TMQA 1W9VA 3N29A 4ACZB 1OX6A 5AVHA 1ZJAA 1BGAA 2CKSA 2DZVA 2CCRA 4DRSA 1L6WA 1I4NA 4L9ZA 3O15A 2FPVA 3IUHA 3WLPA 2EPKX 4J3SA 3IIOA 3S4TA 5DELA 3VCCA 3MO7A 2R1LA 5EMUA 1F5ZA 5D04C 4F79A 3QZEA 2F9RA 5HJLA 4R34A 1E51A 3U2ZA 4B3KA 1NWSA 3R11A 1QPRA 2YCIX 3LHWA 3UZ5A 3WQDA 7XIMA 4LCRA 1M5WA 1QO5A 4M8UA 2GSJA 1LYXA 1MWOA 1TX0A 4Z1YA 4MGGA 2XM1A 1BWVA 3GYCA 1LRQA 2B31A 3CLWA 3GVWA 1BFNA 3LPOA 3V5OA 3FGCB 3HF3A 4AQLA 3C4UA 4Y9OA 4R53A 1I2RA 4DPQA 3TUUA 3QZAA 4MY8A 1G67A 4I8DA 2P0IA 4JKMA 1Y0EA 1RVGA 1PX3A 3B4UA 5D38A 4KCVA 3BGJA 4GK8A 3MUY1 4D6FA 5HUPA 3V7PA 3QPZA 3RDKA 1W2VA 2YB4A 2OYMA 2RHGA 1PL9A 1Q6CA 2YXOA 1BXBA 3RRXA 4UQ9A 4R85A 2WKGA 4EXQA 3VIPA 1E70M 3CV7A 3ALGA 3A4JA 3WMSA 1QNSA 1YX1A 1R30A 4CKQA 4S23A 1OX5A 2OLAA 4P8XA 4FX8A 1RP9A 1CPUA 1HUVA 3L9CA 2V5LA 1W9BM 4E2BA 2WHLA 3LQLA 1EGVA 3R4IA 1O5RA 3KP1A 3OVRA 1T41A 3OOQA 1V3IA 4E3TA 2WAGA 3WD1A 5F2LA 3QH2A 1JZ5A 4YCPA 3G0SA 1GOWA 3GNOA 2ZFAA 3FJ6A 1K7EA 3BLOA 5MF5A 4HOWA 1YU4A 1FWTA 2HXTA 3CZJA 5G4HC 3LM3A 4P61A 3R1ZA 4V28A 3VOIA 2ADAA 2NXHA 4H41A 2DZWA 2PU0A 3K8MA 1XDLA 2VURA 3UT0A 3USBA 3DFSA 3P80A 2Q02A 2BY3A 1CZ1A 4X63A 1T8XA 4PMVA 3W24A 4Z1CA 2C91A 4L4PA 3NL2A 4KRUA 4CLMA 3FXYA 1B90A 3WJWA 2QIWA 4CN4A 1FWWA 2WC3A 3CTTA 1F3XA 1W31A 1HIZA 4OU1A 1BXNA 4IFOA 1KFJA 4QP0A 2W63A 3UPBA 4KCWA 2NVDA 3W7RA 3UPMA 1TJ0A 3E2SA 3F4NA 2POZA 3L4WA 4WSHA 2VQUA 1AH0A 4NRRA 5EY5A 3PZIA 1ESWA 2FH8A 2V3FA 1B57A 3S8HA 1PYFA 3DYOA 1WP6A 1PZ2A 2PDUA 1CBGA 3NOEA 4JYDA 1G01A 1A5UA 1XLDA 3LBOA 3PVFA 2WJDA 3MI2A 1TWDA 3QSTA 2Q3OA 4H9YA 2VQTA 4RZ4A 4EPKA 3FAXA 5EL1A 2QF8A 1OK4A 5CC5A 3T9PA 4YTUA 5F2GA 4PMRA 4UBPC 4RNFA 3U2OA 1WBJA 3EWCA 1MW0A 2QV4A 3B8IA 1R3VA 2GDQA 3TZFA 1UWSA 3DG3A 1E9IA 4S3FA 2QR6A 5GNYA 2INZA 1KXHA 4L6OA 4BK9A 4MJZA 3ZVHB 2YPIA 3VXGA 1REQB 2DV0A 4H9ZA 3THDA 1Q6OA 1L8PA 1GOQA 3VZYA 5GQBA 1R3SA 2ESCA 3G8RA 3FSUA 3LYEA 3JS3A 3WYZA 1Z48A 2ATSA 1CECA 4LVDA 2QCNA 1FVPA 1A53A 4GC3A 4X2PA 5D9OA 4E2DA 1LOQA 3K13A 3E5PA 3VDCA 4H9UA 2AAMA 4GMEA 4ZOBA 4Q4SA 3M16A 3GDBA 4GBUA 3FNDA 2OWXA 1P0DA 4U33A 2R14A 4D6CA 3CO4A 5A2AA 1QOXA 2WOQA 2V9DA 1V08A 5HNUA 1K02A 2ALRA 4AD4A 2R94A 3NWRA 4DF0A 1DQUA 3J7HA 3WUEA 1VCFA 4HNVA 3GC5A 2Y1HA 3ARZA 1AH4A 1M7OA 4OV4A 3GX9A 1VFUA 3OQEA 3PFMA 4O50A 3TSMA 4AH7A 3CAQA 4MADA 2QDEA 3BJSA 2A3CA 1FH8A 3WMLA 2OX1A 4CN1A 1N82A 3AHTA 5LSMA 2QVNA 1S5VA 1X6NA 3AZTA 3W38A 4XUGA 1TB3A 1OT2A 3W2MA 3VGDA 1F6PA 1VPQA 3A5FA 4ZQNA 4IBIA 5E6YA 2XH4A 3TJLA 3EYPA 9XIAA 4DZAA 1P48A 4MUZA 3K2GA 3LUTA 1R7AA 3RR4A 3UD6A 3FAWA 3HQ1A 4OUEA 3SO7A 1XI3A 1PWLA 4DBEA 2VGFA 4YN5A 3U6WA 2OXNA 3BOXA 2VR4A 1TPWA 3D5HA 1XLCA 3QY6A 3S1XA 2ONEA 3ARYA 3EWXA 4URIA 1EDQA 3VTRA 4H2CA 2JE8A 4ZQCA 4PMNA 1RA0A 3NNTA 4IOTA 3VCRA 1U1JA 1U30A 1ZLPA 4ROPA 3V1HA 3O0FA 4JQ2A 4GD0A 3VFLA 5LIKX 4QITA 4G2DA 1GVRA 4IXXA 5KZEA 4UCFA 2X0HA 4IPNB 3W6MA 3LY0A 5A6TC 2XIJA 3N3MA 4P7RA 2R82A 4WOQA 1R3RA 1XBZA 1Q7QA 4GQGA 2W4XA 1ZY9A 3C2FA 1V3KA 1OCNA 3CGTA 2PDXA 3XISA 3WDRA 1L6GA 2TAAA 4ZCWA 1DQXA 3QR0A 4J27A 2HROA 2XWDA 2PTZA 3S5SA 1VBGA 3OHMB 5CEWA 2HVMA 5XINA 4IGSA 1MXSA 4GUJA 3EA1A 4GXPA 2XM2A 3LI1A 3GVQA 3FHQA 3FJNA 3VUSA 1XIJA 1OGBA 3IJ8A 1MSSA 3R79A 3VIGA 2DZXA 3BW4A 2WWCA 4BWLC 4JBRA 3LPGA 3W2UA 2Z1BA 2ZQ0A 2G3NA 1EA0A 4I6KA 1JGIA 4B5VA 4Q8NA 1PUDA 1HJVA 3WH5A 4IQLA 3RX3A 4AY1A 2KAUC 5EMLA 4PB4A 1W3LA 1J4EA 1M3UA 4KBXA 5LHEA 1JUKA 4B92A 3QJAA 3AUOA 2WNZA 3NQMA 4UCGA 3ZWSA 1HKWA 2Z27A 5LIWX 1IWAA 4AU0A 1VEPA 4XQ6A 1EOKA 3WENA 3R2GA 3UR2A 1PWMA 4W88A 1P6CA 3W26A 4TVUA 1LLOA 3W7JA 3IEBA 1PE1A 4RCXA 4JHZA 3ZSTA 4J2MA 1TMHA 3MYOA 4RV8A 4UTFA 3PBUA 4GKTA 3UERA 3QV7A 3EPMA 5H1WA 3ZM8A 1AW5A 5HR7A 4M6PA 3PS7A 3GDLA 4O15A 3OJGA 3Q45A 4U28A 1E0UA 4JYFA 3A23A 1P0BA 1EJTC 1DKWA 1W5NA 4OECA 1GYNA 4AD3A 5CAHA 2VCAA 4WHBA 4KCTA 1G1YA 4TIMA 4QNEA 3W1RA 5FKYA 3REQB 4PUNA 3FK4A 1B4KA 1E4NA 3WF3A 1GPFA 1XC6A 1XH2A 4HZ8A 4LS1A 2Y7FA 1SU5A 1UZDA 4JIIX 1R2SA 3SCVA 1EXPA 3K46A 3TE9A 2PF0A 1T96A 5AZ0A 4M56A 1KWGA 2YKKA 4BY3A 4AD0A 1J79A 1CLVA 1UJPA 1KWKA 4PBEA 2PWDA 3MQLA 4MJ4A 1XPGA 3ITOA 2C14A 3N9KA 1XLLA 1E40A 3EPNA 4PFMA 1JCXA 1VBRA 3A4AA 2CZFA 1FWEC 3Q37A 5AHFA 2GUBA 2NX1A 5GNZA 5A3HA 2HNEA 7REQB 1U33A 2OOFA 1YU0A 3DI0A 1QI2A 2JE5A 2JKAA 1XSIA 4G1KA 2J74A 4WIWA 1QW7A 3WNOA 3H70A 5E9AA 3ZFHA 1X8CA 3P84A 4QG9A 1ITCA 1A3WA 2VCBA 1E9ZB 2CNCA 1EIBA 2CFFA 3F7JA 3DOPA 4C6PA 4YU1A 1PDYA 1CXLA 1Z9AA 2ZE0A 5DN1A 5FF3A 4AZ7A 2B7OA 2Z4GA 3WKZA 1LWJA 7ODCA 2WZHA 3OTRA 3HZ3A 1IXQA 3OZPA 4LUSB 3PTKA 4JTHA 3C86A 3GB6A 1CTNA 5BXRA 5GVJA 5M1TA 3I68A 5IRPA 2YCJA 4LC6A 1WBHA 3HPXA 3LXBA 1XW8A 1OC6A 3GU2A 1NDZA 3L4ZA 1BVZA 2NT1A 4CNOA 4NI8A 5FD0A 1C92A 3WFZA 4XAFA 3S5OA 3NPXA 1YXDA 1H0IA 2F84A 4BQ5A 4E4UA 2Y2HA 2WW5A 1IV8A 1QATA 4WDTA 1UMYA 3MY9A 3L4UA 5IDZA 1OCJA 1H7WA 2BBFA 2BHYA 1UR2A 1KRCC 1PS9A 3VFCA 2AL1A 2NQ9A 5JIWA 5M03A 3SR7A 3M6YA 2HJPA 2ZX9A 3EX6A 4PEKA 1RCQA 4I90A 3VNMA 3HQOA 3VNJA 3WLMA 4RJEA 1IR2A 4Z2GA 1Q6FA 2HDJA 4RNJA 1B9ZA 4PEEA 3O1NA 3W7IA 3GC2A 3NEHA 4ATWA 3TYAA 1WA3A 1N8WA 4KWUA 1KCXA 3WK1A 2NV2A 2BVYA 3PAOA 5C7HA 1QAPA 4HBKA 3EB3A 4HT3A 3CL8A 1IZJA 2RKXA 1I9CB 4I7VA 4AEOA 2PWVA 2DH3A 2CXEA 9XIMA 3L65A 1LP6A 4ZXLA 5M3WA 1FWHC 1G94A 3UY7A 4M7SA 1N55A 1SMDA 1UJQA 4HU3A 2DUXA 4XD4A 3P0XA 4GUFA 1E5NA 1RR2A 5ABGA 1OYAA 3FV9A 1FKWA 1VBHA 5A6BA 3LCGA 3LU2A 3NM3A 4GO8A 3S5ZA 4A4AA 4ALDA 3PUEA 3URNA 2NWSA 4GIRA 1U2YA 2V3DA 1UH3A 3WDIA 5CPTA 1QBAA 6REQA 1QNQA 1RK6A 4O1FA 5A8QA 1K8ZA 3LCWA 4GYPC 4MLJA 2J6XA 5CSSA 3ONCA 2ZUUA 5C8BB 2VYOA 3SRKA 3BLDA 5D2TA 1FDZA 4EOUA 3KOWA 5F7UA 2L5HA 1FCBA 2PGEA 4ZO8A 2VZUA 4B15A 1M53A 3ARXA 4HCHA 3CT2A 2VZSA 3OIHA 4LSBA 3T2QA 1K8CA 4O19A 3STPA 2KX9A 5JQ9A 3N2MA 3GXNA 4YPJA 5FF4A 2ISDA 3KVKA 1Q65A 5A6SA 2ZRZA 1VYRA 3NL5A 5H2ZA 1EFZA 2Z7GA 1ZAHA 1QCWA 3E1F1 2KZHA 2ZDSA 3ZO9A 4JTKA 4N02A 3TCSA 3N34A 4S3KA 4HZMA 2VM8A 4PH6A 5I02A 3NQVA 4KWWA 1GOIA 5KSWA 3B0XA 1W1ZA 1KD0A 1R9XA 2JKPA 4PTMA 1ZQ5A 3AISA 2OODA 1Q8JA 3DYMA 3A4XA 4UFHA 3V5CA 4Q6JA 4QM1A 1TKKA 4IPPA 1XL9A 1TJPA 3DXIA 4RNHA 1CGTA 3CT7A 3G0UA 1UP3A 5IXEA 4HPXA 3DZ1A 2Y2OA 4H2HA 4GI9A 1JRBA 2V81A 3W84A 1DE5A 3KRSA 4OJYA 4LQ1A 1H61A 3Q67A 4KFOA 3H4GA 1FP8A 2WK2A 3DN5A 1POJA 3CASA 2YW3A 2O56A 1ONWA 4HHHA 4CU8A 4EXBA 1FKXA 4DJFD 3VKBA 2VFHA 1AQFA 3BMWA 4EAYA 4LG2A 5CLWA 4JHOA 1OF6A 2O7QA 4Z2KA 1V4YA 1VBUA 4H04A 1M68A 1Q63A 4LUJA 4N9DA 2FTPA 3E0WA 1LBFA 1JGMA 1U22A 2Q01A 1GZGA 2X30A 3AXXA 1US2A 3TOYA 3OVPA 2XWEA 4GXWA 4RDYA 4UC5A 1EWEA 4O18A 3V5FA 4NVTA 1XWYA 1NFPA 3H2CA 4GFSA 1Y7VA 2QPXA 1XIGA 5DEZA 3W83A 5FA5A 2VR5A 2FJUB 1O1ZA 1IT7A 4MNKA 1IXNA 2W66A 3PPCA 4NG3A 1NH6A 4AWSA 4Z0SA 1KTNA 1JEZA 3PBGA 4KGLA 5ABFB 3O6DA 3IAQA 3VOGA 4KIEA 1R46A 4IG2A 4WKFA 3E96A 3FLUA 4AF0A 4UFJA 4WOZA 1YLVA 4WGHA 4PUUA 4DBUA 4XWUA 2DQWA 2WCGA 3MKKA 5LA2A 4W5ZA 2R6OA 2YA2A 3GR4A 4YVPA 1OY0A 4AVFA 4EK7A 4K1GA 3LB0A 3VMNA 3WLTA 1DIDA 4C65A 1H8PA 1A5AA 4DI9A 1FH9A 5LGXA 6A3HA 3PJUA 5EPDA 1K9TA 4A8NA 2J27A 4QROA 1HJXA 5JU6A 2P50A 4Q8PA 2IKIA 3LGDA 4O1AA 1BSIA 3GFYA 3U8GA 4AIOA 4DWSA 2WSKA 3MB9A 1N7KA 5C9UA 2GK1B 4DLFA 3GKAA 4QEEA 3SGGA 4V1XA 3TN4A 1E4MM 2QV5A 3PJXA 3B9OA 1TCMA 4BI6A 2W0UA 4GVGA 4C6KA 3WBAA 2W27A 2G97A 1NIUA 2ZVRA 4NZ4A 4NUWA 4OJPA 2JK2A 4S3CA 2NSOA 3TCEA 5J8LA 3WF1A 5C71A 2BY1A 4I5RA 1Z41A 3R7MA 2OB3A 2OEKA 4RPPA 4UNIA 4MNLA 3EWYA 3W2NA 1M7JA 4P2VA 1I1WA 2CESA 4IWWA 4HB7A 4U4MA 2G4FA 4QLLA 2FHFA 3UZXA 1L2QA 3DERA 5C0QA 3HO8A 3OG3A 4RZBA 1RBOB 1DL3A 3FS2A 3P0WA 2Y5EA 2GJXA 4XUYA 3T0AA 7A3HA 2FN2A 1RH9A 3OIXA 3N04A 3VI2A 3OQ8A 3WDHA 2FIQA 3N19B 5HDRA 2HISA 1S46A 3N3TA 4OBRA 1JNEA 1A4MA 2CLIA 3EX3A 3HIJA 4RE2A 3G22A 4UTMA 3CMJA 1XRSA 4HK7A 3E2VA 1JR1A 3FVMA 2VFFA 5DRIA 4JD4A 1P6WA 1LG1A 3ZJ6A 3BSMA 2OCZA 2QLYA 5CLTA 9CGTA 4L9XA 4K7VA 1EHAA 4RK8A 4I9JA 4A29A 3ITLA 3OW1A 6PTDA 3ZZ1A 3CUIA 3AS1A 1WCGA 3EMCA 3LNMA 4GVIA 4DF1A 2O4QA 1KGUA 4ICMA 3BAWA 1L2UA 1OB0A 3BARA 4E8CA 3PAJA 1I2PA 3W7OA 2Y4SA 5HWMA 4LFYA 5CJ5A 1DJZA 3W4RA 5TQLA 1E88A 2VD9A 2EJAA 1RPKA 3BUVA 4QJ3B 3H21A 4IX0A 1VEOA 4DXKA 1KBKA 2PLJA 3QV8A 4W7WA 4C1NA 4ZA0A 3GNDA 3LZ3A 2YDRA 5AYYA 4K8EA 2OSXA 5BOOA 2E9LA 1C29A 4UTLA 2D49A 3N15A 5FL0A 1UA7A 1QPNA 1JZ7A 2H8ZA 3L5MA 4FSAA 3TW7A 1E5JA 1VJZA 4QAWA 1E6ZA 3SCQA 3AMGA 2DIEA 2WZIA 1GZ1A 1S1RA 1XSKA 4XBJA 4ZOCA 1SZFA 4XZBA 5K9XA 5H6HA 3G1AA 4K6AA 2R9RA 1IXPA 3KVMA 1KM1A 3IVUA 4WD0A 4DJEA 3UQNA 3KFTA 3PK7A 3NVTA 3S5NA 2PE4A 2CU0A 4IJCA 4WF7A 1V0MA 1S39A 3MUXA 4DLMA 3TYZA 1NOWA 3FXGA 3EXTA 3C0QA 3DFNA 3TW6A 1W3JA 3OU8A 3M07A 1XRFA 2WC4A 3KBNA 2YCKX 4W9TA 4C6BA 3AS0A 2V3EA 1DJQA 3HPFA 1FHDA 1QNVA 1V6YA 1ADSA 4CNTA 3W72A 3MV01 2PU1A 1TPDA 3S2CA 1YIXA 4GLEA 4MWAE 1XHGA 3CUGA 2D22A 2AMXA 2XIMA 4FNRA 5JBEA 4O53A 5KZDA 2B4GA 3AYSA 3S5YA 1RV8A 4O28A 1JYNA 3T6CA 4IQDA 1PCKA 3GM8A 2D0FA 4AZ6A 4DHGA 2C1HA 2PD5A 1DJXA 1EP2A 4YVXA 3WN6A 4MYXA 1EQCA 1RQHA 2HWGA 1RHCA 2VGIA 1GKPA 3KL3A 2VZOA 4HIBA 4IFKB 5CJMA 1AMYA 2WV8A 1VCGA 4AHQA 2Z1KA 1DJHA 4F0KA 2PBGA 4BF7A 5A6JA 4WX2A 4HD5A 2DJLA 1LT7A 2J13A 1OC5A 5G5IA 1SJDA 4UTWC 1PSCA 2AQWA 3AFBA 3LBMA 2VFDA 4LS0A 3NZRA 4FXRA 3QHNA 3VOCA 3QYQA 3U3HA 3AYRA 2ZUVA 3MPGA 3LEPA 3GDMA 4GO9A 4TO8A 2C8NA 1EX1A 1BF6A 1ME9A 3RUBL 3WQFA 2V38A 3FEQA 4N9EA 3H2NA 3PNUA 5BCAA 4A3QA 1KM4A 2OLHA 5TIMA 1A5BA 1EYEA 3QQ0A 5CZJA 1TA3A 1C9WA 4S3AA 3E38A 1GVQA 1TTQA 5HPOA 3SCTA 1PHQA 1UKOA 4OBTA 1VEMA 1LTDA 1OF8A 2VMFA 2ZIDA 4D8LA 1RBAA 3ATYA 5I77A 1J0JA 1E6PA 3W1NA 3HV9A 1US0A 4QQUA 3ZSSA 2Y2LA 2VL4A 3PJWA 2DH2A 3B8UA 4Y8EA 1YYAA 4FNSA 4PRWA 3EA3A 5BOEA 4E2VA 1X6LA 3UXLA 4S3JA 4MWAA 3GTIA 4ZXOA 3S9YA 3BGAA 1LL7A 4I5UA 2Z6IA 5U7SA 4Y8FA 5ABEA 3WLOA 2ATMA 4RE0A 3MO4A 4OZOA 3RAOA 1QU4A 1LBMA 1UWRA 3DC8A 3T1GA 3O07A 4FNPA 5CBIA 2XH7A 1UBPC 3ABRA 3N14A 1TV3A 2FGZA 2NQLA 2O9PA 2GQAA 4JCMA 2E40A 5A8GA 4F66A 4PB5A 2EHHA 1ADOA 3SUSA 1Z7AA 1Y5WA 4AUBA 3UFYA 4PTVA 2GQ9A 4CD8A 5K4ZA 1E3XA 1NJJA 4CN6A 2E7FA 5A8PA 8XIAA 2O92A 1UIPA 4KIRA 2XIQA 2VGGA 5DCEA 4ML9A 2QJHA 2FB3A 2E0PA 3LBCA 3KRBA 4MM1A 3IARA 3W7HA 1CIUA 2TRSA 2XSXA 1MEHA 2DW7A 4GJIA 2OLSA 4AIBA 3AIVA 1V51A 1WXJA 4O17A 4LCSA 4OTKA 2SFPA 2CZDA 1JPMA 3H2MA 3MW7A 1FTXA 5BPVA 3AYTA 1DPMA 1V6TA 1C93A 3M64A 3K30A 1TMLA 1NEYA 1NELA 1SSGA 5JIPA 3ZR6A 2FJKA 1O6IA 3EX2A 4M6VA 1X97A 3WNLA 3GR8A 2PWHA 2PAJA 4XX6A 1E0WA 1FOBA 1LUCB 3TFXA 3IUIA 4W8AA 3WJYA 4LUIA 1UG6A 4DN1A 1GOKA 3LHYA 5AECA 2ZRVA 5A5WA 1DTUA 3NM1A 1W1B1 2GPTA 4HN4A 2CPUA 2BG5A 3UZWA 3T78A 1EAKA 4L1GA 2EEXA 1OFEA 4HOXA 3U2CA 3QKZA 5KZ6A 1LF1A 1H7OA 2WJEA 4I3GA 2QVHA 2X1SA 3PP7A 4B2DD 3GE7A 4M1RA 3PBVA 2BHUA 3ANUA 3VIFA 1QASA 3A4WA 3MS8A 4NX0A 4CVWA 3LHZA 3UXAA 1ZNNA 4Q22A 5G1TA 4PE8A 1J8VA 1KM6A 4DM2A 2ISSA 3UCCA 2JGYA 2A7PA 4FNQA 4B90A 3FDGA 4PYSA 4C6FA 2BZNA 1VFLA 1HKVA 3BCFA 2DORA 3EOSA 1GEHA 3PNZA 3WH9A 3WLIA 4C1KA 1WZLA 2DSUA 1D3HA 3BAXA 2VDHA 1E71M 1JD9A 1DEDA 4GOAA 3ABSA 5AC4A 4ECLA 4KERA 4OUIA 1Q3NA 1O12A 3T07A 5E09A 3VIIA 2Q8XA 3EDFA 3WLQA 5DBUA 1KNWA 3PF3A 3ZJ7A 3PBWA 5AYBA 1DYSA 1P0EA 3SCUA 3LRKA 2QJIA 4FP1A 2QDHA 3R43A 1VQTA 1TZZA 3KVLA 1RXOB 2D73A 4LAKA 2ALDA 2AL2A 3MSRA 2CBVA 3R25A 4AYGA 4ZE5A 2YZ5A 5I3IA 3NJ3A 4GX8A 2O7SA 1A5OC 3FY1A 4MB3A 3GIQA 4PCFA 1X7IA 3B9AA 2QIIA 4WR3A 4IP5A 3WZ0E 3OPSA 3WK3A 4MB4A 4GJ1A 1OT1A 3FDKA 2YOCA 4H7CA 4PCTA 2DT3A 5T9CE 3MUZ1 4GNJA 1KRMA 4BQ2A 3CL7A 2PDHA 2QUUA 3QGAC 2XSAA 3FYPA 5CBBA 3CL6A 1DWJM 2VX7A 1KLZA 1JZ6A 2OO0A 4KESA 5TF0A 2W91A 2E28A 1W1VA 1MMFA 4QGCA 2Y24A 3ZT5A 4IBJA 3L28A 4FB7A 3CWHA 3OVGA 2VKZG 1IEXA 1Z8AA 1SUXA 4MKNA 3S3GA 3B8DA 4BJHA 4XG1A 4JTRA 3MQTA 1XYFA 2YDAA 5G4EA 2FMOA 4MY9A 3WDPP 1LQ2A 4DY1A 4AZIA 4PMDA 3RRAA 3BJFA 3EDKA 1JQVA 3CYVA 1SZNA 4NSBA 4RPQA 1G4PA 4DJFC 4O11A 3NXFA 3L4TA 3CAVA 3QW3A 1YBQA 3EB2A 3Q58A 1F8MA 3PTQA 3AWOA 2AGKA 1VF8A 2G50A 5KINA 3QC3A 1Q45A 4UTTC 2FZMA 4GE8A 3GIPA 4IISA 5LKYA 1GVIA 4QJ4B 3EKLA 3H6OA 1QXLA 3L21A 2PTDA 1OCQA 3R10A 4MUPA 4M3PA 3UWVA 3PULA 3GSMA 1JFXA 3AI0A 3MDUA 4AWEA 2Q6ZA 3H4WA 1WKYA 3OLGA 1HG3A 1NY1A 3E6EA 1R85A 5IFTA 1U5JA 5G2IA 3N17A 5D2YA 4GGHA 1QFEA 5LZLA 2CWXA 2BVTA 3KX6A 1OG6A 3SECA 1NDWA 2A2IA 3ZOAA 1NU5A 2WJZA 4MIMA 1T0OA 3T42A 4X2RA 3TMLA 5B7YA 2WMJA 1TPC1 2XG9A 4CQCA 1LM1A 4JTCA 5GPRA 1SMAA 4JAWA 3T0BA 1NF7A 3BLIA 1S2TA 2BX7A 5JH1A 1Q6QA 4KRTA 1P4CA 1QHPA 5DCBA 3L27A 4PR4A 5EKYA 4CUCA 4TTUA 2W79A 2CIPA 1NWRA 3KBWA 3R0UA 4C6LA 1IT8A 1MI3A 4R7OA 1M41A 1XYCA 3TKFA 4JTFA 1ZL1A 4HKPA 3TYCA 4MDOA 1GVSA 2C7FA 2JIEA 2PODA 5LNRA 3NQ7A 4QDPA 3VKAA 5G1MA 2C0AA 3D3AA 2QUTA 4NF7A 3D0CA 4C7DA 3UG8A 1AK5A 5LXEA 3N2OA 3HMJG 4GZ7A 1FWBC 3PANA 1B3VA 4IP4A 1CGVA 2F2HA 3VD7A 3VINA 3KOZA 5CPMA 4JTQA 3APGA 3ARQA 3RXZA 3VOJA 1U1HA 3SFWA 3SRDA 2B7PA 3UYIA 2O0TA 3LTYA 1UQYA 3C56A 3M5ZA 2NT0A 4C5ZA 4C6IA 4XD3A 4YHGA 3HPAA 4H7VA 1DXEA 4PRTA 2ACRA 4HPGA 5C9RA 1Z32X 2WNWA 4UQBA 1XXXA 3COTA 5LNUA 2HPMA 2Y2JA 1UROA 3WLNA 2BS9A 2ISFA 1TVLA 1GT8A 5DMMA 2G41A 3A9BA 4FIRA 1WDRA 1TRDA 4DO5A 1XGDA 2DJXA 3SZ8A 2EG7A 4Q7NA 3W7EA 1TV4A 2D3LA 1JCYA 2QEZA 3K1DA 2E6AA 2BWGA 3B0UX 1XQLA 4W8LA 1XX1A 1CLKA 1UPPA 4QLKA 4A6GA 1W1A1 5CG7A 4C6DA 4K3ZA 4IBCA 5JVLA 2EQDA 3PUDA 3G1VA 1NDYA 1TUFA 2H3BA 5FF0A 4DQWA 4MFEA 1X6UA 4BEUA 5CZKA 5I24A 1KXVA 2DZTA 2ANUA 1QI5A 3RGTA 3AOFA 3W82A 2FLIA 2IPGA 1MUWA 3EWZA 4PB3A 3TJIA 1TV2A 1QI3A 1A5SA 3MSYA 3LMZA 3SQSA 5ENLA 5D30A 3QM3A 2PBOA 1FWFC 3HA1A 2ZX5A 1RP8A 4UOZA 4H8VA 1Z42A 2VHLA 2QJJA 1CXEA 1IEVA 3F5KA 4JTEA 3MC5A 2PURA 3HBLA 4J2PA 2J4GA 3CHDA 4MLRA 3KLKA 2XVKA 3NQDA 4IP7A 2F6XA 3KE0A 3DKLA 3RFAA 4GZEA 3U7BA 3HPSA 1Y8BA 3EOEA 2R8WA 5M5DA 3KDOA 4LV4A 2I16A 3CMGA 3GFZA 1J11A 3QV9A 4K39A 2PCQA 1YW1A 1X1NA 4H6EA 4QEHA 5EB8A 1LQ0A 4LWWA 1ZPTA 1W8SA 1R3YA 1SJBA 4W85A 4UFIA 2H9AA 2BGQA 5FJIA 2V63A 4ZQPA 4AWUA 4J5NA 4GYJA 4J3ZA 4Y96A 4U3AA 1MVYA 6XIAA 1V3JA 3MWAA 4OWGA 1QVBA 5GNXA 3G1XA 1JD7A 4UZSA 3KM8A 1V6VA 3QV6A 2OT0A 1SGJA 2A1YA 3ZIZA 1B30A 3B0PA 2OZ8A 4NNCA 3EPOA 1A47A 2OGYA 1V77A 3BURA 1I8JA 2FB2A 2ZZ7A 2OG9A 2X09A 4UWMA 3QPEA 4YHEA 2WSQA 3GVGA 3P6LA 3MVIA 2Z7KA 3DAQA 3WEZA 4E3VA 2XINA 4MZYA 4PUWA 1TPFA 3MZ2A 4HYVA 5KMYA 2Y5JA 3IGHX 4AXKA 3N73A 3DFTA 5AHIA 3T2OA 4UFKA 1G69A 4A21A 3R94A 3VKCA 2E09A 4GHRA 3UZYA 1UKSA 2XFYA 1E1FA 1SPQA 2WBGA 5DRCA 3CUXA 1U1UA 2O9TA 3SUTA 5T26A 4B4HA 2ZA2A 2F7FA 3S6TA 1C8VA 1D9EA 4ZFCA 1GONA 3W22A 4F2BA 2BGSA 1TZ7A 2GJLA 3M5VA 4KKXA 4HNLA 2WPBA 4GY0A 4QCFA 4JTSA 1W1YA 4RXFA 3BSHA 3MHFA 4LAZA 4O0KA 2EKCA 2G3JA 3KL0A 5AHLA 1KR1A 3B8VA 4S38A 3IACA 4QRNA 2ACQA 1DTNA 3NSMA 2WHMA 4UR8A 3H23A 4H9MA 1JIBA 3SN0A 3VNYA 4EWJA 4DUVA 5I03A 1XYAA 3MHGA 2I1OA 2I5IA 3OLDA 4JEQA 2BTMA 3TN5A 3TVAA 5AC6A 3HFYA 4V2XA 1VFMA 2Y88A 1UMLA 1EO5A 4TTGA 1Z69A 5I79A 1X7FA 3H7VA 1BTMA 4HHLA 4BCEA 4S1FA 2FMNA 3CJPA 2FZBA 1XS2A 3A9IA 4NJJA 3PBMA 4JDYA 2VI0A 2DUAA 3PZGA 2ACSA 3PZMA 2EF9A 4MNJA 3M44A 3E2RA 2B81A 2JBMA 5BYWA 2XH2A 4E4PA 3AC0A 3BE7A 3QN3A 4TV5A 5I3FA 4J1OA 1TTPA 4QLJA 3M1ZA 4ZVJA 3G1RA 3LXAA 1OEPA 1HFBA 1UP2A 3UA4A 3R13A 3VAVA 3WNPA 5FJPA 1UD2A 5LNWA 4JEJA 2HPIA 4U3CA 2Y2QA 5FAJA 3TW9A 3H54A 4B16A 3DX5A 3W23A 4HPJA 2OWWA 4IMEA 3AXHA 1TO3A 4AZCA 4GUIA 3AS2A 1C90A 1CXKA 2PLCA 4QNLA 1VBJA 1VGAA 1W91A 2IPJA 4MB5A 2YDQA 1ZFJA 3CPGA 5H8UA 1K8YA 1TTIA 2E9MA 5AHNA 5D2XA 5MHBA 5IHRA 3GXFA 2VWSA 4X60A 3F2BA 2E6DA 3XIMA 4OFCA 5F2IA 3ARRA 2E1DA 3WEMA 2UBPC 1E55A 3PZUA 3CZKA 5H91A 2EPNA 1IZKA 4A22A 3NDYA 4ADUA 1YMYA 2XDFA 3STFA 2WVTA 2ZCGA 3BJTA 4X3ZA 3S0CA 1Q6EA 2DVTA 2DFAA 1REQA 1FWSA 3PZ9A 3RILA 1H4PA 2YL5A 4DPPA 2G5WA 3IJLA 4FK9A 1FDJA 3GFXA 3C8FA 3GH7A 2ACUA 1XLEA 1US3A 1LRNA 1ECEA 2FTWA 5AYZA 5D9PA 4QSFA 3W28A 3APYA 1VFOA 3TEVA 4KWVA 5EMKA 5E0CA 1HNYA 1WYIA 5LGZA 2QCMA 1FRBA 4LX4A 5BOFA 2EPLX 1P0KA 2HQAA 4AYSA 1HQTA 1KFWA 2DZSA 2PC8A 2XGZA 2J7EA 3R0DA 1F07A 2P8BA 3WQEA 2DUZA 2Y8VA 1N2VA 5LIYX 3ARVA 4JYEA 3WL1A 4KH2A 3SM0A 5AC5A 1J0ZA 5D2WA 2VELA 2DW6A 3CUHA 4KGJA 3OBEA 4PRRA 1EF3A 4GI6A 4HA3A 4LGXA 1CK7A 3H26A 1XH1A 1XR2A 3GS6A 1VH7A 1VAHA 1WDWA 2V2CA 2A5HA 1EDGA 2IW0A 4ZTXA 2ZRWA 1CI1A 4GKLA 5I3JA 2NXGA 1UD5A 7TIMA 1GEQA 1TPVA 3QHOA 1LRTA 3AYVA 4XZWA 3WD3A 4JNYA 4NXKA 1J0YA 3UJRA 1FWJC 2VOMA 2A3HA 4BI5A 1AW2A 3R8HA 4MKSA 3QLLA 2GGEA 1PBGA 2GYIA 3MJYA 1BKSA 3UPWA 2ZWYA 3BCDA 2VFEA 3WQ4A 3MP5A 2XYLA 5CQ1A 3W00A 1NSJA 3W37A 2OOGA 4XVDA 1POKA 3I6EA 2EPHA 2YBTA 4LF2A 2NXIA 5C5YA 3QGKC 3NQAA 4W93A 3H2FA 2CLKA 3BAJA 3PZQA 2VRQA 1OG0A 3KXQA 1GTEA 3NQEA 3VIHA 5EYWA 3I3BA 4MB1A 3UGVA 1TX2A 4OOZA 2C18A 3PN8A 3ZYZA 3GTHA 4GX9A 4PMJA 3HQPA 2IS7A 1NFGA 2PTXA 4P5UA 2I57A 4ZQMA 4BQ4A 3EX4A 1OVDA 1JZ3A 5DT7A 1GQIA 1E0XA 1KM5A 3MUAA 3UWYA 3U7VA 1NFBA 5AB3A 1XISA 4CVUA 1CENA 3S1WA 3GNNA 3I7RA 3N1AA 1JCNA 3EKGA 3BZJA 4S39A 1Q7MA 4IIEA 1KBJA 2NQJA 4S2CA 3DHUA 3LI0A 4LALA 2ZZ3A 1GW9A 2PWUA 2G8ZA 4QNWA 5FEXA 1V7YA 1G7UA 1EUNA 2RDWA 2OQYA 1UCWA 2ZBTA 4GPNA 1PZ3A 4NP7A 3WF2A 3GG1A 1Z89A 2UY3A 3VE9A 1JCLA 1WKDA 5SWUA 4IFRA 1KRBC 1FHUA 1V7AA 2CYGA 1E6NA 4GUHA 2FTYA 2Z2AA 3DH7A 3HOJA 3DG6A 1ZBVA 1JXKA 3U9IA 1H0GA 4IMCA 2Y0FA 2OU4A 3HN3A 2PP3A 3LTSA 4JTTA 2H3DA 2X41A 2YB1A 2QDGA 2FZNA 6REQB 4YXGA 3L29A 2XZ7A 2V5BA 4RXGA 1XM3A 1DJYA 4RW5A 3VD5A 4FLOA 1FQ0A 3ZVIA 5HMEA 3EWBX 4YLWA 1F6KA 3O06A 3P60A 2C79A 4N2YA 3HJEA 4RUBA 4KW2A 3QQ1A 3PG9A 8XIMA 3C52A 2NQHA 6ENLA 1PIGA 4Z2LA 2FGLA 3IAPA 1MRQA 3CBWA 4MZ1A 1CXFA 2Z1WA 1XH0A 3F4CA 2Y2KA 2TYSA 3L0NA 4MKVA 3QQWA 1W5PA 2WANA 2ON3A 1PJ9A 4BWLA 3W53A 1PKYA 2ZRUA 2J6VA 3S2MA 1OD0A 4LUTA 3WF4A 4BKNA 1GPWA 3M41A 5AC8A 2FKPA 3K8KA 3NA8A 3TSBA 4AVOA 4Y90A 2G0WA 2Y5SA 3OBKA 1KGXA 5D9NA 1ZZMA 3T8LA 4D6IA 1XGZA 3KRUA 5REQA 2YIHA 4LBSA 4HNOA 2OVLA 4IPJA 4D8AA 1BAGA 1E0TA 4W84A 3TA9A 5F4XA 1QNPA 4H00A 3W85A 1V03A 3C2YA 3ZS4A 1XSJA 3WDJA 3UW6A 3LERA 3VIJA 5C9XA 4O12A 2HK0A 1H09A 2RJHA 2PDWA 4X9SA 2ZTJA 3GNXA 2HS8A 3KTXA 1R87A 2YL6A 2YR1A 4U2YA 5TNVA 2X05A 1KFLA 4ZB0A 5BRPA 2RDUA 2J7GA 2YYTA 1E72M 1ISXA 3UZJA 3GTFA 2VEFA 3N2BA 1GVOA 4PGLA 4JY8A 1RJRA 3KOYA 2CBJA 1X98A 4CEXC 1CW2A 3U48A 3CV6A 3A12A 1W0MA 1M03A 4A05A 2IKGA 5FACA 2OZTA 4AZ5A 4C6NA 4WXYA 4H6RA 1TMQA 1D8CA 4GIYA 2CHOA 1BVNP 4YS1A 1UP0A 3GUGA 4RL3A 2GLKA 1H7RA 3B05A 2P3EA 2VUNA 3C0JA 5BRBA 4LC8A 4GNKB 4HHMA 1WZMA 4NAEB 3VZZA 2DZBA 4Z1BA 3RJXA 3M0MA 3RPDA 2WSPA 1AVAA 2GWGA 1LL6A 1W9XA 4MAVA 3L68A 2E5DA 1BYCA 5AVNA 3O16A 4O52A 2GVJA 2ZUMA 3STGA 1NQKA 3URAA 2GQ8A 1TR1A 4FALA 4LCQA 1V02E 4BZYA 1QO2A 4WY0A 3W7MA 3CV2A 4IG2B 1GWJA 3SW6A 4AF0B 5HNRA 2E25A 4HK6A 4X22A 4LH8A 4WRHA 1Q2RA 1GVEA 1VLIA 1ONEA 3LS9A 1K1DA 4J3WA 2WQDA 4F0SA 4Q8QA 2FFCA 1LLZA 1YU1A 1CYGA 4HZ6A 3KTCA 3SUVA 2FHBA 3NUKA 3DUGA 4C7GA 4NYUA 1PXGA 4DWSB 1V79A 3B9EA 4DBDA 1R9YA 4UQAA 2I7GA 4GXMA 4M6QA 1H7NA 2E4TA 4AX6A 1RQEA 1A3HA 5FESA 1RY8A 3GXDA 3CIVA 2VEPA 1XRTA 2PDMA 4MFDA 4GVFA 4IL0A 1DJNA 1ITUA 1WPCA 1RZMA 2BNJA 3WBEA 3DHFA 2WLZA 4WDXA 2TODA 3QXBA 3CUFA 1P0NA 4Y9AA 4E0CA 2EXOA 1CB7B 3B8SA 1IYXA 1H1ZA 3VVGA 1T7LA 1P7TA 4DBSA 1I0BA 1UD6A 1SW7A 4FNTA 4AY7A 4Z2HA 4C6EA 1LBLA 2A4AA 1RJQA 4DB7A 2BY0A 3CAKA 2P1FA 3DHPA 3C2EA 2I14A 4IICA 1PZ0A 4TMBA 5A8NA 5EBUA 3PHAA 2GJXB 1JPHA 3VDGA 1EBHA 5LNSA 2Y2PA 4F3HA 3L5AA 2ZXBA 1NARA 3FA3A 4M29A 1OWQA 1QOQA 3L4XA 3GIYA 4RV3A 4IQJA 3BH4A 4XTDA 3SCOA 4LVAA 4I5XA 3RLVA 3QF0A 3PWIA 4HMEA 5TAOA 2F6KA 3PUOA 1CEOA 1OIMA 5A95A 1RPXA 1QK0A 3GDTA 1MXGA 1W5QA 3LLFA 2PMQA 1V02A 4GH1A 4YCOA 1Q4WA 4D6HA 1JPDX 3GNRA 3L25A 3W7DA 3KBMA 1A3XA 3FKRA 1AZ2A 1Q6RA 1IQ8A 1A5LC 2W6RA 1WUEA 1OJXA 3W6LA 3WK2A 2OZ0A 3AHZA 3DFOA 4JPGA 1E73M 1VC4A 2J24A 4XB3A 3II1A 5CPNA 3P14A 5IFPA 2D20A 2EPMX 4KETA 5FCZA 3LENA 2DY3A 3ARTA 3H12A 3MUCA 1JUBA 3QMRA 4KF1A 4C1NB 3RPTA 1XINA 4NJKA 1XV8A 1PV8A 3W73A 3TJ4A 2VZTA 3MMUA 3VMOA 3QY7A 4IMAA 3CZGA 4GYPA 3BW3A 4J3XA 1EPVA 5D05A 3OZYA 2J47A 1MFVA 3EEZA 1PO9A 3DGBA 1QI4A 2F2KA 4US5D 1BG4A 4LY4A 2J7BA 2FVKA 4O4VA 3WNNA 4OIFA 3V3WA 3S47A 4BA0A 2NUXA 4K7YA 2E5CA 4O0QA 3RPMA 2ZZ5A 2ZXAA 4XD5A 3G24A 2Z1VA 1HW6A 2UZ9A 3S6DA 2A3EA 2D2JA 2P53A 2QJNA 4C91A 3PWGA 4DYKA 4TR9A 2NQ5A 4AMAA 2OQLA 1MQRA 3WD2A 2WVUA 1AD4A 4NIRA 4D8ZA 2REQA 3NQ2A 4IMFA 4N7QA 2VC7A 1WNOA 4W4QA 2DVUA 3A24A 2B7NA 3KBSA 4C90A 3VNKA 1GVYA 2A21A 2E77A 4XVEA 2DVXA 4G5DA 1EJRC 4HP5A 1RJPA 3CWNA 3BCJA 1QPOA 3GH5A 1GJWA 1D3GA 2VENA 4JKKA 5A6MA 3EMZA 3SIZA 1G9HA 2P8CA 2TSYA 3ANYA 3ZR5A 2WJFA 4XZIA 2RGLA 4PBFA 3LLXA 2Z0IA 4O8AA 1UOKA 3BLKA 3W27A 1SR9A 2FPYA 5FIPA 4WY0F 2JKEA 2IPFA 1UQZA 1ISZA 2WBKA 2R1NA 5DF0A 2PRMA 3CUJA 4LT9A 3KS4A 1EJXC 1T8QA 3P82A 4A35A 3JUGA 1KTBA 2X2YA 2VOTA 3QEZA 4UMAA 4DAIA 2VUYA 3DC0A 5J5DA 1W8GA 3M7PA 5RUBA 3W25A 3VC6A 2ZC8A 1EKOA 1XP3A 2HBVA 4D1JA 1IEQA 4IF2A 5MKGA 3W7NA 4M7TA 1D7FA 3LDVA 2GK1A 3RLGA 1M1BA 1PTAA 5FAGA 3VIMA 4X0VA 1UWTA 3MT1A 1JI2A 1WZAA 6XIMA 2NLIA 1LLWA 1GKRA 5C70A 3HMCA 4DBWA 1RQBA 2XFRA 3BAIA 4QFUA 1GVFA 3LGGA 1OK6A 1TA3B 5E9XA 4LS2A 3AMCA 4J35A 4TVCA 3AAMA 4BF5A 4S2BA 2CZEA 2QCLA 3PBYA 3QHMA 1ZU8A 4CU7A 1J96A 2X42A 3IJ9A 4M82A 1VRDA 3M0LA 3RO8A 4HN8A 5I00A 2INFA 4EPEC 2CLFA 3ITGA 1X1OA 1FWAC 2XUCA 5BU9A 3G77A 3I6TA 4A8LA 3FA5A 1GYMA 1ICQA 1H49A 3TTEA 5C6MA 4FZIA 1RD5A 3TR2A 3PTDA 1R3WA 3RO6A 2J88A 2OT1A 1VFTA 1DV7A 3KLLA 5E0FA 4Q7IA 2R1PA 4Q4QA 2X1UA 2JQXA 4GI4A 1UKTA 2IKJA 1XG3A 1NTHA 3LOTA 1Q2SA 4F40A 4UFLA 1SZEA 3RYSA 1SO3A 4NZ3A 3LGEA 4IH3A 2Z1XA 1PX4A 1XGEA 2ISWA 4DWDA 4ZL1A 1YU3A 2Y2GA 4UR9A 4ZSUA 1JI1A 4PA8A 3KCJA 3GDRA 3UWZA 3LTPA 1SFSA 1IWPA 3M43A 1PCWA 1ITXA 4NI3A 3QYSA 4N6EA 3WH7A 3PB0A 4R3UA 1B3OA 3W7PA 1EPXA 4J7RA 1KTCA 2A3BA 2A6NA 1UC4A 3VPLA 4XZHA 2I5GA 3BSGA 5AFDA 1AJZA 1XFBA 2EAWA 4JXCA 2UY5A 2Y62A 2HNHA 4R9XA 5EGRA 1EBGA 3TA6A 5EA9A 4QISA 3M0IA 1VFSA 1IGWA 4WKHA 4DYEA 2QNEA 1TREA 4UUIA 3AIUA 3B8WA 1G7VA 1NP0A 1QR7A 1S3TC 4I7WA 3C6CA 4LB4A 4ONVA 2VXNA 3DFQA 3WY1A 1KFKA 4WVXA 3O9NA 5BU6A 4A3UA 3LSBA 2YGYA 3GG7A 1W1IE 1UUOA 4ZE4A 1C8YA 1C8QA 1Y5XA 1JAEA 1WOBA 1R47A 1OZMA 3QOKA 3CZEA 4WDUA 4JTAA 4INFA 4JTLA 1KA9F 1BQCA 4YVVA 1I1XA 3VOHA 2DT0A 3UGRA 2YXXA 1LOLA 1EJ7L 2WQPA 3WELA 2WNNA 4DJDD 1HO1A 1MZRA 3C2OA 1WAUA 1QW8A 2PDIA 1K4GA 3POHA 3GNPA 4NASA 2ISVA 1UZHA 2FZ9A 1WE5A 5IDIA 4ZZ9A 3VDHA 3ARUA 3ZMRA 4AD1A 3DFHA 1DWGM 4PCSA 3U0HA 1LZOA 3KWSA 3LHVA 4K36A 4RZ5A 3W0KA 1JDEA 3SUWA 4UTIA 1EQPA 4L6HA 4JIHA 2BB0A 4LNYA 2FH6A 3TONA 1BXCA 5HMDA 3AXKA 3VGEA 4YWSA 2GDVA 4XKYB 3AMLA 3NO5A 3HG3A 2UWXA 3U4FA 2A85A 3N6JA 1IWBA 1F74A 2MNRA 1LDCA 3YPIA 4LTSA 2BOGX 2PEVA 2P88A 3T2PA 4ZO6A 1S2UA 3TWBA 3Q4DA 1E56A 5K4XA 2DT1A 3GTNA 4NAFB 4HSOA 2QPUA 3GBDA 3KEHA 2G3FA 1MFUA 2V5KA 5CGMA 3N2TA 1HJUA 2ZZ2A 4W87A 4C6MA 1ED7A 1XLJA 4EP8C 2Z24A 4M6UA 3L23A 3L2AA 4O54A 4WZHA 2HBXA 3CK5A 2EKGA 2AL2B 4M24A 3WLKX 1ZJIA 3GXIA 3UWWA 1OGGA 1KFBA 2PDBA 3AO0A 4XBKA 3AJXA 3ABXA 1PVNA 3BQ6A 2ZZ1A 4L1XA 4FF5A 4HYRA 5FSEC 2V2HA 4QJ5B 1UASA 1M65A 5JMUA 1V6UA 1LCOA 5I3DA 3TAKA 1A50A 4WSKA 4GABA 2GFTA 1RD6A 2ABBA 4JTIA 1TQXA 2J25A 3M0KA 2WB5A 2BDQA 3G1SA 2C1IA 2PDLA 1GJUA 2J9XA 5CBJA 3I6RA 2BHZA 3F1QA 4YWIA 2GVLA 2VWTA 4AY8A 2GOKA 3BV7A 1SJAA 3NGJA 1TRIA 1K3UA 4HNCA 2O55A 1KCZA 2QMJA 1A5CA 4N9CA 4EANA 2QHAA 3WLJA 1XIEA 3MHUA 1WB0A 2DGAA 3TC7A 3LK6A 1QWGA 3KOFA 4CCCA 3DHDA 1VIWA 4QSHA 1CXIA 2YBVA 5DY2A 3AUJA 3E5BA 4UTHA 3WLHA 3TU9A 1LWIA 4A3HA 1GHSA 3UY8A 2DU2A 1JNDA 3MI6A 4H8NA 5D2VA 2VX6A 1YADA 3RHGA 5L9FA 4NZ1A 3VC5A 1RLDA 1TR9A 1V6WA 1F73A 1F05A 4Q7BA 3O0KA 4NZFA 3BXWA 4M51A 2WNQA 3SCRA 3THAA 5C2GA 1WDDA