4TX8A

Crystal structure of a family gh18 chitinase from chromobacterium violaceum
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
395
structure length
374
Chain Sequence
ACPGWAEGTAYKVGDVVSYNNANYTALVAHTAYVGANWNPAASPTLWTPGGSCGNTVPFAKHALVGYWHNFANPSGSAFPLSQVSADWDVIVVAFADDAGNGNVSFTLDPAAGSAAQFIQDIRAQQAKGKKVVLSLGGQNGSVTLNNATQVQNFVNSLYGILTQYGFDGIDLDLESGSGIVVGAPVVSNLVSAVKQLKAKIGPNFYLSMAPEHPYVQGGFVAYGGNWGAYLPIIDGLRDDLSVIHVQYYNNGGLYTPYSTGVLAEGSADMLVGGSKMLIEGFPIANGASGSFKGLRPDQVAFGVPSGRSSANSGFVTADTVAKALTCLTTLQGCGSVKPAQAYPAFRGVMTWSINWDRRDGYTFSRPVAASLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable chitinase A
publication title Crystal Structure of a Family GH18 Chitinase from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 120
structure length 374
sequence length 395
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4tx8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4tx8A02
3CUHA 1LG2A 2BY3A 1A47A 1TR1A 3KZSA 3TTYA 2A3EA 2GJXA 4K68A 4ML4A 4ATDA 4RE3A 4P8WA 1NWTA 1JZ4A 3AIUA 4BCEA 1UZ1A 3KE0A 4AWEA 1E0VA 3AS3A 5BRPA 4F66A 4X9YA 1MW2A 3WQ6A 4HOZA 3AMLA 2WYSA 1BVZA 1MQRA 4M8UA 4Z2GA 4F9DA 4NSBA 4YHEA 4WF7A 1EGZA 1V6VA 1MVYA 1PZ2A 2WBGA 2ZE0A 4WKAA 2W5FA 1XCXA 1TFVA 1XYFA 3GXFA 5ABEA 3WDHA 1AQHA 5ABFB 3VD5A 4MDOA 3AS1A 3MU7A 3GXDA 4LYQA 1W91A 4F9JA 5I2UA 1E6NA 2DSZA 3ZT7A 2VRQA 1JIBA 3F5LA 1QI0A 4MPKA 3W28A 4BQ2A 4BZYA 3AYSA 2YL9A 1QNOA 2OWWA 4UOZA 3VDAA 3THCA 1TA3B 1W9VA 3WDIA 4LX4A 3B9AA 1KGWA 2J7EA 2XG9A 2UY4A 1P6WA 4H41A 3VIMA 3ZT6A 3PHAA 4UQ9A 3L4ZA 1E0XA 3CIVA 3CUJA 2WHKA 1JD9A 3SUSA 4MB5A 2YDSA 4P8UA 3VDHA 1H2JA 2D24A 2G41A 3WQ5A 2D22A 4YPJA 4QLKA 3VU2A 4AZCA 2BV9A 4CD8A 1EOKA 1HF6A 1V02A 2WANA 1H11A 1WNOA 4F8XA 4XB3A 5A3HA 2GJRA 1HJVA 4M24A 1JYNA 2FDMA 3EYPA 3PBGA 4UFMA 2XUCA 3VIPA 1KXQA 1HVXA 3AIBA 1H3GA 3AMKA 4J3WA 1TVPA 2RGMA 3I3EA 3GZAA 5I24A 4MNKA 4U31A 3CGTA 1MW0A 4PN2A 2X8RA 3IK2A 3FN9A 3POHA 5DF0A 2ZX8A 1NOFA 1GQIA 2VO5A 2XIIA 1UUQA 2C0HA 3AHTA 5BXTA 4DWSD 5C71A 1V0NA 3BSGA 1W9BM 3FXYA 4PSPA 2JIEA 2GK1B 2DT2A 1I1WA 4DM2A 5E0FA 2EPOA 4KWUA 4PMDA 5A95A 4TX6A 3EBVA 2EPLX 5EBAA 2WCAA 3CUIA 2G4FA 4PUDA 2FHBA 4W5ZA 2QLYA 1H1NA 3AISA 2Q8XA 1XGZA 1BLIA 4TTGA 1SMAA 5CG0A 1XH0A 2DEPA 1C8YA 5A6LA 1JAEA 4TVUA 1UZ4A 4U2ZA 3WY1A 1VBRA 4DWSC 5A8PA 1GOIA 8CGTA 1PZ3A 2A3BA 1XYZA 2E40A 3KWXA 5D9MA 1E0WA 1FA2A 1UKSA 1ESWA 1JI2A 4ZFMA 5A94A 1J9YA 4WSKA 2JE8A 1W2VA 3ARPA 1KCKA 5IXEA 2FH8A 4MNMA 2PWGA 2OWCA 1HT6A 3QHNA 3CZEA 1HL9A 4CD7A 2Y2WA 3AMGA 2VZSA 3BMWA 1C7TA 2ZUWA 3CZGA 3S6TA 4L4OA 3ZIZA 2VURA 2QPSA 3WBEA 3PZVA 5CPTA 1CIUA 4GZJA 3DYMA 3OBAA 3LPGA 4GZEA 1KGUA 1V02E 4CCCA 3W38A 3VD4A 4GI8A 2V3DA 3OLGA 2HISA 1KXVA 1OIFA 4Q22A 2XFFA 3VMPA 3CZJA 4ATLA 3PZUA 1Q6GA 2VRKA 3GYCA 1JAKA 4UFJA 2D3LA 5AC5A 1W2PA 1MQQA 3VNZA 1HKKA 2GDUA 2BS9A 4GPNA 1FP9A 2AOSA 5A8MA 3QR3A 4PMRA 1PBGA 4J3UA 1XH2A 1LLOA 2PWDA 1CXIA 4TXEA 3OLEA 3MUIA 3WUFA 2G8ZA 5LA2A 4PCSA 3WH5A 1W3KA 2A3CA 4PEEA 1J0IA 5F7UA 3WD2A 3IAPA 1JGIA 3AFBA 2VJXA 1GOMA 2OWXA 2XPKA 2DSUA 3FW6A 4X0NA 3WDRA 4B3KA 4JAWA 2JIWA 2OYKA 4ZEPA 4PMZA 1Q6FA 1YHTA 1EDGA 2FH6A 4FMVA 4BQ3A 4C7DA 5A8OA 1M7XA 4X0VA 5CSUA 4AEFA 4GI6A 2OSYA 1HKIA 7CGTA 2WVVA 3WD0A 5EFFA 4W86A 2ZXAA 4B9YA 2BHUA 2YIHA 2PB1A 4GI9A 5KEZA 4JL2A 3W6MA 4AZBA 1GHSA 4PMQA 4A4AA 1QVBA 4JFSA 2VTFA 2UY3A 3AJ7A 1ZBVA 4AD0A 2J77A 4BF7A 3WL0A 5D9PA 1JDAA 3MMWA 1B30A 1ECEA 1Q4NX 2E3ZA 1UD8A 1B3ZA 4TUFA 2NSXA 3GTNA 1RPKA 2ZUSA 1IZJA 2G3IA 4URIA 1VFUA 3WN6A 4UZSA 1TMQA 4B9ZA 2WMGA 4OKDA 3WBAA 2YBUA 4AIUA 3EDFA 2UY2A 4OIFA 2A3AA 4P7RA 5A6BA 3CHEA 1BAGA 2XVPA 1GOWA 3G6MA 1YQ2A 1EOMA 1JDDA 2WVSA 3TA9A 3OLDA 5A1AA 2G3NA 4H8UA 4OOUA 1J12A 4AD2A 1EHAA 2VR4A 4KMQA 3BAIA 5JIWA 3QGVA 4JFVA 2XFYA 4UQBA 2X1IA 3WF1A 2XTKA 2XWEA 1KXTA 4GO9A 2XGBA 3SEPA 3ZSTA 2VCBA 3WMCA 4MNLA 3WF4A 2DH2A 4CCDA 1Z32X 5I5RA 4GKLA 1V03A 2YOCA 1PX3A 4IUGA 3A4WA 1E4MM 2VVSA 3CHFA 2PF0A 2MANA 1E71M 2WVTA 4J3SA 1H0GA 1HVQA 3GM8A 2F61A 4J27A 5DEZA 5GPRA 1DWIM 1PX8A 3N9KA 1MFVA 2YLLA 2ZWYA 4V2XA 1EHNA 5M5DA 2X2YA 2WWCA 4RE4A 2DSKA 1B3VA 1V6UA 1HXJA 5FD0A 8A3HA 4WSJA 2BVDA 4WKHA 5CJ5A 1MW3A 4CU7A 4D6JA 4DM1A 1CXHA 2IXVA 5FOOA 4KGJA 4AMCA 3DECA 4ACZA 3WH9A 4JCLA 1WZAA 3SCPA 4W89A 2W61A 4WIWA 1KQYA 1JXJA 3AHVA 3L4UA 1J0KA 2Y5EA 1XRVA 1QBBA 2IUZA 1O6IA 3W24A 1J0HA 2VI0A 4TVCA 2IXUA 5CPSA 4HMEA 4M81A 4UOQA 2QMJA 4NZCA 2WMJA 1ISVA 5HBFA 1JXKA 1GVIA 3OA5A 1LWHA 5M03A 4HOWA 4E8DA 3L4WA 1VF8A 4D6IA 4UTFA 4J7RA 3BSHA 2C7FA 3K8KA 2DIJA 1CEOA 2ZX9A 4TVDA 4D6EA 2Z1KA 1EIBA 2YL6A 2WAGA 3ARWA 4UOJA 4OUEA 3L4TA 2J7HA 3AMCA 4GO8A 4EK7A 3K8MA 1CXLA 5JUVA 1HJWA 1EQPA 4AZ5A 4M82A 3L4XA 7A3HA 3A6OA 4J28A 4GINA 3ARUA 5A2CA 1CWYA 4AIEA 3PZNA 2CBIA 2WHJA 4ZE4A 2O9PA 3PTKA 1IV8A 1H5VA 4OZOA 1JG9A 2W63A 5CZKA 1HNYA 3SCVA 3GXMA 4HOXA 4HZ8A 4KRUA 4ZE5A 4UFHA 2QPUA 3VKKA 1E3ZA 1K9EA 2CCRA 3WQVA 4QCEA 1I1XA 1CGWA 3WH7A 1HJSA 4JKLA 2J8FA 5BXRA 3WNNA 1HP4A 1BPLB 1FOBA 1OGBA 4NF7A 1GHRA 2VZUA 2VT0A 2CBVA 4U2YA 4H8HA 1UH3A 2BHZA 2GJPA 2CETA 1E6RA 1GJUA 4UQEA 1J0ZA 2VX4A 2Y8VA 3OGSA 1G0CA 2WC3A 1ZL1A 3WDQA 1FFRA 1RP9A 2CESA 4HMCA 3MV01 3WNLA 1WB0A 4PYSA 4IISA 1DWAM 3W26A 2GVYA 4PCTA 3QHOA 1C90A 4PTMA 5E9AA 3F4VA 1ZS2A 1Y7VA 1GUVA 5DO8A 1BSIA 1HIZA 1SMDA 3WDJA 3T0AA 4WJXA 2WKLA 3PTQA 2EO7A 5IHRA 3WEZA 1OBAA 3VTRA 3E1F1 1M53A 1GOKA 2XYLA 3KL5A 1ISXA 4C7GA 1E5NA 2E4TA 3K46A 5IFTA 4U33A 1JFHA 1MXGA 6CGTA 4R27A 1OD8A 1US2A 5I0DA 3BAWA 2YDQA 4UFLA 3VD9A 1V6WA 1DTUA 1FH7A 1UR4A 3L2MA 3ECQA 2WMIA 1LQ0A 1SYTA 1NOWA 2EPKX 3CO4A 4AD4A 1J0JA 4UCFA 1GW1A 1EO5A 1TG7A 3K4AA 4DWSB 2J7BA 1BFNA 3VDCA 4MAVA 1E6ZA 1WDQA 4HPHA 3M6DA 3CZ8A 5A6JA 1XSJA 3RILA 3SURA 5C70A 3BAYA 1UH4A 4AW7A 4CU6A 1CECA 4W7VA 1LG1A 1UKTA 1E6PA 1E43A 3MSGA 3SIMA 1B0IA 3M07A 1EA9C 1F4HA 4P8XA 4MAZA 1HKJA 1XSIA 3AZSA 1BG9A 2ZUTA 1FP8A 2JEPA 1CGTA 5A8QA 2E8ZA 3CH9A 1BG4A 3WD4A 2BY2A 3AQUA 1UQYA 4MNJA 1UWRA 3DHPA 2WHLA 1J18A 2O9OA 3SUTA 2FGLA 3IJ7A 4HZ6A 2A3HA 2YBTA 3MSDA 1AQ0A 4U3AA 3OZOA 2W67A 4MTVA 4CN4A 1UR2A 3CUGA 4D6FA 3GNPA 7TAAA 1OCQA 1C3FA 3FHAA 3FY1A 1V3IA 5CLTA 1JL8A 3ZT5A 4F79A 3ZJKA 3N1AA 3WH8A 3ZSSA 3N12A 3SCOA 3T08A 3WD3A 2Y4SA 1OT1A 4NRSA 3AYRA 1VB9A 3TP4A 1I75A 2D0FA 3BAXA 1JYVA 1E3XA 1BGGA 1UH2A 4AZ7A 3CTTA 2YL5A 2C8NA 9CGTA 2E0PA 1C8XA 1E6QM 3VGGA 2ESCA 3MUY1 3POCA 1R7OA 5DT5A 3NDYA 3BLPX 4EE9A 2PWEA 1LF1A 1MQPA 5DT7A 1CLVA 5ABFA 1WO2A 3LPFA 1MWOA 4W8BA 2X05A 5JIPA 1ITCA 3FHQA 3VX1A 3VGBA 1TA3A 4OBSA 3MMDA 3UERA 3MUAA 2XJ7A 1E9LA 3OB8A 4E2OA 1DWFM 2Y8KA 2XVKA 3RDKA 1CXEA 1CLXA 4B15A 3EMCA 3N13A 1AVAA 1ITXA 3AXHA 2EPNA 2VC9A 4HA3A 4M56A 4UQCA 2V5CA 1NWRA 1E73M 1BF2A 2NT1A 4W8AA 4Z2HA 3W53A 2VZOA 1ISYA 2BXZA 1EDTA 1R7AA 3PZMA 1CGYA 1UD6A 4R5EA 1JDCA 3ARSA 4N0RA 4OOZA 4H04A 3ALFA 2WPGA 4KGLA 3NIYA 1EO7A 3T2OA 4D6GA 4Z2JA 1B9ZA 5AY7A 3SCNA 1RH9A 6TAAA 1LL7A 5E6ZA 4AIOA 4HA4A 1LL4A 4LPCA 4D6CA 1ZBKA 2O92A 2OSWA 1GPFA 2XHYA 4W8LA 3T0DA 4CVWA 2J78A 5ABHA 3GH5A 5EMYA 2UY5A 2FGZA 3RPMA 1V3HA 4H8VA 3BC9A 4UNIA 2GK1A 1NWSA 3UG3A 1MXDA 3UG4A 1ISZA 3M46A 1HJUA 3DYOA 4PMXA 1HP5A 1DWGM 2GDVA 3N15A 2DSVA 1WDRA 1K6AA 1J01A 1GJWA 4PSRA 2QV4A 5HNNA 2W91A 1GZJA 2OYMA 3QOMA 1BVNP 2CHNA 3M7SA 2VQTA 1JNEA 1XD0A 2D1ZA 4AD5A 5BWFA 2BFGA 4HMDA 2V38A 4QCFA 2BVTA 2WWDA 4AD1A 3WSUA 2EXOA 2AAAA 3AOFA 3NSNA 1IT0A 3CUFA 1E40A 3VX0A 2WCSA 2V5DA 1WP6A 1QHPA 4QP0A 1JNDA 1RP8A 4WLCA 4FF5A 5LYRA 1JZ5A 1PEZA 3TTSA 5HOSA 4AD3A 1CXKA 2YA0A 3U7BA 3D5HA 3RO8A 1M04A 3L4VA 4U5KA 5IFPA 4Z2LA 1E1FA 1WDPA 2J47A 4W7WA 4CVUA 4PUEA 3WQ8A 1GOQA 2ZXBA 1C7SA 4AZHA 1E4LA 1UD4A 3N11A 1WKYA 5FL0A 3WNPA 1EDQA 2BVYA 4P7NA 3N04A 2WSKA 2WC7A 3KEHA 3NSXA 2ZXQA 1TUXA 1R85A 3WD1A 2YA1A 4MB3A 2YA2A 1H49A 1KFWA 1NQ6A 4UR9A 1ED7A 1OIMA 3ZO9A 1NP2A 5D9OA 2YDRA 1PIFA 2J79A 2XFRA 3WUBA 5E09A 2XSAA 4S3JA 5A6KA 3ZMRA 2YL8A 4LXFA 1BYCA 3W27A 1CYGA 3VM5A 3AIRA 3DHUA 2DQXA 5A6BD 2XWDA 4XZWA 3VGEA 5JBFA 4AC1X 1KBBA 4V28A 1CNVA 2VMFA 3ZR5A 1OD0A 4DUXA 3N17A 1UKOA 3K1DA 1H09A 2D20A 1A3HA 2VR5A 3II1A 3EMQA 3ZM8A 3ARYA 2TAAA 3AIEA 4Y7EA 5BRQA 3GNOA 2XM2A 4V27A 1NOUA 1VEPA 4FLOA 1TE1A 5LA1A 3VO0A 1UKPA 3T0BA 2WSPA 3ZJ7A 1M01A 2CITA 4HZ7A 1QNPA 1E55A 1KCLA 1X6NA 4MADA 2VX6A 4AEEA 2F2HA 1OM0A 2D0HA 1R87A 4JL1A 3ARXA 3MANA 3MKKA 1FHDA 3RM9A 3W29A 4UQAA 2WHMA 4MJ2A 3MUZ1 4AYSA 1UD5A 4E8CA 3PN8A 3GBEA 5CSYA 3WNKA 4U3CA 3VIJA 3VDBA 4WK9A 3VIGA 1Q6CA 4TX8A 1UOKA 4W88A 3VGFA 3D3AA 2OLHA 3RM4A 2PWFA 3K8LA 4EANA 3FAWA 2YKKA 4P7LA 3RM8A 3OZPA 3RIKA 2X09A 5GQBA 3PZIA 4HU8A 1W1YA 3KL0A 4JFWA 4M80A 3WKZA 1XCWA 1G9HA 5D8WA 5D9NA 2ZICA 3IANA 2CERA 1JZ8A 5AC4A 2XVGA 2O9RA 1OGGA 2B31A 3O6AA 1BGAA 1X1NA 4M1RA 2VL4A 2CKSA 5GNYA 2E9LA 3TOPA 2DIEA 2J74A 1KBKA 4GZIA 1QNQA 3AMDA 1KWGA 5A69A 2WZHA 2GJXB 1VAHA 4FLSA 3SUVA 3QHMA 3W25A 4BQ5A 4JHOA 3OGRA 1KQZA 4KH2A 1EH9A 2O9TA 2J75A 1UWSA 4PTVA 4D1JA 2CEQA 1QI2A 1JZ7A 3TONA 3SCUA 5I23A 3SCQA 4ZXLA 1CBGA 5CLWA 2NW0A 2WXDM 3T2PA 2XGIA 2ZUNA 1BTCA 3T09A 2D0GA 1WDSA 5EFDA 1E70M 1PAMA 3TTOA 3U57A 3GXIA 3BAKA 4W87A 3MS8A 4N42A 4EKJA 5A6MA 1V0KA 1QI3A 3GDBA 3BGAA 1FFQA 1W3HA 3SCSA 4KRTA 4AXNA 2EEXA 1KR0A 3CPUA 3BH4A 3ARTA 3UR7A 4P7QA 1B3YA 3PTMA 4D1IA 2HVMA 1CZ1A 4L4PA 1ZJBA 1HJQA 4QLJA 4DUWA 2GFTA 4RL3A 4QDMA 4PMUA 4YHGA 1UR0A 3QOKA 1VJZA 3VMNA 4PTXA 4DUVA 3VNYA 1CENA 5BXSA 5KZ6A 1UG6A 3HU7A 2QMKA 1UHVA 2V3EA 2W62A 1JD7A 1D2KA 5JBEA 3SCWA 5C8BB 1OT2A 1W1TA 4J3XA 1G5AA 1ISWA 5A6SA 1QOXA 2CBUA 3GNRA 1QNSA 3F5KA 2JF6A 1MYRA 3VIOA 1C92A 1LWJA 2D49A 2XSBA 3UETA 3MO4A 1UR9A 1BYAA 2XVNA 3W81A 2J7GA 3AROA 3CMGA 4CD5A 3VIIA 2X0YA 1GQLA 1OSEA 2G3JA 4AZCB 4CN1A 2DGAA 1H41A 1OINA 1S46A 3NDZA 3WL1A 1NP0A 1VJSA 3OG2A 4W93A 3LPOA 4Z2KA 1J11A 3RMEA 2QHAA 3RJYA 3TTQA 1OGSA 1CPUA 1CXFA 3B9EA 1NH6A 4JHZA 3F5JA 1FHLA 3WNOA 1SFSA 4W5UA 3A3HA 1NM9A 1W1VA 2PBOA 1GNXA 1BYBA 3AS0A 1HKMA 1B3WA 1WZLA 1CGUA 4GIAA 3SCRA 3S2CA 1KR1A 4UZUA 4EAMA 1WZKA 1VFFA 2WB5A 2DSWA 3SUUA 3U7VA 2J8GA 3WELA 1JZ2A 1KGXA 3HMCA 3ZQ9A 3VGDA 1MFUA 1QW9A 3PZ9A 5E6YA 1QBAA 1GQJA 3I3BA 4ZXOA 2WZIA 2WZEA 3EDDA 2VZVA 4S3KA 3AHZA 4E4PA 2W66A 3W4RA 4WKFA 1CGXA 1FH8A 4FK9A 2EJ1A 2ZXDA 3IJ9A 1C91A 3BCFA 2QF8A 5HDRA 2CYGA 2NT0A 1C8QA 3VM7A 4CD4A 2WM0A 3VILA 3EMZA 2EBNA 1H4PA 2ZX6A 3ALGA 4C7FA 1G1YA 2BY1A 1UD3A 5M3WA 1K9DA 2VVNA 1CDGA 2PBGA 2WMFA 4BQ4A 1WE5A 5E70A 1V3MA 1XD1A 4U5IA 2AMGA 1HN1A 1J10A 5BROA 2RGLA 3AHXA 1B31A 2E8YA 2VUYA 1E5JA 1K9TA 5I3DA 1JI1A 1NWUA 1VFMA 2YLAA 4B3LA 2D23A 3NSMA 4D71A 2UWFA 5BYWA 1U30A 4MB1A 1E4NA 1ZBWA 3A47A 2WNWA 4NI3A 1H0IA 1BQCA 3SUWA 4DWSA 3N18A 2ZOXA 1B90A 2J62A 1QHZA 1X6LA 2ZWZA 4PTWA 5CGTA 5FCZA 2XM1A 5CPQA 1TVNA 5D8ZA 1EXPA 4RE2A 1NARA 1V6XA 4CN6A 1J0YA 3ZR6A 2G3MA 4XV0A 1E15A 2D2OA 2DDXA 1M03A 2DT3A 5CGMA 1DHKA 1V3LA 1GONA 4LYRA 4PMOA 2WBKA 1XH1A 1XHGA 2W4XA 4XZBA 1PIGA 2JALA 4H7VA 4D6DA 1EQCA 3J7HA 1OB0A 1SR0A 3WFLA 3VINA 2WMKA 2BHYA 3W37A 3NUKA 1B2YA 3GH4A 3WH6A 4QAWA 4CU8A 4XX6A 3AIVA 2PI6A 1W3JA 2BNJA 2WVUA 4FLQA 5I77A 4OBRA 2ZX7A 4J3TA 1QHOA 2WVVB 4A3HA 4IPLA 3VIFA 2RTSA 2WC4A 1BYDA 4AY1A 2YJQA 2ZIDA 5GNXA 6A3HA 4AZ6A 4PMNA 1JYWA 5A8NA 1D3CA 4J3VA 1W9UA 4AZGA 5HXMA 1WZMA 1JFXA 3WMSA 3W6LA 2GSJA 2J7CA 2E9MA 3UR8A 2CKRA 4ACYA 3OLIA 1VFOA 1XC6A 4UQDA 4FLRA 3VOCA 3AICA 5GNZA 1B1YA 4CGTA 4P7OA 1FH9A 1VIWA 3BMVA 4JZ5A 3KL3A 2OSXA 2CPUA 5D4YA 2EQDA 1W9PA 5A2AA 3CZKA 3VVGA 2VQUA 2WLYA 3I3DA 5I79A 3ARZA 2VCAA 3IJ8A 1Q6DA 1ZU8A 3CHCA 3DYPA 3FAXA 4D72A 1ZBCA 4MDPA 1HL8A 3WUGA 4H2CA 4LGXA 2ZUMA 1UYQA 4A3YA 4LQ1A 3LPPA 5E0CA 4D6HA 1KWKA 1TZ7A 3W0KA 5AYIA 3ZOAA 3VPLA 3O2LA 4AISA 1AQMA 3VMOA 3WQ4A 2DT0A 2VZTA 4MJ4A 3WEMA 2WMHA 1UA3A 2E9BA 3VD7A 3PZTA 1UWQA 1L0PA 1IZKA 4JFUA 2VNCA 1QPKA 3AS2A 4OJYA 1R8LA 1ZB5A 2FHCA 1JZ3A 3WENA 1W9DM 1E6SM 2DH3A 1O7AA 3WF0A 1BHGA 3U5UA 3VIHA 3PZOA 1E6XM 1QNRA 2J25A 1ZJAA 4CUCA 3U5YA 4UFIA 5HPOA 3GBDA 5CQ1A 2FHFA 1V0MA 2X0HA 3BAJA 4PBGA 3L4YA 1V6YA 2V3FA 4AZIA 3APGA 3AHYA 3UEQA 3CZLA 4ACZB 4XUYA 3L2LA 1ODZA 1GOOA 1V3KA 1DWJM 4YN5A 3EDJA 3WQWA 3RCNA 4BA0A 1C93A 1E4IA 3SCTA 2VCCA 3LMYA 4QFUA 3FNDA 2PC8A 3AXIA 1U2YA 1VENA 1PPIA 4IPNB 3CHDA 3BLKA 5CXPA 4LYPA 4PRWA 1V0LA 2CNCA 4HPGA 1DP0A 3IAQA 2XIBA 3WEOA 4IM4A 4HA1A 1XSKA 1E72M 3PZGA 1LL6A 2JEQA 3EDEA 3ARQA 5ABGA 1W3LA 4BS0A 1QI4A 3AZTA 2ZUVA 5IDIA 2WLZA 3WDPP 3NJ3A 1DEDA 3AIWA 3O9NA 1UQZA 3K4DA 4UFKA 2CIPA 2J7DA 1GVYA 1CGVA 4JCMA 2VRJA 2WK2A 5DFAA 4ZENA 1UD2A 1F4AA 1UWUA 3OIHA 1VEOA 3OGVA 1U33A 3G6LA 1Q6EA 4Q7NA 1MW1A 3AXXA 1UA7A 1XV8A 5I78A 1L8NA 3WUEA 1HX0A 4CCEA 2CBJA 3RJXA 3WIJA 4JKKA 3PZQA 2JFEX 5A6AA 1WAWA 1G94A 2Z1SA 1KXHA 2BXYA 3ZJ8A 5JBDA 3HJEA 3JUGA 4MB4A 1US3A 1E1EA 2ZUUA 4W84A 5A2BA 3AZRA 4W85A 1VRXA 3ARRA 3EDKA 2J4GA 4TTUA 1UR1A 5M17A 5I6SA 1N82A 1AMYA 1V3JA 2OYLA 3VGHA 4QLLA 3AIQA 1PJ9A 1W9XA 5IHSA 3GH7A 1W1PA 3CMJA 4TOQA 2CXGA 1TCMA 4ATWA 4HTYA 2JF7A 5FL1A 4JFTA 4PMYA 5BCAA 2EPMX 5BXPA 4HP5A 3BXWA 1G01A 3T2QA 3DC0A 5FKYA 3NYDA 1OWQA 3THDA 3W82A 5FIPA 3CBWA 5HPCA 3UG5A 3WMBA 3UESA 1GCYA 3AI0A 1LJYA 1UKQA 2DT1A 3CLWA 1WCGA 1JF6A 3BCDA 4Z2IA 1ODUA 1RD6A 2D3NA 5AYBA 2WKGA 4GQQA 5ECUA 3MV11 2VX7A 1DWHM 3WF2A 2WCGA 3UCQA 4HU0A 1R86A 1QI5A 3A4XA 4JIEA 1QW8A 2J7FA 3VIKA 1V08A 3HN3A 3NCOA 1JF5A 5EB8A 1AIWA 3WNMA 1E56A 1UR8A 1HJXA 1VBUA 3A4AA 2WMIB 2BY0A 1UWTA 3B9DA 4GXPA 4P8VA 1JZ6A 3WF3A 1K9FA 2CHOA 3ZJ6A 2VOTA 1GORA 1WPCA 2WW5A 1PX4A 2DPEA 3B8SA 2VX5A 2GUYA 4M29A 5TD4A 2V3GA 2PWHA 5LA0A 2Y24A 4NRRA 2W92A 1W32A 2XVLA 3MMUA 3VUPA 1D7FA 2F8QA 4B16A 4CKQA 4JKMA 2ZX5A 3VD3A 1JYXA 1B3XA 1CTNA 5DMYA 1KB3A 1VEMA 1GQKA 4PMVA 3WFZA 4W7UA 3ARVA 1UWIA 4GQRA 4CD6A
chains in the Genus database with same CATH superfamily
3TZNA 3CUHA 3TLQA 2Q09A 1GG0A 4YYFA 1KM6A 1TR1A 1AW5A 3ID7A 1X7IA 1D7KA 1VH7A 4ATDA 2YX0A 3GO2A 3QZAA 2VWSA 1UZ1A 3KE0A 1TQXA 2G50A 3H4XA 3AS3A 4PFMA 3VFLA 2YCKX 3AMLA 2WYSA 3NG3A 5D03A 1MQRA 4M8UA 4DF2A 1VFSA 5DRIA 4F0RA 3O16A 4JBRA 1QXLA 3H12A 1EGZA 2VHLA 1MVYA 4OGZA 1TJRA 1XLBA 4OUIA 4S3CA 5F4WA 3TAKA 2PMQA 2I5IA 1AQHA 4H4IA 3VD5A 5H1WA 1W1ZA 4LYQA 2CHRA 1KM1A 1XDJA 2VRQA 3ZT7A 1JIBA 3F5LA 2MUCA 1EFZA 2FZ8A 4GD0A 1QNOA 2OWWA 3VDAA 3OVRA 1XKYA 5I09A 2CLHA 3WDIA 4JEJA 4LX4A 4H41A 3L0GA 4Q3MA 4A8NA 3CMFA 4UQ9A 3L4ZA 3S8HA 2ZRVA 1KTBA 2WHKA 5AHFA 3EX2A 3VDHA 4ZVJA 1H2JA 1K7FA 3VU2A 4AZCA 2BV9A 4Q4RA 1EOKA 3TJ4A 2B0MA 1HF6A 5K7JA 2F2KA 1V02A 2WANA 5DY3A 1ZUAX 2NXGA 3CL8A 3U8GA 3W83A 1PVNA 4O8AA 4M24A 3AAMA 4RW3A 4GIRA 3VE9A 3ZVIA 4UFMA 4QG6A 3O6DA 4DX3A 1HVXA 2DUAA 1H3GA 3H7VA 4AY7A 4J3WA 1TVPA 2Y6ZA 1EBGA 2RGMA 3I3EA 3XIMA 1OY0A 3GZAA 1OFOA 4Q8PA 4WDXA 4U31A 3CGTA 1MW0A 2Y2PA 3WLOA 1YTKA 2YW3A 4XIAA 3FN9A 3UY7A 2C13A 2ZX8A 2VO5A 4MG4A 2C0HA 3AHTA 3VOGA 4A6GA 2ZC1A 2OOFA 4DWSD 1HW6A 1EA0A 2VEIA 3FXYA 1AUSL 2GK1B 2EG6A 1ONWA 3T07A 3CNYA 2FTPA 1XBVA 2EPLX 4NZ4A 2FHBA 3WLHA 3MBFA 2IOUA 2QLYA 4G7EB 4NASA 3GLCA 4GABA 1JCLA 1DJGA 2ZRUA 3KRZA 5T9BG 3BJSA 4IWWA 5A6LA 3BLDA 2F38A 1AH0A 1UZ4A 1GVEA 4RZ5A 1P1MA 2DV0A 1JCTA 5A8PA 1FVPA 3LYEA 2J9ZA 1PZ3A 3UZYA 1A5NC 2IPJA 4O14A 1UKSA 2AKZA 1ESWA 1FWNA 4HD5A 2BLEA 1UB3A 3CPGA 3CZEA 4CD7A 1NIUA 1XYLA 1Z41A 4UTWC 1C7TA 3OEXA 3VKBA 3CT2A 3CZGA 2IPFA 3S6TA 4L4OA 4I6VA 3N2XA 2F6KA 3WBEA 1IIGA 5CPTA 4N02A 3GD6A 3CAQA 3AWNA 4Y9AA 1BSLA 4CCCA 3EOOA 5EY5A 2HISA 3O0FA 4EXAA 3QY7A 3A3WA 3VMPA 3ME3A 2FB2A 1T6MA 3R25A 1PKMA 3GYCA 2QUVA 4EIVA 5AC5A 1W2PA 3U3HA 3H2MA 3DHDA 4ZB2A 2BS9A 3LG3A 3CB8A 3KBSA 1FP9A 3L26A 1TV7A 4PMRA 2OQYA 5HJLA 5LSMA 3IJLA 4J3UA 1RAKA 4YMZA 4LU0A 2PWDA 3A5FA 1VCGA 4QIUA 2GSHA 2GGHA 2DQWA 3OLEA 4TXEA 3RRAA 2VEGA 3EX1A 3NWRA 3KFTA 2A3CA 3G1YA 3TQVA 1JCYA 1OC5A 1JGIA 2ABAA 2DSUA 4GGBA 3WDRA 1NFPA 1K4GA 2O4MA 1K1DA 3QF0A 1H5YA 4PMZA 2FZDA 3GVGA 4BQ3A 3UYIA 5A8OA 3GDLA 5T9CE 1A0EA 1M7XA 2JE5A 3R13A 4AEFA 2OSYA 3W87A 2WVVA 1XRFA 1Z6KA 3BQ6A 4C6QA 4B9YA 1F8MA 1VBHA 5H2ZA 4X3ZA 3TN3A 3QLLA 4AZBA 4PMQA 5C55A 5G4HC 2VTFA 1CXWA 1FWIC 4GMEA 4PUJA 4AD0A 2J77A 3DI0A 3UQNA 5I06A 2QCMA 1JDAA 1UD8A 1B3ZA 1PZ0A 5EMLA 3GTNA 1MZRA 2G3IA 1T5AA 2BOGX 2P3ZA 3SY5A 4US6A 4XTIA 4OKDA 4AIUA 3PPCA 1M5WA 4OIFA 2A3AA 4P7RA 1DE6A 3TROA 4AEOA 2SFPA 1GOWA 3KS6A 1YQ2A 4L65A 1O1HA 1GVOA 1R38A 3H2FA 4H8UA 1Q8AA 1QT1A 3G0XA 1EHAA 2VR4A 2YSWA 4J4KA 3OPSA 3BAIA 3HOJA 1JPIA 2VYOA 4H2HA 2ZTKA 4JFVA 3TH6A 2X1IA 2ZDSA 3ZSTA 2VCBA 1MMFA 3WF4A 3SN0A 2NVDA 4CCDA 2PDMA 1EWDA 1QW7A 4IQEA 2QVNA 4YVVA 1UR3M 1E4MM 2YBVA 4L9YA 3HG5A 2MANA 3B0UX 3GXPA 4L4LA 3GM8A 4J27A 4A3RA 4KFPA 5HQLA 5DEZA 1PDYA 3HGSA 1MFVA 4Q4PA 3NZQA 5M5DA 2X2YA 2PDGA 2WWCA 4RE4A 1ZAJA 4MFDA 3TYAA 2VD9A 2VDHA 5I7GA 4D6JA 2IXVA 5FOOA 4KGJA 2QCFA 1H61A 3EX4A 4GCXA 2BTMA 3SCPA 4KW2A 2W61A 2GQ9A 3SDOA 2A3LA 1JXJA 4E3VA 4EPBC 3L4UA 2D2JA 3DFTA 2Y5EA 1QBBA 1TREA 4NZCA 2ZYFA 1H62A 4RDWA 4PBFA 1ISVA 1W5MA 2BX7A 3NQAA 4IG2B 4HOWA 4E8DA 2PWUA 4UTFA 4J7RA 3G77A 4JTQA 2AAMA 2DIJA 4GK8A 1CEOA 1GT8A 2EF9A 2XIMA 2Z1KA 5E0KA 2YL6A 2WAGA 3ARWA 5BOOA 4HJFA 3NXFA 4GO8A 4EK7A 1CXLA 1PCKA 1EQPA 3L4XA 3V16A 4GX8A 4FOKA 5KTLA 4ZE4A 5H8MA 1P0NA 1H5VA 3M5VA 4DBEA 4UIOA 1JG9A 5CZKA 4EP8C 1K8YA 3ITXA 1Q45A 4M7TA 4IL2A 1A4MA 1SJAA 2OO6A 3DOPA 4IMGA 3WH7A 1HJSA 1NU5A 5BXRA 3REQB 3STGA 1TWWA 1OGBA 4JIHA 3T7VA 1FUYA 2BHZA 2CETA 4UQEA 2WZTA 1NELA 2FFIA 2OOGA 1L6SA 2BP1A 1YXDA 2QJIA 4O57A 3L12A 2DP3A 1TRDA 2WC3A 3WDQA 2Z00A 1V6TA 1FFRA 2BGNE 4Q8TA 3B3DA 2CESA 4UTTC 3THQA 5IBXA 1JUBA 2Y7DA 4HMCA 1AW1A 4Q8NA 1N8WA 2WJEA 1XLHA 3PJUA 4IISA 3W26A 4JNYA 1C90A 4GJ1A 1ZS2A 2Z2UA 3PPHA 1XISA 1BSIA 2PP0A 2RAGA 3FSTA 3GSMA 3UJEA 5FAJA 1W54A 3PANA 3E1F1 3PJTA 1M53A 1EC9A 4C7GA 1OFDA 3K46A 2NSOA 2XFWA 2C1GA 3QVQA 2PODA 1IGWA 6CGTA 4R27A 2IQTA 3BK0A 3M64A 3SN4A 3BMXA 5D02A 3KCJA 2EKGA 1DTUA 1UR4A 3KOWA 3ECQA 5HUPA 2AL2B 1O94A 1FKWA 5I3KA 1J0JA 3CJPA 5I3FA 5REQA 1IEIA 1EO5A 1TG7A 5LGXA 3VDCA 4MAVA 1TZ9A 5AOUA 4HPHA 1SSGA 1MZHA 3AYVA 2HS6A 3RILA 3SURA 5C70A 3BAYA 4IJRA 2Y2MA 4CNTA 3JU2A 3MSGA 1J8VA 4D8LA 2E5DA 4P8XA 4C6NA 4MAZA 2PRLA 3AZSA 1KM4A 2HPIA 4H9UA 1BG9A 1CGTA 2B4GA 3OYXA 3S6DA 1VPQA 4WDUA 1UWRA 4LCRA 3T4WA 2E1WA 2GL5A 5FEZA 2WHLA 3QSRA 3SUTA 3NTYA 3EX6A 3MSDA 2DZSA 2FIQA 3CUGA 3M0VA 1QR7A 3EKZA 4I9AA 3FHAA 4IUOA 5F4XA 3V0UA 4F79A 3ZJKA 3E38A 3UNDA 3T08A 1OT1A 1Q2SA 3AYRA 1VB9A 3TP4A 1I75A 1TB3A 4GOAA 4MOZA 4AZ7A 2RH9A 2V2DA 2CLIA 2YL5A 9CGTA 4FOJA 1JQXA 1VBJA 2XN1A 4IGSA 2NX1A 3URBA 4H7ZA 1KKOA 3MUY1 3POCA 4C6CA 1XGEA 4MY8A 4Q4SA 1MQPA 1CLVA 4HK7A 5ABFA 1MWOA 1IEVA 1QU4A 3HGOA 3OO2A 4FNPA 5C9WA 2I16A 3C3UA 1TA3A 3P5ZA 2Y8UA 3TYZA 1Q6OA 3UGRA 3TNBA 4EF8A 2XISA 5DMLA 2Q8ZA 1X96A 2RHGA 3ZS4A 3RDKA 4C6IA 1K3UA 1QTWA 3N13A 1EX1A 1MUCA 1ITXA 2O7QA 4ZO8A 2VC9A 1OC7A 3FKKA 3E2QA 4UQCA 2V5CA 1EJWC 1E73M 3S9IA 1BF2A 2V30A 4DIAA 4W8AA 3EKGA 4Z2HA 1CGYA 2DVTA 4OOZA 2WPGA 4KGLA 1LUCB 4D6GA 4Z2JA 3V36A 1HKVA 1B9ZA 5HAOA 1S5MA 3DG6A 2DZWA 1RQEA 1LL7A 1WA3A 3TW9A 2XH2A 1CX9A 4GNVA 2VFDA 5FESA 1YE4A 2XHYA 4IJFA 3T0DA 1F76A 1RA0A 2UY5A 1LBLA 4WY0B 3HBLA 2IMRA 3L23A 4US5D 1P0KA 3IIOA 4H8VA 4X61A 3O3RA 3VCCA 1HJUA 1HP5A 1DWGM 3JZEA 1X8FA 4WHBA 2DZUA 4IBKA 2H9AA 3W22A 3PNZA 3EWXA 2V9DA 1XFBA 3R10A 4A8RA 4DJFA 2QV4A 3R58A 2CHNA 2HXTA 1C8VA 1Y5WA 1XD0A 2D1ZA 1R3TA 4HMDA 2V38A 2E28A 3I4EA 4E2VA 2F6UA 2F84A 2E25A 1HGWA 2EXOA 1IT0A 3FDKA 3VX0A 4AVFA 1WP6A 2Q8LA 4OJLA 3KRUA 3W01A 2GLKA 1KFEA 3W1LA 2EHHA 3H24A 1W5OA 3WLKX 1PEZA 3A21A 3TTSA 2QIWA 1EZ2A 2FPTA 5E5CA 3D5HA 1M04A 2F9RA 3L4VA 1OABA 2P53A 1YYAA 3G3DA 2OKOA 4ILSA 4W7WA 4IHCA 3LY0A 4PUEA 4FA3A 3WQ8A 1KLYA 4DYKA 4JYDA 1FXPA 3WNPA 1ONEA 1SPQA 2ZXQA 5EYWA 3C0QA 1R85A 4YWSA 5BU9A 2YA1A 3SI9A 5JXQA 3LM7A 1H49A 1KFWA 1NQ6A 2YDRA 3P14A 5E09A 3W1TA 5D2VA 3R94A 3ZMRA 2YL8A 2HV5A 1BYCA 3TVAA 1OX4A 4PZVA 3AIRA 2RDWA 3C4UA 2XWDA 4J5NA 3VGEA 3KOZA 1KBBA 3HFTA 4DLFA 1CNVA 1FWJC 2Z1BA 1VLIA 4HQVA 4ZB0A 4O1DA 3A3XA 3AU2A 1I2OA 2PP3A 4IGHA 3NVTA 4ZOEA 4C1KA 5ABTA 2VR5A 3O07A 4NQ1A 4QNWA 3GNOA 3F2DA 1W1A1 2EG8A 1NOUA 4N9EA 1TE1A 3CASA 1XBYA 4HZ7A 1QNPA 4WRHA 3T05A 1SFTA 2ZZ5A 3G1RA 3TW7A 1R47A 2D0HA 1Q65A 1FBAA 3ARXA 3OHMB 2R82A 2QYGA 3S3GA 3UXDA 3LBCA 4AYSA 1UD5A 3RRXA 1EUAA 3GBEA 3DGBA 3VDBA 4I9JA 3VIGA 3S2NA 4OBTA 1WUFA 3LRLA 5K9CA 1X39A 3FAWA 3UW6A 2YKKA 3NZRA 2D73A 5GQBA 3MC5A 3W71A 2QUTA 3KL0A 1EUNA 4FIRA 4HZMA 1OC6A 1XCWA 1L6GA 4FNTA 3A9BA 3P5YA 3KAOA 1PZ1A 1JZ8A 3VNKA 4RXFA 3EX3A 1OGGA 3G5EA 4GYJA 3O6AA 1G7UA 4Z08A 4XTDA 3V5CA 2FTYA 2E9LA 2Z29A 4A2SA 1QNQA 1KWGA 5A69A 3LENA 1A49A 3W25A 2OELA 4LC8A 1XINA 5C9ZA 3I6EA 4I7UA 1M7JA 1YDOA 5F4SA 4G8TA 3SCUA 3M4HA 4U28A 3SCQA 4ZXLA 2ZUNA 1WDSA 2WKJA 3ZZ1A 1E70M 1PAMA 4A2RA 1LQAA 1M3UA 3GXIA 4W87A 3FDGA 1QOQA 2C6QA 4LBUA 3BGAA 3O6YX 1W3HA 2HK1A 3ARTA 5BMWA 1B3YA 2HVMA 2QIIA 3TIMA 1HUVA 2VFIA 3WJSA 3UR5A 3MCNA 1VFLA 4OWGA 4YHGA 3IUHA 1PKYA 3QOKA 4PTXA 5DCDA 3NL5A 1UG6A 1W5PA 2W62A 1GVFA 3P2VA 3UCDA 1W1TA 2WOQA 4UTMA 3FKRA 5LNWA 1QOXA 4QEEA 3RCYA 1MYRA 3STCA 2V69A 1O12A 3UJ2A 4JX6A 3UETA 4KEMA 3G8RA 2J7GA 4LFYA 3PG9A 1GQLA 2G3JA 4JTLA 3KM8A 4AZCB 3WQGA 4MLJA 4QEHA 3OBKA 3LPOA 4DJED 4Z2KA 4HA0A 3RMEA 4LV4A 2VOMA 4L64A 1CPUA 2NV9A 1CXFA 3PWAA 3E0VA 3F5JA 3SFWA 1FHLA 1PYMA 4W5UA 1BYBA 3AS0A 1HKMA 3BV7A 2B7QA 4X60A 1CGUA 3CLMA 4V1XA 4Q8UA 3SCRA 3S2CA 4FNQA 3GB6A 1ZY9A 4PUUA 4R3UA 1KR1A 4RNFA 2CLPA 3AO0A 1G69A 1PDCA 3HV8A 3H70A 3SUUA 3E2RA 4LRSA 4O8RA 3PC0A 3PZ9A 1GQJA 4RZBA 3H6OA 2OT0A 2XIQA 4ROQA 5HJXA 2EJ1A 3CS2A 1AZ2A 1C91A 3B9NA 2X16A 3I6RA 3P93A 3M0ZA 3PF3A 1B57A 3KCLA 1R2RA 2WM0A 3EMZA 3P60A 1H4PA 4H7CA 5AYYA 2ZX6A 1BXBA 3C8NA 4GUFA 2ANUA 1UW9A 3FX4A 3BOFA 2Y5SA 2GOUA 2OR2A 1JUKA 4BQ4A 1WE5A 3QN3A 1J5SA 1HL2A 2OT1A 4PB5A 5K9DA 1HN1A 5BROA 2RGLA 2YZRA 1BXCA 1NF7A 1E5JA 1K9TA 3LS9A 2TODA 5I3DA 1JI1A 3IUDA 5C7HA 1ITUA 2V2HA 1JCNA 1M7PA 3NSMA 4MKSA 3T1GA 5BYWA 3VUSA 3LXCA 2ZOXA 2J62A 1X6LA 3KVJA 3I7SA 2OU4A 4PTWA 1ENUA 3M1ZA 3KS8A 1TVNA 2PDWA 3WBYA 4RE2A 5LZLA 1FWFC 4Z1YA 2E5CA 1NF0A 1E15A 2DDXA 3WQDA 1RLDA 3CL6A 4UR7A 1V3LA 1GONA 4PMOA 4M6PA 1LRNA 2W4XA 4FEZA 1EGVA 1EQCA 1KRMA 4ZOAA 3J7HA 3N73A 1E8BA 1SR0A 4B4FA 4GBUA 2JQXA 3W37A 9XIAA 4MY9A 3NUKA 3GH4A 3WH6A 4QAWA 4CU8A 4NVTA 3O05A 2PI6A 2EPHA 2NQ9A 4OBRA 1TV4A 2XZ7A 2ZX7A 1XYBA 1QHOA 1BQGA 2WVVB 4YCOA 1EBHA 3SRHA 1FWHC 3UXIA 1BYDA 1OCJA 3EOLA 4UXDA 4AY1A 5GNXA 1IT7A 3CAVA 6A3HA 4BI7A 3SRKA 1DPMA 4MM1A 3RLVA 5HXMA 2V5OA 3W6LA 3R0UA 2X1SA 3N4AA 4HHMA 3OLIA 3MO7A 6TIMA 1GQNA 3IIPA 5HNTA 1FH9A 3UBPC 4JTSA 4H6EA 5BOEA 2V67A 2XN0A 2DVUA 2EQDA 4HNNA 3RPDA 3LTPA 1YNYA 3VVGA 4XBKA 3I3DA 1GVSA 5I79A 2QXWA 4I6KA 2VEPA 2Z6JA 4XSLA 3ITLA 5HWMA 4RCXA 2DW7A 2HPMA 2VUNA 3G1VA 3JZUA 2ZUMA 4LQ1A 1X97A 4LV9A 3CYJA 5CH9A 2TMDA 5EMMA 3RITA 4AISA 3ERPA 4WSHA 4EX4A 3STEA 1XKJA 4GJIA 4Q8VA 4DPQA 4MJ4A 2WMHA 2E9BA 3PZTA 4D2JA 1L0PA 3WBXA 1QPKA 4OJYA 1R9ZA 3FA5A 4TU1A 3ICJA 4CNUA 2C1HA 3VIHA 3S1UA 1SM9A 3QMSA 2REQA 1AH4A 2FHFA 2X0HA 2PDUA 1XIBA 3DU0A 5GJNA 3B0VC 3EWDA 4IPJA 4PODA 1L6WA 3H21A 4IQLA 4XUYA 4DY1A 1TR9A 3EDJA 1E4IA 3SCTA 3WLPA 5G4EA 1RY0A 2VCCA 2OODA 2B81A 4RK8A 3AXIA 1VENA 1KM5A 5I03A 3DH7A 4O19A 3BLKA 1J7MA 3OVGA 2Y62A 4MKVA 4IBBA 4DO4A 2HEJA 3IAQA 3LLXA 4HA1A 1VQTA 4GVHA 4K7VA 5GJPA 4XAFA 4Q4QA 3ARQA 3GVRA 3AZTA 4Y8EA 5IDIA 2HZGA 4BHYA 2H90A 2X30A 2XH7A 4FAMA 3V4BA 2ISVA 1XLLA 2QVHA 5CAKA 3O15A 1UQZA 4UFKA 4AF0A 2CIPA 1NSJA 1U1HA 4ZENA 1F4AA 3OA3A 2VC7A 1GKRA 3LXAA 3W6YA 2E67A 1RUSA 3T9PA 2ZZ6A 4Q7NA 1XV8A 1L8NA 4MF4A 3QMTA 2DZBA 4ORMA 4ES4A 1WAWA 4TMBA 3ZJ8A 3HJEA 1E1EA 4HU4A 2GVLA 3F4CA 2H8XA 1VRXA 3EEZA 3FV9A 3B4UA 1UR1A 3R0KA 5M17A 1N82A 1TPVA 4XZHA 1AMYA 2PDBA 4RPQA 4NXKA 1BD0A 1SZNA 3CT7A 2OYLA 1AQFA 3VGHA 3FVMA 3AIQA 4ZB5A 1O68A 3GH7A 1EPXA 3CMJA 5T26A 4DBDA 2CXGA 1IR2A 4HTYA 3E74A 4JFTA 3NQ6A 3OOQA 4K37A 5G4WA 1TPFA 1G01A 3T2QA 1A5UA 3DC0A 1GJPA 3NYDA 4RUBA 3THDA 1K8CA 4HNTA 2QQ6A 1I9CB 3ITCA 3UG5A 3UESA 1TPUA 1GCYA 1VIZA 1GK8A 3BCDA 4Z2IA 3C0SA 2D3NA 2WKGA 2ATMA 1KFBA 5ECUA 4KWWA 3JS3A 4XD3A 4XD4A 4HU0A 4GC4A 3R8GA 2PTYA 3I7RA 1V08A 3HN3A 5AHIA 4CNNA 3WNMA 4FS9A 4HCLA 4N2YA 4WJEA 1HJXA 2ZADA 1XYMA 3LGEA 3MB9A 3ORWA 4UTTA 3K4WA 1I2QA 2CHOA 1XBZA 2VOTA 5REQB 1WPCA 3TK7A 5D09A 3B8SA 3FEQA 2VX5A 2QDHA 3G18A 4ZO9A 3GHRA 4NRRA 2NVCA 7ENLA 4ICCX 2F8QA 2IQ0A 3GAKA 4B16A 3GIPA 3ONBA 3DGRA 1EKOA 4LNCA 3N34A 1CTNA 1I2PA 1VEMA 1H7OA 1GQKA 1AFSA 4JIRA 4NP7A 4F0SA 3U0HA 4NHVA 4W7UA 3WFZA 5U7SA 4PE8A 4CD6A 1YU0A 1AD4A 3ABSA 1LG2A 4JS3A 2GVJA 3EKLA 1SO6A 3KZSA 2I5GA 2A3EA 2GJXA 4K68A 1JVNA 4GNJA 4RE3A 4M5PA 3GC5A 2GQAA 4NJIA 4P8WA 4QJ3B 1NWTA 3WJWA 5D05A 5DANA 3WK0A 5RUBA 3W7LA 5BRPA 4F66A 3FK4A 3A12A 1R0MA 1MW2A 3WQ6A 1IXOA 1GEQA 4GX9A 1OYBA 2P1FA 1S2WA 1UBPC 4Z2GA 4NSBA 1MNSA 2GGGA 1PZ2A 4XK2A 4FPSA 1NDZA 2WBGA 2ZE0A 1GVQA 2UBPC 2FYMA 1OCNA 4M6QA 2W5FA 3W7KA 2FJUB 2VGIA 1W0MA 3GXFA 5PTDA 4I3GA 3BVJA 2VM8A 5B80A 5ABFB 1TQJA 1EJTC 4DWDA 5LKYA 5C2GA 4MDOA 1YNPA 2EGZA 3AS1A 4DAIA 3R43A 5IRPA 2PTDA 3GU1A 1TJ1A 3W7MA 5KZEA 4K38A 4GZ7A 1GKQA 4I5UA 1TA3B 3BSMA 1W9VA 2YR1A 5EU9A 1KFLA 4I7VA 1KGWA 1P6WA 3UA4A 4YVPA 4JQ3A 4O1BA 3CIVA 3CUJA 2HE8A 2XSXA 5LXXA 1DJIA 3DFQA 4P8UA 1S3TC 1IXNA 3GHUA 2D24A 2G41A 4FHAA 4YPJA 4QLKA 1DJXA 4XO7A 4CD8A 3W88A 2PZ0A 1PTDA 2GUUA 4S23A 4F8XA 4YTTA 3URQA 1XRTA 3CWHA 4I8DA 4X2RA 3INPA 5DMNA 1Q7QA 4ZSTA 1KXQA 4IX2A 3AIBA 4S3AA 2QUNA 1FKXA 2R1LA 4RV3A 4YCPA 4ZGYA 4FALA 1H7NA 1LCOA 1XUUA 4U10A 2R1PA 2XINA 1SFLA 2GWGA 2J9XA 3SFKA 4LAOA 3QW3A 5C9RA 2QEZA 4C1LA 4PSPA 2DT2A 4H6KA 1GTHA 4DM2A 5E0FA 4PMDA 3I65A 2D69A 4QNEA 4TIMA 3VKDA 3MP5A 4JIIX 2G4FA 1R30A 2ZCGA 4IMAA 3MWCA 2Q8XA 4UNKA 1BLIA 3DG3A 4GQGA 4ZR8A 3W86A 5CG0A 4CNOA 1MRAA 1XH0A 2FDSA 3GVQA 2GGIA 2Y0FA 1VBGA 4TVUA 3WQCA 1A5SA 5G1MA 1VBRA 2QR6A 3NEVA 3SECA 2Z24A 3C5QA 1XYZA 4KCWA 1TWDA 1L6YA 3KWXA 4AXKA 5D9MA 3KXQA 1VFHA 4YL2A 1JI2A 1TTJA 2HK0A 5G2IA 3EB4A 3GTIA 4WSKA 2JE8A 3ARPA 3SY8A 5IXEA 1TMHA 2FH8A 3EWCA 2OWCA 4ZO7A 3B40A 3AMGA 1F2JA 4LSBA 2VZSA 1TX2A 4N4PA 3HQOA 4NKCA 3UD6A 3ZIZA 4WD0A 2QZRA 4DVOA 5CJNA 1QAPA 4JTGA 2QPSA 3PZVA 4KEUA 2HROA 1CIUA 2QAFA 3DYMA 1W8SA 2PTZA 2R14A 5HQEA 1KGUA 2DU2A 2P3EA 4WGHA 1LQ2A 1OQFA 3OLGA 2FZMA 3MCMA 2H3BA 1Q6GA 3DHFA 3B05A 2D3LA 2EAWA 1ADSA 3M5ZA 4QAIA 2VFFA 5C0QA 3ZR4A 2INFA 5A8MA 4HNOA 3MYOA 3GIYA 2NQJA 3C56A 3MUIA 4HN4A 4ERAA 5JQ9A 3OZYA 1IYXA 4PCSA 1W3KA 3IEBA 4GISA 1J0IA 3TYEA 1CI1A 1UMYA 5F7UA 3WD2A 3IAPA 1J79A 3AFBA 2VJXA 1GOMA 3W73A 3FW6A 3TLLA 3S0CA 4B3KA 1V77A 3MQTA 2JIWA 4ZEPA 4AUBA 2Y5JA 4PH6A 4FMVA 4GBDA 3TNOA 5H6HA 2NXHA 4MSSA 1O5KA 1HKIA 7CGTA 1XUZA 3V18A 1P1XA 2BHUA 4GI9A 5KEZA 1GZGA 1GHSA 3LV6A 3ITYA 3MKCA 1EWEA 3T81A 1G4EA 3PUOA 4ZSUA 3WFAA 4QISA 3WL0A 4H8NA 4L56A 4GVFA 1B30A 1ECEA 4MKNA 3C2EA 2PDIA 4TUFA 1BKSA 3LLFA 1LP6A 2ZUSA 1IZJA 8TIMA 1VFUA 3WN6A 3GFYA 3WBAA 3EDFA 2HVOA 1DJNA 1UIOA 1KTCA 5A6BA 3R4IA 3CHEA 2WJFA 2XVPA 3PVFA 3F2BA 3G6MA 4J2MA 4DXXA 4FO4A 4OOUA 3VNIA 1BTMA 4AD2A 3AXKA 3DFNA 5JIWA 2ACUA 2ZZ7A 3QGVA 5I3GA 1E88A 1KFCA 4UQBA 1OADA 3DCPA 3WF1A 2XTKA 2XWEA 1KXTA 4QR6A 2XGBA 2ALRA 3SEPA 4LUJA 4MNLA 2HRWA 1Z32X 5I5RA 1V03A 2YOCA 3HPAA 2AGTA 3GG8A 4H6RA 5FSEC 2PF0A 3GNNA 1LOLA 1HVQA 4NU7A 4QG8A 4KCTA 2J6VA 4G5DA 2ZWYA 1EHNA 1B3VA 3AU6A 5FD0A 2G97A 4WSJA 5CJ5A 1MW3A 3BQ5A 4CU7A 4LS2A 4DM1A 3LHTA 3LHWA 3R5EA 3DECA 1YUEA 1H1YA 4JCLA 2YFOA 4FXFA 2E6AA 5K9XA 2Q3OA 2IUZA 3ANYA 1O6IA 5E9XA 2ODOA 2WMJA 3FA3A 1PL9A 4O1EA 1W5QA 2WSYA 3CQHA 3IGUA 1LWHA 5M03A 4S3FA 5AHEA 4D6IA 3O63A 3BSHA 3K8KA 1RVKA 3BW3A 3RLGA 4D6EA 3PY2A 1FXQA 1ALDA 3VE7A 3L4TA 2J7HA 1X7FA 2HBVA 2I57A 3QYQA 1KTNA 3K8MA 3IJDA 4M82A 4M3PA 2F7FA 3ARUA 5A2CA 4AIEA 3IV3A 3N29A 1WXJA 4PCFA 3ANUA 3PTKA 5HUOA 4NNCA 3PB2A 3B8WA 4OZOA 3NQCA 3W7JA 2O7SA 1GVRA 3GXMA 1TPC1 2QPUA 1RV8A 3L9CA 1EPVA 3F03K 1O95A 3WQVA 4QCEA 1K8ZA 1I1XA 1EJXC 1QMLA 2J8FA 2WQDA 4OECA 1HP4A 3DEQA 4L4MA 4LUYA 4ECLA 4NF7A 1GHRA 4PB4A 4LUIA 2CBVA 4H8HA 1UH3A 5KZDA 4GLEA 2NLIA 3CWNA 1N2VA 1U22A 1ZL1A 4FP1A 1MUMA 1RP9A 3LOTA 2EKCA 2WO5A 3O8AA 2QDEA 3VNLA 1GTEA 3NAVA 2E6DA 1WB0A 4DB7A 2AQWA 3NM3A 4PTMA 4Y90A 3CAKA 3PR2A 2IKGA 3CIWA 1HIZA 1DHPA 3HM7A 5DN1A 1EJVC 2W9MA 4JHMA 2VFGA 4WJXA 3PTQA 4ADUA 3WEZA 2XYLA 4LCQA 3IGXA 1ISXA 1E5NA 5IFTA 4GC3A 1XL9A 4U33A 2ZZ2A 8XIMA 3GIQA 1OD8A 1SR9A 1R3YA 2VXNA 5HULA 2NQ5A 6PTDA 3VD9A 1V6WA 2YYUA 2QULA 2Y70A 1Q63A 5D37A 1H1ZA 2WMIA 4K3ZA 2OZ0A 4YLWA 4LH8A 1RR2A 1K03A 1MEWA 2C18A 1MNZA 3RNDA 2Z7KA 4ZTYA 2CWXA 4R85A 3CZ8A 4RNIA 3CV1A 1EP3A 3KHJA 4LAZA 4PCPA 4AW7A 1AZ1A 4IIEA 1CECA 1UKTA 1E6PA 1B0IA 4ML9A 1EA9C 1F4HA 5LIYX 1IWAA 2ZUTA 1AK5A 4OJPA 3CH9A 5CBJA 1BG4A 5KITA 2BY2A 3A24A 1UQYA 4MNJA 5DCBA 1KCZA 1S5VA 4IBIA 4IJEA 2O9OA 1TPB1 3GW3A 2YXGA 5MHBA 3OZOA 4MTVA 4CN4A 4D6FA 1FHUA 2Z7GA 7TAAA 2QJMA 4DNMA 2ALDA 1V3IA 5CLTA 1GPWA 3DC8A 4JY8A 3CM4A 5FACA 3N6JA 3PAOA 3IARA 2Y4SA 2QCHA 4NRSA 4JQ4A 4QGCA 3BAXA 2ACSA 1RSCA 1JYVA 1BGGA 3G1XA 1K8XA 1UH2A 2J6XA 4AU0A 1F6PA 4PC8A 1P0DA 1C8XA 3VGGA 2ESCA 5CKSA 3QPYA 4UTKA 1HO1A 5AB3A 4S3GA 5XIMA 5CC7A 4B5XA 1TVLA 5JIPA 5BMXA 1J6PA 2CZFA 3VX1A 1Q8JA 3B0XA 2BBFA 3VGBA 1R2SA 4OBSA 5IOBA 3UERA 5LXEA 2PDHA 3TOYA 3GUWA 5CCZA 3OP2A 1AJ0A 1CLXA 3TC3A 4B15A 3EMCA 3W2UA 1TV5A 2I1OA 2OMAA 4J40A 2EPNA 1QPRA 2QNEA 3TXZA 4QTGA 1CW2A 4XZMX 4HA3A 4M56A 1NWRA 3B8TA 3DERA 2BODX 4A29A 3W53A 2A7PA 1E51A 1EDTA 2PDJA 3SJ3A 4R5EA 4N0RA 4H04A 2VWTA 4Q4MA 2VDIA 4DBWA 1H7PA 5AY7A 1YU1A 3KBWA 3TYCA 1FWWA 3SCNA 1RH9A 2E68A 4AIOA 1U1JA 2REQB 3DG7A 4C6OA 2RFGA 4D6CA 2O92A 3GH5A 4XZNX 1YNQA 4FR6A 1YE6A 1V3HA 5EMJA 4DHGA 2VP8A 3BC9A 1NWSA 3S2LA 4KF1A 1ISZA 1RY8A 3HQ1A 3LCXA 1A80A 1WDRA 1K6AA 3M0KA 4Q8MA 3BLIA 3HB9A 4C6KA 4Q4OA 3ISIX 1AODA 1GZJA 1BVNP 2Z1XA 1JNEA 2PURA 1OK6A 2VQTA 2Y7FA 4AD5A 5BWFA 2D2GA 1THFD 4QCFA 3IK4A 3NQMA 1RK6A 5L6UA 4AD1A 3QLDA 2AAAA 2PCEA 3W7IA 3NSNA 3RMJA 3CUFA 2Z27A 1E40A 2WCSA 3M7PA 1DVJA 2OXNA 3P82A 4QP0A 1VD6A 1RP8A 1W3IA 4WLCA 5LYRA 4CQAA 1RZMA 3MDWA 3T6CA 3A9IA 1Z42A 4L6HA 5HOSA 1S2VA 4KWOA 4FXRA 3U7BA 3PM6A 4DJDA 4S3DA 4PEKA 5I02A 4O12A 4E6MA 4KRZA 1LUCA 1SZRA 3R2GA 2J47A 4CVUA 1MXSA 1GOQA 2W6RA 2ZXBA 4E2BA 1E4LA 1UD4A 1DBTA 3H2CA 2AGKA 3U6WA 1EDQA 4NUWA 4P7NA 2WSKA 2FVKA 2WC7A 1TUXA 1ME9A 3O7UA 3N2CA 3BWWA 3S47A 1TWZA 1TV3A 2YA2A 4AVOA 2ZVIA 3ZO9A 4O15A 1WKFA 2XFRA 2J79A 1SVDA 1ZZMA 2XIJA 4S3JA 5A6KA 2R6OA 3BARA 1A0CA 3H55A 3PP7A 4L1XA 4MWAE 1TMLA 2CW6A 3DHUA 2DQXA 1XC4A 3JR2A 4GUJA 5JBFA 4V28A 3L29A 3QC3A 2VMFA 1V79A 4D8AA 3WCZA 3R89A 4IIDA 1ZALA 4L7ZA 4GACA 3ZFHA 3F7JA 2A5HA 5BRQA 4RLIA 2R91A 3PB0A 4FLOA 3VO0A 1YEYA 5SWUA 1M01A 1E55A 3TYDA 4MADA 2I56A 3R7MA 1OM0A 4KS0A 4I90A 2ZKMX 2BVWA 3I7QA 3MKKA 1FHDA 3RM9A 2WHMA 4EWND 3PN8A 2VDGA 5CSYA 4BFAA 4BJHA 2Z6IA 3NFUA 3BG9A 3SO7A 3MTWA 5U4NA 3UA3A 5KZMA 1M41A 4W88A 2OLHA 1VP5A 1J96A 1X1OA 2PGEA 3RM8A 4C6MA 4AHPA 2X09A 5CPLA 4B5TA 4HU8A 3H2AA 1W1YA 4M80A 4IICA 3TU9A 1K6WA 5D8WA 2ZICA 3IANA 2CERA 3G2GA 1OYCA 2PLJA 3PWGA 1U83A 2Y2IA 3UU0A 4Z1BA 1POKA 2R9RA 1QK0A 3NQ8A 4JY9A 2DIEA 1B4KA 3NPWA 3AMDA 2WZHA 5DRCA 2GJXB 2NUWA 2VFHA 3SUVA 4NY2A 4D8ZA 2H6RA 3QHMA 4BQ5A 1L8PA 1BXNA 1XLGA 2JKEA 2J75A 5CC6A 4QJ4B 1JZ7A 3TKFA 2G5WA 5I23A 1CBGA 3WQEA 5CLWA 3HA1A 2WXDM 2NW0A 2XGIA 3T2PA 1BTCA 3T09A 4IBEA 4H9XA 3UWEA 4N4QA 2X1TA 3BAKA 4N42A 2Y2JA 5A6MA 1QI3A 3UWYA 3GDBA 2IQDA 4AXNA 1KR0A 1V7AA 4YTSA 4EPEC 2QT3A 4L4PA 1ZJBA 4QLJA 1FTXA 4RL3A 1TV8A 4H83A 4PMUA 5H8UA 2OKTA 1UR0A 2TRSA 4GA8A 1EIXA 4KWVA 3QJAA 1OT2A 3W72A 4JTIA 1MEIA 4O11A 4P2VA 5A6SA 2CBUA 3GNRA 1PE1A 3CH0A 3PJWA 1WDDA 2ZA3A 3VIOA 4HHLA 1XLFA 1LWJA 1BYAA 3JRKA 3W81A 3GTFA 3AROA 2INZA 1XLMA 2X0YA 4CN1A 2DGAA 1H41A 1OINA 2HVNA 4N6FA 1YDNA 3OG2A 3S9ZA 2GWNA 3M6YA 3GU9A 2PDPA 1W31A 4CQBA 3TTQA 4H6QA 1F05A 3RLUA 4DF0A 5FJTA 4MIMA 7REQA 3TN6A 3AALA 3IIZA 4JHZA 3M43A 1VCVA 3RX3A 3NOYA 1JEZA 3P3BA 3THUA 3VK5A 2WNNA 2XD1A 3OW1A 4S2CA 4L9XA 1NJJA 4Y8FA 1YIXA 4UZUA 3S83A 3B8IA 4EAMA 2ZDRA 4NG3A 4P5UA 4QDPA 1JUEA 1VFFA 3LI1A 1RPXA 1Y0EA 2PSNA 3ZQ9A 1O1ZA 2PDCA 4JTAA 3WZ0E 1MFUA 1QW9A 5E6YA 3RUBL 5CZTA 1QBAA 4RNHA 3OJGA 4IXHA 1ZRQA 2VZVA 3NQ7A 4F4RA 2CLKA 4NZ5A 3W74A 4WKFA 2VFEA 3NO5A 2Y2QA 3BCFA 1PV8A 4IZGA 3A4JA 3AWOA 2WNZA 4V15A 2Q3RA 4CD4A 2EBNA 3CHVA 4IBJA 5K4ZA 5FJIA 4HYVA 3OHIA 5M3WA 2VVNA 4KIRA 1UJPA 1EL3A 4R9OA 4ZQMA 4OT7A 3LK6A 1V3MA 4MMWA 4U5IA 2ONEA 1J10A 2A4AA 4JTRA 1Y65A 1B31A 1DQWA 1JPKA 2E8YA 4DLMA 3H7UA 5J5RA 4Q33A 3E5PA 1AJ2A 3MI3A 4H1ZA 1U30A 1VYRA 3QQ0A 1ZBWA 2WNWA 3R1ZA 2O4QA 3DFYA 3STFA 2ZWZA 2AQOA 5CGTA 2Z1WA 3LCFA 3QKEA 2XM1A 5CPQA 2GGEA 4IBFA 5D8ZA 1A5CA 5LGZA 5CG7A 1T0OA 1H51A 4R53A 1NARA 3FSUA 3N6HA 1E0TA 4FX6M 2P76A 3LBMA 3YPIA 1XHGA 4XZBA 1E9ZB 4UNLA 1TRIA 3T0TA 4ERIA 4KEVA 2HCVA 1PIGA 8RUCA 3B03A 1OEPA 3T8LA 3WFLA 2GJLA 4FNRA 3TMLA 1DL3A 3GG1A 4AG0A 1MEHA 5FEXA 4E5TA 3AIVA 1V5XA 2WVUA 4RDYA 4FIQA 1C9DA 4AHOA 1XLKA 1MDRA 2CLEA 2OX4A 3QR0A 5L9FA 4KCUA 2CWNA 1C9WA 2PPGA 3QTGA 3W1RA 4HNUA 5JU6A 3NVDA 4MJMA 1XX1A 1W9UA 1RA5A 1JFXA 1S1PA 2GSJA 3UR8A 1XC6A 3LBOA 3V7PA 1RD5A 4INFA 4P7OA 1VIWA 3BMVA 4C91A 1DTNA 2CPUA 3W7DA 3G1FA 3LU2A 3WLMA 3CZKA 6XIMA 1XI3A 4MWAC 3G1HA 3SJNA 1ITQA 4PRTA 2C0AA 3CC1A 2BOEX 4D72A 1UPPA 2PRMA 4N9CA 2V82A 4BKNA 4DJFD 2NWRA 3IJ6A 3BLLA 2X2GA 1NDWA 1G4SA 2G96A 3V1PA 3LPPA 5E0CA 3TXVA 4PGLA 2C16A 4WEVX 1TZ7A 5AYIA 3ZOAA 1NEYA 3ZLFA 3O2LA 1AQMA 1TTIA 3P0XA 2MNRA 4ZQRA 3Q67A 3E0FA 3SGGA 1G7VA 1ZB5A 1JZ3A 2DH3A 4ZO6A 4B2DA 3VKJA 1BHGA 3PZOA 1E6XM 2J25A 1ZJAA 2C3ZA 4MUZA 3DBPA 3LCWA 4L6OA 4UFIA 5CQ1A 1IXQA 1M6JA 2QCCA 4LJ3A 3TAOA 2XZ9A 3BAJA 3L28A 4F0MA 1A5LC 1XS2A 2V3FA 4XAYA 3B8VA 1F6KA 4BK9A 2VR2A 1AA1B 3L2LA 1ODZA 4UCGA 3LZ3A 1DWJM 3CEUA 3V1HA 3WQWA 1C93A 3LMYA 2PGFA 4QFUA 3EWZA 1SUXA 2YCLA 4MVAA 3STPA 3FIGA 5FJPA 4WX2A 1KFKA 2Y1HA 3SZ8A 3QR1A 3APYA 3ATZA 4PRWA 4K1GA 2CNCA 1DP0A 1L9WA 3SQLA 3WEOA 4IM4A 1XSKA 1I2NA 3XINA 2JEQA 1T8QA 5ABGA 4GHAA 2ZUVA 3HSHA 5HMDA 3MW7A 2WLZA 1QO6A 1R9YA 3E12A 4NZ1A 3S4TA 3AIWA 4B91A 3L7RA 3T55A 1PTAA 2VGBA 1CGVA 2D2HA 4H01A 4JCMA 2VRJA 2WK2A 2Y89A 5DFAA 5I3HA 3VZXA 4IBGA 2Y2NA 4Q7BA 1VEOA 3OGVA 3U2ZA 3VYLA 1P7TA 1W56A 1KNWA 3G6LA 5DY2A 1OK4A 2P5NA 5I78A 3WUEA 4CCEA 1VGAA 2W27A 2HMCA 2CBJA 5AHNA 1POJA 3PZQA 3S5ZA 1XDMA 3B8UA 4UB9A 2JFEX 1G94A 2Z1SA 3W7PA 1FQ0A 1KXHA 4GUIA 3QY8A 4YTUA 4DYJA 1UP0A 2ZUUA 5A2BA 4K36A 3AZRA 3VZZA 4OE7A 5I6SA 3MZNA 4S2BA 2CXEA 4EAYA 4EOUA 3LHZA 3SSJA 5EBUA 3CQJA 1QPNA 3V5OA 1W9XA 1PS9A 1LBFA 2PDXA 2FFFB 5TAOA 3B06A 5CAHA 3GNDA 2PDNA 1WKDA 1NDVA 1S5WA 3PPFA 5BXPA 2VD8A 3BXWA 4PULA 1OJXA 4PUWA 3GS6A 1OWQA 3KOFA 1EP2A 5HPCA 1GGOA 5D04C 1Z89A 3UZXA 4CQ8A 1LJYA 1FY6A 3P6LA 3ANVA 3WF2A 2E1DA 2WCGA 3Q94A 4QSHA 2G3FA 2QKFA 3A4XA 4AHQA 4JIEA 2OEMA 5HJYA 3N3TA 3NCOA 1AIWA 3RX2A 3VC6A 1ZQ5A 3P8JA 1IWPA 3H54A 3ABXA 4IGMA 2WMIB 1XLJA 3B9DA 4P8VA 1JZ6A 3WF3A 1R2TA 1K9FA 2NUXA 2PLCA 4HMNA 1ZP3A 2DPEA 4HNLA 4XKMA 4K8GA 1KA9F 4UTIA 2GUYA 5TD4A 2V3GA 2PWHA 3GVVA 2QJNA 2Y24A 4WXYA 1W32A 2XVLA 3MMUA 1D7FA 3K2GA 2QCLA 4JKMA 4LF1A 2FZNA 1A5MC 1B3XA 1OFEA 1F7BA 4AH7A 3SAZA 3BJTA 3FJ4A 4AMAA 5FJRA 1XBXA 4JD4A 3GUGA 5DXXA 1UWIA 4OQVA 2X7WA 3GNXA 2BY3A 1A47A 3UZZA 4JQAA 3DN5A 3SGUA 3T78A 3CUZA 1UROA 3ITTA 2E09A 1IEQA 4HSNA 3GQYA 4BCEA 3T8QA 1G6CA 2WNQA 2CLMA 3L25A 1HZYA 4X9YA 3L21A 3EPMA 3AJXA 1BVZA 4EPDC 1YDYA 4WOZA 4F9DA 1EGMA 4YHEA 2ZBTA 3N6QA 4WF7A 3F4DA 1V6VA 4JYEA 8XIAA 4ZFCA 2YPIA 1KS0A 4WKAA 4JX5A 3VNDA 2HNEA 4ZL1A 4GHRA 4JXCA 1TZZA 3N2TA 1XYFA 3KP0A 1TKKA 3WDHA 3AXMA 3NZ1A 2HBXA 3TA6A 2CZDA 2O55A 3MU7A 4OJ6A 3GXDA 5BPVA 3GC2A 2DSZA 3TTEA 5AHLA 4MPKA 4BZYA 4QG9A 3HGJA 2ICSA 3D0CA 3THCA 4AYGA 2WV8A 1GKPA 1BEUA 3LCIA 2IPWA 4IMCA 3ES7A 1ICQA 4AB4A 3W07A 2YDSA 3W1PA 2PRHA 2G4JA 4RE0A 1XIGA 1QDSA 1H11A 5D38A 1ZCCA 2Z1VA 5HNUA 4XB3A 5A3HA 3KUMA 3VI2A 1JYNA 3ENLA 3NDOA 4NT0A 2OG9A 3C2FA 5D32A 1F07A 3BJFA 3P8IA 3AMKA 3PPGA 4K2SA 4GFSA 1RXOB 1D3GA 3UZJA 3O1NA 5AECA 3QPZA 4MNKA 4NAEA 2AQVA 1RBAA 2X8RA 3IK2A 3N3MA 5J5DA 1EEPA 2ZQ0A 1UUQA 3LRMA 5BXTA 3BSGA 3BG5A 4AFYA 1I1WA 2IKHA 5F1VA 4LYKA 3DENA 3EBVA 5AC8A 4QSFA 5EBAA 2WCAA 3MHFA 2WQPA 4W5ZA 3W7GA 3W1AA 1H1NA 4JNMA 3MSRA 3NNTA 3L67A 1PKLA 4TTGA 1SMAA 2DEPA 5I3IA 4RKAA 5ENLA 4AY8A 4G1KA 3WY1A 4DWSC 3EGJA 2ZC8A 4NYYA 1SJCA 1H63A 1E0WA 1FA2A 1QJWA 1T99A 3NPXA 4ZFMA 5A94A 1MUWA 1J9YA 4LRTA 4QJ1A 3RX4A 3T4CA 1KCKA 1I8JA 4ENLA 1HL9A 2Y2WA 4UMBA 1RALA 2DW6A 2IS7A 4GVIA 4HYWA 3N9SA 2BSLA 3PFRA 1IT8A 3UT0A 1KD0A 1V93A 3OYZA 2V68A 4JR5A 4GZJA 3OBAA 2Y61A 1IEWA 2QJGA 3LCLA 3W38A 3C2RA 3IWPA 4FZIA 1KXVA 1UBSA 4ATLA 3W23A 5DBUA 3PZUA 2VRKA 4XVEA 4BF5A 2ZTJA 1JAKA 3W75A 1G4TA 4B5WA 3TQ0A 3OZMA 3QR3A 3UZ5A 4BY3A 4HNCA 1PBGA 1XH2A 3IJQA 4I9TA 4RZ4A 3GVWA 1N55A 4HK6A 3GXNA 1IHIA 3H4GA 4JTFA 1YPFA 2A1YA 3WUFA 2G8ZA 3MSYA 1VPXA 3WH5A 1B3OA 5D33A 4PEEA 5JH1A 5EGRA 4Z42C 1EYEA 4UTLA 5BZAA 3E0WA 4YNGA 2OWXA 4HCDA 4X2PA 4BI5A 4X0NA 5TNVA 1J93A 4JAWA 1YHTA 1YXYA 5AFDA 1MI3A 3QMRA 4IP5A 2V0TA 4X0VA 3WLRA 4GI6A 2QCDA 2YFNA 3BDKA 1FX6A 5EFFA 4JNZA 2YIHA 3PSVA 2PB1A 2FQIA 3W6MA 1OYAA 4FNUA 1RCXB 4A4AA 4DNHA 1QVBA 2UY3A 1ZBVA 1F3WA 1LTDA 5C2CA 3G3MA 4LUTA 4BF7A 4M6VA 5D9PA 3S6OA 5LHEA 1QCWA 2BZNA 1L6FA 3O06A 1Q4NX 3B0YA 1OG6A 2R94A 3NGFA 2NSXA 4Q4KA 3E5BA 1RJRA 4LWWA 3CAWA 5C2XA 4URIA 1TMQA 4B9ZA 2DZPA 4QROA 4H9TA 2YBUA 3NL6A 2UY2A 1BAGA 2OQLA 3QRHA 1E0UA 1ZP4A 1JDDA 2WVSA 2H3DA 3OLDA 4PB3A 5A1AA 2G3NA 1R3QA 1J12A 5C7VA 2Q71A 3OQEA 4OFCA 3EWUA 3N4FA 4QQUA 2OZ3A 1TTQA 1ONRA 3M9YA 3UP8A 4K6AA 4V1YA 4GO9A 3W7CA 3WMCA 4E0CA 1XWYA 1WYIA 4Y9PA 4L1WA 1PX3A 1NFBA 3A4WA 2VVSA 4NI8A 3MUXA 2ZA1A 4YVXA 1E71M 1AG1O 2WVTA 4J3SA 2GSEA 1FWRA 1GYMA 3TYUA 3NZPA 2Y2HA 3MT1A 5FJJA 1DWIM 1PX8A 3N9KA 4G1NA 3SGZA 2VEKA 1KBIA 2WJZA 1TWIA 1PIIA 1CB7B 2PS2A 1FCBA 5HA7A 1V6UA 2V81A 4GFIA 8A3HA 3TJLA 3TQPA 3FFSA 4RPPA 2XN2A 1T7LA 3TN4A 2IW0A 3WH9A 1WZAA 2V8ZA 3WO8A 4EPKA 2QV5A 5J8LA 3U2OA 5HMSA 3KTCA 3UCCA 4UTUA 1J0KA 2YCEA 3D47A 6XIAA 4JQ1A 1TJ0A 5CPSA 4HMEA 4M81A 4O1AA 3W2KA 4HNVA 1W6TA 4WUIA 1D8WA 3FS2A 1JXKA 1UCWA 1UASA 4F2UA 1GVIA 1DV7A 4UBPC 1VHNA 3GHSA 1CLKA 2C7FA 1RCQA 2WZMA 4JTKA 4TVDA 4PBEA 1EIBA 1L2QA 3B04A 4OUEA 3AMCA 1ZAHA 4AZ5A 4IFRA 7A3HA 3A6OA 4J28A 4JDBA 4H00A 7REQB 3UYCA 1CWYA 3PZNA 4AIBA 2E7FA 1XQKA 4JDYA 3T0CA 4O10A 2O9PA 3MPGA 2FMNA 1KW1A 1DXFA 3IV8A 3P62A 1TCDA 4HJWA 1DE5A 3GFZA 3SCVA 1XXXA 2DZVA 4HZ8A 4AWSA 4UFHA 2Y2OA 3VKKA 1K9EA 2CCRA 1FRBA 1P6BA 2B7NA 3DFOA 1XYAA 3SQSA 1CGWA 4JKLA 1I60A 3WNNA 3BO9A 3CV7A 5HMEA 2VZUA 4ICMA 2VT0A 2A2IA 4JEQA 4G2DA 3FCPA 2GJPA 3ZVHA 1E6RA 2Z0IA 4TV5A 3R0DA 2VX4A 5EMKA 3C52A 3LMZA 4CNPA 4XWUA 4MFEA 1G0CA 1UOZA 1XICA 3I10A 2ZA2A 1XLEA 7PTDA 1NAL1 1JPHA 3MV01 3WNLA 3BURA 2TPSA 4BWLA 2GVYA 4PCTA 5C5YA 3QHOA 3BW4A 3NPVA 1LT8A 1QWGA 3F4VA 1UZDA 5HK4A 5JVLA 1GUVA 1SMDA 3ABRA 3T0AA 1KBJA 3TSDA 1DOSA 4QDWA 2WKLA 1OBAA 4XVDA 1GOKA 4GI4A 3KL5A 2OB3A 1KBLA 3FA4A 4ZQCA 2V6AA 1W1B1 1JFHA 1MXGA 3HG4A 3GR7A 1US2A 5I0DA 3BAWA 4UFLA 3MVIA 2ZZ4A 1FH7A 5HINA 3L2MA 1US0A 4Y2WA 3C2VA 3QV9A 2Q02A 5JMUA 2EPKX 3LX9A 4AD4A 4UCFA 1LYXA 1OF8A 1BFNA 4ZA0A 3UY8A 2FFCA 1F6YA 3UWQA 3SRFA 3M6DA 5A6JA 3L5MA 4WCJA 1S1RA 4AX6A 1L6JA 1DORA 3KX6A 4QS6A 3S2MA 5I07A 3UJRA 1E43A 3IGSA 3SIMA 4LAMA 5DLCA 3RU8X 3WLTA 1NY1A 1A5KC 1OF6A 1UP2A 2Z4GA 2E8ZA 4JN8A 4EACA 4J9JA 3C0JA 4DXKA 3VXGA 1O4UA 2I9EA 2X41A 3E49A 2NVAA 3IJ7A 3CQ0A 2A3HA 1XW8A 3W9ZA 4U3AA 2X7VA 2W67A 2OJPA 1UR2A 3M41A 3G8EA 5AKQA 3GNPA 4PL1A 4F0KA 3S1XA 1JL8A 3HO8A 3N14A 1O5XA 3N2OA 3QGAC 4HTBA 3WH8A 3SCOA 3TDFA 1F5ZA 1H7XA 3ABOA 5AVHA 2D0FA 2E6FA 3H23A 3PAJA 1E3XA 5AC6A 4J2PA 4POCA 1GW9A 1MO0A 2E0PA 4CNSA 1E6QM 2I7GA 4E4UA 4RR4A 2B7OA 1LT7A 2A85A 5J04A 2PDFA 1R7OA 1LOQA 4EE9A 3BLPX 1EB3A 1WO2A 3EXRA 3LPFA 3H2OA 3MCOA 4LAKA 3EPNA 5F2LA 1YADA 1ITCA 3GY1A 2GDQA 3U2CA 3CU2A 5AYZA 5DCEA 2UZ9A 3FYOA 3MMDA 4KBXA 3MUAA 2XJ7A 3S1WA 3G24A 4E2OA 4HPNA 1DWFM 2Y8KA 3E3HA 6ENLA 1CXEA 4L6DA 4FNSA 5HMFA 1XQLA 3S5YA 3IRSA 3Q65A 5C9XA 1AVAA 3ES8A 1M7OA 2GOKA 2Z25A 3EOUA 1KFJA 4IMFA 2VGGA 4IF2A 4NIRA 1OZMA 2VZOA 1ISYA 1R7AA 3PZMA 1YBQA 1UD6A 1DIDA 1JDCA 3RF9A 2XIOA 3U48A 4RDZA 3ALFA 1BWKA 3NIYA 2DZXA 1QNVA 1IF2A 4MWAA 3FYPA 6TAAA 3ZWTA 3VDGA 4HA4A 1SO5A 1LL4A 1EJSC 3W1XA 3LQGA 4LPCA 2FJKA 4PCNA 3I6TA 2OLAA 4W8LA 3FLUA 4CVWA 3S46A 4HHHA 5ABHA 3LI0A 2QPXA 5EMYA 3TR2A 4HSOA 4GRSA 1H7WA 2JGQA 2FGZA 3RPMA 5T91A 1X38A 4GGHA 1XR2A 3BZGA 4UNIA 3GDKA 1QASA 2JBMA 1MXDA 2YCLB 4GXMA 3UG4A 3M46A 1PWMA 3CIXA 4F48A 3AUJA 2GDVA 3N15A 1VLWA 2PP1A 1YPIA 4R88A 5K4XA 3EWYA 4FI4A 4B5SA 1Q66A 1GJWA 4PSRA 2FTWA 1IIHA 5HNNA 2W91A 4LY4A 2NV2A 4LCSA 1CCWB 1FDJA 4LEQA 3M7SA 1QUMA 2POTA 2BFGA 4LB3A 3WSUA 2TSYA 4F2BA 2HXUA 2FVLA 1EF3A 2KAUC 2QJJA 1JNDA 2X42A 3Q37A 2OEJA 2CFFA 4UUIA 3B0PA 4AD3A 1P7TB 3G0SA 1N8IA 5G1TA 1TTPA 4Z2LA 1E1FA 4ONVA 1R3RA 3N4EA 4IMEA 3F4NA 4AZHA 2FZ9A 3N11A 5FL0A 3WK3A 4JIQA 2NQHA 1XPYA 2RKXA 2BVYA 4MPQA 3N04A 1DKWA 4JTJA 3HZ3A 1P0BA 3SIZA 4HKPA 4UR9A 3LERA 1OIMA 2V63A 1NP2A 2PDKA 5D9OA 4DF1A 2TYSA 3TN5A 3WUBA 2XSAA 1B4EA 4XUGA 3IVUA 4LXFA 4DJDC 4REQA 1CYGA 5LIXX 5G2WA 2NLYA 5A6BD 4MZYA 3MI6A 4AC1X 4IBCA 1DXIA 1SO3A 1OX6A 1DQXA 3ZR5A 3AYTA 4DUXA 3UVAA 3N17A 1UKOA 4G6CA 1H09A 1SW7A 2QAPA 3EWWA 4GNKB 1JJKA 3HURA 1A3HA 5K2ZA 5BWAA 1DQUA 3ZM8A 4RV8A 3AIEA 4Y7EA 4GWEA 2XM2A 4V27A 3TSBA 4DELA 1ZFJA 4WQ6A 2E77A 1UKPA 2WSPA 2L5HA 2VGFA 3HMJG 3G22A 1EX5A 2VX6A 4AEEA 1H60A 3N2MA 1R87A 2WSRA 4JL1A 1Q3NA 4UMAA 4IQJA 3W29A 2UV8G 3MUCA 4UQAA 4MJ2A 5BNKA 3MUZ1 3S9YA 3KZPA 1IE7C 1P48A 1X98A 4HPJA 1F74A 3WNKA