4TX9A

Crystal structure of hisap from streptomyces sviceus with degraded profar
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
AMPSKLSRLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALSWQRAGAEWLHLVDLDAAFGTGDNRELVRQVTEAMDIKVELSGGIRDDASLAAALATGCTRVNLGTAALESPEWVAKVIAEHGDRIAVGLDVRGTTLKGRGWTSEGGDLYEALERLDKEGCARYVVTDIAKDGTLQGPNLELLRNVCAATDRPVVASGGVSSLDDLRAIAELVPLGVEGSIVGKALYAKAFTLEEALEAVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-occurrence of analogous enzymes determines evolution of a novel ( beta alpha )8-isomerase sub-family after non-conserved mutations in flexible loop.
pubmed doi rcsb
source organism Streptomyces sviceus atcc 29083
molecule tags Isomerase
molecule keywords Phosphoribosyl isomerase A
total genus 87
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4tx9A00
1DL3A 3PG9A 1VJIA 4H6KA 1KFLA 3MYOA 3FEMA 1I2RA 3LV5A 4R34A 3UQNA 3PBVA 5AC8A 1GTEA 3NQFA 1EB3A 3W86A 2RH9A 2RDWA 2ZRZA 4LS1A 4JTFA 3G1SA 5I3IA 5TBOA 2UV8G 5CSSA 4MYXA 4JD4A 1JUBA 4GUHA 4HIBA 1KM5A 2GUUA 5AHLA 1S5WA 3UXAA 3MMTA 1GZGA 3QSRA 2B7NA 2OT0A 5G1TA 3MYPA 3VCRA 1W37A 2E6AA 1IF2A 5K3VA 2X1RA 1OFOA 3M5YA 4OBTA 1RQHA 3HPSA 1XBXA 3GB6A 3JS3A 5FEZA 1KBJA 4OV9A 5GVJA 3LTYA 1XXXA 3R13A 4K38A 4LRSA 1F7BA 5U4NA 5C54A 5D2TA 4K37A 1FDJA 2PRLA 2VKZG 3TA6A 1L6WA 1KTCA 2QCCA 2QF7A 4FEZA 2Z2UA 4MFEA 3SECA 1CW2A 5KITA 4FO4A 4O1CA 2WOQA 1JR1A 5C5YA 1BWKA 3LCXA 3MP5A 2VEMA 3CEPA 2J9YA 3TMLA 2RDUA 1W1ZA 5FESA 3O8AA 4JTGA 3G22A 5I3KA 3I68A 1LM1A 3P61A 4M6VA 4M6QA 4JX4A 3GR7A 4JTIA 3QQ1A 4TMBA 4DO6A 1PS9A 3SR7A 1UBSA 1T96A 3G1FA 3PB2A 3S1UA 3PBWA 3CC1A 3HB9A 5D30A 3QH2A 4XKYB 2FIQA 1TPFA 3TQ0A 2CFFA 1KFJA 1SQ7A 2BLEA 1KTNA 1UUMA 4TO8A 3OVRA 1QMLA 1N7KA 1JCXA 2ISVA 3CLMA 5FF4A 1LYXA 1QDSA 1GYNA 2PC4A 3RLVA 2F84A 4UNLA 3S5NA 3TC7A 1JQXA 3DHFA 2WV8A 1K7EA 2V0TA 4PC8A 3VI2A 3C6CA 1XDMA 1DBTA 2GQAA 1W31A 4N9DA 1Q6QA 3TROA 3LM7A 3PULA 1WXJA 2G5WA 2CZEA 2RHGA 3EEGA 5A8GA 4XZ9A 3GXTA 2NUYA 5T26A 4A3UA 3MHGA 1QFEA 3TU9A 3BW4A 1A5CA 4AWUA 3F4NA 3OBKA 3ZR4A 3TNOA 3GYEA 3LOTA 1RD5A 1M7PA 3THQA 1WAUA 4QAIA 5C55A 1H7NA 1GT8A 3BPWA 4UTWA 3UPBA 4YWIA 1A50A 3F03K 3TDFA 3LTSA 2E6YA 1B4EA 1L6YA 1R2TA 5IBXC 3UXDA 4I7UA 4O11A 4LWWA 3G18A 1HG3A 2ZDRA 2E5DA 3IRDA 2GVLA 3B8DA 3B4UA 2NV1A 3IGXA 3TX9A 4RJEA 1TQJA 4GUJA 1LLZA 4UTLA 3W22A 2YZRA 1DV7A 2QCLA 2WSYA 3C0JA 4CCDA 4NUWA 4GXMA 1AL8A 3IV3A 3W23A 5L9FA 4JTTA 1EWEA 1TPB1 5DY3A 3W7IA 1GOXA 3KVKA 1H7RA 3GX9A 2QDGA 3QMTA 2QJIA 1JCLA 3GLCA 4WUIA 3DHDA 1NVMA 3C2FA 4Q32A 4JDBA 2XN1A 2R14A 5BMWA 1KM3A 1S3HA 5HJLA 3TMQA 3GZ3A 2DU2A 3OIXA 5J5DA 1L9WA 4UFIA 1JRCA 3PBYA 5F2MA 3TK7A 2NUXA 2NXGA 3TV8A 2RFGA 5LHFA 1B9BA 2YDAA 4E0CA 1K7XA 4HN4A 3B03A 3M43A 4HNVA 3CWOX 3N9SA 4MZ8A 1Z48A 5KSWA 1LLWA 2RKXA 4LVFA 2X1SA 1GQNA 3IVSA 1EUNA 1VLWA 4EVZA 1KM0A 3E02A 3AO0A 1KFKA 1TJPA 5D03A 2TMDA 5D32A 5K4XA 1X7FA 5I3GA 1H51A 4K36A 4LY8A 3WJYA 1TB3A 1Q6RA 5EA9A 4Z0JA 2NXHA 3W83A 4S2BA 4O0ZA 4NNBA 1YXYA 4ADUA 3HJZA 4O13A 3STFA 1JUEA 4JICA 2GJLA 1LROA 2C18A 4GRSA 1ZALA 4FIRA 3UPWA 1WOAA 3IIPA 1LBMA 4NVTA 1VYPX 2TRSA 3PUDA 3ABSA 1ZENA 3R5EA 2E77A 1AW2A 5K7JA 3SGUA 1U5JA 1P0KA 1QPRA 1TRDA 5EY5A 4BFAA 8TIMA 3BW2A 3P5YA 2V8ZA 2PCQA 3RNDA 5AFDA 5E1QA 4HT3A 4PFMA 1K8XA 4QQ3A 3T7VA 4A2SA 1H7OA 4BWLA 4N9CA 3LHWA 2ALDA 4TU1A 3LI1A 1TPEA 1TPWA 3BG5A 5MHBA 3ABRA 1YDOA 4PA8A 1VPXA 4X3ZA 3N19B 4PH6A 2QUTA 2CLHA 5LNSA 3VE7A 1CX9A 3FIGA 4JX5A 4K8EA 4N2YA 2ZQ0A 3K30A 5G1YA 1B4KA 2E1DA 1T99A 5G2WA 4O52A 4GBUA 1PHWA 4GJ1A 2JK2A 1ADOA 2F7FA 2WSRA 5C6MA 2HS6A 2DZSA 1SZEA 4H3DA 3E49A 5FEXA 3IIVA 4WX2A 3BK0A 4XTDA 4UXDA 1FBAA 5D02A 3EKLA 3LHUA 1ZFJA 1JCJA 5D2WA 4UFKA 2QKFA 2V9DA 3Q2DA 2V82A 3CM4A 2YX0A 1FCQA 5EBUA 5HUPA 1UASA 4QNEA 3UWWA 4JN6A 4IMEA 1PL9A 2V2CA 1XFBA 4HNTA 4FIQA 4NX5A 1SZGA 4UR8A 5IM51 4Z1AA 1XM3A 1I2OA 4XQ6A 1ONRA 1GYLA 2XN0A 6ALDA 2H8XA 3GNDA 2EPHA 2A0NA 3NM1A 3NO5A 1LOQA 3EWYA 3STEA 1TREA 3G0UA 2PE4A 4FF7A 3CPRA 2FPTA 3BG3A 4JYEA 2Y63A 3LXBA 3W73A 4MJMA 3SIZA 4CCEA 1MO0A 1LP6A 2H3BA 1OFDA 3PM6A 3EWUA 3FKRA 1LCOA 4DBDA 4DQWA 3QMRA 2I9EA 1LRTA 3KVMA 3NXFA 4PL1A 2J9ZA 3DKJA 4X22A 1VLIA 2CWNA 1KM6A 3EKZA 1A5AA 3P74A 5EPDA 3W1NA 2YW4A 3C2OA 3CTLA 3QEZA 3IGUA 4LV4A 2GOUA 3NQEA 3LLDA 1WOBA 3B0VC 1K8YA 1BTMA 2QAFA 1LRQA 1G67A 3CWNA 3LHVA 1OFAA 3GAKA 4NJJA 1H5YA 1TPUA 3GDRA 3W88A 3QW3A 1DQWA 3LERA 4HKPA 5G4WA 2CLMA 1FX6A 4GWEA 1IIGA 3G8EA 4QIUA 1OX5A 5I3HA 3LX9A 1XDLA 3NL2A 3W2KA 5SWUA 5J5RA 3E96A 5FF3A 1W3NA 5KMYA 1AG1O 2C13A 4L4LA 3S1VA 3N9RA 5BNKA 3IGSA 1C8VA 1W54A 1OJXA 1XI3A 1SSGA 1SO5A 2ZFAA 3T55A 3W1RA 1EP1A 3LB0A 3UWYA 1FDZA 3HBLA 1WDWA 1G7VA 1KBIA 3DXIA 3H53A 4Y96A 3B04A 5FF7A 3MWAA 5F4XA 2C15A 4FNPA 3IIOA 5AN7A 1X8FA 3EB2A 1JRBA 4KFNA 3NG3A 2W0UA 2Y6ZA 4FX8A 4FNUA 3M44A 5HINA 1OFQA 3DENA 3UWUA 3IIXA 1GG0A 3N2XA 1ICSA 5CSRA 2JKPA 2NWRA 3P7YA 3S8HA 4KFPA 1NFBA 4O1AA 3A24A 3A21A 5F4WA 3NYZA 5K2ZA 1PHQA 3F1QA 5AC7A 1I2QA 1QOQA 4Y8FA 2E09A 3L2IA 4FX7A 1KFBA 2G96A 2A1YA 5BMXA 4Z0SA 2AGKA 3HGRA 3M5VA 4CQ8A 1QR7A 4S2CA 1R30A 3EXSA 5A5WA 4JTJA 2KZHA 5DLCA 3UNDA 3M47A 5LGXA 2ZTJA 3S0CA 1VYRA 1WQ5A 1LORA 1M6JA 4AHPA 3EX3A 4YXGA 5F1UA 4LW7A 1GVRA 5K9DA 4JNMA 3EWXA 5EYWA 4O12A 1OYCA 4IQLA 4W9TA 4LTSA 1W5OA 2OX1A 3TXVA 3FA5A 3HIJA 3GDMA 4WY0A 1F05A 1FWTA 4AWSA 3QMSA 3LLFA 1W0MA 3OVQA 3PY2A 1OFPA 2O7QA 1KFEA 3QZEA 1WYIA 1VHCA 3LDVA 3P62A 4POCA 1XC4A 2JKAA 2QCEA 4ZMGA 2DJLA 5K9CA 1H62A 1E51A 2FFCA 1BKSA 2ZRVA 1GVOA 1XUUA 1ALDA 2C3ZA 3W2UA 1YADA 3BVJA 3I65A 4PCFA 1D9EA 1P5BA 3CEUA 1WBHA 4E2DA 3UD6A 4PTNA 4O53A 3TFXA 3WJWA 1DJNA 3W85A 4O19A 3SW6A 4RZ6A 1SO4A 3DGRA 2ZYFA 4UR7A 2GJNA 4AHOA 3KAOA 1VQTA 2OCZA 1Y0EA 1QAPA 1KV8A 1TTJA 4NJIA 2J9XA 3TUUA 1XUZA 4NJGA 2I1OA 1UJPA 3ANYA 1TIMA 1UUOA 1T0OA 4D2JA 3PSWA 4LS2A 3NZRA 4N4PA 2Z6JA 4ML9A 5LSMA 3S6DA 4RXFA 2DZTA 5LKYA 3HG5A 1GWJA 3E12A 3JRKA 4A29A 4DF1A 2WQPA 4IMDA 3H55A 4XTIA 3OHIA 4TR9A 2NZLA 3SGZA 4WXYA 1Q6LA 2QCDA 3P82A 2DZWA 2X1TA 4UMCA 3S9YA 2FB3A 3WK2A 3PS7A 4OE7A 5AYYA 3AJXA 4UTJA 4RX0A 4HSNA 5DXYA 3GAYA 2JKEA 3NEVA 1RZMA 2NLIA 3A23A 4JTUA 2ZA3A 3D0CA 4N6EA 3L5LA 1X6UA 3O1NA 2HMCA 5CZJA 1WA3A 4J9JA 4LC6A 3LCGA 3N34A 4XBSA 3T4CA 3GR8A 4O57A 2CZDA 4OGZA 4LUJA 2NX9A 2WNNA 4MKNA 2B0MA 3SFKA 5HQEA 2YCEA 4RCXA 4HNUA 3HGJA 4WY0F 2B7PA 2V2DA 2Y85A 4O50A 3L65A 5BW6A 1KM4A 1WV2A 5F4SA 2FLIA 3MBDA 3NQMA 1ME9A 1NSJA 3BGGA 4JYFA 3OG3A 3DFTA 4RZ4A 4FHAA 2ZRXA 3W6YA 5D2YA 2NV2A 2XN2A 4LVDA 3HMJG 1QPOA 2X30A 3LCHA 3PWAA 3DFSA 1Z41A 3C2VA 3C61A 3UZJA 1KLYA 4Y6GA 4S1FA 4JTEA 1QCWA 4XKYA 4OWGA 3QC3A 5DCBA 5KZMA 3R2GA 1QPNA 1J5TA 1KFCA 3KXQA 3I7RA 4ORIA 3RFAA 3QM3A 4CNOA 2EAWA 2VENA 1LDCA 1LRNA 2FDSA 1XBZA 5HUOA 3CIXA 4Q4KA 2BZNA 1H7PA 3LRMA 1FXPA 5IBXA 1YPIA 5KZDA 1D3HA 4FXSA 3W7KA 2QJGA 2YPIA 3W70A 3W2NA 1XL9A 1SW0A 2C16A 1HL2A 4HHPA 1TPH1 1RQBA 4GUGA 3INPA 5D2XA 2BXVA 1K03A 1G4EA 2W6RA 1W3TA 1TV7A 4PL2A 2HTMA 1YXDA 3VKJA 3RF9A 1LBLA 1HFBA 4MZYA 4C1LA 1YTKA 4MJZA 3NDOA 1VCGA 3N3MA 2ABBA 1A53A 5CG7A 1LBFA 5I3JA 2Z1BA 4MVAA 2QCMA 3ATYA 2Y88A 3TR2A 4UMAA 1SFLA 2WO5A 3ABQA 3VE9A 2B7OA 3GKAA 5U7SA 4JEQA 4EIVA 3R12A 2NWSA 1R47A 4NJKA 4ZQCA 4ZQMA 4JY9A 1AMKA 3IVTA 3PBUA 1L2UA 4EWND 2ATMA 3QQ0A 2V30A 4MY1A 3W71A 4ZQRA 3A5FA 4XUGA 4R7JA 3OEXA 2EGZA 4AEOA 5LNWA 1RV8A 2WNZA 1J2WA 4XWUA 4TMCA 2ISWA 3THAA 1C9DA 4UFMA 3WK1A 3PVFA 3GKFA 5TIMA 2VFHA 1SSDA 3CHVA 3G1DA 2EKCA 1TQXA 2FTPA 6TIMA 4NX0A 1G6CA 1KV5A 4ZQPA 1YDNA 1Z44A 3NPWA 1TPDA 3HOJA 4AB4A 4EOUA 5AHFA 4HSOA 3PAJA 3M1ZA 4JS3A 2V2HA 3W7GA 1YDVA 3I6RA 3MP4A 2Z6IA 2RDTA 1W5PA 4DBEA 3SJ3A 3VFLA 3NPUA 2ZA1A 3NQVA 4DPPA 4R33A 1M5WA 1JULA 3HQ1A 1RPXA 2CU0A 3N2MA 4UTHA 3HGSA 3FJLA 1TTIA 3LGEA 2A5HA 1HO4A 1O94A 1DOSA 3JR2A 1OF6A 3NR0A 1R46A 2QCGA 4YL2A 2E68A 3F4WA 1DVJA 3GDKA 4NZFA 2WPBA 2WKJA 3O63A 2YXGA 1KTBA 4UC5A 1W5QA 1YPFA 1YTDA 2TYSA 4MOZA 3TW7A 4RZ5A 3M7WA 4I7VA 1LTDA 4M19A 4Z1CA 3W07A 3L68A 4I9AA 1H61A 4U28A 1IXNA 2BTMA 4ZL1A 3LCFA 5AHIA 1I2PA 3M5ZA 1JCNA 2BX7A 2ZCGA 4DF2A 1Q45A 3EXRA 3P84A 1V5XA 2QJHA 4AMAA 3KVJA 2YYTA 4NXKA 2VEPA 4O14A 3MI2A 1PVNA 4GNJA 3UYCA 1QWGA 3EWBX 3P80A 4O0KA 1RVGA 4YMZA 2OMAA 1EX5A 3N14A 1K8ZA 4K8HA 4B5NA 3DKLA 4ONVA 1A5SA 1TO3A 3SSJA 2B4GA 2YR1A 3KX6A 4LT9A 4LC8A 3BG9A 1OX4A 3FLUA 4X9SA 2EF9A 1VCFA 3LV6A 3HF3A 4WXZA 4CNNA 1I8JA 3QF0A 1AW5A 4IGHA 4ZQOA 1O95A 4IUOA 5CZSA 3QYQA 1LOLA 4CQ9A 3KVLA 3V1PA 5D09A 1XBYA 5BRBA 2VELA 4AAJA 4QNWA 2ZZ5A 4O28A 4WOZA 4AF0B 3MBFA 3NA8A 1LZOA 3ATZA 5LNVA 4O17A 5HWMA 3SY5A 1FWRA 3CU2A 3EX4A 1WBJA 1X1OA 1NAL1 3NPVA 5HNRA 1Q6OA 1O5KA 3EWZA 3S5YA 2A2IA 4IPIA 3KRUA 4MIMA 3T78A 1IXQA 5DCDA 1TMHA 3W7LA 4M5PA 2CZ5A 1W56A 2NXIA 3HGOA 3R8RA 4DXVA 2AAMA 5HULA 3S5OA 3EX1A 1F6PA 1P0NA 4JIQA 3IVUA 4HPXA 4JX6A 4LVBA 4LVGA 2E6FA 1IIHA 4HNNA 1ZJIA 1R2SA 4ORMA 3B05A 1AK5A 1ME8A 2HSAA 3NL6A 4UMBA 1ME7A 3FKKA 4O4VA 3EWWA 2FB2A 5EMUA 3M0ZA 4UTTC 1MEIA 2A6NA 3KRZA 3W7CA 4IXXA 1OG0A 3P8IA 4IJBA 2J24A 3G24A 2DJXA 1UCWA 3L0NA 3W74A 2ZZ2A 2OT1A 3W7DA 4DPQA 4DEFA 4UTMA 4RKAA 1QOPA 3M16A 3NQ2A 3TW6A 2VFFA 1ZY9A 4UTTA 5CPMA 1W3IA 4R53A 1GVQA 3EX6A 2GQ8A 3ZFHA 1NEYA 4QJ1A 1QPQA 3U8GA 1JUKA 2Q8ZA 3DFNA 1OVDA 3UWVA 3NQ7A 1JVNA 3W76A 1VHNA 3ZWTA 4GUFA 1VRDA 3GNNA 3MHUA 3TAOA 2JGQA 3CIWA 3BGJA 1A5BA 3QPYA 1TPC1 4UNKA 3FS2A 3C52A 3E9AA 1VYSX 4N9EA 1MZHA 3O6CA 3LI0A 3DI1A 3B0UX 3TE9A 1OABA 1VC4A 3QW4B 3HPZA 3W9ZA 1OX4B 1OFBA 3TSMA 2QCDB 1FY6A 5C2XA 1SR9A 2CLLA 1SO3A 1WX0A 2PRMA 2VC6A 4RK8A 3EXTA 4O10A 5FEWA 1FUYA 3NOEA 4O4WA 3V75A 4UTKA 3T40A 4N4QA 3TCEA 1GVFA 2ZBTA 5AYXA 4IX0A 3L66A 3PSVA 1ZCOA 5AHMA 3UWQA 2DZPA 1P4CA 2E5BA 4IOTA 1TTQA 2C6QA 4QITA 3C2EA 4OHQA 2DORA 3OA3A 1ZAJA 3TJXA 1G69A 3QSTA 1MSSA 2G95A 1G4SA 1TSIA 2JBMA 4O15A 3HPXA 1H7WA 4Y90A 4U4MA 4K7YA 1DJQA 2YW3A 2ATSA 2X2GA 3LHZA 1BWLA 1F76A 4LOCA 1FWNA 3TKFA 2CZFA 1OK4A 2WSQA 4JTKA 4CQAA 3P81A 2P10A 4ICNA 2BWGA 4MUZA 2O7SA 2Y7GA 2V81A 3LHTA 1U83A 1L6SA 4BI7A 2CW6A 1OFEA 3W75A 1K7FA 4AHQA 1G4PA 1V7YA 4LUIA 4MZ1A 3OVPA 4P2VA 3G3MA 4L4MA 4JTSA 3T44A 3NVTA 1KLZA 2R94A 2CLFA 1SW7A 2Q8LA 2HS8A 3G1XA 2GQ9A 1TTPA 3PG8A 4JDYA 1X1ZA 1F73A 3RK8A 2GPTA 5AYZA 2YSWA 4M7TA 3W7HA 3W87A 2WNQA 4WY0B 3W7NA 3GXPA 2OZ0A 2A7NA 4P61A 1ICPA 5CKSA 3TSDA 3GVGA 1AL7A 2QEZA 1XBVA 4FNQA 5K9XA 3W1PA 2ZA2A 1SZNA 2Y7DA 1Q3NA 1TV5A 1OK6A 4GC4A 3W7JA 1R2RA 1W8SA 2VOMA 4OV4A 3G0SA 3L5MA 4NJHA 5D04C 4LNYA 4JY8A 2C1HA 2X1UA 3L67A 2LLEA 5DY2A 3BLEA 3PC0A 4KFOA 3VNDA 2ABAA 2E6DA 4KWVA 1FXQA 5EL1A 3A22A 3P60A 3N73A 4XBKA 1IGSA 4UCGA 1B3OA 4ZQNA 3TIMA 1H1ZA 1UB3A 3NL3A 1W5MA 2WJZA 5LNUA 1FWSA 3S1XA 4OQVA 3TFCA 4EF8A 2QUVA 1HO1A 2FQIA 1GEQA 1FWWA 1SW3A 2BSLA 4NT0A 2AQWA 5H91A 7TIMA 3YPIA 1HUVA 4PEKA 3LCLA 4LV9A 4O1DA 2QUUA 3MJYA 1NF7A 3L9CA 2X16A 3MI6A 5FF2A 3NQ8A 4BWLC 2J6XA 3HO8A 2Y89A 1G4TA 3RLUA 5HR6A 2CLEA 3LXCA 1M7OA 1GVSA 4YLWA 1VGAA 3W7RA 3SZ8A 1P1XA 3GK0A 3BARA 4CCCA 2V5BA 3CT7A 1SZFA 1EUAA 3H54A 4FXRA 2QCNA 1GG1A 2Y61A 5G4EA 3A5VA 3I7QA 2A7PA 4KKXA 2DZVA 4UTWC 2A4AA 3QPZA 4NZJA 2QDHA 3G3DA 5FEPA 3NQCA 1K3UA 2J27A 2ZZ1A 3WJZA 1NF0A 5HWNA 3W7EA 3DFQA 3DZ1A 4TIMA 3W2JA 3TXZA 3TQVA 3NAVA 3LBCA 1TJRA 5F2GA 4JXCA 3DFPA 2Q3RA 1OYAA 5DBTA 4MLJA 5ABTA 4BF9A 3O05A 1J4EA 3C2RA 1OX6A 1YYAA 4E2BA 4BI5A 2R8WA 4NNAA 3O06A 4YCPA 1SPQA 3PUOA 1TPVA 1EP2A 1F74A 3SI9A 3LTPA 5HR7A 2PURA 2I14A 4QISA 4Z1BA 3W1QA 1OFRA 3KRSA 5LGZA 1H7XA 1N55A 5L6UA 1PCKA 2JGYA 2YFNA 5TQLA 2QR6A 2YYUA 1KM1A 3M6YA 1S5VA 1D3GA 2C14A 1YXCA 1EWDA 4AXKA 2Z0IA 3MP3A 2PRHA 3KOFA 4NU7A 1JCMP 3MI3A 5LNRA 3GDLA 1MEWA 3G8RA 3TH6A 1FCVA 3LHYA 4IXHA 2Y7EA 1RQEA 3O16A 1ML1A 1H50A 3EX2A 1EP3A 4LRTA 5D38A 3W84A 3PUEA 2Y70A 2GVJA 5E0KA 2DZUA 2Q3OA 5D2VA 5BOOA 5I3FA 3E0IA 3NNTA 1PE1A 3NPXA 3P5ZA 1KM2A 3TC6A 3FYPA 4IMCA 1PCWA 4ADTA 4Z1DA 1BEUA 3W3OA 1QO5A 5CPNA 1Z42A 3CB8A 4QM1A 4MLRA 3O6DA 5CZ0A 4UFHA 4FNSA 2G97A 1VCVA 2ISSA 1JJKA 2P1FA 2V5LA 1OF8A 3W1MA 4A22A 4EF9A 4WOQA 4UTUA 1VS1A 2ZRWA 4DF0A 3PB0A 5EKYA 3Q37A 4O1BA 3Q94A 5LZLA 1MEHA 1SFJA 3W7OA 1TRIA 3BW3A 4I7WA 2Y7FA 2CLKA 3WK3A 3NQGA 3DH7A 3UY8A 5AOUA 1KW1A 3UY7A 5F2IA 1SO6A 4JIPA 2QCHA 2VFEA 2VXNA 3G0XA 3PF3A 4DELA 3LCWA 5LHEA 3DI0A 5DELA 1F5ZA 1I4NA 3MO7A 2Y62A 3RU6A 4WJEA 5FI8A 1N8FA 1F2JA 4NQ1A 1FCBA 3W1LA 4NXSA 5G2HA 3ZWSA 5DXXA 2W79A 4Y9AA 1ICQA 4MYAA 4AWTA 3W1XA 4M7SA 2FPVA 4NNCA 4N02A 5D37A 4O16A 3FOKA 3GXNA 5G5IA 2C0AA 4AF0A 3G1VA 4WD0A 1YLVA 5G2IA 4WQ6A 1TV8A 3LBMA 4GFSA 3O6YX 2NUWA 3LCIA 3S42A 1JCYA 2XFWA 3FJ6A 4M6PA 3W1TA 3LRLA 2FJKA 4K7VA 3UZ5A 5CGQA 3KHJA 4OT7A 3L0GA 4O8RA 3BV4A 5HMSA 2QCFA 3DBPA 3TJLA 2D73A 2ZZ6A 3WJXA 3O07A 2VEIA 3WFAA 4IX2A 1EPXA 3MUXA 2H3DA 4N6FA 5KINA 4K39A 2J88A 3GIYA 5DCEA 1H1YA 5FF0A 4QSHA 4UFLA 3NM3A 4Q33A 2NX1A 5AHEA 3IIZA 4FX6M 1MXSA 1O4UA 3KFTA 3MW7A 1THFD 2TSYA 3A9IA 4ADSA 4RLIA 2VFDA 4FNRA 2TPSA 4JGDA 3BLFA 5E93A 3NQ6A 1RR2A 1EA0A 3HG2A 3WK0A 1QO2A 1DQXA 5CZTA 5AB3A 4CNPA 2E5CA 4UIOA 1VZWA 1VH7A 4WZHA 4H4IA 3U6WA 3L0KA 3C3NA 3Q58A 2DP3A 3ABOA 4BI6A 2OJPA 2ZZ7A 3STGA 3P8JA 4TX9A 5AC6A 1JQVA 2H6RA 4MFDA 3G1YA 4RR4A 3L5AA 1W5NA 2ZZ4A 4GUIA 3I7SA 3O15A 4PODA 5HWJA 1PIIA 2P0OA 1QNVA 1XCFA 1H63A 5CPOA 2A6LA 3FFSA 2A21A 4E38A 3DAQA 1B57A 1T8XA 3TSBA 3P67A 2YFOA 1O60A 3L21A 3RMJA 3STCA 4FNTA 2H90A 2ZRUA 4UUIA 3LXAA 3NQDA 4ZVJA 1DORA 1AW1A 3TQKA 2VFIA 4Z08A 1GPWA 4AVFA 1XKYA 3S1WA 5CPLA 1DKWA 4JYDA 3M5XA 3NL5A 2A7RA 1FDYA 4FB7A 3G1AA 3NQAA 1EEPA 2GVGA 3GDTA 5D05A 4ALDA 1CI1A 4N9BA 2A85A 3ELFA 2ZTKA 1ZAIA 1ZHAA 1I2NA 2EHHA 1I45A 1YTEA 4OU1A 4C1KA 5KZEA 1PV8A 1S5TA 3USBA 1H60A 3QRHA 2R91A 4HPJA 3C4UA 1ZNNA 3CQ0A 1FQ0A 4X2RA 2C19A 4ZZ9A 4MPQA 2CLIA 3W7QA 5F2LA 2VEKA 4BR1A 3M41A 3G1HA 3NZ1A 1FCUA 1OHLA 3C8FA 1HTIA 3PR2A 4UTIA 1TYGA 4YCOA 3W2LA 1TCDA 3FYOA 4UFJA 5AHNA 1G7UA 4IMFA 3R89A 1KA9F 1O5XA 1F6KA 3BO9A 1ZAHA 4DO5A 4IWWA 3QFEA 3B0PA 3W72A 5KTLA 2IQTA 2NX3A 3S5ZA 5DN1A 1SU5A 4LVAA 4JTLA 4BK9A 1OYBA 2CLOA 3UWZA 4LS0A 5K4ZA 4CLMA 3W7PA 3W7MA 4GE8A 3NGJA 4MY8A 4DO4A 3WJSA 3DFOA 3HG3A 3IEBA 3B06A 3QJAA 4JR5A 2ZRYA 3C56A 1IXPA 4A21A 1VR6A 1SUXA 1DHPA 1EIXA 3TAKA 1LOSA 4LU0A 5H2ZA 2B7QA 5F1VA 4AH7A 2QAPA 1GJPA 2ZZ3A 1GTHA 4O54A 3ZS4A 2DZXA 4MY9A 4RV8A 4JTHA 5DBUA 2VFGA 1C29A 4G1KA 3W2MA 2YGYA 3LRKA 4A2RA 4IMGA 2H8ZA 5D33A 3HG4A 4K6AA 3MHFA 4RXGA 3U2OA 3BLIA 3M9YA 1IXOA 4KWWA 3W1UA 2FPYA 4O18A 3DU0A 3W1AA 1K02A 4IPJA
chains in the Genus database with same CATH superfamily
3PG9A 1VJIA 2E0PA 1OCBA 4H6KA 2WHMA 3LV5A 1I2RA 4R34A 4DNMA 2VWTA 1CXFA 3UQNA 5AC8A 1GTEA 2RDWA 1V3JA 3G1SA 4MYXA 2OGJA 4WDXA 4YTQA 4NKCA 1KM5A 4Q8VA 2GUUA 1Q8JA 4JFSA 3UXAA 3MMTA 1SGJA 4OJYA 3HJEA 4JHOA 2GJRA 3VCRA 1EOKA 4FAMA 4PRWA 3DFHA 1IR2A 3WL1A 4JFUA 3M5YA 1S1PA 1V8EA 3HPSA 4Q8UA 4DBWA 4AZCA 2AL2B 4FK9A 4OV9A 1KCKA 3LTYA 4IPLA 5U4NA 1H0GA 1V6UA 1VFMA 3P6LA 1K8CA 3R58A 4FEZA 2Z2UA 4MFEA 3CUFA 3J7HA 1GEHA 4US5A 1CW2A 3D6NA 1AJ2A 4H6EA 1G5AA 2X0YA 3CEPA 2J9YA 2V5KA 4P5UA 1DWGM 5FESA 4QR6A 1MRAA 2VZOA 3H6OA 4AZHA 4QS6A 4M6VA 5EFDA 3LMYA 5DRCA 4XSLA 4GH3A 2PS2A 3C86A 4B92A 3PB2A 4FLSA 1B3YA 4RDZA 3FNDA 4FR1A 3PBWA 3QY6A 3CC1A 4P8VA 5D30A 3QH2A 2FIQA 3NOYA 3TQ0A 1KTNA 3VU2A 3P0WA 1N7KA 1JFXA 3SADA 2ASHA 1LYXA 4F9DA 1IZCA 1MUWA 3OYXA 2CHOA 2BHYA 3S5NA 1JQXA 1QI3A 1CB2A 2WW5A 1WP6A 2YA0A 1BVZA 3AXIA 5G1MA 4N9DA 1PJ9A 3LM7A 3UR2A 4J2MA 3S83A 4GINA 5A8GA 5T26A 2NUYA 4YU1A 4D6JA 5ABEA 1ZUAX 1DJWA 4AWUA 3GYEA 3M0VA 1WPCA 1GT8A 4LUTA 4YWIA 1RVKA 3RHGA 1R2TA 2V38A 4Y7EA 4NP7A 2O9RA 2ZDRA 1HJWA 3IRDA 4DM1A 2Z29A 3B8DA 4GJJA 4RJEA 3EB3A 1TQJA 4H01A 4GUJA 3SSZA 2ACUA 4NUWA 4GXMA 1AL8A 3LZ3A 3IV3A 3W23A 3EPMA 4JTTA 1EWEA 1GOXA 3KVKA 2OKOA 3QMTA 1RXOB 5CG0A 1QNSA 4HA1A 1JCLA 4JQ3A 3ARRA 3GLCA 1NWRA 4WUIA 1UD3A 3PZTA 5BMWA 1OC7A 3NYDA 3TMQA 4AEEA 3LZ5A 2DU2A 1H1NA 2Q8XA 3K2GA 1L9WA 3WF1A 3PBYA 1E40A 2OX4A 3SCRA 4GX8A 3BOXA 1PO9A 2OG9A 3DDMA 1K7XA 4HN4A 4PBGA 1NY1A 2B81A 4HZ7A 8CGTA 3D3AA 3IV8A 4U2ZA 2AMGA 3N12A 3WFZA 1CEOA 3IVSA 4DWSA 1VLWA 3VIGA 3E02A 3AO0A 1TJPA 3GW0A 5IDZA 4ZOBA 5D32A 4JTRA 4AVNA 2VZVA 3VOCA 3ALGA 1UMYA 2ZUSA 4XKMA 5JBFA 3LY0A 4S2BA 4O0ZA 3UJEA 4NNBA 3HJZA 3STFA 4Z2HA 4GRSA 1ZALA 3WBXA 4FIRA 1DJHA 1LBMA 3COTA 4WJXA 1NFGA 4FLQA 2C71A 1ZENA 3R5EA 1DYSA 3E38A 5K7JA 1P0KA 5EY5A 2D2OA 4GG9A 3IK4A 3PTQA 2HCVA 4G1NA 5ECVA 8TIMA 3BW2A 3P5YA 2V8ZA 4OFCA 3P2VA 4HT3A 4HD5A 2VUYA 3QY8A 4UZUA 3BLKA 4A2SA 1H7OA 4BWLA 4TU1A 4C6EA 3CZ8A 3EZ4A 3V35A 4PH6A 2HVOA 1R9YA 2QUTA 1E0VA 3WEMA 3U2ZA 5LNSA 2A3HA 3BSGA 3VE7A 1CX9A 5BROA 5HOSA 5G1YA 1B4KA 3SN4A 4WDUA 1LWHA 5G2WA 1HN1A 1WAWA 1XHGA 2F7FA 2AQVA 2WSRA 6PTDA 2HS6A 3TN3A 1YNQA 3AYVA 5FEXA 4LYQA 3OGVA 2VVNA 3PBGA 4XTDA 3N4AA 1HKJA 3EKLA 3AUOA 3IACA 5CSUA 5LIKX 1GQLA 3Q2DA 3RG6A 3GG1A 3NFUA 2PD5A 3SCTA 1EHNA 2ACSA 5HUPA 4ASTA 3UWWA 1V4YA 4JN6A 3SB0A 4U33A 1ZBVA 2WC7A 1CPUA 4Q6JA 4J3ZA 2V6AA 2NVDA 4NX5A 1SZGA 4UR8A 4XQ6A 1GYLA 3AFBA 3DN5A 2XN0A 3AIQA 4FXFA 4YS1A 2BP1A 2H8XA 4JTAA 2GK1B 2A0NA 3NO5A 3BAYA 1YEYA 4AZ7A 3G0UA 3CHFA 4TVDA 1P0BA 3CPRA 2I9UA 2C7FA 4B3LA 2VZUA 1GHRA 3LXBA 3W73A 3SIZA 3N3TA 3DHUA 3UEQA 4C6CA 1QJWA 3EWUA 1GVIA 1LCOA 3R0DA 3GH5A 3QMRA 2WJEA 4PL1A 3F5LA 4X22A 1VLIA 3OGRA 1S1RA 2CWNA 3PFRA 2KAUC 5EPDA 2YW4A 3C2OA 1BYBA 2YDRA 3CTLA 3WDJA 3Q65A 3FVMA 1WOBA 1K8YA 1BTMA 1M7JA 1LRQA 4ZO8A 3EEZA 5JH1A 1G67A 5BRPA 1OFAA 3MUAA 4NJJA 2XGZA 3W88A 3ANUA 5C2CA 4BF7A 4JIRA 1DTUA 1KQZA 3P0XA 4H8HA 5I3HA 3LX9A 3NL2A 3W2KA 3VOJA 1GVEA 4F4RA 2E9MA 2O0TA 3NIYA 4DIAA 1PBGA 4F66A 5BNKA 4B9ZA 1J79A 4PULA 4IPPA 2OWXA 3WDIA 2Y5JA 3KWXA 3FA3A 2ZFAA 5M17A 2DV0A 2WZHA 2BG5A 3SUSA 1BD0A 1JIBA 2ZC8A 1WDWA 1KKRA 1UR1A 4Y96A 2FYMA 5FF7A 3B0YA 3MWAA 1X6LA 4DZ5A 2X05A 1FWFC 4HK5A 1A3HA 3EB2A 1XLCA 4KFNA 3SRDA 3S3GA 3NG3A 4PR4A 4B90A 2Y6ZA 3KTSA 4FX8A 4K3ZA 4LUTB 4Z2GA 2XPKA 3IUHA 3IIXA 4Q7NA 1HNYA 1ICSA 3P7YA 4KFPA 1H3GA 1CLXA 5AC7A 1I2QA 1P7TA 4Y8FA 4FX7A 2QPXA 3LLXA 2EJAA 4DJEA 1J6OA 2G96A 3VIJA 3S2NA 2ZUMA 1QI2A 2PLCA 4ICMA 5A6BA 3WMCA 5CC3A 4S2CA 5LA0A 4DRSA 4HHLA 3UNDA 3W24A 5LXEA 1VYRA 1LORA 4PMYA 5F1UA 4FP1A 3NO1A 3GH4A 4Q4OA 3VMOA 3EWXA 5EYWA 3EKGA 4W9TA 4NIRA 4LTSA 3GDMA 3LLFA 5A8PA 3PY2A 1V0KA 3H26A 4I6VA 3EAUA 5A6AA 3LDVA 2INFA 1XC4A 2QCEA 2X09A 5ABGA 1HJXA 2BFGA 1H62A 2FFCA 4DUWA 5DQPA 3CNYA 4IFKA 2VGIA 5E09A 1GVOA 3W2UA 2OLHA 3ZM8A 1NQKA 1FHVA 2Y8VA 1XLBA 2J8TA 1WBHA 3CEUA 3UD6A 1WB0A 4DWDA 1DJNA 2WM1A 5XIMA 1S2WA 2VZTA 1EOMA 4UR7A 4AHOA 1VQTA 3UR5A 1ZCCA 2OCZA 2XTKA 1JZ4A 1QAPA 4L56A 4DI9A 2X41A 2NT1A 3GXFA 3OLGA 2I1OA 1RALA 1UJPA 2G37A 3WQ5A 1UUOA 3RCMA 4PFHA 1ZBKA 3T0AA 3JUGA 3PSWA 3S6DA 5DX7A 5LKYA 4LUSA 4V15A 3E12A 3JRKA 1OGGA 3TZNA 2WQPA 4IMDA 3VMNA 4NASA 3ORWA 1F3EA 4NAFB 3BQ5A 4IIHA 3OHIA 2XWEA 3QOKA 1JZ5A 2QCDA 3WQ4A 1PZ3A 1UR2A 3S9YA 1R6WA 4UTJA 2FVLA 3WO8A 5DXYA 3GAYA 2JKEA 1YBQA 3A23A 4Q8TA 4RNFA 3K46A 2O9OA 3E5BA 1OM0A 4D1IA 2YZ5A 1WA3A 2JQXA 1VJSA 3VOHA 4GY7A 1TZ9A 1FWBC 4J7RA 3C5QA 3GR8A 3U3HA 4S3CA 2XVLA 2WNNA 5HQEA 3E0VA 4UNIA 3USZA 4GISA 3HGJA 3DG6A 4H41A 2Y85A 4O50A 1A0CA 5DT5A 3WQ8A 4G7EB 1WV2A 2R1PA 3NQMA 7CGTA 1ME9A 3BOFA 2QT3A 1P6CA 1TR9A 4JYFA 2FVKA 3W6YA 1ZQ5A 3AYTA 3DYOA 2WZEA 3HMJG 2X30A 4J3XA 1Z41A 3UZJA 3WENA 4Y6GA 3IARA 1D3CA 4S1FA 1W1YA 1A49A 1QW7A 3C3UA 4J3WA 4XKYA 6CGTA 4DYJA 2DSVA 2XIBA 5KZMA 5A69A 1J5TA 2D2HA 3A4JA 1B3XA 2WM0A 1XH0A 1GHSA 1EIBA 3BUVA 3V18A 1LRNA 5HUOA 1UR8A 2W27A 4Q4KA 5BWAA 1H7PA 1YPIA 3PBMA 1JZ7A 4RNHA 2QGYA 4IFRA 3A13A 3TJ4A 3TEVA 3W2NA 2VP8A 5CLTA 1XL9A 4CU7A 2D2GA 5D8ZA 3H8AA 1SW0A 3VIIA 1J0KA 3WELA 1TPH1 1S3TC 1GQIA 5D2XA 1FWJC 2G3NA 1K03A 1KGUA 4R3UA 5FJOA 1YTKA 4ZODA 3NDOA 3TVAA 3R1ZA 3N3MA 5C9UA 2ZC1A 3WLHA 5CG7A 8XIAA 1EF2A 3U5UA 4UQAA 5I3JA 3AMGA 3M7SA 4MNKA 3TR2A 3ITLA 3ABQA 4NJKA 1VAHA 2OR2A 2PLMA 3PBUA 4EWND 3HTWA 4MY1A 3W71A 4DUXA 3R11A 1A0DA 4XUGA 4R7JA 1XH2A 4LPCA 4EK7A 1VFLA 3BAJA 3T1GA 3SEPA 3PVFA 3WQPA 3WH9A 4YWSA 5TIMA 2W66A 3MZ2A 3S4TA 3RM8A 3G1DA 2FTPA 1YIXA 1X39A 5AC4A 1G6CA 1Z44A 3NPWA 5AHFA 4I5RA 3W7GA 3HQNA 1BFNA 1BXCA 1MFVA 3KL3A 2ZA1A 4ATDA 3RR1A 3MSGA 1M5WA 2VL4A 4Q8PA 3CGTA 1WCGA 2P3EA 4B9YA 1NP0A 3VKCA 1O94A 3JR2A 1S2UA 2VQTA 4XZHA 3N15A 3ERPA 4NZFA 2WPBA 2WKJA 3O63A 3MSYA 4KPLA 1YTDA 4MOZA 3TW7A 3SDOA 3H2OA 1IEXA 3WUEA 1I1XA 1VD6A 3AZSA 1H61A 1LL4A 3GBEA 3RPDA 4ZA0A 5CJNA 3QR0A 3ABZA 1Q45A 2ANUA 3H2MA 1ZJHA 4AD1A 2P50A 3T2OA 2ZX7A 1W2PA 3ARVA 4QX4A 4AD2A 3HMCA 5JVLA 3BV7A 4E2OA 1E4IA 4O0KA 3WZ0E 4F0HA 4K8HA 1TG7A 4ONVA 1A5SA 2B4GA 2CPUA 2DDXA 4LC8A 3W38A 1FA2A 3FLUA 3LSBA 1VCFA 4WXZA 1O66A 4HA0A 3V36A 2X0HA 4M51A 1JZ6A 1LOLA 4CQ9A 1E4NA 1UOZA 3V1PA 5A1AA 4GO9A 4QNWA 2W91A 3SY8A 4GI6A 3ATZA 3WNMA 4HMDA 3EOUA 3EX4A 1W9UA 3UZWA 4DZHA 2QJNA 1X1OA 4LAZA 4GOAA 1O5KA 5DCDA 3W7LA 3WMBA 4DI8A 1GGOA 1W56A 1H0IA 1F8IA 1C3FA 2D69A 3EX1A 3CL6A 5EMLA 3PZMA 1BYAA 1UQZA 4W89A 4PE8A 4FSAA 1JPHA 3WF2A 2XHYA 4HNLA 5LA2A 1NJJA 4EAMA 3B05A 4H9XA 3CUZA 4ENLA 3NL6A 4UMBA 3WLOA 3FKKA 2AGTA 2QJJA 3EWWA 5EMUA 4QAWA 3M0ZA 5TF0A 1MEIA 3KRZA 1OGBA 3AYSA 4HB7A 4IXXA 3HN3A 1UCWA 3KOWA 4GLEA 2OT1A 4DPQA 1O68A 2E1WA 4CQDA 5DMLA 4UTMA 4RKAA 5EB8A 1EX1A 3M16A 4JFWA 3TW6A 2VFFA 4R5EA 4UTTA 3PZNA 3M0JA 5RUBA 1GVQA 3EX6A 2GQ8A 3APTA 1R38A 1QHOA 2OU4A 3UWVA 3NQ7A 2PDNA 1PWMA 4L1GA 1J01A 3ZWTA 4B4HA 1UZHA 3BJSA 2R24A 4UNKA 4JQ2A 4GACA 4L1XA 4LUSB 3TLLA 4XK2A 1VYSX 2WMIA 3T9PA 1XIIA 3TE9A 3A4WA 2VHLA 1VC4A 2D22A 2PWEA 3QW4B 2OSWA 3HPZA 3W9ZA 3ES7A 2PPGA 2D24A 5CBBA 3VKBA 2CLLA 2WBGA 1SO3A 1ZU8A 2G0WA 2VC6A 4QG9A 4AWEA 3PTDA 3EXTA 5I79A 4O4WA 3TCEA 4N4QA 1TZ7A 2ZBTA 3PSVA 5AHMA 3S6TA 1P4CA 4JFVA 1M53A 1WDDA 1M7XA 3C2EA 3WF3A 3NZPA 4KERA 1ZAJA 1MSSA 4CD5A 2G95A 3HZ3A 4QDWA 1G4SA 3GVRA 1JD7A 2VYOA 4YVPA 4Y90A 4TXEA 2BB0A 4MG4A 3LHZA 5A6TC 1F76A 4AC1X 2CNCA 3VILA 2CZFA 4EXQA 1OK4A 4JTKA 4PCSA 4CQAA 3AMCA 1SJDA 2BWGA 2Y7GA 4OZOA 1PTAA 2V81A 3LHTA 4BI7A 3L23A 1K7FA 4AHQA 1V7YA 3KZPA 3GRIA 2JF7A 1TE1A 3G3MA 1OIMA 4L4MA 1IT0A 4HHMA 1ZSXA 3T44A 1XIFA 3EDJA 2HS8A 4H9TA 1TTPA 1BVWA 1X1ZA 4CD7A 4FLOA 1IT7A 2GPTA 5AYZA 3OA5A 4ACZB 1FH8A 3GXPA 4P61A 1ICPA 2ZUNA 3GVGA 3ISIX 2QEZA 2PI6A 2ZA2A 4QJ3B 3HFYA 1TV5A 1EGVA 3PP7A 2VOMA 3E74A 1Q13A 3CK5A 4B5SA 1V3KA 4TV6A 3FDKA 2X1UA 5DY2A 2LLEA 2E6DA 3AZTA 1JZ2A 1J18A 3VKDA 2I7GA 3MC5A 5EL1A 4O8AA 1Q6CA 4GBDA 1P0EA 4XBKA 3OU8A 4PTVA 1B3OA 2XIMA 4ZQNA 5E0FA 1CZ1A 4KEZA 1UB3A 3NL3A 1UR3M 3UZYA 2WLZA 2G3IA 2JEPA 3S1XA 2X8RA 4LH8A 4EF8A 2FQIA 1ZL1A 2OO6A 1IZJA 2BSLA 1VF8A 3PWIA 2AQWA 5CBIA 3VK5A 3YPIA 2BASA 2G4FA 4CVWA 3NQ8A 4EPDC 4ICCX 2AKZA 1RJQA 1G4TA 3AXKA 1M7OA 1GVSA 4NI8A 4CCCA 2FZNA 3CT7A 1EUAA 1GG1A 1GCYA 3T8QA 3KP0A 4KKXA 2DZVA 4UTWC 3QPZA 1YRRA 2EKGA 4NZJA 4AC7C 4AW7A 3WJZA 1DHKA 2ZZ1A 2GLKA 3F7JA 6A3HA 4LAOA 2RGMA 5AYBA 3CB3A 1OX6A 1TVPA 3TOYA 3LK6A 4E2BA 4BI5A 2R8WA 4Z2KA 2A3CA 4HBKA 1SPQA 2DW6A 1F74A 1BG9A 2HBVA 2I14A 4UR9A 1ZP4A 4QISA 4UOQA 1FHLA 4H8UA 2ZVRA 5REQB 1E3XA 4F2UA 4EPBC 4HZ6A 3MDWA 4V28A 3MP3A 3UJFA 2PRHA 4NU7A 3MI3A 3WH6A 1QATA 1F9CA 2WHLA 2WWDA 4PMRA 3ZYZA 2YCIX 2IW0A 3G8RA 4CN4A 3B8SA 1FCVA 3LHYA 4L64A 1DWHM 1UH2A 4N0RA 3P3BA 3O16A 1JPMA 5A2CA 1OGSA 1EP3A 4LRTA 3VM7A 3SFWA 5I02A 3PUEA 2GFTA 5BOOA 4P8WA 1DE5A 2I5IA 2PGEA 1VFOA 3NNTA 1AMYA 1KM2A 1C7SA 2PU0A 4ADTA 5T8GA 3GE7A 1KB3A 3VIHA 5CPNA 1KNWA 3IAQA 4MLRA 2FKPA 4UFHA 3T42A 1VCVA 2WSPA 4EF9A 3CZLA 4WOQA 2GSEA 3VFCA 1BSLA 1VS1A 4GYJA 3FA4A 2ZRWA 3DIPA 4WDTA 5A8OA 4ZR8A 4KRUA 4C6BA 1SFJA 1KWKA 4I7WA 2EG7A 4JHZA 4IPNB 4A3QA 4MAVA 3H2FA 1XIHA 5E70A 3NQGA 4LNCA 3UA4A 2FGLA 1GW1A 3CHEA 1MZRA 4OTKA 1H5VA 2PGRA 4EXBA 4ZE5A 5F2IA 2PD9A 4AMCA 4JIPA 2Y24A 4YYFA 1QT1A 1OT2A 5AVNA 3GIPA 3AXXA 3QC0A 1ZPTA 5DELA 4WJEA 3Q4DA 2NSOA 3VAVA 1JGIA 3GTXA 5JIPA 4XO7A 4K68A 4MYAA 2OQYA 3LYEA 3W1XA 1W1A1 4R88A 4O16A 3GXDA 3GXNA 2P76A 2PWVA 1UR0A 3G1VA 4H04A 4Y9NA 3V7PA 1UKTA 4IGSA 3N4FA 5HNTA 1V79A 3WQEA 4O1FA 1E43A 1S5MA 1EBGA 1K4GA 3VXGA 5ENLA 2FJKA 1RCXB 1UWIA 3AZRA 2PF8A 5HMSA 3WFAA 3WJXA 4QXIA 4IX2A 1EPXA 4WIWA 2J88A 1B2YA 5IFPA 1E1CB 4QSHA 5MF5A 3PUGA 4UFLA 2ZE0A 2BY2A 3R0UA 5AHEA 3ITTA 1A5MC 2OSXA 4JPGA 4FX6M 3TR9A 2AMXA 1XYCA 3MW7A 4D6HA 3TTOA 4YNGA 3A9IA 2VFDA 2TPSA 4JGDA 5HK4A 4S39A 3BLFA 5E93A 4WSJA 1EA0A 2HV5A 3TJIA 4DO7A 3HG2A 1FWDC 3MVIA 5JUVA 4UIOA 1IHIA 4H4IA 2V3EA 4WGHA 3KHDA 2F38A 2DP3A 3ABOA 3STGA 5HA7A 3P8JA 1KBLA 4MFDA 4RR4A 4GUIA 5C9RA 3N1AA 4E8GA 3IJ7A 4Q4MA 4E38A 3V4BA 1B57A 3GC4A 2YFOA 4FNTA 4V33A 3H24A 3NQDA 2JE8A 1DORA 1SJAA 3AIUA 2PA6A 1UG6A 1ODZA 4Z08A 1E71M 4TTUA 4XISA 4GZJA 1J0HA 1TWSA 4I5UA 1DKWA 3TYBA 1RBOB 3GDTA 5H1WA 3OGSA 3VC6A 4ALDA 1PZ1A 1HIZA 2OYMA 1ZHAA 4WR3A 3BJTA 2BXZA 1CGYA 3SQMA 4B3KA 1UW9A 4C1KA 1S5TA 4PTDA 5EMJA 4UQEA 3CQ0A 4X2RA 3EOLA 4MPQA 2CLPA 4LB4A 3M41A 1FCUA 1OHLA 3GHRA 4AZCB 4GQ0A 3W2LA 1G7UA 3L4TA 2DUAA 5AY7A 1DEDA 2Z1KA 2YL9A 3ARPA 1KA9F 7XIMA 3GNRA 3GC2A 4JNZA 4HPGA 4IWWA 1DXEA 2AKMA 4R9OA 4ZXOA 2XFRA 1ISVA 1L8PA 1P48A 4LVAA 4ZB5A 4JTLA 1UYQA 3M07A 4PYSA 1HZYA 2CLOA 2Y0FA 5E0CA 3E1F1 5K4ZA 4GE8A 4MY8A 3UESA 4DO4A 3DFOA 4HZMA 1QNQA 1K9EA 4JR5A 3C56A 4NF7A 1IXPA 3ZOAA 4A21A 1QK2A 1SUXA 1JDEA 1EIXA 2D0GA 4JKLA 3U7VA 2F2KA 3IJIA 4LU0A 5H2ZA 3CQHA 4TX8A 2HDJA 4AZIA 1UZDA 4DZIA 1VBHA 1V3MA 4L9XA 5A6LA 4A2RA 1OD0A 1BQCA 2J7GA 5D33A 2VDGA 2JIWA 3MHFA 2NW0A 3BLIA 3M9YA 3W1UA 2FPYA 3DU0A 3KRBA 1MQRA 3L4YA 2DVXA 1KFLA 4C6OA 3FEMA 4D6DA 1ISZA 2PDMA 3H70A 2XVNA 2E8ZA 3NQFA 1EB3A 3W86A 3JVAA 2ZRZA 3IJ6A 4JTFA 5I3IA 3KOYA 5CSSA 1HF6A 3QGAC 4HIBA 3K8KA 1XWYA 3CYJA 4H00A 3MWCA 1PTGA 2OT0A 1B5TA 3CV2A 5CGMA 1IF2A 2NVAA 5CQ1A 2V5JA 3VD4A 3QV7A 5JQ9A 4XZBA 3WQCA 1W3HA 4OBTA 3VIFA 3ENLA 2PWGA 2XM1A 3GB6A 3JS3A 4HJFA 5FEZA 1S2CA 1RPKA 4W4QA 2WKGA 3R13A 1UIPA 1IZKA 1F7BA 5C54A 5HNNA 4AZBA 2PRLA 1L6WA 1QVBA 5E6YA 2QCCA 3REQB 2XSBA 4H8NA 1IE7C 4FOKA 4ERAA 3AXMA 2YCJA 1B31A 4FO4A 4O1CA 3VO0A 3KS5A 1JR1A 3WLTA 3AS3A 3GW3A 1NWUA 3SO7A 2AL1A 4JTGA 5I3KA 3I68A 3P61A 1JPDX 1VKFA 2UBPC 4M6QA 3GR7A 1JF6A 3SR7A 3PAOA 1UBSA 1CCWB 3FX4A 1I1WA 4L80A 3DUGA 1BYDA 3LMZA 1KFJA 2YB4A 3FY1A 2HPIA 4H19A 1BXBA 4QEEA 4HA4A 1A4LA 4TO8A 1TA3A 1QMLA 1JAEA 1OY0A 3GBDA 4JKKA 2ISVA 3BAXA 3S1GA 3CLMA 3NJ3A 4MB3A 3VIKA 3WD4A 4ROQA 2F84A 2FTYA 3WIJA 1RCOB 5FKYA 4YHGA 2HISA 2WV8A 4PC8A 1XDMA 3OYZA 3IJLA 3VOFA 3TROA 1WXJA 3EWCA 4JN8A 3KBNA 2VRQA 4CNUA 3GXTA 2UY5A 3R6IA 1QFEA 3G5EA 3TU9A 3W81A 3BW4A 1A5CA 3RAOA 1GONA 3W26A 3EDDA 3ZR4A 1NDYA 3TNOA 4LANA 3LOTA 3PPFA 1CNVA 1TX0A 1M7PA 3I4KA 1LL6A 3H4XA 5BU9A 1BVNP 4QAIA 1H7NA 4UTWA 2PP3A 3A3XA 3TTYA 1EYEA 1SJCA 3CQJA 3F03K 3ZLHA 2E6YA 1L6YA 4IP7A 2F9RA 3NGFA 4HOZA 3UJ2A 3N13A 1LLZA 3IANA 3W22A 2QCLA 3C0JA 4LF2A 3A4XA 3MMUA 5L9FA 1TPB1 5CBJA 4M56A 1H7RA 3GX9A 1WDPA 1IEQA 4XAYA 4FF5A 1XQLA 1DPMA 4QCFA 2BOFX 3WLQA 1NVMA 4Q32A 3Q67A 4H7ZA 2ZICA 2XN1A 1HXJA 1KM3A 3GZ3A 4UFIA 1JRCA 1PX4A 2J75A 2NUXA 3TV8A 4IF2A 4B5VA 3B03A 1C93A 3M43A 1MI3A 3CWOX 1X7IA 4Q8MA 4A6GA 1JXJA 2RKXA 4CUCA 5BOEA 4Q4SA 1EUNA 3TLQA 4EVZA 1KM0A 1UD6A 2IPGA 3ITXA 2VWSA 2F2HA 4Q8WA 4KIRA 5D03A 1UQYA 2TMDA 4OUEA 4K36A 1RP9A 2VD9A 2WYSA 1EO7A 3AHXA 1TB3A 1Q6RA 4B2DA 4R9XA 5FACA 3W83A 2PGFA 3LPGA 4O13A 1FOBA 1OCNA 4JICA 2GJLA 2C18A 2WVVB 3IS4A 1OQFA 1AFSA 1VFSA 3IIPA 1XFCA 4JCMA 4MWAB 3QFWA 2Y2WA 3GNPA 2TRSA 3PUDA 2E8YA 3G6LA 2E77A 1AW2A 3F2DA 4ZENA 3WLMA 1DIKA 2C79A 2YBUA 3FXYA 3AHYA 5HPOA 3CT2A 3PZGA 3WF0A 1TMLA 1VPQA 2ZKMX 3R10A 3GU9A 4N9CA 4YTUA 4PTXA 2ALDA 1TPEA 4DJEC 1M01A 5MHBA 2UY2A 1YHTA 3MSRA 3RCYA 3M46A 5A3HA 4M29A 4PMOA 2EPLX 4ATWA 3CUIA 3DECA 3ICJA 3K30A 4IH3A 5FJPA 2OB3A 2E1DA 1T99A 1JZ3A 1DJXA 1BHGA 3FGCB 3RO6A 2G8ZA 3R43A 4C91A 3E49A 3KTCA 4H3DA 3E2VA 3SQLA 3IIVA 3WBYA 1FBAA 4IIBA 5D02A 3FYYA 2WCGA 2OGYA 1JCJA 3NO3A 1UBPC 5D2WA 1WKDA 2QKFA 2V9DA 2VQUA 4QS5A 4BCEA 1EHAA 1LUCA 4GNVA 5FCZA 5H6HA 4GI8A 4M1BA 1S38A 4I90A 1UOKA 1VEPA 1XLJA 3F5KA 4HNTA 3LPFA 4FIQA 5IM51 1XM3A 1I2OA 4LEQA 1ONRA 4GO8A 3R8HA 3LGDA 6ALDA 3GNDA 4TQTA 5EMKA 3AS0A 1OG6A 4L9ZA 3DC0A 1J2BA 4A3HA 1TREA 3EMCA 4FF7A 3WQVA 1J11A 2Y63A 1X98A 3UFYA 4KEVA 1EFZA 1XRVA 1LP6A 2H3BA 3T2PA 1OFDA 1Q65A 4LEFA 3BGAA 3PM6A 3MCOA 3KVMA 3E2QA 2Q02A 3DKJA 2MANA 4X63A 1A5AA 3P74A 1VJZA 3NQEA 2VR2A 4A3YA 1E6ZA 3QGVA 3VD9A 1DQWA 2YBTA 4HKPA 4JAWA 1T41A 1IIGA 1MVYA 3PNUA 4G56A 1EGZA 3GSMA 5FF3A 1W3NA 5KMYA 4O1EA 3VGFA 5JMUA 1AG1O 2C13A 1UA7A 7ODCA 2XH4A 2BY3A 1EP1A 1FDZA 3HBLA 3APYA 4LAMA 5CAKA 3DXIA 2E9BA 2C15A 1RJRA 4EAYA 3URNA 1X8FA 1JRBA 4XBJA 3FJ4A 1KRMA 1E9IA 3CUGA 4FNUA 4Y9PA 5HINA 5IHRA 3DENA 3W37A 1OT1A 3KE0A 3N2XA 5CSRA 1IWPA 3S8HA 3E5PA 4O1AA 5DANA 5F4WA 3NYZA 5K2ZA 5T9BG 4J1OA 5DRIA 1QOQA 2WJDA 3H7UA 4GVIA 4PMVA 3L2IA 3SUTA 2QJMA 4GKLA 5B7YA 1DWJM 1N82A 4QP0A 3KBVA 2A1YA 2C1GA 3AMKA 1UKQA 3SCVA 5BMXA 3GUGA 3HGRA 3M5VA 3B97A 3PFMA 1QR7A 3LPPA 3WH8A 2GJPA 2UY3A 1R30A 4JTJA 3QHNA 1ZJAA 3N18A 3WNLA 4DYEA 3M47A 1E6SM 2ZTJA 1JD9A 1M6JA 4HNOA 4C90A 4WF7A 3UW6A 1UA3A 2ZXDA 3IJQA 4LW7A 4NZ4A 3DC8A 3WN6A 4OKDA 9XIAA 4IQLA 1RK6A 4ML4A 3TXVA 3HIJA 4WY0A 3S47A 1F05A 3T6CA 3N2TA 3QMSA 4NSBA 3OVQA 1OFPA 1GK8A 3B3DA 4P7LA 2O7QA 3MUZ1 1KFEA 2OODA 2D1ZA 2JKAA 4E2VA 4ZMGA 2DJLA 5K9CA 2F6KA 1JF5A 1EXPA 2C3ZA 4KMQA 2PDCA 4BA0A 3I65A 1TV4A 4PCFA 2IPJA 2XVKA 4PTNA 1DIEA 1RY8A 1C8QA 1LG1A 2CXEA 4O53A 3WJWA 2JF6A 4O19A 3SW6A 3W4RA 1SO4A 1BLIA 2ZYFA 2KX9A 3DGRA 4S3DA 2A79A 3GG8A 1RSCA 3N2BA 1KV8A 2YLAA 4NJIA 2J9XA 1XUZA 5EMYA 3RO8A 1ITUA 4NJGA 2XH7A 3RRAA 3ANYA 1TIMA 4HTBA 4H7CA 3RXZA 1V6WA 2QS8A 2VTFA 4C1NB 3NZRA 4N4PA 4JOMA 4ML9A 3WG6A 2YDSA 4XX6A 3S6OA 4E3VA 3MCNA 1XLFA 2PTDA 1XSKA 4IICA 2XU2A 1I0BA 3C0SA 4TR9A 3SGZA 4WXYA 5CC6A 1Q6LA 3P82A 4KCWA 2FB3A 3R79A 1AZ1A 3PS7A 5HDRA 4OE7A 3KBWA 5AYYA 3AJXA 4HSNA 1YE6A 4UQ9A 2XVGA 1RZMA 2NLIA 3B4YA 2GOKA 1EJTC 1ISWA 4N6EA 4D1JA 2CEQA 2HMCA 4J9JA 4UQBA 5GNZA 1E72M 1HX0A 4HCDA 2CZDA 3HV8A 2YCLB 4OGZA 4LUJA 3VDBA 2NX9A 3R4IA 2B0MA 1O1ZA 2QNEA 3BZGA 3MZNA 3UJRA 1XIJA 1P6BA 1FWEC 3L65A 3SRHA 5F4SA 3BGGA 1XINA 1UZ1A 3XIMA 3T8LA 2XN2A 1D8CA 3K8LA 4GPNA 3C61A 1KLYA 3WSUA 1QCWA 2DH2A 5DCBA 1KFCA 1DE6A 3CH9A 1R3TA 4ORIA 3ZVIA 1EBHA 4A35A 4CNOA 2VENA 1XBZA 2BZNA 5IBXA 4CN6A 2D23A 3UCCA 3W7KA 2QJGA 2YPIA 4A4AA 3FHQA 2C16A 1Q8AA 1J0IA 3EB4A 3T08A 3MKKA 1A5OC 3VTRA 2W6RA 2J62A 2WCSA 3MB9A 4V1XA 3SCQA 4LYRA 1VCGA 2BDQA 3BL3A 4YPJA 1A53A 1QK0A 3SJNA 1J9YA 1PWLA 4MVAA 6REQA 2QCMA 3ATYA 3V5OA 1Y8BA 2F6XA 3VDGA 4UMAA 2B7OA 2OPJA 2REQB 2VNCA 3TC3A 3GKAA 5U7SA 4UB9A 4YJ5A 4LAKA 4EIVA 4ZQMA 5FJIA 3TYEA 3VCCA 3IVTA 3HA1A 3H7VA 3QQ0A 3POCA 3OZPA 3APGA 3OEXA 5LNWA 1RV8A 4R27A 2ISWA 4PSRA 1C9DA 1IV8A 3WK1A 1EPVA 4JIIX 1QNPA 4BKNA 4S3KA 1SSDA 1VBRA 1TJ0A 4NX0A 1KV5A 4ZQPA 4Z2JA 1NDVA 3HOJA 4EOUA 2GDVA 5XIAA 4QHRA 4DYKA 4ZOAA 2WMKA 1B0IA 2Y4SA 1D8WA 2XIJA 3MP4A 1UKSA 2Z6IA 3VZXA 1W5PA 1YQ2A 3ARWA 1XGZA 1XIMA 2CBIA 3CMGA 1FWGC 3NPUA 4Q4PA 1MXDA 5CH9A 4R33A 3W6MA 3HQ1A 1VRXA 1K9DA 3N2MA 3BCDA 3LGEA 2FZDA 1HO4A 4AYGA 4HMEA 3K1DA 3C8NA 5I06A 1L8NA 3NR0A 2HWGA 3N25A 2A3LA 2OLAA 3F4WA 2INZA 3VIPA 1LLOA 2YXGA 4UC5A 3N4EA 2Z24A 2PAJA 1MDLA 4I7VA 3ZR5A 1XLEA 4DJDC 4Z1CA 3L68A 4I9AA 4U28A 2BTMA 1IYXA 2UY4A 3MVTA 2FMNA 5AHIA 3NSNA 3VNYA 1K70A 5IXEA 2ZCGA 4MGGA 1EDTA 3EXRA 3CO4A 1E5JA 1V5XA 1S2AA 1EKOA 1TCMA 1F4AA 5BXPA 2VEPA 3MI2A 4RE0A 1ZP3A 1FFRA 3LS9A 4EE9A 5I78A 5C70A 3T81A 3UYCA 4BQ5A 4A8LA 3P80A 4GGBA 5LXXA 4DX3A 1K8ZA 2XUCA 4L1WA 2ZXQA 1Q7QA 3M64A 4IGNA 4RL3A 2D3LA 1AVAA 1ZJBA 4DBSA 1CXHA 1H4PA 2EF9A 3VMPA 4HZ8A 3P93A 4JN7A 2WHKA 1AW5A 4IGHA 1U5VA 4IUOA 5CZSA 1R3QA 1QRQA 2R1MA 3KVLA 3W28A 2FH8A 5D09A 1XBYA 1D7FA 4DJDD 3OQEA 4AAJA 2DSKA 2DQXA 4HA3A 3MBFA 3NA8A 1TJ2A 4O17A 5HWMA 3PZOA 4HHHA 3SY5A 1FWRA 1OSEA 3CU2A 1WBJA 1NAL1 1Q6DA 3NPVA 4HOXA 3VD7A 3S5YA 2A2IA 4IPIA 3CV6A 4WJ8A 1TMHA 4M5PA 2VVSA 1GUVA 1Q6GA 3R8RA 4DXVA 2AAMA 3N9KA 1FWAC 4PMDA 5FJJA 2V68A 1PEZA 4URIA 4JX6A 5MKGB 4LVBA 4LVGA 1A5NC 1GOWA 3DOPA 5A6SA 1AK5A 1UR9A 4HPNA 3RJYA 4PTWA 3SCWA 2FB2A 3I3DA 4UTTC 4WK9A 2A6NA 3W7CA 2PDWA 2FDMA 2CWXA 2J24A 3G24A 3L0NA 3W74A 4XIMA 3W7DA 4L6DA 7A3HA 2X40A 3H2NA 3QV9A 3L4ZA 4X9YA 1ELSA 2J7BA 1ZY9A 1N2VA 2PGWA 5CPMA 2G3MA 1HVXA 3O0KA 3PZ9A 2ALRA 3AC0A 3CUXA 1R86A 1QPQA 4W93A 3U8GA 1KCLA 4P7QA 3V16A 1M9HA 4GQQA 4NYUA 4JTQA 3W76A 5DT7A 3CZKA 3ZVHB 3GNNA 1E9LA 3CIWA 3QPYA 1TPC1 4N9EA 1MZHA 4QBXA 3LI0A 4Q8QA 4F0MA 4YN5A 3KBJA 4KWSA 1OFBA 2ZX5A 3TSMA 5AC5A 3CL7A 1PYMA 3GDBA 4MADA 5FEWA 1FUYA 4H9YA 1BQGA 3V75A 3WX7A 4UTKA 3T40A 2P5NA 1YBQB 1GVFA 5AYXA 4IX0A 5CJ5A 1SMAA 3UWQA 3CPUA 1PKYA 1SJBA 2DVTA 4QITA 1VFFA 2DORA 4IZGA 4WVXA 1EJSC 1EZWA 3TJXA 4JHMA 2XISA 3K8MA 4ZO6A 2XFFA 2OLSA 2YL6A 3W6LA 4U4MA 4K7YA 2WSQA 3EDKA 3VNMA 4LBUA 1PX3A 2P10A 4Q4QA 2VJXA 1WE5A 5LYRA 1R3RA 2Y5SA 4RW5A 1OC6A 1OFEA 3ANVA 4UTFA 3C0QA 3KUMA 5C71A 4ZSUA 3ZLGA 1AD4A 2R94A 4UOZA 1SW7A 1ECQA 2HNHA 5I24A 3G1XA 3GVVA 5A94A 4PUDA 1F73A 3RK8A 3W02A 2D0HA 3MY9A 1ITXA 1XLIA 2I16A 2YSWA 4M7TA 2HVMA 3W7HA 4XVEA 4PBEA 2OZ0A 3TSDA 4FNQA 1XKJA 1PKMA 5CEWA 1U2YA 4XD3A 4E8CA 1OK6A 4GC4A 3W7JA 6XIMA 1R2RA 4KWOA 4X2PA 1LQ2A 4OV4A 1UIOA 4HYRA 3DGBA 1E6QM 3L5MA 4LNYA 2C1HA 3L67A 4KFOA 3VNDA 4HU8A 4HMNA 4XG1A 2V3FA 4A8RA 4Z2LA 1W2VA 4UCGA 3QN3A 1ENUA 1XSJA 4J3UA 8XIMA 5A8NA 2YCLA 1CYGA 2WQDA 1NOUA 1W5MA 3VX0A 1M3UA 4JZ5A 2QUVA 1GEQA 1PZ0A 3UNTA 4PMNA 4XD5A 2HE5A 7TIMA 2GQ3A 1HUVA 1FRBA 3LCLA 4LV9A 4O1DA 4GVHA 4PCNA 3ABXA 3MI6A 4C6DA 5PTDA 3H12A 2J6XA 2Y89A 2OWCA 3RLUA 2OWWA 2ZX8A 1PDZA 4JIEA 3LXCA 3WDHA 1KXHA 4YLWA 2PUZA 3SZ8A 5HATA 1RHCA 4C6IA 1SZFA 3H54A 2QCNA 3A5VA 3I7QA 4UQCA 3KOZA 2VR5A 3F5JA 3UT0A 2BNJA 3NQCA 1OWQA 3WLKX 3QZ6A 2J27A 3CZJA 5HWNA 5D4YA 3DFQA 3DZ1A 3BMXA 1W3JA 2QMJA 4AY1A 3TQVA 2DVUA 1TJRA 3U0HA 1E1FA 3VKAA 3TA9A 3O05A 4D8LA 3URBA 2YL5A 4ROPA 4IG2B 2QF8A 2DZAA 1EP2A 3PJXA 3LTPA 3CBWA 1ISYA 3RLHA 1N55A 3FHAA 4EWJA 1D3GA 1DWIM 1REQB 3M0LA 2Z0IA 5HMEA 2H9AA 2O9PA 3KDNA 5LNRA 3GDLA 1DJYA 2HNEA 2PMQA 3GIQA 3TH6A 3UGRA 1O5RA 4IXHA 3VKKA 1ML1A 2J7CA 5GJPA 3ONCA 2CHRA 5D38A 2V3GA 3W84A 2FHCA 5E0KA 2DZUA 5D2VA 5I3FA 1KXTA 3NPXA 5C7VA 1JAKA 4TTGA 3ARTA 3W29A 4FS9A 4Z1DA 3RU8X 1QO5A 5T91A 4QM1A 3O6DA 4OECA 1FKXA 2VC9A 3LQLA 5KETA 1OF8A 4A22A 4UTUA 1AQHA 3PB0A 1J0YA 5EKYA 3Q37A 3D5HA 4O1BA 3Q94A 5LZLA 2DT3A 1MEHA 3W7OA 1R3VA 2Y7FA 1MUCA 2F6UA 3ZMRA 1Z89A 4INFA 2YJQA 4KS0A 1A5UA 1R5YA 4WCJA 3E0FA 5I23A 2QCHA 2VFEA 4GNKB 1IGWA 2VXNA 3R94A 1W9BM 3AIEA 1OB0A 3DI0A 4NI3A 1I4NA 4MKVA 2DIJA 3MO7A 2Y62A 1OBAA 2B31A 3UP8A 4NQ1A 4IIEA 3AS1A 3H4GA 1ZGDA 4C6LA 4PGLA 2QHAA 3VGGA 1J8VA 3OOQA 3UBPC 4EANA 1ICQA 3EMZA 1M1BA 1G0CA 1TIWA 4H9VA 3FOKA 5G5IA 2AAAA 2BS9A 3GY1A 4JNYA 1E0XA 3QTPA 4WQ6A 4GFSA 2HQAA 1V02E 3FK4A 3EDFA 1JCYA 1SYTA 4EP8C 3FDGA 3ZLFA 1XX1A 3AWNA 2YXOA 3TJLA 1XPGA 2D73A 4N6FA 1TJ1A 2ZWZA 5GNXA 5KINA 3GIYA 1Q4WA 1H1YA 2HK1A 1BGAA 2Z27A 1MYRA 4Q33A 2J7HA 3GU1A 4GFIA 1XF0A 4BZYA 1Q6EA 3H21A 4N42A 1NWSA 3UVAA 1THFD 2TSYA 4GKTA 1KR1A 1NDZA 4RLIA 3RUBL 3B9EA 3BDKA 4FNRA 4L6OA 2XWDA 3VM5A 4DN1A 3TTSA 3NQ6A 1RR2A 5M2FX 2GWGA 1K9TA 3WK0A 3QTGA 1QO2A 1DQXA 5CZTA 1FH9A 1XYLA 4DJFD 3C3NA 2OJPA 4Z1YA 2ZZ7A 4B2DD 4GX9A 5AC6A 2DT0A 3G1YA 4PB5A 3L5AA 2ZZ4A 4E6MA 1B1YA 4IQJA 2J4GA 1FP9A 3O15A 4L61A 4LXFA 1JZ8A 4V1YA 1VENA 3U2EA 1WUFA 1H63A 5CPOA 1UPMB 2WLYA 2A21A 4RW3A 3HURA 1K6WA 3VIOA 1FHDA 3P67A 3GVWA 3STCA 3RMJA 1CTNA 4MF4A 1O7AA 2ZRUA 1JYNA 4HOWA 2G50A 4PUNA 3TQKA 5AZ1A 4J3VA 4MB1A 2VGGA 2XVPA 3NWRA 4LGXA 1C90A 2WCAA 4JYDA 4WGXA 1FDYA 2WMGA 4CU6A 2JIEA 3B8TA 4IL0A 4KH2A 2Z25A 2FZBA 3LNPA 4DXKA 5A2BA 2ZTKA 1ZAIA 1NOFA 4OU1A 4ZE4A 3USBA 1H60A 4IQDA 3UCQA 8A3HA 1JL8A 3C4UA 1C8YA 1QI0A 1K1DA 3A9BA 4H2HA 1JDDA 1U1HA 2CLIA 3I3EA 3W7QA 1K6AA 1F3TA 4ZBCA 2VEKA 5DFAA 4CKQA 3PNZA 2WSKA 3NZ1A 4OIFA 3PR2A 4G8TA 1VEOA 4B5XA 1TCDA 4UFJA 2HEJA 1FP8A 3UF9A 4MWAD 2DT2A 4AD0A 2IKHA 3AJ7A 4QDPA 4GI4A 3H7RA 1ZAHA 3CAKA 3LSCA 3W01A 3SUVA 4JCLA 2PFHA 3W72A 2IQTA 3S5ZA 3PPHA 4DM2A 4JTDA 3BMVA 4GD0A 1OYBA 1YDYA 5E9XA 2PDLA 4KGLA 3WQWA 2CKSA 3CYVA 1M41A 3NEHA 3QJAA 1VP5A 2O9TA 3EWDA 4MTVA 1VR6A 4GYFA 1DHPA 3MO4A 3V5FA 1LOSA 5JH2A 1GZJA 1VIZA 3LM3A 1JYXA 2B7QA 4AH7A 1Q2RA 4I9TA 1U22A 3BSHA 5IFTA 1GJPA 2ZZ3A 2EO7A 4MY9A 3WEZA 3GTHA 4G1KA 3W2MA 2YGYA 4DLFA 4IMGA 1HKIA 2CCRA 4M80A 1WKEA 3RCNA 1XLGA 4KWWA 4IPJA 2J6VA 5DMMA 2HXTA 3EA2A 1UJQA 3MYOA 4ZSTA 3LNMA 2Z7KA 1HJUA 3PBVA 5HJXA 2RH9A 1WNOA 4G2DA 4FOUA 1LWJA 3VDAA 5TBOA 4AYSA 1XGEA 2DUXA 2JALA 3H2EA 3OZYA 4GUHA 1XICA 2VX5A 2IQ0A 3VNZA 3CPGA 4MNLA 2BOGX 5AHLA 1S5WA 1GZGA 3U48A 3MYPA 3WBWA 5F7UA 1B3ZA 1JPKA 1KXVA 1OFOA 1XBXA 2DW7A 1KBJA 2R1NA 3TWAA 3FVDA 5HAOA 4GHRA 4K37A 2VKZG 4HU4A 5FIPA 5CPSA 3OZOA 5KITA 4XD4A 2WOQA 1MRQA 2L5HA 4O0QA 1BWKA 2FZMA 3H23A 2VEMA 3TMLA 1W1ZA 4UQDA 1G94A 1OEPA 4GI9A 3O8AA 1TWDA 4RNIA 1X96A 4TMBA 3QQ1A 1W3KA 4BQ3A 2W61A 1T96A 3TNBA 3G1FA 2WWCA 3PZQA 3WD0A 4J2PA 3TYUA 4K1GA 3RRXA 1TPFA 2CFFA 4D6IA 4M8UA 1UUMA 3PZUA 3E0LA 5FF4A 3KW3A 4W8AA 4I8DA 3L2LA 1PKLA 3SM0A 2PC4A 3AAMA 3N6HA 3RLVA 4UNLA 1T5AA 1Y5VA 4TUFA 4JQAA 3TC7A 2YLLA 4NILA 3DHFA 4R7WA 3VIMA 3RILA 1K7EA 2V0TA 1SM9A 2GGHA 3WDRA 3VI2A 3C6CA 2GSJA 1R85A 1W31A 3GR4A 3PULA 2G5WA 3MU7A 2AOSA 2RHGA 3EEGA 3OIHA 2XH2A 4I3GA 3O9NA 4CQCA 3NZGA 3GHTA 2WMHA 1O12A 4GIEA 1RD5A 4MUPA 4AVOA 3AOFA 3THQA 3UPBA 3BPWA 2XYLA 1QI4A 3TDFA 1UWQA 4DUVA 3KM8A 3KCLA 5IBXC 3UXDA 4Z17A 4LWWA 1QI5A 3G18A 1T8QA 3DFYA 3OO2A 2E5DA 1V93A 2NV1A 3IGXA 3VABA 1E6NA 1R8LA 2J8GA 3ZIZA 1DV7A 4HP5A 1Q2SA 3TN6A 4LAUA 4C6KA 4BF5A 4G7EA 3W7IA 1CXIA 1H09A 5GPRA 2J7EA 5BWFA 1U1UA 2QJIA 5I0DA 2Q6ZA 3AI0A 3DHDA 1Z7AA 3C2FA 4JDBA 1EGMA 4C6JA 2R14A 4C6MA 3BLPX 3ECQA 4WRHA 4MAZA 1E6XM 1W9PA 3TK7A 4F40A 4RNJA 3UG4A 4DWSD 2DGAA 1TKKA 2RFGA 3RDKA 4TV5A 1B9BA 5FJRA 2YDAA 3JZUA 1K4HA 4E0CA 2Q01A 5A8MA 3DX5A 3IJ9A 4AD4A 1NTHA 6TAAA 4RUBA 1LLWA 3CS2A 2C1IA 1V6YA 5CPTA 1GQNA 2X7WA 2E67A 4ZGYA 4OBRA 4AD3A 4EKJA 5I3GA 7TAAA 1V3LA 4GCXA 3WJYA 2YA2A 1X97A 2FZ8A 5EA9A 2NXHA 1LF1A 4GCAA 1YXYA 4WLCA 1UP3A 4P7NA 3ITYA 1POKA 3DYMA 2O4MA 4CD4A 2IKIA 1XC6A 4ZCWA 2EPMX 2ZX6A 3UPWA 5BCAA 1OZMA 2DPEA 4NVTA 1VYPX 4PCPA 1AA1B 4W87A 4FZIA 3ABSA 3SIMA 3B8VA 3VGDA 3AHVA 2VGFA 1KKOA 4JL2A 2I17A 9CGTA 1K9FA 2NQJA 3DG7A 1XPYA 3SGUA 5M5DA 1U5JA 1QPRA 2GSHA 3BANA 2PODA 1A80A 3UU0A 1NFPA 3RNDA 3U57A 4ECLA 5E1QA 3IK2A 1TWWA 3ES8A 4H9ZA 4PFMA 1K8XA 4QQ3A 3T7VA 1P6WA 2XSAA 3LHWA 1RLDA 3BG5A 3ABRA 3NSMA 1ITQA 1YDOA 4PA8A 3VD5A 1VPXA 3PWGA 4X3ZA 3N19B 1OCJA 4AY7A 3F2BA 2PC8A 4XO6A 1UD8A 3CV1A 3WDQA 3CXOA 3FIGA 2DH3A 1R87A 2ZQ0A 1NARA 3S9ZA 4GJ1A 1ADOA 5C6MA 2DZSA 4OUIA 4S3AA 2XSXA 3CJPA 3L4VA 4PRRA 2R1KA 4UXDA 3UXLA 3ZJ8A 4U31A 3LHUA 3CAQA 2OOFA 2ZUUA 4UFKA 3VDCA 3PPGA 2C0HA 2W92A 2V82A 3CM4A 3DYPA 3WUGA 2QPSA 4W7WA 1ZZMA 3RX2A 3MKCA 2NT0A 1UASA 4GIRA 3AHZA 2G3FA 1WKYA 1QNRA 4IMEA 1PL9A 1E5NA 2GGIA 3FGCA 3WQOA 3BMWA 2V2CA 1XFBA 5FD0A 4LBRA 1RD6A 1YNYA 3D47A 3QPEA 2QDDA 3QHMA 4RZBA 5TNVA 1Y7VA 4NAEB 3NM1A 3ZVHA 3EWYA 3WQGA 2J8FA 3L4WA 1L0PA 5D9NA 3UXKA 4PUJA 3K4AA 3STEA 1AH0A 1ZBWA 4B15A 2RUSA 1D7KA 2FPTA 3BZJA 3BG3A 4MJMA 4CCEA 1MO0A 4YYCA 3BWWA 2ISFA 4K2SA 2VCCA 3AALA 4M6UA 2OOGA 1SR0A 3FKRA 1FVPA 2PLKA 3AIRA 3SCPA 4HN8A 3NXFA 2J9ZA 3MUCA 2POZA 7ENLA 1KM6A 3OZMA 4LV4A 2WAGA 3LLDA 3B0VC 2QAFA 1L6GA 3CWNA 3LHVA 3GAKA 5EGRA 3RPTA 4GVGA 3FV9A 4PUMA 1H5YA 1CXLA 4GXWA 1Q7ZA 3LERA 4PZVA 5HJYA 3BICA 5G4WA 2CLMA 2X2YA 4QSFA 4HNCA 4CGTA 4GWEA 4U10A 3G8EA 1B54A 3ARYA 4QIUA 5XINA 1XDLA 5SWUA 3E96A 3WNNA 5FL1A 4DAIA 5FL0A 6REQB 2DEPA 2WZTA 3S1VA 3MV01 1EDQA 1W54A 2IPWA 3A47A 4MSSA 3W1RA 3LB0A 2BVDA 3SY1A 3AQUA 4M0XA 1H2JA 1E3ZA 2D2JA 4IHCA 3CMFA 1G7VA 2QUMA 3AISA 5C9XA 1KR0A 5AN7A 1WZLA 4ZFCA 5G4HC 4G6CA 3U5YA 3WUFA 1VFUA 4WEVX 1OFQA 1AQFA 4DJED 2JKPA 1E6RA 3A24A 4Y9MA 3CH0A 2PDGA 1UD5A 5A6BD 3WQFA 4XAGA 3S2JA 3MKVA 1EJWC 1XYBA 1KFBA 1DJZA 1QTWA 2DY3A 2F61A 4Z0SA 2AGKA 2IUZA 4CQ8A 2J78A 2FGBA 1XG4A 5J8LA 3BAKA 1W1IE 2KZHA 5LGXA 3S0CA 2DT1A 3EX3A 2TAAA 4L6HA 3MS8A 3UGVA 3N6JA 3KTXA 4MPKA 1OYCA 1ZTVA 2PEVA 2PTYA 2OX1A 3FA5A 1B30A 1FWTA 2Y1HA 4AWSA 2P0IA 2YKKA 1F07A 4GYPA 4XAZA 2C8NA 3QZEA 1WYIA 1F6YA 3P62A 4POCA 3WLPA 2GYIA 4ATLA 3WD3A 1U5HA 2Z28A 5REQA 1BKSA 2WC3A 1RJPA 1TA3B 1YADA 3BVJA 4XZWA 2OYKA 3SN1A 1H49A 2GDQA 1P5BA 2R82A 4IJCA 4Y2WA 4Q8NA 3TFXA 3FW6A 1UP2A 4RZ6A 2GJNA 3KAOA 2PF0A 3ARQA 1Y0EA 2CC0A 1TTJA 3CQKA 3TUUA 3ZT6A 4RDYA 1H11A 2QUNA 2GDUA 3OLEA 1J96A 3KEHA 2I5QA 3NTYA 2GGGA 4RXFA 3HG5A 3UPMA 4A29A 3UA3A 3VNLA 1J5SA 4DF1A 5ABHA 4NZ1A 3GC5A 1EF3A 5D9MA 4XTIA 2OXNA 2NZLA 3E3HA 1XR2A 3ITOA 4UMCA 3WK2A 3RX4A 2VX4A 2YBVA 4RX0A 1OZQA 2R1LA 3NEVA 3PZIA 4B16A 3TP4A 3CV7A 4JTUA 3SBFA 5CPQA 2NSXA 6ENLA 1UUQA 1PIGA 2WPGA 3L5LA 1X6UA 2VCAA 3THCA 1E56A 2QW5A 4XBSA 1XRTA 4O57A 3T4CA 2CIPA 1ADDA 4C6PA 3FSUA 3SFKA 1BKHA 4DY1A 3TN5A 1HGWA 4WKAA 2B7PA 2V2DA 3CIVA 1HW6A 3R0KA 5BW6A 2Z2BA 1W9VA 1BXNA 1NSJA 3DFTA 3OG3A 4RZ4A 2ZRXA 4DBUA 1UMLA 5D2YA 4H2CA 4E5TA 1FHUA 1D2KA 1MWOA 4LVDA 2YXXA 1QPOA 3RPMA 3C2VA 3EOEA 4MHBA 2D20A 3R2GA 3KXQA 1IEWA 2ACQA 2XGIA 3ZR6A 4AUBA 3QM3A 3B9AA 1UH4A 1XYMA 2OEJA 1LDCA 2FDSA 1QXLA 4NG3A 4RPPA 2ZOXA 3LRMA 4NZ5A 1ZRQA 4ZTXA 4ZTYA 2DIEA 5KZDA 4P7OA 3MANA 5DMYA 1D3HA 2VX7A 2WVTA 4NAFA 4FPSA 3QR3A 1RUSA 4MWAE 4FXSA 3BAWA 1L6FA 4IUGA 5GQBA 3RJXA 2J77A 2ZDSA 1GQKA 3EYPA 3DBNA 2RAGA 1HL2A 3FXGA 1J12A 4PMJA 1GVYA 3INPA 3GS6A 1G4EA 1W3TA 1TV7A 4PL2A 3KBSA 3OPSA 3STPA 1KFWA 1HFBA 1Z32X 4MZYA</