4TXOA

Crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
177
structure length
177
Chain Sequence
PTGDPACRAAVATAQKIAPLAHGEVAALTMASAPLKLPDLAFEDADGKPKKLSDFRGKTLLVNLWATWCVPSRKEMPALDELQGKLSGPNFEVVAINIDTRDPEKPKTFLKEANLTRLGYFNDQKAKVFQDLKAIGRALGMPTSVLVDPQGCEIATIAGPAEWASEDALKLIRAATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How Periplasmic Thioredoxin TlpA Reduces Bacterial Copper Chaperone ScoI and Cytochrome Oxidase Subunit II (CoxB) Prior to Metallation.
pubmed doi rcsb
molecule keywords Thiol:disulfide interchange protein TlpA
molecule tags Oxidodreductase/copper binding protein
source organism Bradyrhizobium diazoefficiens usda 110
total genus 47
structure length 177
sequence length 177
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4txoA00
3APOA 2H6ZA 4HI7A 1UC7A 2FA4A 2H1AA 3TKPA 4ML1A 1R26A 4I8BA 2VLUA 5CNWA 3DVWA 2VCVA 3FZ5A 4EVMA 1EOGA 1O6JA 5HR1A 3GFKA 2V6KA 1QUWA 3HYPA 3W8JA 4F2IA 3EU4A 3UMAA 2EIRA 1MDKA 3D0ZA 4HZ4A 5CYYA 1ZCPA 4JZQA 1U87A 2QKEA 5IO0A 2WGRA 4IP1A 1V98A 4EDYA 3D4MA 5D93A 1GUMA 5DBQA 3DYRA 4JBBA 2LJKA 2C4JA 5D9TA 1OYJA 5H5RA 5IMCA 1FHEA 4KCEA 1PD21 3DD3A 3FYGA 4WF5A 3RBTA 2HZEB 3UVTA 3WGXA 1O8WA 1XW5A 1PSQA 4NHWA 4POKA 3A5WA 2YWOA 1JHBA 2H74A 1X5CA 2E2GA 6GSUA 2L4CA 4JU5A 3GSTA 1R4WA 2YPMA 4J56E 1T00A 1FAAA 3QDNA 1GWCA 5IMFA 2WULA 2GZZA 3TJJA 3TCOA 4V1Ap 1GSYA 1XIYA 1ERTA 2B5EA 3BD2A 3WD6A 2DJ1A 2IIYA 3VI7A 3QAWA 2C1YA 1G6YA 3VI5A 4J2FA 3TKRA 2R4VA 2OA7A 2LS5A 2NTOA 4GSTA 4K7IA 4AJ7A 1K0OA 2X64A 4KUNA 3SWLA 3RHBA 4O7HA 3GA4A 1MTCA 4TXOB 3EYTA 4TR1A 1TJDA 2JL4A 5EVOA 3HJOA 3W8SA 1EEMA 16GSA 3HKRA 5HFIA 2HE3A 3TJFA 3TKSC 5AIXA 1K0AA 4XTSA 1OVNA 5FT3A 3V1WA 1AC1A 1GTBA 1SL1B 1VRSD 1XWGA 1QQ2A 4KNDA 1T8EB 1I9DA 4N10A 2GT6A 1R7HA 4LA1A 3GX8A 3C7MA 1GSFA 1Y6EA 3EURA 1U6TA 2A4VA 4EDZA 1G7EA 1DUGA 4EUYA 1QXHA 3BCIA 4BWQA 1F9MA 2P31A 4MJAA 3NOFA 3QPMA 4WBJA 4CDOA 4DSQA 2R6KA 3LYPA 2DJKA 2QGVA 1EEJA 4MZCA 1KEBA 4MF6A 2C0GA 5IPHA 2ZNMA 2L57A 2HZEA 2FLSA 3GMFA 1FOVA 1OAZA 2V32A 2AB6A 3TJBA 3A2VA 2JZTA 3E3EA 14GSA 12GSA 3ME7A 2PERA 2VL2A 3ZVJA 5KN1A 3S9FA 3LWAA 1NSWA 2GQMA 2NBSA 2VO4A 4PGTA 4TN8A 3RPPA 1XWKA 4YAVA 2GT5A 1N8JA 2KP2A 2DC5A 3GNJA 4GXZA 4PUAA 4KSMA 3RAZA 6GSWA 1K0CA 2NDOA 2NVLA 5DAKB 1SK2A 2VCZA 5DJMA 4OCEA 4ZBAA 2F8AA 2B6MA 3M9JA 1ZGNA 2MBTA 1OE8A 3VLNA 5JCGA 1A2MA 1YF0A 2I1UA 1TI3A 1GTIA 1UVZA 3IPZA 2HSHA 4TXOA 3O3TA 1KTEA 4OMVA 2AYTA 1EGRA 2JU5A 1RW1A 4XS1A 1XVWA 2GTUA 2VL2C 5E59A 1WPIA 3GV1A 1TDIA 3FHKA 2FNOA 3E9JB 1TTZA 1TK5B 2PVQA 1WE0A 3C73A 2K9FA 3TOTA 4FYUA 2HLSA 4ZL9A 4V2MA 5JWOB 4IQAA 2YWMA 5HQPA 4JRRA 1Z6MA 2ALBA 1RQMA 4HZ2A 4JR6A 1K0NA 3UARA 3GYKA 4MPFA 4QQ7A 4BVXA 4KGIA 2E0QA 5DCHA 1TRWA 2CVKA 3ZVJD 1B4QA 4POMA 1G0TA 4WXTA 4HQSA 2CA8A 1UN2A 1Q4JA 2B1KA 1PRXA 4K9ZA 4O5RA 3GUSA 2VL3A 5J9CA 1SK1A 5JWRB 2PWJA 3GURA 3F9UA 1XW6A 2ZUPA 2OE3A 4KA0A 1THXA 1USBA 1XBSA 4KB3A 2J23A 3IDVA 2C80A 3GL3A 4MK3A 18GSA 4IKHA 5IO2A 3HJMA 4OO4A 2EIOA 4HUAA 4DVCA 2GZPA 3ZMLA 3FEUA 5LD0A 1AAZA 2YWIA 5ELAA 4WR4A 1AQVA 1WJKA 3H79A 4ZIJA 3UEMA 3C8EA 1AXDA 3P2AA 4I5QA 3Q18A 2N5BA 1R5PA 2L6DA 5FWGA 5DAKA 5B6NA 2IPAA 4ZB6A 4GTUA 2K8VA 1VF2A 2TIRA 2LEGA 2RM5A 1PQNA 1C72A 2H6XA 4L5LA 3LFLA 2H66A 5ECSA 2YJ7A 4HS1A 5HR0A 4TXVA 4MH2A 1M2DA 3ERGA 1IYHA 1XWCA 2GSQA 2QC7A 4LMWA 2WDUA 3EMXA 5DDLA 4WBRD 5CRWA 1G6WA 1FG4A 4HU9A 1ZYEA 2LTKA 2L5OA 5CO3A 2GZYA 1T1VA 3IE3A 2AUVA 4KDUA 1ZYQB 2IL3A 2YZHA 1TP9A 2GSTA 4TR0A 5ECKB 2B7KA 3G7IA 1T4YA 2H1DA 4X43A 6GSVA 3CBUA 4NHZA 4L0WA 3BJ5A 3D6IA 3QFBC 4ZL8A 5EPFA 4IHUA 1XVQA 3WGEA 3IAS2 3F3RA 4KDYA 4IQ1A 3HDCA 3A3TA 4DSSB 3P8WA 5IOXA 2O87A 3H93A 4OO5A 3LJRA 3KH9A 4RQRA 2R3XA 2CV4A 3ZTLA 3FZ9A 3OR5A 5F8BA 4KCAA 3D21A 2RM6A 3HVXA 1TOFA 2C0DA 1XPVA 1XOBA 4TW5A 2I4AA 1XXUA 5KEJA 3F4SA 1WWJA 4POBA 2VL9A 1EWXA 4ID0A 3SBCA 5F05A 4CHSA 3ERWA 5KN3A 2V2GA 3FRCA 2M72A 5GSTA 2BTOT 3CSIA 3ZIJA 1ILOA 4MA9A 2M46A 1HNCA 4RQXA 2DMMA 3DKSA 4IN0A 3TGZA 1ERWA 4X1UA 5GSSA 4YQUA 3L0HA 3G9BA 4Q5NA 4K1FA 2VCXA 1F37A 5G2ZA 1YEXA 2CT6A 4FH8A 4JEDA 3QAGA 5IPGA 1S3AA 2VAFA 2LJAA 3F3QA 4V2NA 2JZRA 2LKUA 1W89A 2VCTA 1DSBA 2YP6A 5FHIA 2HT9A 3EMPA 4O32A 2L4QA 1BEDA 1SK0A 1F3BA 3F63A 3C1SA 1A2JA 1LU4A 3F6DA 4OFMA 2VUPA 3NZNA 4PXOA 3M9KA 3VPQA 1TW9A 1X9MB 4GWRA 5L71A 3J7Yk 2GVPA 1XCCA 1OE7A 5ELGA 2V1MA 3W6GA 4TR3A 2YCDA 1Z5YE 2YJHA 5IQYA 2JSZA 1K3YA 2CVDA 4XS6A 1Q98A 1X0RA 2I9HA 3TKSA 2PBJA 3GSSA 3F0IA 3IAM2 2OE0A 5AGYA 1FW1A 2VD0A 4EKZA 3KH7A 2RUEA 1A0RP 2PUKC 1S3DA 3WYWA 4IJ3A 2F3MA 4ML6A 3IK9A 3Q74A 3BCKA 1K0DA 3ISOA 1AQXA 2H72A 2AAWA 4NV2A 3KJYA 2IWTA 5ECLB 5LNKe 3F8UA 1Y25A 3KCMA 2P0GA 6GSTA 2HZFA 4HOJA 2H01A 4QL9A 4H86A 2ON7A 5G5EA 3TJGA 3ZZXA 2HRFA 1THOA 1VF4A 3E0UA 1T7PB 2HYXA 1ERVA 3KGKA 4EC0A 2H0IA 2L59A 4GQCA 4PUFC 4YQMA 1SENA 1B48A 5AN1A 5E4WA 3TOUA 3PINA 2HFDA 2E7PA 4N0ZA 3US3A 3WGDA 4K6XA 1K0BA 5IMDA 2H1GA 2B1LA 3L9UA 4EF0A 1SJZA 2I81A 4ECIA 1GP1A 2DBCA 3GKXA 2WS2A 2VCQA 2HXKA 1BG5A 3QD9A 4OCFA 5J9BA 2IMDA 1A8LA 3HXSA 2OACA 1VF1A 4BPYA 5CREA 4P3YB 3L9SA 1AQWA 3IBHA 3F4RA 9GSSA 1EOHA 2YWNA 1GRXA 2ZCTA 4ZB9A 3QR6A 2LJRA 4E8EA 3ZLPA 3GKKA 3HHVA 3ME8A 1CQGA 3HY2A 1WIKA 1DBYA 4IW9A 4CW9A 3AY8A 3ZIVA 4I6XA 5IIZA 1XFLA 3KXOA 3H4KA 4GQFA 1GUHA 2KP1A 2IN3A 3DXBA 2XPDA 4WF4A 3UIWA 1EP7A 1K0MA 22GSA 2ON5A 1E2YA 3ZYWA 2WRTA 4G9HA 4F03A 4MCUA 2LUSA 4PQHA 2B3SA 2H8LA 3KP9A 2D2ZA 4OWYA 5DVBA 2AJQB 4RUVA 3DIEA 1M9BA 3GL5A 2E2MA 5KN0A 4IS0A 4FYBA 4F0BA 3KIJA 3CXGA 2JACA 2OJLA 1CQHA 5B7CA 5IMVA 4GRFA 4XHMA 5ABRA 2CAIA 5IM9A 3FR6A 5JCUA 4X0XA 3HJPA 3GHAA 2VIMA 3VWWA 1TK0B 1KNGA 2JSYA 2P5QA 4POLA 1OC9B 4MABA 4XRAA 4IJIA 1SL2B 2DJ2A 4MZWA 4BWSA 2B5XA 1PL1A 4Q5FA 4F82A 3ZFLA 4MH3A 1PMTA 3GH9A 2AV4A 3L4NA 4MP4A 2J9HA 3KP8A 3G7JA 4EL1A 1JZRA 4LL1B 2R5GA 3PH9A 1K3OA 5D9VA 4L5OA 4ZILA 3LEFA 1SJ6A 4GLTA 4MMMA 2OE1A 4EO3A 1MD4A 1QGVA 1O85A 5C04A 1BJXA 1H4OA 2FD3A 3ERFA 2H30A 2REMA 3C71A 5EL8A 3MWHA 2H0HA 2XBQA 2QSIA 3VWXA 1VGLA 4KDXA 2AHEA 2R2JA 3IR4A 3UBKA 2CZ2A 1R5AA 1FVJA 3QAVA 1S3CA 3K8NA 1SYXA 3IXRA 3M8NA 4ZB8A 4AGSA 5J3RA 2GGTA 3I43A 2LV3A 5B8AA 4MLYA 3HD5A 1MD3A 1Z9HA 3TUEA 1XWBA 1TXXA 2XPEA 3I6AA 1ERUA 2EIQA 2YZUA 4KX4A 2IFQB 2GQLA 3MSZA 1MEKA 3QOUA 4I2TA 3IRAA 4NMUA 4BA7A 3CSJA 1FB6A 3P90A 2XC2A 4KSOA 4ECJA 4V2LA 4HJMA 2OADA 4K8MA 2B7JA 3APSA 5CRHA 1AW9A 3C1RA 1J08A 1AUCA 2LQQA 3EE2A 4IBPA 1B9YC 3FZAA 4HEA2 2GLRA 5DJLA 4MDCA 1OC9A 4KW6A 2YV9A 1Z7PA 3KMOA 1V9WA 1ON4A 2IMKA 2PMTA 2H76A 1N2AA 1TU7A 2C3TA 4PNGA 1TU8A 2YANA 2KHPA 1JZOA 2X99A 3EVIA 5D8IA 1PKWA 2KUCA 1GH2A 3TRXA 2CX3A 3FZ4A 3EWLA 1JLVA 4K7OA 4RI7A 3KMNA 4N30A 4JR4A 1YKAA 1T3BA 3GKNA 4XRDA 5ECOB 5CRDA 1U3AA 1XZOA 4TR4A 3EC3A 2A2SA 5INYA 1GLQA 2MYGA 2OBKA 1O7UA 5J4UA 3VFIA 1J0FA 4HDEA 3F6FA 1M9AA 2VD1A 3BOAA 3DGQA 1SKSB 5A4UA 2F8FA 2LNTA 4N0VA 3M1GA 1EV9A 4ECCA 2PVOC 5D96A 1M2BA 5G1LA 5CRGA 2G0FA 5HR2A 4BVYA 3TKQA 1Z3EA 4N11A 1TK8B 3H1NA 4MF5A 2HRNA 5HR3A 1BX9A 1SD8A 1X5DA 1HD2A 2TRCP 3Q19A 2KLXA 2HNLA 3HA9A 2GSSA 3HVSA 2IFQA 5B8BA 4EE0A 1PN9A 4DSRA 3IC4A 1RK4A 2H6YA 1YDKA 5J41A 3VPTA 1Z7RA 5C00A 4F9ZA 2P5RA 1PX7A 3CTGA 2WFCA 4JE1A 5EY6A 1J9BA 3FW2A 3MNGA 3LORA 4PX1A 1A0FA 1ACVA 3FR3A 2JADA 4O92A 3ZITA 4KE3A 4PNFA 2DIZA 4ZBDA 2C8UA 5GAPD 4V1Ag 1H75A 4ZBBA 3NIVA 3L78A 6GSSA 1IYIA 4KH7A 5ENUA 2K6VA 1LJRA 1EV4A 5IMAA 1WP0A 4NV5A 4ILFA 3UVHA 2M80A 5DQYA 1NW2A 3U6VA 2FWEA 3TKSE 1K3LA 3DMLA 4TOPA 5ECPB 3UOMA 3VWUA 4IGJA 3DVXA 3DEXA 2VOCA 2VM1A 1GSEA 2BJXA 4ULXA 8GSSA 1GULA 5DALB 2DJ0A 4DSSA 11GSA 2FA8A 2WZ9A 3O76A 3GTUB 2TRXA 3N5OA 4GSSA 5HFKA 1NHYA 3KM6A 2GQKA 5J5NA 3LG6A 1B9XC 2MZCA 5HFGA 2L5LA 5ID2B 5ECMB 1XOAA 2H70A 1X9SB 1I5GA 3TJKA 2IMIA 5CAXA 5AISA 2XBIA 3WT1A 2DLXA 1GSSA 3KTLA 2OBIA 4Q5RA 4MJCA 2FGXA 3DRNA 1SL0B 2DJ3A 1WOUA 3QFAC 2H0GA 1O73A 2FWGA 4IP6A 2HSYA 5IMZA 3A2WA 2WCIA 1A8YA 4BL7A 2G2QA 1GSUA 7GSSA 4PQIA 3LGCA 5A4VA 3R2QA 5G31A 4I97A 2VM2A 3VURA 2PGTA 1WMJA 3A2XA 4K0GA 2X8GA 3ED3A 4OFNA 2PPTA 1V40A 3CYNA 3GKMA 1HYUA 1M7TA 2YV7A 3CRTA 3P7XA 5B6MA 2ES7A 1SKRB 1UA5A 2HI7A 2LSTA 1SJIA 20GSA 3LXZA 2FUG2 1YEPA 3LXTA 5A4WA 3FY7A 2IMFA 1OKDA 1AIUA 4LLRA 5ECQB 3IOSA 3RHCA 1NHOA 1LBKA 1URMA 3WT2A 2GSRA 2WB9A 5F0GA 1B8XA 3UJ1A 2RIIA 5DQSA 2H71A 3D5JA 1GLPA 2H1BA 2FCHA 1GNEA 4L0UA 3CTFA 1PA3A 2FY6A 4MJBA 3MDKA 3GN3A 1YF1A 4K2DA 4XS4B 5ECNB 4NWYA 4HQZA 5GZZB 3LSZA 5ECIB 3CSHA 2F9SA 1O8XA 1TRUA 2IJYA 4FYCA 2B5YA 3F4TA 2VLTA 4XIHA 5DALA 3M3MA 4PQ1A 5KN2A 3KEBA 3JCML 3FR9A 2FWFA 3GTUA 1GTUA 1V58A 3HZ8A 3GH6A 1YY7A 5G5FA 1M0UA 2IMEA 2F51A 1GTAA 5ID2A 4D73B 3D22A 1V57A 3FKFA 2I3YA 6GSYA 1OC3A 3D4TA 1HQOA 1OKTA 5D9XA 2RUFA 2V41A 3ZMKA 4F0CA 1GSDA 4FIWA 2CAQA 4AF2A 3KTBA 10GSA 1SD9A 3UL3A 1MDIA 3QCPA 2DJJA 3KD0A 1SKWB 1F6MC 3BBYA 4E8HA 2C0EA 5DCGA 3UAPA 3L9VA 2X8HA 3N9JA 4WEYA 4YH2A 1EGOA 4K0NA 3IA1A 2FHEA 1M2AA 1ZMAA 1X5EA 1JFUA 4QL7A 5H5SA 1PGTA 1HNAA 4MPGA 2R37A 2LRTA 2C3QA 2LNSA 1GUKA 4G19A 1GSQA 2LQOA 2VLVA 2CQ9A 5F07A 4MF7A 4G2EA 1XW9A 2RLIA 3IV4A 17GSA 2DIYA 3IHQA 4OD7A 2MMOA 4YAPA 1ST9A 1X9WB 2N5FA 3LYKA 1A23A 5A5KA 1NM3A 2YN1A 1U3IA 3APQA 1BAYA 1PKZA 4HJ2A 4K7NA 4XCSA 3ZL5A 5IOWA 5GAND 1V2AA 3IK7A 1XWAA 3G7YA 3FK8A 4XS4A 2L6CA 1W4VA 1GL8A 2LRCA 2GDRA 2CX4A 4Z7XA 1YZXA 4FO5A 4RI6A 2CVBA 2H73A 2MBSA 3U5RE 2PN8A 4TKYA 4NPBA 4ISDA 1JZDA 5LCZA 2GS3A 3DWVA 1M99A 2LRNA 1FVKA 2MMZA 3UBLA 4D73A 1SYRA 5CP1A 2VCWA 4IVFA 2C0FA 4I2UA 3ZRDA 5JWQB 5COHA 5AIVA 1BYEA 1BQ7A 2MMNA 2K18A 2KOKA 1YKCA 2OKAA 1O81A 4G10A 2EC4A 4NXIA 1TKDB 1Z6NA 2O8VB 4HU7A 1ZZYA 3PGTA 1E6BA 3VWVA 1F2EA 4LL4B 5H5QA 1ZL9A 1QMVA 3CMIA 1TRSA 1YJ6A 3O6TA 4Q5QA 1QFNA 5G30A 3GIXA 1DE1A 2C3NA 2YNXA 1FB0A 2K8SA 4ACSA 1OC8A 3KZQA 3EU3A 2WJUA 3GRXA 2PU9C 1SU9A 2X8CA 2O85A 3TDGA 1GNWA 1MDJA 4KAEA 1TI1A 4ZL7A 4ZXGA 3VK9A 2FWHA 1T4ZA 1U88A 5D73A 5JCWA 1PX6A 3ZREA 4NAXA 3EINA 4WR5A 2N5AA 4YQVA 6GSXA 2DMLA 1TRVA 4EXJA 1G7OA 1JLWA 4WETA 1ML6A 1A2LA 3TRPA 1F3AA 3TB2A 4AJ8A 3MAKA 3I69A 4TVEA 3QMXA 3RDWA 3I9V2 1ZOFA 2YOIA 4AJ6A 4DEJA 1JZWA 2O89A 4TRXA 3CRUA 1DE2A 4OFTA 2A2RA 4GF0A 5G1KA 2MMAA 1WRYA 4IELA 2CZ3A 3Q6OA 4WKWA 3RPNA 5D9WA 4MZBA 3HCZA 3ZFBA 4LMVA 1A24A 2JZSA 1PL2A 3H8QA 2Z9SA 2XHFA 19GSA 2NPBA 5F06A 1FO5A 5ECHB 3HVVA 3HZ4A 1HNBA 1YQ1A 3TRQA 1KBNA 1B4PA 4GCIA 4J57E 2BMXA 4MJEA 2DSAA 2V6OA 1VF3A 3M0FA 2H19A 3PR8A 2H75A 4GSNA 1EZKA 1EP8A 1ABAA 4TR1B 3J7Yb 13GSA 3GX0A 1QK8A 4L8EA 4ECBA 4PURA 3LQ7A 5ECRB 2O7KA
chains in the Genus database with same CATH superfamily
3APOA 2H6ZA 4HI7A 1UC7A 4O5UA 2FA4A 2H1AA 3TKPA 4ML1A 1R26A 4I8BA 2VLUA 5CNWA 3DVWA 2VCVA 3FZ5A 4EVMA 1EOGA 1O6JA 5HR1A 3GFKA 2V6KA 1QUWA 3HYPA 3W8JA 4F2IA 4YKFA 3EU4A 3UMAA 2EIRA 1MDKA 3D0ZA 4HZ4A 5CYYA 1ZCPA 4JZQA 1U87A 2QKEA 5IO0A 2WGRA 4IP1A 1V98A 4EDYA 3D4MA 5D93A 1GUMA 5DBQA 3DYRA 4JBBA 2LJKA 2C4JA 5D9TA 1OYJA 5H5RA 5IMCA 1FHEA 4KCEA 1PD21 3DD3A 3FYGA 4WF5A 3RBTA 2HZEB 3UVTA 3WGXA 1O8WA 1XW5A 1PSQA 4NHWA 4POKA 3A5WA 2YWOA 1JHBA 2H74A 1X5CA 2E2GA 6GSUA 2L4CA 4JU5A 3GSTA 2DKIA 1R4WA 2YPMA 4J56E 1T00A 1FAAA 3QDNA 1GWCA 5IMFA 3HVNA 2WULA 2GZZA 3TJJA 3TCOA 4V1Ap 1GSYA 1XIYA 1ERTA 2B5EA 3BD2A 3WD6A 2DJ1A 2IIYA 3VI7A 3QAWA 2C1YA 1G6YA 3VI5A 4J2FA 3TKRA 2R4VA 2OA7A 2LS5A 2NTOA 4GSTA 4K7IA 4AJ7A 1K0OA 2X64A 4KUNA 3SWLA 3RHBA 4O7HA 3GA4A 1MTCA 4TXOB 3EYTA 4TR1A 3MYDA 4Z2UA 1TJDA 2JL4A 5EVOA 2HRKA 3HJOA 3W8SA 1EEMA 16GSA 3HKRA 5HFIA 2HE3A 3TJFA 3TKSC 5AIXA 1K0AA 4XTSA 1OVNA 5FT3A 3V1WA 1AC1A 1GTBA 1SL1B 1VRSD 1XWGA 1QQ2A 4KNDA 1T8EB 1I9DA 4N10A 2GT6A 1R7HA 4LA1A 3GX8A 3C7MA 1GSFA 1Y6EA 3EURA 1U6TA 2A4VA 4EDZA 1G7EA 1DUGA 4EUYA 1QXHA 3BCIA 4BWQA 1F9MA 2P31A 4BVXB 4MJAA 3NOFA 3QPMA 4WBJA 4CDOA 4DSQA 2R6KA 3LYPA 2DJKA 2QGVA 1EEJA 4MZCA 1KEBA 4MF6A 2C0GA 5IPHA 2ZNMA 2L57A 2HZEA 2FLSA 3GMFA 1FOVA 1OAZA 2V32A 2AB6A 3TJBA 3A2VA 2JZTA 3E3EA 14GSA 12GSA 3ME7A 2PERA 2VL2A 3ZVJA 5KN1A 3S9FA 3LWAA 1NSWA 5KOXA 2GQMA 2NBSA 2VO4A 4EIPA 4PGTA 4TN8A 3RPPA 1XWKA 4YAVA 2GT5A 1N8JA 2KP2A 2DC5A 3GNJA 2X4AA 4USSA 4GXZA 4PUAA 4KSMA 3RAZA 6GSWA 1K0CA 2NDOA 2NVLA 5DAKB 1SK2A 2VCZA 5DJMA 4OCEA 4ZBAA 2F8AA 2B6MA 3M9JA 1ZGNA 2MBTA 1OE8A 3VLNA 5JCGA 1A2MA 1YF0A 2I1UA 1TI3A 1GTIA 1UVZA 3IPZA 2HSHA 4TXOA 3O3TA 1KTEA 4OMVA 2AYTA 1EGRA 2JU5A 1RW1A 4XS1A 1XVWA 2GTUA 2VL2C 5E59A 1WPIA 3GV1A 1TDIA 3FHKA 2FNOA 3E9JB 1TTZA 1TK5B 2PVQA 1WE0A 3C73A 2K9FA 3TOTA 4FYUA 2HLSA 4ZL9A 4V2MA 5JWOB 4IQAA 2YWMA 5HQPA 4JRRA 1Z6MA 2ALBA 1RQMA 4HZ2A 4JR6A 1XG8A 1K0NA 3UARA 3GYKA 4MPFA 4QQ7A 4BVXA 4KGIA 2E0QA 5DCHA 1TRWA 2CVKA 3ZVJD 1B4QA 4POMA 1G0TA 4WXTA 4HQSA 2CA8A 1UN2A 1Q4JA 2B1KA 1PRXA 4K9ZA 4O5RA 3GUSA 2VL3A 5J9CA 1SK1A 5JWRB 2PWJA 3GURA 3F9UA 1XW6A 2ZUPA 2OE3A 4KA0A 1THXA 1USBA 1XBSA 4KB3A 2J23A 3IDVA 2C80A 3GL3A 4MK3A 18GSA 4IKHA 5IO2A 3HJMA 4OO4A 3MIXA 3PPUA 2EIOA 4HUAA 4DVCA 2GZPA 3ZMLA 3FEUA 5LD0A 1AAZA 2YWIA 5ELAA 4WR4A 1AQVA 1WJKA 3H79A 4ZIJA 3UEMA 3C8EA 1AXDA 3P2AA 4I5QA 3Q18A 2N5BA 1R5PA 2L6DA 5FWGA 5DAKA 5B6NA 2IPAA 4ZB6A 4G0IA 4GTUA 2K8VA 1VF2A 2TIRA 2LEGA 2RM5A 1PQNA 1C72A 2H6XA 4L5LA 3LFLA 2H66A 5ECSA 2YJ7A 4HS1A 5HR0A 4TXVA 4MH2A 1M2DA 3ERGA 1IYHA 1XWCA 2GSQA 2QC7A 4LMWA 2WDUA 3EMXA 5DDLA 4CY6A 4WBRD 5CRWA 1G6WA 1FG4A 4HU9A 1ZYEA 2LTKA 2L5OA 5CO3A 2GZYA 2HSMA 1T1VA 3IE3A 2AUVA 2QA2A 4KDUA 1ZYQB 2IL3A 2YZHA 1TP9A 2GSTA 4TR0A 5ECKB 2B7KA 3G7IA 1T4YA 2H1DA 4X43A 6GSVA 3CBUA 4NHZA 4L0WA 3BJ5A 3D6IA 3QFBC 4ZL8A 5EPFA 4IHUA 1XVQA 3WGEA 3IAS2 3F3RA 4KDYA 4IQ1A 3HDCA 3A3TA 4DSSB 3P8WA 5IOXA 2O87A 3H93A 4OO5A 3LJRA 3KH9A 4RQRA 2R3XA 2CV4A 3ZTLA 3FZ9A 3OR5A 5F8BA 4KCAA 3D21A 2RM6A 3HVXA 1TOFA 2C0DA 1XPVA 1XOBA 4TW5A 2I4AA 1XXUA 5KEJA 3F4SA 1WWJA 4POBA 2VL9A 1EWXA 4ID0A 3SBCA 4YKGA 5F05A 4CHSA 3ERWA 5KN3A 2V2GA 3FRCA 2M72A 5GSTA 2BTOT 3CSIA 3ZIJA 1ILOA 4MA9A 2M46A 1HNCA 4RQXA 2DMMA 3DKSA 3R3EA 4IN0A 3TGZA 1ERWA 4X1UA 5GSSA 4YQUA 3L0HA 3G9BA 4O5QA 4Q5NA 4K1FA 2VCXA 1F37A 5G2ZA 1YEXA 2CT6A 4FH8A 2X49A 3QAGA 4JEDA 5IPGA 1S3AA 2VAFA 2LJAA 3F3QA 4V2NA 2JZRA 2LKUA 1W89A 2VCTA 1DSBA 2YP6A 5FHIA 2HT9A 3EMPA 4O32A 2L4QA 1BEDA 1SK0A 1F3BA 3F63A 3C1SA 1A2JA 1LU4A 1PFOA 3F6DA 4OFMA 2VUPA 3NZNA 4PXOA 3M9KA 3VPQA 1TW9A 1X9MB 4GWRA 5L71A 3J7Yk 2GVPA 1XCCA 1OE7A 5ELGA 2V1MA 3W6GA 4TR3A 2YCDA 1Z5YE 2YJHA 5IQYA 2JSZA 1K3YA 2CVDA 4XS6A 1Q98A 1X0RA 2I9HA 3TKSA 2PBJA 3GSSA 3F0IA 3IAM2 2OE0A 5AGYA 4KF9A 1FW1A 2VD0A 4EKZA 3KH7A 2RUEA 1A0RP 2PUKC 1S3DA 3WYWA 4IJ3A 5KOWA 2F3MA 4ML6A 3IK9A 3Q74A 3BCKA 1K0DA 3ISOA 1AQXA 2H72A 3FMWA 2AAWA 4NV2A 3KJYA 2IWTA 5ECLB 5LNKe 3F8UA 1Y25A 3KCMA 2P0GA 6GSTA 2HZFA 4HOJA 2H01A 4QL9A 4H86A 4A5PA 2ON7A 5G5EA 3TJGA 3ZZXA 2HRFA 1THOA 1VF4A 3E0UA 1T7PB 2HYXA 1ERVA 3KGKA 4EC0A 2H0IA 2L59A 4GQCA 4PUFC 4YQMA 1SENA 1B48A 5AN1A 5E4WA 3TOUA 3PINA 2HFDA 2E7PA 4N0ZA 3US3A 3WGDA 4K6XA 1K0BA 5IMDA 2H1GA 2B1LA 3L9UA 4EF0A 1SJZA 2I81A 4ECIA 1GP1A 2DBCA 3GKXA 2WS2A 2VCQA 2HXKA 1BG5A 3QD9A 4OCFA 5J9BA 2IMDA 1A8LA 3HXSA 2OACA 1VF1A 4BPYA 5CREA 4P3YB 3L9SA 1AQWA 3IBHA 3F4RA 9GSSA 1EOHA 2YWNA 1GRXA 2ZCTA 3CQFA 4ZB9A 3QR6A 2LJRA 4E8EA 3ZLPA 3GKKA 3HHVA 3ME8A 1CQGA 3HY2A 1WIKA 4K5SA 1DBYA 4IW9A 4CW9A 3AY8A 3ZIVA 4I6XA 5IIZA 1XFLA 2HRAA 3KXOA 3H4KA 4GQFA 1GUHA 2KP1A 2IN3A 3DXBA 2XPDA 4WF4A 3UIWA 1EP7A 1K0MA 22GSA 2ON5A 1E2YA 3ZYWA 2WRTA 4G9HA 4F03A 4MCUA 2LUSA 4PQHA 2B3SA 2H8LA 3KP9A 2D2ZA 4OWYA 5DVBA 2AJQB 4RUVA 3DIEA 1M9BA 3GL5A 3EPTA 2E2MA 5KN0A 4IS0A 4FYBA 4F0BA 3KIJA 2UZ8A 3CXGA 2JACA 2OJLA 1CQHA 4K2XA 5B7CA 5IMVA 4GRFA 4XHMA 5ABRA 2CAIA 5IM9A 3FR6A 5JCUA 4X0XA 3HJPA 3GHAA 2VIMA 3VWWA 1TK0B 1KNGA 2JSYA 2P5QA 4POLA 1OC9B 4MABA 4XRAA 4IJIA 1SL2B 2DJ2A 4MZWA 4MNNA 4BWSA 2B5XA 1PL1A 4Q5FA 4F82A 3ZFLA 4MH3A 1PMTA 3GH9A 2AV4A 3L4NA 4MP4A 2J9HA 3KP8A 3G7JA 4EL1A 1JZRA 4LL1B 2R5GA 3PH9A 1K3OA 5D9VA 4L5OA 2A2PA 4ZILA 3LEFA 1SJ6A 4GLTA 4MMMA 2OE1A 4EO3A 1MD4A 1QGVA 1O85A 5C04A 1BJXA 1H4OA 2FD3A 3ERFA 2H30A 2REMA 3C71A 1ZYPA 5EL8A 3MWHA 2H0HA 2XBQA 2QSIA 3VWXA 1VGLA 4KDXA 2AHEA 2R2JA 3IR4A 3UBKA 2CZ2A 1R5AA 1FVJA 2QA1A 3QAVA 1S3CA 3K8NA 1SYXA 4BVYB 3IXRA 3M8NA 4ZB8A 4AGSA 5J3RA 2GGTA 3I43A 2LV3A 5B8AA 4MLYA 3HD5A 1MD3A 1Z9HA 3TUEA 1XWBA 1TXXA 2XPEA 3I6AA 1ERUA 2EIQA 2YZUA 4KX4A 2IFQB 2GQLA 3MSZA 1MEKA 3QOUA 4I2TA 3IRAA 4G0LA 4NMUA 4BA7A 3CSJA 1FB6A 3P90A 2XC2A 4KSOA 4ECJA 4V2LA 4HJMA 2OADA 4K8MA 2B7JA 3APSA 5CRHA 1AW9A 3C1RA 1J08A 1AUCA 2LQQA 3EE2A 4IBPA 1B9YC 3FZAA 4HEA2 4EIQA 2GLRA 5DJLA 4MDCA 1OC9A 4KW6A 2YV9A 1Z7PA 3KMOA 1V9WA 1ON4A 2IMKA 2PMTA 2H76A 1N2AA 1TU7A 2C3TA 4PNGA 1TU8A 2YANA 2KHPA 1JZOA 2X99A 3EVIA 5D8IA 1PKWA 2KUCA 1GH2A 3TRXA 2CX3A 3FZ4A 3EWLA 1JLVA 4K7OA 4RI7A 3KMNA 4N30A 4PTSA 4JR4A 1YKAA 1T3BA 3GKNA 4XRDA 5ECOB 5CRDA 1U3AA 1XZOA 4TR4A 3EC3A 2A2SA 5INYA 1GLQA 2MYGA 2OBKA 1O7UA 5J4UA 3VFIA 1J0FA 4HDEA 3F6FA 1M9AA 2VD1A 3BOAA 3DGQA 1SKSB 5A4UA 2F8FA 2LNTA 4N0VA 3M1GA 1EV9A 4ECCA 2PVOC 5D96A 1M2BA 5G1LA 5CRGA 2G0FA 2A4HA 5HR2A 4BVYA 3TKQA 1Z3EA 4N11A 1TK8B 3H1NA 4MF5A 2HRNA 5HR3A 1BX9A 1SD8A 1X5DA 1HD2A 2TRCP 3Q19A 2KLXA 2HNLA 3HA9A 2GSSA 3HVSA 2IFQA 4BL7B 5B8BA 4EE0A 1PN9A 4DSRA 3IC4A 1RK4A 2H6YA 1YDKA 5J41A 3VPTA 1Z7RA 5C00A 4F9ZA 2P5RA 1PX7A 3CTGA 2WFCA 4JE1A 5EY6A 1J9BA 3FW2A 3MNGA 3LORA 4PX1A 1A0FA 1ACVA 3FR3A 2JADA 4O92A 3ZITA 4KE3A 4PNFA 2DIZA 4ZBDA 2C8UA 5GAPD 4V1Ag 3IHGA 1H75A 4ZBBA 3NIVA 3L78A 4Z2RA 6GSSA 1IYIA 4KH7A 5ENUA 2K6VA 1LJRA 1EV4A 5IMAA 2R0CA 1WP0A 4NV5A 4ILFA 3UVHA 2M80A 5DQYA 1NW2A 3U6VA 2FWEA 3TKSE 1K3LA 3DMLA 4TOPA 5ECPB 3UOMA 3VWUA 4IGJA 3DVXA 3DEXA 2VOCA 2VM1A 1GSEA 2BJXA 4ULXA 8GSSA 1GULA 5DALB 2DJ0A 1S3RA 4DSSA 11GSA 2FA8A 2WZ9A 3O76A 3GTUB 2TRXA 3N5OA 4GSSA 5HFKA 4BIKA 1NHYA 3KM6A 2GQKA 5J5NA 3LG6A 1B9XC 2MZCA 5HFGA 2L5LA 5ID2B 5ECMB 1XOAA 2H70A 1X9SB 1I5GA 2R0GA 3TJKA 2IMIA 5CAXA 5AISA 2XBIA 3WT1A 2DLXA 1GSSA 3KTLA 2OBIA 4Q5RA 4MJCA 2FGXA 3DRNA 1SL0B 2DJ3A 1WOUA 3QFAC 2H0GA 1O73A 2FWGA 4IP6A 2HSYA 5IMZA 3A2WA 2WCIA 1A8YA 4BL7A 2G2QA 1GSUA 7GSSA 4PQIA 3LGCA 5A4VA 3R2QA 5G31A 4I97A 2VM2A 3VURA 2PGTA 1WMJA 3A2XA 4K0GA 2X8GA 3ED3A 4OFNA 2PPTA 1V40A 3CYNA 3GKMA 1HYUA 3LW9A 1M7TA 2YV7A 3CRTA 3P7XA 5B6MA 2ES7A 1SKRB 1ZYNA 1UA5A 2HI7A 2LSTA 1SJIA 20GSA 3LXZA 2FUG2 1YEPA 3LXTA 5A4WA 3FY7A 2IMFA 1OKDA 1AIUA 4LLRA 5ECQB 3IOSA 3RHCA 1NHOA 1LBKA 1URMA 3WT2A 2GSRA 2WB9A 5F0GA 1B8XA 3UJ1A 2RIIA 5DQSA 2H71A 3D5JA 1GLPA 2H1BA 2FCHA 1GNEA 4L0UA 3CTFA 1PA3A 2FY6A 4MJBA 3MDKA 3GN3A 1YF1A 4K2DA 4XS4B 5ECNB 4NWYA 4HQZA 5GZZB 3LSZA 5ECIB 3CSHA 2F9SA 1O8XA 1TRUA 2IJYA 4FYCA 2B5YA 3F4TA 2VLTA 1M3IA 4XIHA 5DALA 3M3MA 4PQ1A 5KN2A 3KEBA 3JCML 3FR9A 2FWFA 3GTUA 1GTUA 1V58A 3HZ8A 3GH6A 1YY7A 5G5FA 1M0UA 2IMEA 2F51A 1GTAA 5ID2A 4D73B 3D22A 1V57A 3FKFA 2I3YA 6GSYA 1OC3A 1M3JA 3D4TA 1HQOA 1OKTA 5D9XA 4K5RA 2RUFA 2V41A 3ZMKA 4F0CA 4FQUA 1GSDA 4FIWA 2CAQA 4AF2A 4CY8A 3KTBA 10GSA 1SD9A 3UL3A 1MDIA 3QCPA 2DJJA 3KD0A 1SKWB 1F6MC 3BBYA 4E8HA 2C0EA 5DCGA 3UAPA 3L9VA 2X8HA 3N9JA 4WEYA 4YH2A 1EGOA 4K0NA 3IA1A 2FHEA 1M2AA 1ZMAA 1X5EA 1JFUA 4QL7A 5H5SA 1PGTA 1HNAA 4MPGA 2R37A 2LRTA 2C3QA 2LNSA 1GUKA 4G19A 1GSQA 2LQOA 2VLVA 2CQ9A 5F07A 4MF7A 4G2EA 1XW9A 2R0PA 2RLIA 3IV4A 17GSA 2DIYA 3IHQA 4OD7A 2MMOA 4YAPA 1ST9A 1X9WB 2N5FA 3LYKA 1A23A 5A5KA 1NM3A 2YN1A 1U3IA 3APQA 1BAYA 1PKZA 4HJ2A 4K7NA 4XCSA 3ZL5A 5IOWA 5GAND 1V2AA 3IK7A 1XWAA 3G7YA 3FK8A 4XS4A 2L6CA 1W4VA 1GL8A 2LRCA 2GDRA 2CX4A 4Z7XA 1YZXA 4FO5A 4X4JA 4RI6A 2CVBA 2DKHA 2H73A 2MBSA 3U5RE 2PN8A 4TKYA 4Z2TA 4NPBA 4ISDA 1JZDA 5LCZA 2GS3A 3DWVA 1M99A 2LRNA 1FVKA 2MMZA 3UBLA 4D73A 1SYRA 5CP1A 2VCWA 4IVFA 2C0FA 4I2UA 3ZRDA 5JWQB 5COHA 5AIVA 1BYEA 1BQ7A 2MMNA 2K18A 2KOKA 1YKCA 2OKAA 1O81A 4G10A 2EC4A 4NXIA 1TKDB 1Z6NA 2O8VB 4HU7A 1ZZYA 3PGTA 1E6BA 3VWVA 1F2EA 4LL4B 5H5QA 1ZL9A 1QMVA 3CMIA 1TRSA 1YJ6A 3O6TA 4Q5QA 1QFNA 5G30A 3GIXA 1DE1A 2C3NA 2YNXA 1FB0A 2K8SA 4G0KA 4ACSA 1OC8A 3KZQA 3EU3A 2WJUA 3GRXA 2PU9C 1SU9A 2X8CA 2O85A 3TDGA 1GNWA 1MDJA 4KAEA 1TI1A 4ZL7A 4ZXGA 5BMUA 3VK9A 2FWHA 1T4ZA 1U88A 5D73A 5JCWA 1PX6A 3ZREA 4NAXA 1PN0A 3EINA 4WR5A 2N5AA 4YQVA 6GSXA 2DMLA 1TRVA 4EXJA 1G7OA 1JLWA 4WETA 1ML6A 4ICYA 1A2LA 3TRPA 1F3AA 3TB2A 4AJ8A 3MAKA 3I69A 4TVEA 3QMXA 5BRTA 3RDWA 3I9V2 1ZOFA 2YOIA 4AJ6A 4DEJA 1JZWA 2O89A 4TRXA 3CRUA 1DE2A 4OFTA 2A2RA 4GF0A 5G1KA 2MMAA 1WRYA 4IELA 2CZ3A 3Q6OA 4WKWA 3RPNA 5D9WA 4MZBA 3HCZA 3ZFBA 3A5IA 4LMVA 1A24A 2JZSA 1FOHA 1PL2A 3H8QA 2Z9SA 2XHFA 19GSA 2NPBA 5F06A 1FO5A 5ECHB 3HVVA 3HZ4A 1HNBA 1YQ1A 3TRQA 1KBNA 1B4PA 4GCIA 4J57E 2BMXA 4MJEA 2DSAA 2V6OA 1VF3A 4HSCX 3M0FA 2H19A 3PR8A 3IC8A 2H75A 4GSNA 1EZKA 1EP8A 1ABAA 4TR1B 3J7Yb 13GSA 3GX0A 1QK8A 4L8EA 4ECBA 4PURA 3LQ7A 5ECRB 2O7KA
chains in the Genus database with same CATH topology
3APOA 2H6ZA 4HI7A 1UC7A 4O5UA 2FA4A 2H1AA 3TKPA 4ML1A 1R26A 4I8BA 2VLUA 5CNWA 3DVWA 2VCVA 3FZ5A 4EVMA 1EOGA 1O6JA 5HR1A 3GFKA 2V6KA 1QUWA 3HYPA 3W8JA 4F2IA 4YKFA 3EU4A 3UMAA 2EIRA 1MDKA 3D0ZA 4HZ4A 5CYYA 1ZCPA 4JZQA 1U87A 2QKEA 5IO0A 2WGRA 4IP1A 1V98A 4EDYA 3D4MA 5D93A 1GUMA 5DBQA 3DYRA 4JBBA 2LJKA 2C4JA 5D9TA 1OYJA 5H5RA 5IMCA 1FHEA 4KCEA 1PD21 3DD3A 3FYGA 4WF5A 3RBTA 2HZEB 3UVTA 3WGXA 1O8WA 1XW5A 1PSQA 4NHWA 4POKA 3A5WA 2YWOA 1JHBA 2H74A 1X5CA 2E2GA 6GSUA 2L4CA 4JU5A 3GSTA 2DKIA 1R4WA 2YPMA 4J56E 1T00A 1FAAA 3QDNA 1GWCA 5IMFA 2WULA 2GZZA 3TJJA 3TCOA 4V1Ap 1GSYA 1XIYA 1ERTA 2B5EA 3BD2A 3WD6A 2DJ1A 2IIYA 3VI7A 3QAWA 2C1YA 1G6YA 3VI5A 4J2FA 3TKRA 2R4VA 2OA7A 2LS5A 2NTOA 4GSTA 4K7IA 4AJ7A 1K0OA 2X64A 4KUNA 3SWLA 3RHBA 4O7HA 3GA4A 1MTCA 4TXOB 3EYTA 4TR1A 3MYDA 4Z2UA 1TJDA 2JL4A 5EVOA 2HRKA 3HJOA 3W8SA 1EEMA 16GSA 3HKRA 5HFIA 2HE3A 3TJFA 3TKSC 5AIXA 1K0AA 4XTSA 1OVNA 5FT3A 3V1WA 1AC1A 1GTBA 1SL1B 1VRSD 1XWGA 1QQ2A 4KNDA 1T8EB 1I9DA 4N10A 2GT6A 1R7HA 4LA1A 3GX8A 3C7MA 1GSFA 1Y6EA 3EURA 1U6TA 2A4VA 4EDZA 1G7EA 1DUGA 4EUYA 1QXHA 3BCIA 4BWQA 1F9MA 2P31A 4BVXB 4MJAA 3NOFA 3QPMA 4WBJA 4CDOA 4DSQA 2R6KA 3LYPA 2DJKA 2QGVA 1EEJA 4MZCA 1KEBA 4MF6A 2C0GA 5IPHA 2ZNMA 2L57A 2HZEA 2FLSA 3GMFA 1FOVA 1OAZA 2V32A 2AB6A 3TJBA 3A2VA 2JZTA 3E3EA 14GSA 12GSA 3ME7A 2PERA 2VL2A 3ZVJA 5KN1A 3S9FA 3LWAA 1NSWA 5KOXA 2GQMA 2NBSA 2VO4A 4EIPA 4PGTA 4TN8A 3RPPA 1XWKA 4YAVA 2GT5A 1N8JA 2KP2A 2DC5A 3GNJA 2X4AA 4USSA 4GXZA 4PUAA 4KSMA 3RAZA 6GSWA 1K0CA 2NDOA 2NVLA 5DAKB 1SK2A 2VCZA 5DJMA 4OCEA 4ZBAA 2F8AA 2B6MA 3M9JA 1ZGNA 2MBTA 1OE8A 3VLNA 5JCGA 1A2MA 1YF0A 2I1UA 1TI3A 1GTIA 1UVZA 3IPZA 2HSHA 4TXOA 3O3TA 1KTEA 4OMVA 2AYTA 1EGRA 2JU5A 1RW1A 4XS1A 1XVWA 2GTUA 2VL2C 5E59A 1WPIA 3GV1A 1TDIA 3FHKA 2FNOA 3E9JB 1TTZA 1TK5B 2PVQA 1WE0A 3C73A 2K9FA 3TOTA 4FYUA 2HLSA 4ZL9A 4V2MA 5JWOB 4IQAA 2YWMA 5HQPA 4JRRA 1Z6MA 2ALBA 1RQMA 4HZ2A 4JR6A 1K0NA 3UARA 3GYKA 4MPFA 4QQ7A 4BVXA 4KGIA 2E0QA 5DCHA 1TRWA 2CVKA 3ZVJD 1B4QA 4POMA 1G0TA 4WXTA 4HQSA 2CA8A 1UN2A 1Q4JA 2B1KA 1PRXA 4K9ZA 4O5RA 3GUSA 2VL3A 5J9CA 1SK1A 5JWRB 2PWJA 3GURA 3F9UA 1XW6A 2ZUPA 2OE3A 4KA0A 1THXA 1USBA 1XBSA 4KB3A 2J23A 3IDVA 2C80A 3GL3A 4MK3A 18GSA 4IKHA 5IO2A 3HJMA 4OO4A 3MIXA 3PPUA 2EIOA 4HUAA 4DVCA 2GZPA 3ZMLA 3FEUA 5LD0A 1AAZA 2YWIA 5ELAA 4WR4A 1AQVA 1WJKA 3H79A 4ZIJA 3UEMA 3C8EA 1AXDA 3P2AA 4I5QA 3Q18A 2N5BA 1R5PA 2L6DA 5FWGA 5DAKA 5B6NA 2IPAA 4ZB6A 4G0IA 4GTUA 2K8VA 1VF2A 2TIRA 2LEGA 2RM5A 1PQNA 1C72A 2H6XA 4L5LA 3LFLA 2H66A 5ECSA 2YJ7A 4HS1A 5HR0A 4TXVA 4MH2A 1M2DA 3ERGA 1IYHA 1XWCA 2GSQA 2QC7A 4LMWA 2WDUA 3EMXA 5DDLA 4CY6A 4WBRD 5CRWA 1G6WA 1FG4A 4HU9A 1ZYEA 2LTKA 2L5OA 5CO3A 2GZYA 2HSMA 1T1VA 3IE3A 2AUVA 2QA2A 4KDUA 1ZYQB 2IL3A 2YZHA 1TP9A 2GSTA 4TR0A 5ECKB 2B7KA 3G7IA 1T4YA 2H1DA 4X43A 6GSVA 3CBUA 4NHZA 4L0WA 3BJ5A 3D6IA 3QFBC 4ZL8A 5EPFA 4IHUA 1XVQA 3WGEA 3IAS2 3F3RA 4KDYA 4IQ1A 3HDCA 3A3TA 4DSSB 3P8WA 5IOXA 2O87A 3H93A 4OO5A 3LJRA 3KH9A 4RQRA 2R3XA 2CV4A 3ZTLA 3FZ9A 3OR5A 5F8BA 4KCAA 3D21A 2RM6A 3HVXA 1TOFA 2C0DA 1XPVA 1XOBA 4TW5A 2I4AA 1XXUA 5KEJA 3F4SA 1WWJA 4POBA 2VL9A 1EWXA 4ID0A 3SBCA 4YKGA 5F05A 4CHSA 3ERWA 5KN3A 2V2GA 3FRCA 2M72A 5GSTA 2BTOT 3CSIA 3ZIJA 1ILOA 4MA9A 2M46A 1HNCA 4RQXA 2DMMA 3DKSA 3R3EA 4IN0A 3TGZA 1ERWA 4X1UA 5GSSA 4YQUA 3L0HA 3G9BA 4O5QA 4Q5NA 4K1FA 2VCXA 1F37A 5G2ZA 1YEXA 2CT6A 4FH8A 2X49A 3QAGA 4JEDA 5IPGA 1S3AA 2VAFA 2LJAA 3F3QA 4V2NA 2JZRA 2LKUA 1W89A 2VCTA 1DSBA 2YP6A 5FHIA 2HT9A 3EMPA 4O32A 2L4QA 1BEDA 1SK0A 1F3BA 3F63A 3C1SA 1A2JA 1LU4A 3F6DA 4OFMA 2VUPA 3NZNA 4PXOA 3M9KA 3VPQA 1TW9A 1X9MB 4GWRA 5L71A 3J7Yk 2GVPA 1XCCA 1OE7A 5ELGA 2V1MA 3W6GA 4TR3A 2YCDA 1Z5YE 2YJHA 5IQYA 2JSZA 1K3YA 2CVDA 4XS6A 1Q98A 1X0RA 2I9HA 3TKSA 2PBJA 3GSSA 3F0IA 3IAM2 2OE0A 5AGYA 4KF9A 1FW1A 2VD0A 4EKZA 3KH7A 2RUEA 1A0RP 2PUKC 1S3DA 3WYWA 4IJ3A 5KOWA 2F3MA 4ML6A 3IK9A 3Q74A 3BCKA 1K0DA 3ISOA 1AQXA 2H72A 3FMWA 2AAWA 4NV2A 3KJYA 2IWTA 5ECLB 5LNKe 3F8UA 1Y25A 3KCMA 2P0GA 6GSTA 2HZFA 4HOJA 2H01A 4QL9A 4H86A 4A5PA 2ON7A 5G5EA 3TJGA 3ZZXA 2HRFA 1THOA 1VF4A 3E0UA 1T7PB 2HYXA 1ERVA 3KGKA 4EC0A 2H0IA 2L59A 4GQCA 4PUFC 4YQMA 1SENA 1B48A 5AN1A 5E4WA 3TOUA 3PINA 2HFDA 2E7PA 4N0ZA 3US3A 3WGDA 4K6XA 1K0BA 5IMDA 2H1GA 2B1LA 3L9UA 4EF0A 1SJZA 2I81A 4ECIA 1GP1A 2DBCA 3GKXA 2WS2A 2VCQA 2HXKA 1BG5A 3QD9A 4OCFA 5J9BA 2IMDA 1A8LA 3HXSA 2OACA 1VF1A 4BPYA 5CREA 4P3YB 3L9SA 1AQWA 3IBHA 3F4RA 9GSSA 1EOHA 2YWNA 1GRXA 2ZCTA 4ZB9A 3QR6A 2LJRA 4E8EA 3ZLPA 3GKKA 3HHVA 3ME8A 1CQGA 3HY2A 1WIKA 4K5SA 1DBYA 4IW9A 4CW9A 3AY8A 3ZIVA 4I6XA 5IIZA 1XFLA 2HRAA 3KXOA 3H4KA 4GQFA 1GUHA 2KP1A 2IN3A 3DXBA 2XPDA 4WF4A 3UIWA 1EP7A 1K0MA 22GSA 2ON5A 1E2YA 3ZYWA 2WRTA 4G9HA 4F03A 4MCUA 2LUSA 4PQHA 2B3SA 2H8LA 3KP9A 2D2ZA 4OWYA 5DVBA 2AJQB 4RUVA 3DIEA 1M9BA 3GL5A 3EPTA 2E2MA 5KN0A 4IS0A 4FYBA 4F0BA 3KIJA 2UZ8A 3CXGA 2JACA 2OJLA 1CQHA 4K2XA 5B7CA 5IMVA 4GRFA 4XHMA 5ABRA 2CAIA 5IM9A 3FR6A 5JCUA 4X0XA 3HJPA 3GHAA 2VIMA 3VWWA 1TK0B 1KNGA 2JSYA 2P5QA 4POLA 1OC9B 4MABA 4XRAA 4IJIA 1SL2B 2DJ2A 4MZWA 4MNNA 4BWSA 2B5XA 1PL1A 4Q5FA 4F82A 3ZFLA 4MH3A 1PMTA 3GH9A 2AV4A 3L4NA 4MP4A 2J9HA 3KP8A 3G7JA 4EL1A 1JZRA 4LL1B 2R5GA 3PH9A 1K3OA 5D9VA 4L5OA 2A2PA 4ZILA 3LEFA 1SJ6A 4GLTA 4MMMA 2OE1A 4EO3A 1MD4A 1QGVA 1O85A 5C04A 1BJXA 1H4OA 2FD3A 3ERFA 2H30A 2REMA 3C71A 1ZYPA 5EL8A 3MWHA 2H0HA 2XBQA 2QSIA 3VWXA 1VGLA 4KDXA 2AHEA 2R2JA 3IR4A 3UBKA 2CZ2A 1R5AA 1FVJA 2QA1A 3QAVA 1S3CA 3K8NA 1SYXA 4BVYB 3IXRA 3M8NA 4ZB8A 4AGSA 5J3RA 2GGTA 3I43A 2LV3A 5B8AA 4MLYA 3HD5A 1MD3A 1Z9HA 3TUEA 1XWBA 1TXXA 2XPEA 3I6AA 1ERUA 2EIQA 2YZUA 4KX4A 2IFQB 2GQLA 3MSZA 1MEKA 3QOUA 4I2TA 3IRAA 4G0LA 4NMUA 4BA7A 3CSJA 1FB6A 3P90A 2XC2A 4KSOA 4ECJA 4V2LA 4HJMA 2OADA 4K8MA 2B7JA 3APSA 5CRHA 1AW9A 3C1RA 1J08A 1AUCA 2LQQA 3EE2A 4IBPA 1B9YC 3FZAA 4HEA2 4EIQA 2GLRA 5DJLA 4MDCA 1OC9A 4KW6A 2YV9A 1Z7PA 3KMOA 1V9WA 1ON4A 2IMKA 2PMTA 2H76A 1N2AA 1TU7A 2C3TA 4PNGA 1TU8A 2YANA 2KHPA 1JZOA 2X99A 3EVIA 5D8IA 1PKWA 2KUCA 1GH2A 3TRXA 2CX3A 3FZ4A 3EWLA 1JLVA 4K7OA 4RI7A 3KMNA 4N30A 4PTSA 4JR4A 1YKAA 1T3BA 3GKNA 4XRDA 5ECOB 5CRDA 1U3AA 1XZOA 4TR4A 3EC3A 2A2SA 5INYA 1GLQA 2MYGA 2OBKA 1O7UA 5J4UA 3VFIA 1J0FA 4HDEA 3F6FA 1M9AA 2VD1A 3BOAA 3DGQA 1SKSB 5A4UA 2F8FA 2LNTA 4N0VA 3M1GA 1EV9A 4ECCA 2PVOC 5D96A 1M2BA 5G1LA 5CRGA 2G0FA 2A4HA 5HR2A 4BVYA 3TKQA 1Z3EA 4N11A 1TK8B 3H1NA 4MF5A 2HRNA 5HR3A 1BX9A 1SD8A 1X5DA 1HD2A 2TRCP 3Q19A 2KLXA 2HNLA 3HA9A 2GSSA 3HVSA 2IFQA 4BL7B 5B8BA 4EE0A 1PN9A 4DSRA 3IC4A 1RK4A 2H6YA 1YDKA 5J41A 3VPTA 1Z7RA 5C00A 4F9ZA 2P5RA 1PX7A 3CTGA 2WFCA 4JE1A 5EY6A 1J9BA 3FW2A 3MNGA 3LORA 4PX1A 1A0FA 1ACVA 3FR3A 2JADA 4O92A 3ZITA 4KE3A 4PNFA 2DIZA 4ZBDA 2C8UA 5GAPD 4V1Ag 3IHGA 1H75A 4ZBBA 3NIVA 3L78A 4Z2RA 6GSSA 1IYIA 4KH7A 5ENUA 2K6VA 1LJRA 1EV4A 5IMAA 2R0CA 1WP0A 4NV5A 4ILFA 3UVHA 2M80A 5DQYA 1NW2A 3U6VA 2FWEA 3TKSE 1K3LA 3DMLA 4TOPA 5ECPB 3UOMA 3VWUA 4IGJA 3DVXA 3DEXA 2VOCA 2VM1A 1GSEA 2BJXA 4ULXA 8GSSA 1GULA 5DALB 2DJ0A 4DSSA 11GSA 2FA8A 2WZ9A 3O76A 3GTUB 2TRXA 3N5OA 4GSSA 5HFKA 1NHYA 3KM6A 2GQKA 5J5NA 3LG6A 1B9XC 2MZCA 5HFGA 2L5LA 5ID2B 5ECMB 1XOAA 2H70A 1X9SB 1I5GA 2R0GA 3TJKA 2IMIA 5CAXA 5AISA 2XBIA 3WT1A 2DLXA 1GSSA 3KTLA 2OBIA 4Q5RA 4MJCA 2FGXA 3DRNA 1SL0B 2DJ3A 1WOUA 3QFAC 2H0GA 1O73A 2FWGA 4IP6A 2HSYA 5IMZA 3A2WA 2WCIA 1A8YA 4BL7A 2G2QA 1GSUA 7GSSA 4PQIA 3LGCA 5A4VA 3R2QA 5G31A 4I97A 2VM2A 3VURA 2PGTA 1WMJA 3A2XA 4K0GA 2X8GA 3ED3A 4OFNA 2PPTA 1V40A 3CYNA 3GKMA 1HYUA 3LW9A 1M7TA 2YV7A 3CRTA 3P7XA 5B6MA 2ES7A 1SKRB 1ZYNA 1UA5A 2HI7A 2LSTA 1SJIA 20GSA 3LXZA 2FUG2 1YEPA 3LXTA 5A4WA 3FY7A 2IMFA 1OKDA 1AIUA 4LLRA 5ECQB 3IOSA 3RHCA 1NHOA 1LBKA 1URMA 3WT2A 2GSRA 2WB9A 5F0GA 1B8XA 3UJ1A 2RIIA 5DQSA 2H71A 3D5JA 1GLPA 2H1BA 2FCHA 1GNEA 4L0UA 3CTFA 1PA3A 2FY6A 4MJBA 3MDKA 3GN3A 1YF1A 4K2DA 4XS4B 5ECNB 4NWYA 4HQZA 5GZZB 3LSZA 5ECIB 3CSHA 2F9SA 1O8XA 1TRUA 2IJYA 4FYCA 2B5YA 3F4TA 2VLTA 4XIHA 5DALA 3M3MA 4PQ1A 5KN2A 3KEBA 3JCML 3FR9A 2FWFA 3GTUA 1GTUA 1V58A 3HZ8A 3GH6A 1YY7A 5G5FA 1M0UA 2IMEA 2F51A 1GTAA 5ID2A 4D73B 3D22A 1V57A 3FKFA 2I3YA 6GSYA 1OC3A 3D4TA 1HQOA 1OKTA 5D9XA 4K5RA 2RUFA 2V41A 3ZMKA 4F0CA 4FQUA 1GSDA 4FIWA 2CAQA 4AF2A 4CY8A 3KTBA 10GSA 1SD9A 3UL3A 1MDIA 3QCPA 2DJJA 3KD0A 1SKWB 1F6MC 3BBYA 4E8HA 2C0EA 5DCGA 3UAPA 3L9VA 2X8HA 3N9JA 4WEYA 4YH2A 1EGOA 4K0NA 3IA1A 2FHEA 1M2AA 1ZMAA 1X5EA 1JFUA 4QL7A 5H5SA 1PGTA 1HNAA 4MPGA 2R37A 2LRTA 2C3QA 2LNSA 1GUKA 4G19A 1GSQA 2LQOA 2VLVA 2CQ9A 5F07A 4MF7A 4G2EA 1XW9A 2R0PA 2RLIA 3IV4A 17GSA 2DIYA 3IHQA 4OD7A 2MMOA 4YAPA 1ST9A 1X9WB 2N5FA 3LYKA 1A23A 5A5KA 1NM3A 2YN1A 1U3IA 3APQA 1BAYA 1PKZA 4HJ2A 4K7NA 4XCSA 3ZL5A 5IOWA 5GAND 1V2AA 3IK7A 1XWAA 3G7YA 3FK8A 4XS4A 2L6CA 1W4VA 1GL8A 2LRCA 2GDRA 2CX4A 4Z7XA 1YZXA 4FO5A 4X4JA 4RI6A 2CVBA 2DKHA 2H73A 2MBSA 3U5RE 2PN8A 4TKYA 4Z2TA 4NPBA 4ISDA 1JZDA 5LCZA 2GS3A 3DWVA 1M99A 2LRNA 1FVKA 2MMZA 3UBLA 4D73A 1SYRA 5CP1A 2VCWA 4IVFA 2C0FA 4I2UA 3ZRDA 5JWQB 5COHA 5AIVA 1BYEA 1BQ7A 2MMNA 2K18A 2KOKA 1YKCA 2OKAA 1O81A 4G10A 2EC4A 4NXIA 1TKDB 1Z6NA 2O8VB 4HU7A 1ZZYA 3PGTA 1E6BA 3VWVA 1F2EA 4LL4B 5H5QA 1ZL9A 1QMVA 3CMIA 1TRSA 1YJ6A 3O6TA 4Q5QA 1QFNA 5G30A 3GIXA 1DE1A 2C3NA 2YNXA 1FB0A 2K8SA 4G0KA 4ACSA 1OC8A 3KZQA 3EU3A 2WJUA 3GRXA 2PU9C 1SU9A 2X8CA 2O85A 3TDGA 1GNWA 1MDJA 4KAEA 1TI1A 4ZL7A 4ZXGA 5BMUA 3VK9A 2FWHA 1T4ZA 1U88A 5D73A 5JCWA 1PX6A 3ZREA 4NAXA 1PN0A 3EINA 4WR5A 2N5AA 4YQVA 6GSXA 2DMLA 1TRVA 4EXJA 1G7OA 1JLWA 4WETA 1ML6A 4ICYA 1A2LA 3TRPA 1F3AA 3TB2A 4AJ8A 3MAKA 3I69A 4TVEA 3QMXA 5BRTA 3RDWA 3I9V2 1ZOFA 2YOIA 4AJ6A 4DEJA 1JZWA 2O89A 4TRXA 3CRUA 1DE2A 4OFTA 2A2RA 4GF0A 5G1KA 2MMAA 1WRYA 4IELA 2CZ3A 3Q6OA 4WKWA 3RPNA 5D9WA 4MZBA 3HCZA 3ZFBA 3A5IA 4LMVA 1A24A 2JZSA 1FOHA 1PL2A 3H8QA 2Z9SA 2XHFA 19GSA 2NPBA 5F06A 1FO5A 5ECHB 3HVVA 3HZ4A 1HNBA 1YQ1A 3TRQA 1KBNA 1B4PA 4GCIA 4J57E 2BMXA 4MJEA 2DSAA 2V6OA 1VF3A 3M0FA 2H19A 3PR8A 3IC8A 2H75A 4GSNA 1EZKA 1EP8A 1ABAA 4TR1B 3J7Yb 13GSA 3GX0A 1QK8A 4L8EA 4ECBA 4PURA 3LQ7A 5ECRB 2O7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APO A;  2H6Z A;  4HI7 A;  1UC7 A;  2FA4 A;  2H1A A;  3TKP A;  4ML1 A;  1R26 A;  4I8B A;  2VLU A;  5CNW A;  3DVW A;  2VCV A;  3FZ5 A;  4EVM A;  1EOG A;  1O6J A;  5HR1 A;  3GFK A;  2V6K A;  1QUW A;  3HYP A;  3W8J A;  4F2I A;  3EU4 A;  3UMA A;  2EIR A;  1MDK A;  3D0Z A;  4HZ4 A;  5CYY A;  1ZCP A;  4JZQ A;  1U87 A;  2QKE A;  5IO0 A;  2WGR A;  4IP1 A;  1V98 A;  4EDY A;  3D4M A;  5D93 A;  1GUM A;  5DBQ A;  3DYR A;  4JBB A;  2LJK A;  2C4J A;  5D9T A;  1OYJ A;  5H5R A;  5IMC A;  1FHE A;  4KCE A;  1PD2 1;  3DD3 A;  3FYG A;  4WF5 A;  3RBT A;  2HZE B;  3UVT A;  3WGX A;  1O8W A;  1XW5 A;  1PSQ A;  4NHW A;  4POK A;  3A5W A;  2YWO A;  1JHB A;  2H74 A;  1X5C A;  2E2G A;  6GSU A;  2L4C A;  4JU5 A;  3GST A;  1R4W A;  2YPM A;  4J56 E;  1T00 A;  1FAA A;  3QDN A;  1GWC A;  5IMF A;  2WUL A;  2GZZ A;  3TJJ A;  3TCO A;  4V1A p;  1GSY A;  1XIY A;  1ERT A;  2B5E A;  3BD2 A;  3WD6 A;  2DJ1 A;  2IIY A;  3VI7 A;  3QAW A;  2C1Y A;  1G6Y A;  3VI5 A;  4J2F A;  3TKR A;  2R4V A;  2OA7 A;  2LS5 A;  2NTO A;  4GST A;  4K7I A;  4AJ7 A;  1K0O A;  2X64 A;  4KUN A;  3SWL A;  3RHB A;  4O7H A;  3GA4 A;  1MTC A;  4TXO B;  3EYT A;  4TR1 A;  1TJD A;  2JL4 A;  5EVO A;  3HJO A;  3W8S A;  1EEM A;  16GS A;  3HKR A;  5HFI A;  2HE3 A;  3TJF A;  3TKS C;  5AIX A;  1K0A A;  4XTS A;  1OVN A;  5FT3 A;  3V1W A;  1AC1 A;  1GTB A;  1SL1 B;  1VRS D;  1XWG A;  1QQ2 A;  4KND A;  1T8E B;  1I9D A;  4N10 A;  2GT6 A;  1R7H A;  4LA1 A;  3GX8 A;  3C7M A;  1GSF A;  1Y6E A;  3EUR A;  1U6T A;  2A4V A;  4EDZ A;  1G7E A;  1DUG A;  4EUY A;  1QXH A;  3BCI A;  4BWQ A;  1F9M A;  2P31 A;  4MJA A;  3NOF A;  3QPM A;  4WBJ A;  4CDO A;  4DSQ A;  2R6K A;  3LYP A;  2DJK A;  2QGV A;  1EEJ A;  4MZC A;  1KEB A;  4MF6 A;  2C0G A;  5IPH A;  2ZNM A;  2L57 A;  2HZE A;  2FLS A;  3GMF A;  1FOV A;  1OAZ A;  2V32 A;  2AB6 A;  3TJB A;  3A2V A;  2JZT A;  3E3E A;  14GS A;  12GS A;  3ME7 A;  2PER A;  2VL2 A;  3ZVJ A;  5KN1 A;  3S9F A;  3LWA A;  1NSW A;  2GQM A;  2NBS A;  2VO4 A;  4PGT A;  4TN8 A;  3RPP A;  1XWK A;  4YAV A;  2GT5 A;  1N8J A;  2KP2 A;  2DC5 A;  3GNJ A;  4GXZ A;  4PUA A;  4KSM A;  3RAZ A;  6GSW A;  1K0C A;  2NDO A;  2NVL A;  5DAK B;  1SK2 A;  2VCZ A;  5DJM A;  4OCE A;  4ZBA A;  2F8A A;  2B6M A;  3M9J A;  1ZGN A;  2MBT A;  1OE8 A;  3VLN A;  5JCG A;  1A2M A;  1YF0 A;  2I1U A;  1TI3 A;  1GTI A;  1UVZ A;  3IPZ A;  2HSH A;  4TXO A;  3O3T A;  1KTE A;  4OMV A;  2AYT A;  1EGR A;  2JU5 A;  1RW1 A;  4XS1 A;  1XVW A;  2GTU A;  2VL2 C;  5E59 A;  1WPI A;  3GV1 A;  1TDI A;  3FHK A;  2FNO A;  3E9J B;  1TTZ A;  1TK5 B;  2PVQ A;  1WE0 A;  3C73 A;  2K9F A;  3TOT A;  4FYU A;  2HLS A;  4ZL9 A;  4V2M A;  5JWO B;  4IQA A;  2YWM A;  5HQP A;  4JRR A;  1Z6M A;  2ALB A;  1RQM A;  4HZ2 A;  4JR6 A;  1K0N A;  3UAR A;  3GYK A;  4MPF A;  4QQ7 A;  4BVX A;  4KGI A;  2E0Q A;  5DCH A;  1TRW A;  2CVK A;  3ZVJ D;  1B4Q A;  4POM A;  1G0T A;  4WXT A;  4HQS A;  2CA8 A;  1UN2 A;  1Q4J A;  2B1K A;  1PRX A;  4K9Z A;  4O5R A;  3GUS A;  2VL3 A;  5J9C A;  1SK1 A;  5JWR B;  2PWJ A;  3GUR A;  3F9U A;  1XW6 A;  2ZUP A;  2OE3 A;  4KA0 A;  1THX A;  1USB A;  1XBS A;  4KB3 A;  2J23 A;  3IDV A;  2C80 A;  3GL3 A;  4MK3 A;  18GS A;  4IKH A;  5IO2 A;  3HJM A;  4OO4 A;  2EIO A;  4HUA A;  4DVC A;  2GZP A;  3ZML A;  3FEU A;  5LD0 A;  1AAZ A;  2YWI A;  5ELA A;  4WR4 A;  1AQV A;  1WJK A;  3H79 A;  4ZIJ A;  3UEM A;  3C8E A;  1AXD A;  3P2A A;  4I5Q A;  3Q18 A;  2N5B A;  1R5P A;  2L6D A;  5FWG A;  5DAK A;  5B6N A;  2IPA A;  4ZB6 A;  4GTU A;  2K8V A;  1VF2 A;  2TIR A;  2LEG A;  2RM5 A;  1PQN A;  1C72 A;  2H6X A;  4L5L A;  3LFL A;  2H66 A;  5ECS A;  2YJ7 A;  4HS1 A;  5HR0 A;  4TXV A;  4MH2 A;  1M2D A;  3ERG A;  1IYH A;  1XWC A;  2GSQ A;  2QC7 A;  4LMW A;  2WDU A;  3EMX A;  5DDL A;  4WBR D;  5CRW A;  1G6W A;  1FG4 A;  4HU9 A;  1ZYE A;  2LTK A;  2L5O A;  5CO3 A;  2GZY A;  1T1V A;  3IE3 A;  2AUV A;  4KDU A;  1ZYQ B;  2IL3 A;  2YZH A;  1TP9 A;  2GST A;  4TR0 A;  5ECK B;  2B7K A;  3G7I A;  1T4Y A;  2H1D A;  4X43 A;  6GSV A;  3CBU A;  4NHZ A;  4L0W A;  3BJ5 A;  3D6I A;  3QFB C;  4ZL8 A;  5EPF A;  4IHU A;  1XVQ A;  3WGE A;  3IAS 2;  3F3R A;  4KDY A;  4IQ1 A;  3HDC A;  3A3T A;  4DSS B;  3P8W A;  5IOX A;  2O87 A;  3H93 A;  4OO5 A;  3LJR A;  3KH9 A;  4RQR A;  2R3X A;  2CV4 A;  3ZTL A;  3FZ9 A;  3OR5 A;  5F8B A;  4KCA A;  3D21 A;  2RM6 A;  3HVX A;  1TOF A;  2C0D A;  1XPV A;  1XOB A;  4TW5 A;  2I4A A;  1XXU A;  5KEJ A;  3F4S A;  1WWJ A;  4POB A;  2VL9 A;  1EWX A;  4ID0 A;  3SBC A;  5F05 A;  4CHS A;  3ERW A;  5KN3 A;  2V2G A;  3FRC A;  2M72 A;  5GST A;  2BTO T;  3CSI A;  3ZIJ A;  1ILO A;  4MA9 A;  2M46 A;  1HNC A;  4RQX A;  2DMM A;  3DKS A;  4IN0 A;  3TGZ A;  1ERW A;  4X1U A;  5GSS A;  4YQU A;  3L0H A;  3G9B A;  4Q5N A;  4K1F A;  2VCX A;  1F37 A;  5G2Z A;  1YEX A;  2CT6 A;  4FH8 A;  4JED A;  3QAG A;  5IPG A;  1S3A A;  2VAF A;  2LJA A;  3F3Q A;  4V2N A;  2JZR A;  2LKU A;  1W89 A;  2VCT A;  1DSB A;  2YP6 A;  5FHI A;  2HT9 A;  3EMP A;  4O32 A;  2L4Q A;  1BED A;  1SK0 A;  1F3B A;  3F63 A;  3C1S A;  1A2J A;  1LU4 A;  3F6D A;  4OFM A;  2VUP A;  3NZN A;  4PXO A;  3M9K A;  3VPQ A;  1TW9 A;  1X9M B;  4GWR A;  5L71 A;  3J7Y k;  2GVP A;  1XCC A;  1OE7 A;  5ELG A;  2V1M A;  3W6G A;  4TR3 A;  2YCD A;  1Z5Y E;  2YJH A;  5IQY A;  2JSZ A;  1K3Y A;  2CVD A;  4XS6 A;  1Q98 A;  1X0R A;  2I9H A;  3TKS A;  2PBJ A;  3GSS A;  3F0I A;  3IAM 2;  2OE0 A;  5AGY A;  1FW1 A;  2VD0 A;  4EKZ A;  3KH7 A;  2RUE A;  1A0R P;  2PUK C;  1S3D A;  3WYW A;  4IJ3 A;  2F3M A;  4ML6 A;  3IK9 A;  3Q74 A;  3BCK A;  1K0D A;  3ISO A;  1AQX A;  2H72 A;  2AAW A;  4NV2 A;  3KJY A;  2IWT A;  5ECL B;  5LNK e;  3F8U A;  1Y25 A;  3KCM A;  2P0G A;  6GST A;  2HZF A;  4HOJ A;  2H01 A;  4QL9 A;  4H86 A;  2ON7 A;  5G5E A;  3TJG A;  3ZZX A;  2HRF A;  1THO A;  1VF4 A;  3E0U A;  1T7P B;  2HYX A;  1ERV A;  3KGK A;  4EC0 A;  2H0I A;  2L59 A;  4GQC A;  4PUF C;  4YQM A;  1SEN A;  1B48 A;  5AN1 A;  5E4W A;  3TOU A;  3PIN A;  2HFD A;  2E7P A;  4N0Z A;  3US3 A;  3WGD A;  4K6X A;  1K0B A;  5IMD A;  2H1G A;  2B1L A;  3L9U A;  4EF0 A;  1SJZ A;  2I81 A;  4ECI A;  1GP1 A;  2DBC A;  3GKX A;  2WS2 A;  2VCQ A;  2HXK A;  1BG5 A;  3QD9 A;  4OCF A;  5J9B A;  2IMD A;  1A8L A;  3HXS A;  2OAC A;  1VF1 A;  4BPY A;  5CRE A;  4P3Y B;  3L9S A;  1AQW A;  3IBH A;  3F4R A;  9GSS A;  1EOH A;  2YWN A;  1GRX A;  2ZCT A;  4ZB9 A;  3QR6 A;  2LJR A;  4E8E A;  3ZLP A;  3GKK A;  3HHV A;  3ME8 A;  1CQG A;  3HY2 A;  1WIK A;  1DBY A;  4IW9 A;  4CW9 A;  3AY8 A;  3ZIV A;  4I6X A;  5IIZ A;  1XFL A;  3KXO A;  3H4K A;  4GQF A;  1GUH A;  2KP1 A;  2IN3 A;  3DXB A;  2XPD A;  4WF4 A;  3UIW A;  1EP7 A;  1K0M A;  22GS A;  2ON5 A;  1E2Y A;  3ZYW A;  2WRT A;  4G9H A;  4F03 A;  4MCU A;  2LUS A;  4PQH A;  2B3S A;  2H8L A;  3KP9 A;  2D2Z A;  4OWY A;  5DVB A;  2AJQ B;  4RUV A;  3DIE A;  1M9B A;  3GL5 A;  2E2M A;  5KN0 A;  4IS0 A;  4FYB A;  4F0B A;  3KIJ A;  3CXG A;  2JAC A;  2OJL A;  1CQH A;  5B7C A;  5IMV A;  4GRF A;  4XHM A;  5ABR A;  2CAI A;  5IM9 A;  3FR6 A;  5JCU A;  4X0X A;  3HJP A;  3GHA A;  2VIM A;  3VWW A;  1TK0 B;  1KNG A;  2JSY A;  2P5Q A;  4POL A;  1OC9 B;  4MAB A;  4XRA A;  4IJI A;  1SL2 B;  2DJ2 A;  4MZW A;  4BWS A;  2B5X A;  1PL1 A;  4Q5F A;  4F82 A;  3ZFL A;  4MH3 A;  1PMT A;  3GH9 A;  2AV4 A;  3L4N A;  4MP4 A;  2J9H A;  3KP8 A;  3G7J A;  4EL1 A;  1JZR A;  4LL1 B;  2R5G A;  3PH9 A;  1K3O A;  5D9V A;  4L5O A;  4ZIL A;  3LEF A;  1SJ6 A;  4GLT A;  4MMM A;  2OE1 A;  4EO3 A;  1MD4 A;  1QGV A;  1O85 A;  5C04 A;  1BJX A;  1H4O A;  2FD3 A;  3ERF A;  2H30 A;  2REM A;  3C71 A;  5EL8 A;  3MWH A;  2H0H A;  2XBQ A;  2QSI A;  3VWX A;  1VGL A;  4KDX A;  2AHE A;  2R2J A;  3IR4 A;  3UBK A;  2CZ2 A;  1R5A A;  1FVJ A;  3QAV A;  1S3C A;  3K8N A;  1SYX A;  3IXR A;  3M8N A;  4ZB8 A;  4AGS A;  5J3R A;  2GGT A;  3I43 A;  2LV3 A;  5B8A A;  4MLY A;  3HD5 A;  1MD3 A;  1Z9H A;  3TUE A;  1XWB A;  1TXX A;  2XPE A;  3I6A A;  1ERU A;  2EIQ A;  2YZU A;  4KX4 A;  2IFQ B;  2GQL A;  3MSZ A;  1MEK A;  3QOU A;  4I2T A;  3IRA A;  4NMU A;  4BA7 A;  3CSJ A;  1FB6 A;  3P90 A;  2XC2 A;  4KSO A;  4ECJ A;  4V2L A;  4HJM A;  2OAD A;  4K8M A;  2B7J A;  3APS A;  5CRH A;  1AW9 A;  3C1R A;  1J08 A;  1AUC A;  2LQQ A;  3EE2 A;  4IBP A;  1B9Y C;  3FZA A;  4HEA 2;  2GLR A;  5DJL A;  4MDC A;  1OC9 A;  4KW6 A;  2YV9 A;  1Z7P A;  3KMO A;  1V9W A;  1ON4 A;  2IMK A;  2PMT A;  2H76 A;  1N2A A;  1TU7 A;  2C3T A;  4PNG A;  1TU8 A;  2YAN A;  2KHP A;  1JZO A;  2X99 A;  3EVI A;  5D8I A;  1PKW A;  2KUC A;  1GH2 A;  3TRX A;  2CX3 A;  3FZ4 A;  3EWL A;  1JLV A;  4K7O A;  4RI7 A;  3KMN A;  4N30 A;  4JR4 A;  1YKA A;  1T3B A;  3GKN A;  4XRD A;  5ECO B;  5CRD A;  1U3A A;  1XZO A;  4TR4 A;  3EC3 A;  2A2S A;  5INY A;  1GLQ A;  2MYG A;  2OBK A;  1O7U A;  5J4U A;  3VFI A;  1J0F A;  4HDE A;  3F6F A;  1M9A A;  2VD1 A;  3BOA A;  3DGQ A;  1SKS B;  5A4U A;  2F8F A;  2LNT A;  4N0V A;  3M1G A;  1EV9 A;  4ECC A;  2PVO C;  5D96 A;  1M2B A;  5G1L A;  5CRG A;  2G0F A;  5HR2 A;  4BVY A;  3TKQ A;  1Z3E A;  4N11 A;  1TK8 B;  3H1N A;  4MF5 A;  2HRN A;  5HR3 A;  1BX9 A;  1SD8 A;  1X5D A;  1HD2 A;  2TRC P;  3Q19 A;  2KLX A;  2HNL A;  3HA9 A;  2GSS A;  3HVS A;  2IFQ A;  5B8B A;  4EE0 A;  1PN9 A;  4DSR A;  3IC4 A;  1RK4 A;  2H6Y A;  1YDK A;  5J41 A;  3VPT A;  1Z7R A;  5C00 A;  4F9Z A;  2P5R A;  1PX7 A;  3CTG A;  2WFC A;  4JE1 A;  5EY6 A;  1J9B A;  3FW2 A;  3MNG A;  3LOR A;  4PX1 A;  1A0F A;  1ACV A;  3FR3 A;  2JAD A;  4O92 A;  3ZIT A;  4KE3 A;  4PNF A;  2DIZ A;  4ZBD A;  2C8U A;  5GAP D;  4V1A g;  1H75 A;  4ZBB A;  3NIV A;  3L78 A;  6GSS A;  1IYI A;  4KH7 A;  5ENU A;  2K6V A;  1LJR A;  1EV4 A;  5IMA A;  1WP0 A;  4NV5 A;  4ILF A;  3UVH A;  2M80 A;  5DQY A;  1NW2 A;  3U6V A;  2FWE A;  3TKS E;  1K3L A;  3DML A;  4TOP A;  5ECP B;  3UOM A;  3VWU A;  4IGJ A;  3DVX A;  3DEX A;  2VOC A;  2VM1 A;  1GSE A;  2BJX A;  4ULX A;  8GSS A;  1GUL A;  5DAL B;  2DJ0 A;  4DSS A;  11GS A;  2FA8 A;  2WZ9 A;  3O76 A;  3GTU B;  2TRX A;  3N5O A;  4GSS A;  5HFK A;  1NHY A;  3KM6 A;  2GQK A;  5J5N A;  3LG6 A;  1B9X C;  2MZC A;  5HFG A;  2L5L A;  5ID2 B;  5ECM B;  1XOA A;  2H70 A;  1X9S B;  1I5G A;  3TJK A;  2IMI A;  5CAX A;  5AIS A;  2XBI A;  3WT1 A;  2DLX A;  1GSS A;  3KTL A;  2OBI A;  4Q5R A;  4MJC A;  2FGX A;  3DRN A;  1SL0 B;  2DJ3 A;  1WOU A;  3QFA C;  2H0G A;  1O73 A;  2FWG A;  4IP6 A;  2HSY A;  5IMZ A;  3A2W A;  2WCI A;  1A8Y A;  4BL7 A;  2G2Q A;  1GSU A;  7GSS A;  4PQI A;  3LGC A;  5A4V A;  3R2Q A;  5G31 A;  4I97 A;  2VM2 A;  3VUR A;  2PGT A;  1WMJ A;  3A2X A;  4K0G A;  2X8G A;  3ED3 A;  4OFN A;  2PPT A;  1V40 A;  3CYN A;  3GKM A;  1HYU A;  1M7T A;  2YV7 A;  3CRT A;  3P7X A;  5B6M A;  2ES7 A;  1SKR B;  1UA5 A;  2HI7 A;  2LST A;  1SJI A;  20GS A;  3LXZ A;  2FUG 2;  1YEP A;  3LXT A;  5A4W A;  3FY7 A;  2IMF A;  1OKD A;  1AIU A;  4LLR A;  5ECQ B;  3IOS A;  3RHC A;  1NHO A;  1LBK A;  1URM A;  3WT2 A;  2GSR A;  2WB9 A;  5F0G A;  1B8X A;  3UJ1 A;  2RII A;  5DQS A;  2H71 A;  3D5J A;  1GLP A;  2H1B A;  2FCH A;  1GNE A;  4L0U A;  3CTF A;  1PA3 A;  2FY6 A;  4MJB A;  3MDK A;  3GN3 A;  1YF1 A;  4K2D A;  4XS4 B;  5ECN B;  4NWY A;  4HQZ A;  5GZZ B;  3LSZ A;  5ECI B;  3CSH A;  2F9S A;  1O8X A;  1TRU A;  2IJY A;  4FYC A;  2B5Y A;  3F4T A;  2VLT A;  4XIH A;  5DAL A;  3M3M A;  4PQ1 A;  5KN2 A;  3KEB A;  3JCM L;  3FR9 A;  2FWF A;  3GTU A;  1GTU A;  1V58 A;  3HZ8 A;  3GH6 A;  1YY7 A;  5G5F A;  1M0U A;  2IME A;  2F51 A;  1GTA A;  5ID2 A;  4D73 B;  3D22 A;  1V57 A;  3FKF A;  2I3Y A;  6GSY A;  1OC3 A;  3D4T A;  1HQO A;  1OKT A;  5D9X A;  2RUF A;  2V41 A;  3ZMK A;  4F0C A;  1GSD A;  4FIW A;  2CAQ A;  4AF2 A;  3KTB A;  10GS A;  1SD9 A;  3UL3 A;  1MDI A;  3QCP A;  2DJJ A;  3KD0 A;  1SKW B;  1F6M C;  3BBY A;  4E8H A;  2C0E A;  5DCG A;  3UAP A;  3L9V A;  2X8H A;  3N9J A;  4WEY A;  4YH2 A;  1EGO A;  4K0N A;  3IA1 A;  2FHE A;  1M2A A;  1ZMA A;  1X5E A;  1JFU A;  4QL7 A;  5H5S A;  1PGT A;  1HNA A;  4MPG A;  2R37 A;  2LRT A;  2C3Q A;  2LNS A;  1GUK A;  4G19 A;  1GSQ A;  2LQO A;  2VLV A;  2CQ9 A;  5F07 A;  4MF7 A;  4G2E A;  1XW9 A;  2RLI A;  3IV4 A;  17GS A;  2DIY A;  3IHQ A;  4OD7 A;  2MMO A;  4YAP A;  1ST9 A;  1X9W B;  2N5F A;  3LYK A;  1A23 A;  5A5K A;  1NM3 A;  2YN1 A;  1U3I A;  3APQ A;  1BAY A;  1PKZ A;  4HJ2 A;  4K7N A;  4XCS A;  3ZL5 A;  5IOW A;  5GAN D;  1V2A A;  3IK7 A;  1XWA A;  3G7Y A;  3FK8 A;  4XS4 A;  2L6C A;  1W4V A;  1GL8 A;  2LRC A;  2GDR A;  2CX4 A;  4Z7X A;  1YZX A;  4FO5 A;  4RI6 A;  2CVB A;  2H73 A;  2MBS A;  3U5R E;  2PN8 A;  4TKY A;  4NPB A;  4ISD A;  1JZD A;  5LCZ A;  2GS3 A;  3DWV A;  1M99 A;  2LRN A;  1FVK A;  2MMZ A;  3UBL A;  4D73 A;  1SYR A;  5CP1 A;  2VCW A;  4IVF A;  2C0F A;  4I2U A;  3ZRD A;  5JWQ B;  5COH A;  5AIV A;  1BYE A;  1BQ7 A;  2MMN A;  2K18 A;  2KOK A;  1YKC A;  2OKA A;  1O81 A;  4G10 A;  2EC4 A;  4NXI A;  1TKD B;  1Z6N A;  2O8V B;  4HU7 A;  1ZZY A;  3PGT A;  1E6B A;  3VWV A;  1F2E A;  4LL4 B;  5H5Q A;  1ZL9 A;  1QMV A;  3CMI A;  1TRS A;  1YJ6 A;  3O6T A;  4Q5Q A;  1QFN A;  5G30 A;  3GIX A;  1DE1 A;  2C3N A;  2YNX A;  1FB0 A;  2K8S A;  4ACS A;  1OC8 A;  3KZQ A;  3EU3 A;  2WJU A;  3GRX A;  2PU9 C;  1SU9 A;  2X8C A;  2O85 A;  3TDG A;  1GNW A;  1MDJ A;  4KAE A;  1TI1 A;  4ZL7 A;  4ZXG A;  3VK9 A;  2FWH A;  1T4Z A;  1U88 A;  5D73 A;  5JCW A;  1PX6 A;  3ZRE A;  4NAX A;  3EIN A;  4WR5 A;  2N5A A;  4YQV A;  6GSX A;  2DML A;  1TRV A;  4EXJ A;  1G7O A;  1JLW A;  4WET A;  1ML6 A;  1A2L A;  3TRP A;  1F3A A;  3TB2 A;  4AJ8 A;  3MAK A;  3I69 A;  4TVE A;  3QMX A;  3RDW A;  3I9V 2;  1ZOF A;  2YOI A;  4AJ6 A;  4DEJ A;  1JZW A;  2O89 A;  4TRX A;  3CRU A;  1DE2 A;  4OFT A;  2A2R A;  4GF0 A;  5G1K A;  2MMA A;  1WRY A;  4IEL A;  2CZ3 A;  3Q6O A;  4WKW A;  3RPN A;  5D9W A;  4MZB A;  3HCZ A;  3ZFB A;  4LMV A;  1A24 A;  2JZS A;  1PL2 A;  3H8Q A;  2Z9S A;  2XHF A;  19GS A;  2NPB A;  5F06 A;  1FO5 A;  5ECH B;  3HVV A;  3HZ4 A;  1HNB A;  1YQ1 A;  3TRQ A;  1KBN A;  1B4P A;  4GCI A;  4J57 E;  2BMX A;  4MJE A;  2DSA A;  2V6O A;  1VF3 A;  3M0F A;  2H19 A;  3PR8 A;  2H75 A;  4GSN A;  1EZK A;  1EP8 A;  1ABA A;  4TR1 B;  3J7Y b;  13GS A;  3GX0 A;  1QK8 A;  4L8E A;  4ECB A;  4PUR A;  3LQ7 A;  5ECR B;  2O7K A; 
#chains in the Genus database with same CATH topology
 3APO A;  2H6Z A;  4HI7 A;  1UC7 A;  4O5U A;  2FA4 A;  2H1A A;  3TKP A;  4ML1 A;  1R26 A;  4I8B A;  2VLU A;  5CNW A;  3DVW A;  2VCV A;  3FZ5 A;  4EVM A;  1EOG A;  1O6J A;  5HR1 A;  3GFK A;  2V6K A;  1QUW A;  3HYP A;  3W8J A;  4F2I A;  4YKF A;  3EU4 A;  3UMA A;  2EIR A;  1MDK A;  3D0Z A;  4HZ4 A;  5CYY A;  1ZCP A;  4JZQ A;  1U87 A;  2QKE A;  5IO0 A;  2WGR A;  4IP1 A;  1V98 A;  4EDY A;  3D4M A;  5D93 A;  1GUM A;  5DBQ A;  3DYR A;  4JBB A;  2LJK A;  2C4J A;  5D9T A;  1OYJ A;  5H5R A;  5IMC A;  1FHE A;  4KCE A;  1PD2 1;  3DD3 A;  3FYG A;  4WF5 A;  3RBT A;  2HZE B;  3UVT A;  3WGX A;  1O8W A;  1XW5 A;  1PSQ A;  4NHW A;  4POK A;  3A5W A;  2YWO A;  1JHB A;  2H74 A;  1X5C A;  2E2G A;  6GSU A;  2L4C A;  4JU5 A;  3GST A;  2DKI A;  1R4W A;  2YPM A;  4J56 E;  1T00 A;  1FAA A;  3QDN A;  1GWC A;  5IMF A;  3HVN A;  2WUL A;  2GZZ A;  3TJJ A;  3TCO A;  4V1A p;  1GSY A;  1XIY A;  1ERT A;  2B5E A;  3BD2 A;  3WD6 A;  2DJ1 A;  2IIY A;  3VI7 A;  3QAW A;  2C1Y A;  1G6Y A;  3VI5 A;  4J2F A;  3TKR A;  2R4V A;  2OA7 A;  2LS5 A;  2NTO A;  4GST A;  4K7I A;  4AJ7 A;  1K0O A;  2X64 A;  4KUN A;  3SWL A;  3RHB A;  4O7H A;  3GA4 A;  1MTC A;  4TXO B;  3EYT A;  4TR1 A;  3MYD A;  4Z2U A;  1TJD A;  2JL4 A;  5EVO A;  2HRK A;  3HJO A;  3W8S A;  1EEM A;  16GS A;  3HKR A;  5HFI A;  2HE3 A;  3TJF A;  3TKS C;  5AIX A;  1K0A A;  4XTS A;  1OVN A;  5FT3 A;  3V1W A;  1AC1 A;  1GTB A;  1SL1 B;  1VRS D;  1XWG A;  1QQ2 A;  4KND A;  1T8E B;  1I9D A;  4N10 A;  2GT6 A;  1R7H A;  4LA1 A;  3GX8 A;  3C7M A;  1GSF A;  1Y6E A;  3EUR A;  1U6T A;  2A4V A;  4EDZ A;  1G7E A;  1DUG A;  4EUY A;  1QXH A;  3BCI A;  4BWQ A;  1F9M A;  2P31 A;  4BVX B;  4MJA A;  3NOF A;  3QPM A;  4WBJ A;  4CDO A;  4DSQ A;  2R6K A;  3LYP A;  2DJK A;  2QGV A;  1EEJ A;  4MZC A;  1KEB A;  4MF6 A;  2C0G A;  5IPH A;  2ZNM A;  2L57 A;  2HZE A;  2FLS A;  3GMF A;  1FOV A;  1OAZ A;  2V32 A;  2AB6 A;  3TJB A;  3A2V A;  2JZT A;  3E3E A;  14GS A;  12GS A;  3ME7 A;  2PER A;  2VL2 A;  3ZVJ A;  5KN1 A;  3S9F A;  3LWA A;  1NSW A;  5KOX A;  2GQM A;  2NBS A;  2VO4 A;  4EIP A;  4PGT A;  4TN8 A;  3RPP A;  1XWK A;  4YAV A;  2GT5 A;  1N8J A;  2KP2 A;  2DC5 A;  3GNJ A;  2X4A A;  4USS A;  4GXZ A;  4PUA A;  4KSM A;  3RAZ A;  6GSW A;  1K0C A;  2NDO A;  2NVL A;  5DAK B;  1SK2 A;  2VCZ A;  5DJM A;  4OCE A;  4ZBA A;  2F8A A;  2B6M A;  3M9J A;  1ZGN A;  2MBT A;  1OE8 A;  3VLN A;  5JCG A;  1A2M A;  1YF0 A;  2I1U A;  1TI3 A;  1GTI A;  1UVZ A;  3IPZ A;  2HSH A;  4TXO A;  3O3T A;  1KTE A;  4OMV A;  2AYT A;  1EGR A;  2JU5 A;  1RW1 A;  4XS1 A;  1XVW A;  2GTU A;  2VL2 C;  5E59 A;  1WPI A;  3GV1 A;  1TDI A;  3FHK A;  2FNO A;  3E9J B;  1TTZ A;  1TK5 B;  2PVQ A;  1WE0 A;  3C73 A;  2K9F A;  3TOT A;  4FYU A;  2HLS A;  4ZL9 A;  4V2M A;  5JWO B;  4IQA A;  2YWM A;  5HQP A;  4JRR A;  1Z6M A;  2ALB A;  1RQM A;  4HZ2 A;  4JR6 A;  1XG8 A;  1K0N A;  3UAR A;  3GYK A;  4MPF A;  4QQ7 A;  4BVX A;  4KGI A;  2E0Q A;  5DCH A;  1TRW A;  2CVK A;  3ZVJ D;  1B4Q A;  4POM A;  1G0T A;  4WXT A;  4HQS A;  2CA8 A;  1UN2 A;  1Q4J A;  2B1K A;  1PRX A;  4K9Z A;  4O5R A;  3GUS A;  2VL3 A;  5J9C A;  1SK1 A;  5JWR B;  2PWJ A;  3GUR A;  3F9U A;  1XW6 A;  2ZUP A;  2OE3 A;  4KA0 A;  1THX A;  1USB A;  1XBS A;  4KB3 A;  2J23 A;  3IDV A;  2C80 A;  3GL3 A;  4MK3 A;  18GS A;  4IKH A;  5IO2 A;  3HJM A;  4OO4 A;  3MIX A;  3PPU A;  2EIO A;  4HUA A;  4DVC A;  2GZP A;  3ZML A;  3FEU A;  5LD0 A;  1AAZ A;  2YWI A;  5ELA A;  4WR4 A;  1AQV A;  1WJK A;  3H79 A;  4ZIJ A;  3UEM A;  3C8E A;  1AXD A;  3P2A A;  4I5Q A;  3Q18 A;  2N5B A;  1R5P A;  2L6D A;  5FWG A;  5DAK A;  5B6N A;  2IPA A;  4ZB6 A;  4G0I A;  4GTU A;  2K8V A;  1VF2 A;  2TIR A;  2LEG A;  2RM5 A;  1PQN A;  1C72 A;  2H6X A;  4L5L A;  3LFL A;  2H66 A;  5ECS A;  2YJ7 A;  4HS1 A;  5HR0 A;  4TXV A;  4MH2 A;  1M2D A;  3ERG A;  1IYH A;  1XWC A;  2GSQ A;  2QC7 A;  4LMW A;  2WDU A;  3EMX A;  5DDL A;  4CY6 A;  4WBR D;  5CRW A;  1G6W A;  1FG4 A;  4HU9 A;  1ZYE A;  2LTK A;  2L5O A;  5CO3 A;  2GZY A;  2HSM A;  1T1V A;  3IE3 A;  2AUV A;  2QA2 A;  4KDU A;  1ZYQ B;  2IL3 A;  2YZH A;  1TP9 A;  2GST A;  4TR0 A;  5ECK B;  2B7K A;  3G7I A;  1T4Y A;  2H1D A;  4X43 A;  6GSV A;  3CBU A;  4NHZ A;  4L0W A;  3BJ5 A;  3D6I A;  3QFB C;  4ZL8 A;  5EPF A;  4IHU A;  1XVQ A;  3WGE A;  3IAS 2;  3F3R A;  4KDY A;  4IQ1 A;  3HDC A;  3A3T A;  4DSS B;  3P8W A;  5IOX A;  2O87 A;  3H93 A;  4OO5 A;  3LJR A;  3KH9 A;  4RQR A;  2R3X A;  2CV4 A;  3ZTL A;  3FZ9 A;  3OR5 A;  5F8B A;  4KCA A;  3D21 A;  2RM6 A;  3HVX A;  1TOF A;  2C0D A;  1XPV A;  1XOB A;  4TW5 A;  2I4A A;  1XXU A;  5KEJ A;  3F4S A;  1WWJ A;  4POB A;  2VL9 A;  1EWX A;  4ID0 A;  3SBC A;  4YKG A;  5F05 A;  4CHS A;  3ERW A;  5KN3 A;  2V2G A;  3FRC A;  2M72 A;  5GST A;  2BTO T;  3CSI A;  3ZIJ A;  1ILO A;  4MA9 A;  2M46 A;  1HNC A;  4RQX A;  2DMM A;  3DKS A;  3R3E A;  4IN0 A;  3TGZ A;  1ERW A;  4X1U A;  5GSS A;  4YQU A;  3L0H A;  3G9B A;  4O5Q A;  4Q5N A;  4K1F A;  2VCX A;  1F37 A;  5G2Z A;  1YEX A;  2CT6 A;  4FH8 A;  2X49 A;  3QAG A;  4JED A;  5IPG A;  1S3A A;  2VAF A;  2LJA A;  3F3Q A;  4V2N A;  2JZR A;  2LKU A;  1W89 A;  2VCT A;  1DSB A;  2YP6 A;  5FHI A;  2HT9 A;  3EMP A;  4O32 A;  2L4Q A;  1BED A;  1SK0 A;  1F3B A;  3F63 A;  3C1S A;  1A2J A;  1LU4 A;  1PFO A;  3F6D A;  4OFM A;  2VUP A;  3NZN A;  4PXO A;  3M9K A;  3VPQ A;  1TW9 A;  1X9M B;  4GWR A;  5L71 A;  3J7Y k;  2GVP A;  1XCC A;  1OE7 A;  5ELG A;  2V1M A;  3W6G A;  4TR3 A;  2YCD A;  1Z5Y E;  2YJH A;  5IQY A;  2JSZ A;  1K3Y A;  2CVD A;  4XS6 A;  1Q98 A;  1X0R A;  2I9H A;  3TKS A;  2PBJ A;  3GSS A;  3F0I A;  3IAM 2;  2OE0 A;  5AGY A;  4KF9 A;  1FW1 A;  2VD0 A;  4EKZ A;  3KH7 A;  2RUE A;  1A0R P;  2PUK C;  1S3D A;  3WYW A;  4IJ3 A;  5KOW A;  2F3M A;  4ML6 A;  3IK9 A;  3Q74 A;  3BCK A;  1K0D A;  3ISO A;  1AQX A;  2H72 A;  3FMW A;  2AAW A;  4NV2 A;  3KJY A;  2IWT A;  5ECL B;  5LNK e;  3F8U A;  1Y25 A;  3KCM A;  2P0G A;  6GST A;  2HZF A;  4HOJ A;  2H01 A;  4QL9 A;  4H86 A;  4A5P A;  2ON7 A;  5G5E A;  3TJG A;  3ZZX A;  2HRF A;  1THO A;  1VF4 A;  3E0U A;  1T7P B;  2HYX A;  1ERV A;  3KGK A;  4EC0 A;  2H0I A;  2L59 A;  4GQC A;  4PUF C;  4YQM A;  1SEN A;  1B48 A;  5AN1 A;  5E4W A;  3TOU A;  3PIN A;  2HFD A;  2E7P A;  4N0Z A;  3US3 A;  3WGD A;  4K6X A;  1K0B A;  5IMD A;  2H1G A;  2B1L A;  3L9U A;  4EF0 A;  1SJZ A;  2I81 A;  4ECI A;  1GP1 A;  2DBC A;  3GKX A;  2WS2 A;  2VCQ A;  2HXK A;  1BG5 A;  3QD9 A;  4OCF A;  5J9B A;  2IMD A;  1A8L A;  3HXS A;  2OAC A;  1VF1 A;  4BPY A;  5CRE A;  4P3Y B;  3L9S A;  1AQW A;  3IBH A;  3F4R A;  9GSS A;  1EOH A;  2YWN A;  1GRX A;  2ZCT A;  3CQF A;  4ZB9 A;  3QR6 A;  2LJR A;  4E8E A;  3ZLP A;  3GKK A;  3HHV A;  3ME8 A;  1CQG A;  3HY2 A;  1WIK A;  4K5S A;  1DBY A;  4IW9 A;  4CW9 A;  3AY8 A;  3ZIV A;  4I6X A;  5IIZ A;  1XFL A;  2HRA A;  3KXO A;  3H4K A;  4GQF A;  1GUH A;  2KP1 A;  2IN3 A;  3DXB A;  2XPD A;  4WF4 A;  3UIW A;  1EP7 A;  1K0M A;  22GS A;  2ON5 A;  1E2Y A;  3ZYW A;  2WRT A;  4G9H A;  4F03 A;  4MCU A;  2LUS A;  4PQH A;  2B3S A;  2H8L A;  3KP9 A;  2D2Z A;  4OWY A;  5DVB A;  2AJQ B;  4RUV A;  3DIE A;  1M9B A;  3GL5 A;  3EPT A;  2E2M A;  5KN0 A;  4IS0 A;  4FYB A;  4F0B A;  3KIJ A;  2UZ8 A;  3CXG A;  2JAC A;  2OJL A;  1CQH A;  4K2X A;  5B7C A;  5IMV A;  4GRF A;  4XHM A;  5ABR A;  2CAI A;  5IM9 A;  3FR6 A;  5JCU A;  4X0X A;  3HJP A;  3GHA A;  2VIM A;  3VWW A;  1TK0 B;  1KNG A;  2JSY A;  2P5Q A;  4POL A;  1OC9 B;  4MAB A;  4XRA A;  4IJI A;  1SL2 B;  2DJ2 A;  4MZW A;  4MNN A;  4BWS A;  2B5X A;  1PL1 A;  4Q5F A;  4F82 A;  3ZFL A;  4MH3 A;  1PMT A;  3GH9 A;  2AV4 A;  3L4N A;  4MP4 A;  2J9H A;  3KP8 A;  3G7J A;  4EL1 A;  1JZR A;  4LL1 B;  2R5G A;  3PH9 A;  1K3O A;  5D9V A;  4L5O A;  2A2P A;  4ZIL A;  3LEF A;  1SJ6 A;  4GLT A;  4MMM A;  2OE1 A;  4EO3 A;  1MD4 A;  1QGV A;  1O85 A;  5C04 A;  1BJX A;  1H4O A;  2FD3 A;  3ERF A;  2H30 A;  2REM A;  3C71 A;  1ZYP A;  5EL8 A;  3MWH A;  2H0H A;  2XBQ A;  2QSI A;  3VWX A;  1VGL A;  4KDX A;  2AHE A;  2R2J A;  3IR4 A;  3UBK A;  2CZ2 A;  1R5A A;  1FVJ A;  2QA1 A;  3QAV A;  1S3C A;  3K8N A;  1SYX A;  4BVY B;  3IXR A;  3M8N A;  4ZB8 A;  4AGS A;  5J3R A;  2GGT A;  3I43 A;  2LV3 A;  5B8A A;  4MLY A;  3HD5 A;  1MD3 A;  1Z9H A;  3TUE A;  1XWB A;  1TXX A;  2XPE A;  3I6A A;  1ERU A;  2EIQ A;  2YZU A;  4KX4 A;  2IFQ B;  2GQL A;  3MSZ A;  1MEK A;  3QOU A;  4I2T A;  3IRA A;  4G0L A;  4NMU A;  4BA7 A;  3CSJ A;  1FB6 A;  3P90 A;  2XC2 A;  4KSO A;  4ECJ A;  4V2L A;  4HJM A;  2OAD A;  4K8M A;  2B7J A;  3APS A;  5CRH A;  1AW9 A;  3C1R A;  1J08 A;  1AUC A;  2LQQ A;  3EE2 A;  4IBP A;  1B9Y C;  3FZA A;  4HEA 2;  4EIQ A;  2GLR A;  5DJL A;  4MDC A;  1OC9 A;  4KW6 A;  2YV9 A;  1Z7P A;  3KMO A;  1V9W A;  1ON4 A;  2IMK A;  2PMT A;  2H76 A;  1N2A A;  1TU7 A;  2C3T A;  4PNG A;  1TU8 A;  2YAN A;  2KHP A;  1JZO A;  2X99 A;  3EVI A;  5D8I A;  1PKW A;  2KUC A;  1GH2 A;  3TRX A;  2CX3 A;  3FZ4 A;  3EWL A;  1JLV A;  4K7O A;  4RI7 A;  3KMN A;  4N30 A;  4PTS A;  4JR4 A;  1YKA A;  1T3B A;  3GKN A;  4XRD A;  5ECO B;  5CRD A;  1U3A A;  1XZO A;  4TR4 A;  3EC3 A;  2A2S A;  5INY A;  1GLQ A;  2MYG A;  2OBK A;  1O7U A;  5J4U A;  3VFI A;  1J0F A;  4HDE A;  3F6F A;  1M9A A;  2VD1 A;  3BOA A;  3DGQ A;  1SKS B;  5A4U A;  2F8F A;  2LNT A;  4N0V A;  3M1G A;  1EV9 A;  4ECC A;  2PVO C;  5D96 A;  1M2B A;  5G1L A;  5CRG A;  2G0F A;  2A4H A;  5HR2 A;  4BVY A;  3TKQ A;  1Z3E A;  4N11 A;  1TK8 B;  3H1N A;  4MF5 A;  2HRN A;  5HR3 A;  1BX9 A;  1SD8 A;  1X5D A;  1HD2 A;  2TRC P;  3Q19 A;  2KLX A;  2HNL A;  3HA9 A;  2GSS A;  3HVS A;  2IFQ A;  4BL7 B;  5B8B A;  4EE0 A;  1PN9 A;  4DSR A;  3IC4 A;  1RK4 A;  2H6Y A;  1YDK A;  5J41 A;  3VPT A;  1Z7R A;  5C00 A;  4F9Z A;  2P5R A;  1PX7 A;  3CTG A;  2WFC A;  4JE1 A;  5EY6 A;  1J9B A;  3FW2 A;  3MNG A;  3LOR A;  4PX1 A;  1A0F A;  1ACV A;  3FR3 A;  2JAD A;  4O92 A;  3ZIT A;  4KE3 A;  4PNF A;  2DIZ A;  4ZBD A;  2C8U A;  5GAP D;  4V1A g;  3IHG A;  1H75 A;  4ZBB A;  3NIV A;  3L78 A;  4Z2R A;  6GSS A;  1IYI A;  4KH7 A;  5ENU A;  2K6V A;  1LJR A;  1EV4 A;  5IMA A;  2R0C A;  1WP0 A;  4NV5 A;  4ILF A;  3UVH A;  2M80 A;  5DQY A;  1NW2 A;  3U6V A;  2FWE A;  3TKS E;  1K3L A;  3DML A;  4TOP A;  5ECP B;  3UOM A;  3VWU A;  4IGJ A;  3DVX A;  3DEX A;  2VOC A;  2VM1 A;  1GSE A;  2BJX A;  4ULX A;  8GSS A;  1GUL A;  5DAL B;  2DJ0 A;  1S3R A;  4DSS A;  11GS A;  2FA8 A;  2WZ9 A;  3O76 A;  3GTU B;  2TRX A;  3N5O A;  4GSS A;  5HFK A;  4BIK A;  1NHY A;  3KM6 A;  2GQK A;  5J5N A;  3LG6 A;  1B9X C;  2MZC A;  5HFG A;  2L5L A;  5ID2 B;  5ECM B;  1XOA A;  2H70 A;  1X9S B;  1I5G A;  2R0G A;  3TJK A;  2IMI A;  5CAX A;  5AIS A;  2XBI A;  3WT1 A;  2DLX A;  1GSS A;  3KTL A;  2OBI A;  4Q5R A;  4MJC A;  2FGX A;  3DRN A;  1SL0 B;  2DJ3 A;  1WOU A;  3QFA C;  2H0G A;  1O73 A;  2FWG A;  4IP6 A;  2HSY A;  5IMZ A;  3A2W A;  2WCI A;  1A8Y A;  4BL7 A;  2G2Q A;  1GSU A;  7GSS A;  4PQI A;  3LGC A;  5A4V A;  3R2Q A;  5G31 A;  4I97 A;  2VM2 A;  3VUR A;  2PGT A;  1WMJ A;  3A2X A;  4K0G A;  2X8G A;  3ED3 A;  4OFN A;  2PPT A;  1V40 A;  3CYN A;  3GKM A;  1HYU A;  3LW9 A;  1M7T A;  2YV7 A;  3CRT A;  3P7X A;  5B6M A;  2ES7 A;  1SKR B;  1ZYN A;  1UA5 A;  2HI7 A;  2LST A;  1SJI A;  20GS A;  3LXZ A;  2FUG 2;  1YEP A;  3LXT A;  5A4W A;  3FY7 A;  2IMF A;  1OKD A;  1AIU A;  4LLR A;  5ECQ B;  3IOS A;  3RHC A;  1NHO A;  1LBK A;  1URM A;  3WT2 A;  2GSR A;  2WB9 A;  5F0G A;  1B8X A;  3UJ1 A;  2RII A;  5DQS A;  2H71 A;  3D5J A;  1GLP A;  2H1B A;  2FCH A;  1GNE A;  4L0U A;  3CTF A;  1PA3 A;  2FY6 A;  4MJB A;  3MDK A;  3GN3 A;  1YF1 A;  4K2D A;  4XS4 B;  5ECN B;  4NWY A;  4HQZ A;  5GZZ B;  3LSZ A;  5ECI B;  3CSH A;  2F9S A;  1O8X A;  1TRU A;  2IJY A;  4FYC A;  2B5Y A;  3F4T A;  2VLT A;  1M3I A;  4XIH A;  5DAL A;  3M3M A;  4PQ1 A;  5KN2 A;  3KEB A;  3JCM L;  3FR9 A;  2FWF A;  3GTU A;  1GTU A;  1V58 A;  3HZ8 A;  3GH6 A;  1YY7 A;  5G5F A;  1M0U A;  2IME A;  2F51 A;  1GTA A;  5ID2 A;  4D73 B;  3D22 A;  1V57 A;  3FKF A;  2I3Y A;  6GSY A;  1OC3 A;  1M3J A;  3D4T A;  1HQO A;  1OKT A;  5D9X A;  4K5R A;  2RUF A;  2V41 A;  3ZMK A;  4F0C A;  4FQU A;  1GSD A;  4FIW A;  2CAQ A;  4AF2 A;  4CY8 A;  3KTB A;  10GS A;  1SD9 A;  3UL3 A;  1MDI A;  3QCP A;  2DJJ A;  3KD0 A;  1SKW B;  1F6M C;  3BBY A;  4E8H A;  2C0E A;  5DCG A;  3UAP A;  3L9V A;  2X8H A;  3N9J A;  4WEY A;  4YH2 A;  1EGO A;  4K0N A;  3IA1 A;  2FHE A;  1M2A A;  1ZMA A;  1X5E A;  1JFU A;  4QL7 A;  5H5S A;  1PGT A;  1HNA A;  4MPG A;  2R37 A;  2LRT A;  2C3Q A;  2LNS A;  1GUK A;  4G19 A;  1GSQ A;  2LQO A;  2VLV A;  2CQ9 A;  5F07 A;  4MF7 A;  4G2E A;  1XW9 A;  2R0P A;  2RLI A;  3IV4 A;  17GS A;  2DIY A;  3IHQ A;  4OD7 A;  2MMO A;  4YAP A;  1ST9 A;  1X9W B;  2N5F A;  3LYK A;  1A23 A;  5A5K A;  1NM3 A;  2YN1 A;  1U3I A;  3APQ A;  1BAY A;  1PKZ A;  4HJ2 A;  4K7N A;  4XCS A;  3ZL5 A;  5IOW A;  5GAN D;  1V2A A;  3IK7 A;  1XWA A;  3G7Y A;  3FK8 A;  4XS4 A;  2L6C A;  1W4V A;  1GL8 A;  2LRC A;  2GDR A;  2CX4 A;  4Z7X A;  1YZX A;  4FO5 A;  4X4J A;  4RI6 A;  2CVB A;  2DKH A;  2H73 A;  2MBS A;  3U5R E;  2PN8 A;  4TKY A;  4Z2T A;  4NPB A;  4ISD A;  1JZD A;  5LCZ A;  2GS3 A;  3DWV A;  1M99 A;  2LRN A;  1FVK A;  2MMZ A;  3UBL A;  4D73 A;  1SYR A;  5CP1 A;  2VCW A;  4IVF A;  2C0F A;  4I2U A;  3ZRD A;  5JWQ B;  5COH A;  5AIV A;  1BYE A;  1BQ7 A;  2MMN A;  2K18 A;  2KOK A;  1YKC A;  2OKA A;  1O81 A;  4G10 A;  2EC4 A;  4NXI A;  1TKD B;  1Z6N A;  2O8V B;  4HU7 A;  1ZZY A;  3PGT A;  1E6B A;  3VWV A;  1F2E A;  4LL4 B;  5H5Q A;  1ZL9 A;  1QMV A;  3CMI A;  1TRS A;  1YJ6 A;  3O6T A;  4Q5Q A;  1QFN A;  5G30 A;  3GIX A;  1DE1 A;  2C3N A;  2YNX A;  1FB0 A;  2K8S A;  4G0K A;  4ACS A;  1OC8 A;  3KZQ A;  3EU3 A;  2WJU A;  3GRX A;  2PU9 C;  1SU9 A;  2X8C A;  2O85 A;  3TDG A;  1GNW A;  1MDJ A;  4KAE A;  1TI1 A;  4ZL7 A;  4ZXG A;  5BMU A;  3VK9 A;  2FWH A;  1T4Z A;  1U88 A;  5D73 A;  5JCW A;  1PX6 A;  3ZRE A;  4NAX A;  1PN0 A;  3EIN A;  4WR5 A;  2N5A A;  4YQV A;  6GSX A;  2DML A;  1TRV A;  4EXJ A;  1G7O A;  1JLW A;  4WET A;  1ML6 A;  4ICY A;  1A2L A;  3TRP A;  1F3A A;  3TB2 A;  4AJ8 A;  3MAK A;  3I69 A;  4TVE A;  3QMX A;  5BRT A;  3RDW A;  3I9V 2;  1ZOF A;  2YOI A;  4AJ6 A;  4DEJ A;  1JZW A;  2O89 A;  4TRX A;  3CRU A;  1DE2 A;  4OFT A;  2A2R A;  4GF0 A;  5G1K A;  2MMA A;  1WRY A;  4IEL A;  2CZ3 A;  3Q6O A;  4WKW A;  3RPN A;  5D9W A;  4MZB A;  3HCZ A;  3ZFB A;  3A5I A;  4LMV A;  1A24 A;  2JZS A;  1FOH A;  1PL2 A;  3H8Q A;  2Z9S A;  2XHF A;  19GS A;  2NPB A;  5F06 A;  1FO5 A;  5ECH B;  3HVV A;  3HZ4 A;  1HNB A;  1YQ1 A;  3TRQ A;  1KBN A;  1B4P A;  4GCI A;  4J57 E;  2BMX A;  4MJE A;  2DSA A;  2V6O A;  1VF3 A;  4HSC X;  3M0F A;  2H19 A;  3PR8 A;  3IC8 A;  2H75 A;  4GSN A;  1EZK A;  1EP8 A;  1ABA A;  4TR1 B;  3J7Y b;  13GS A;  3GX0 A;  1QK8 A;  4L8E A;  4ECB A;  4PUR A;  3LQ7 A;  5ECR B;  2O7K A; 
#chains in the Genus database with same CATH homology
 3APO A;  2H6Z A;  4HI7 A;  1UC7 A;  4O5U A;  2FA4 A;  2H1A A;  3TKP A;  4ML1 A;  1R26 A;  4I8B A;  2VLU A;  5CNW A;  3DVW A;  2VCV A;  3FZ5 A;  4EVM A;  1EOG A;  1O6J A;  5HR1 A;  3GFK A;  2V6K A;  1QUW A;  3HYP A;  3W8J A;  4F2I A;  4YKF A;  3EU4 A;  3UMA A;  2EIR A;  1MDK A;  3D0Z A;  4HZ4 A;  5CYY A;  1ZCP A;  4JZQ A;  1U87 A;  2QKE A;  5IO0 A;  2WGR A;  4IP1 A;  1V98 A;  4EDY A;  3D4M A;  5D93 A;  1GUM A;  5DBQ A;  3DYR A;  4JBB A;  2LJK A;  2C4J A;  5D9T A;  1OYJ A;  5H5R A;  5IMC A;  1FHE A;  4KCE A;  1PD2 1;  3DD3 A;  3FYG A;  4WF5 A;  3RBT A;  2HZE B;  3UVT A;  3WGX A;  1O8W A;  1XW5 A;  1PSQ A;  4NHW A;  4POK A;  3A5W A;  2YWO A;  1JHB A;  2H74 A;  1X5C A;  2E2G A;  6GSU A;  2L4C A;  4JU5 A;  3GST A;  2DKI A;  1R4W A;  2YPM A;  4J56 E;  1T00 A;  1FAA A;  3QDN A;  1GWC A;  5IMF A;  2WUL A;  2GZZ A;  3TJJ A;  3TCO A;  4V1A p;  1GSY A;  1XIY A;  1ERT A;  2B5E A;  3BD2 A;  3WD6 A;  2DJ1 A;  2IIY A;  3VI7 A;  3QAW A;  2C1Y A;  1G6Y A;  3VI5 A;  4J2F A;  3TKR A;  2R4V A;  2OA7 A;  2LS5 A;  2NTO A;  4GST A;  4K7I A;  4AJ7 A;  1K0O A;  2X64 A;  4KUN A;  3SWL A;  3RHB A;  4O7H A;  3GA4 A;  1MTC A;  4TXO B;  3EYT A;  4TR1 A;  3MYD A;  4Z2U A;  1TJD A;  2JL4 A;  5EVO A;  2HRK A;  3HJO A;  3W8S A;  1EEM A;  16GS A;  3HKR A;  5HFI A;  2HE3 A;  3TJF A;  3TKS C;  5AIX A;  1K0A A;  4XTS A;  1OVN A;  5FT3 A;  3V1W A;  1AC1 A;  1GTB A;  1SL1 B;  1VRS D;  1XWG A;  1QQ2 A;  4KND A;  1T8E B;  1I9D A;  4N10 A;  2GT6 A;  1R7H A;  4LA1 A;  3GX8 A;  3C7M A;  1GSF A;  1Y6E A;  3EUR A;  1U6T A;  2A4V A;  4EDZ A;  1G7E A;  1DUG A;  4EUY A;  1QXH A;  3BCI A;  4BWQ A;  1F9M A;  2P31 A;  4BVX B;  4MJA A;  3NOF A;  3QPM A;  4WBJ A;  4CDO A;  4DSQ A;  2R6K A;  3LYP A;  2DJK A;  2QGV A;  1EEJ A;  4MZC A;  1KEB A;  4MF6 A;  2C0G A;  5IPH A;  2ZNM A;  2L57 A;  2HZE A;  2FLS A;  3GMF A;  1FOV A;  1OAZ A;  2V32 A;  2AB6 A;  3TJB A;  3A2V A;  2JZT A;  3E3E A;  14GS A;  12GS A;  3ME7 A;  2PER A;  2VL2 A;  3ZVJ A;  5KN1 A;  3S9F A;  3LWA A;  1NSW A;  5KOX A;  2GQM A;  2NBS A;  2VO4 A;  4EIP A;  4PGT A;  4TN8 A;  3RPP A;  1XWK A;  4YAV A;  2GT5 A;  1N8J A;  2KP2 A;  2DC5 A;  3GNJ A;  2X4A A;  4USS A;  4GXZ A;  4PUA A;  4KSM A;  3RAZ A;  6GSW A;  1K0C A;  2NDO A;  2NVL A;  5DAK B;  1SK2 A;  2VCZ A;  5DJM A;  4OCE A;  4ZBA A;  2F8A A;  2B6M A;  3M9J A;  1ZGN A;  2MBT A;  1OE8 A;  3VLN A;  5JCG A;  1A2M A;  1YF0 A;  2I1U A;  1TI3 A;  1GTI A;  1UVZ A;  3IPZ A;  2HSH A;  4TXO A;  3O3T A;  1KTE A;  4OMV A;  2AYT A;  1EGR A;  2JU5 A;  1RW1 A;  4XS1 A;  1XVW A;  2GTU A;  2VL2 C;  5E59 A;  1WPI A;  3GV1 A;  1TDI A;  3FHK A;  2FNO A;  3E9J B;  1TTZ A;  1TK5 B;  2PVQ A;  1WE0 A;  3C73 A;  2K9F A;  3TOT A;  4FYU A;  2HLS A;  4ZL9 A;  4V2M A;  5JWO B;  4IQA A;  2YWM A;  5HQP A;  4JRR A;  1Z6M A;  2ALB A;  1RQM A;  4HZ2 A;  4JR6 A;  1K0N A;  3UAR A;  3GYK A;  4MPF A;  4QQ7 A;  4BVX A;  4KGI A;  2E0Q A;  5DCH A;  1TRW A;  2CVK A;  3ZVJ D;  1B4Q A;  4POM A;  1G0T A;  4WXT A;  4HQS A;  2CA8 A;  1UN2 A;  1Q4J A;  2B1K A;  1PRX A;  4K9Z A;  4O5R A;  3GUS A;  2VL3 A;  5J9C A;  1SK1 A;  5JWR B;  2PWJ A;  3GUR A;  3F9U A;  1XW6 A;  2ZUP A;  2OE3 A;  4KA0 A;  1THX A;  1USB A;  1XBS A;  4KB3 A;  2J23 A;  3IDV A;  2C80 A;  3GL3 A;  4MK3 A;  18GS A;  4IKH A;  5IO2 A;  3HJM A;  4OO4 A;  3MIX A;  3PPU A;  2EIO A;  4HUA A;  4DVC A;  2GZP A;  3ZML A;  3FEU A;  5LD0 A;  1AAZ A;  2YWI A;  5ELA A;  4WR4 A;  1AQV A;  1WJK A;  3H79 A;  4ZIJ A;  3UEM A;  3C8E A;  1AXD A;  3P2A A;  4I5Q A;  3Q18 A;  2N5B A;  1R5P A;  2L6D A;  5FWG A;  5DAK A;  5B6N A;  2IPA A;  4ZB6 A;  4G0I A;  4GTU A;  2K8V A;  1VF2 A;  2TIR A;  2LEG A;  2RM5 A;  1PQN A;  1C72 A;  2H6X A;  4L5L A;  3LFL A;  2H66 A;  5ECS A;  2YJ7 A;  4HS1 A;  5HR0 A;  4TXV A;  4MH2 A;  1M2D A;  3ERG A;  1IYH A;  1XWC A;  2GSQ A;  2QC7 A;  4LMW A;  2WDU A;  3EMX A;  5DDL A;  4CY6 A;  4WBR D;  5CRW A;  1G6W A;  1FG4 A;  4HU9 A;  1ZYE A;  2LTK A;  2L5O A;  5CO3 A;  2GZY A;  2HSM A;  1T1V A;  3IE3 A;  2AUV A;  2QA2 A;  4KDU A;  1ZYQ B;  2IL3 A;  2YZH A;  1TP9 A;  2GST A;  4TR0 A;  5ECK B;  2B7K A;  3G7I A;  1T4Y A;  2H1D A;  4X43 A;  6GSV A;  3CBU A;  4NHZ A;  4L0W A;  3BJ5 A;  3D6I A;  3QFB C;  4ZL8 A;  5EPF A;  4IHU A;  1XVQ A;  3WGE A;  3IAS 2;  3F3R A;  4KDY A;  4IQ1 A;  3HDC A;  3A3T A;  4DSS B;  3P8W A;  5IOX A;  2O87 A;  3H93 A;  4OO5 A;  3LJR A;  3KH9 A;  4RQR A;  2R3X A;  2CV4 A;  3ZTL A;  3FZ9 A;  3OR5 A;  5F8B A;  4KCA A;  3D21 A;  2RM6 A;  3HVX A;  1TOF A;  2C0D A;  1XPV A;  1XOB A;  4TW5 A;  2I4A A;  1XXU A;  5KEJ A;  3F4S A;  1WWJ A;  4POB A;  2VL9 A;  1EWX A;  4ID0 A;  3SBC A;  4YKG A;  5F05 A;  4CHS A;  3ERW A;  5KN3 A;  2V2G A;  3FRC A;  2M72 A;  5GST A;  2BTO T;  3CSI A;  3ZIJ A;  1ILO A;  4MA9 A;  2M46 A;  1HNC A;  4RQX A;  2DMM A;  3DKS A;  3R3E A;  4IN0 A;  3TGZ A;  1ERW A;  4X1U A;  5GSS A;  4YQU A;  3L0H A;  3G9B A;  4O5Q A;  4Q5N A;  4K1F A;  2VCX A;  1F37 A;  5G2Z A;  1YEX A;  2CT6 A;  4FH8 A;  2X49 A;  3QAG A;  4JED A;  5IPG A;  1S3A A;  2VAF A;  2LJA A;  3F3Q A;  4V2N A;  2JZR A;  2LKU A;  1W89 A;  2VCT A;  1DSB A;  2YP6 A;  5FHI A;  2HT9 A;  3EMP A;  4O32 A;  2L4Q A;  1BED A;  1SK0 A;  1F3B A;  3F63 A;  3C1S A;  1A2J A;  1LU4 A;  3F6D A;  4OFM A;  2VUP A;  3NZN A;  4PXO A;  3M9K A;  3VPQ A;  1TW9 A;  1X9M B;  4GWR A;  5L71 A;  3J7Y k;  2GVP A;  1XCC A;  1OE7 A;  5ELG A;  2V1M A;  3W6G A;  4TR3 A;  2YCD A;  1Z5Y E;  2YJH A;  5IQY A;  2JSZ A;  1K3Y A;  2CVD A;  4XS6 A;  1Q98 A;  1X0R A;  2I9H A;  3TKS A;  2PBJ A;  3GSS A;  3F0I A;  3IAM 2;  2OE0 A;  5AGY A;  4KF9 A;  1FW1 A;  2VD0 A;  4EKZ A;  3KH7 A;  2RUE A;  1A0R P;  2PUK C;  1S3D A;  3WYW A;  4IJ3 A;  5KOW A;  2F3M A;  4ML6 A;  3IK9 A;  3Q74 A;  3BCK A;  1K0D A;  3ISO A;  1AQX A;  2H72 A;  3FMW A;  2AAW A;  4NV2 A;  3KJY A;  2IWT A;  5ECL B;  5LNK e;  3F8U A;  1Y25 A;  3KCM A;  2P0G A;  6GST A;  2HZF A;  4HOJ A;  2H01 A;  4QL9 A;  4H86 A;  4A5P A;  2ON7 A;  5G5E A;  3TJG A;  3ZZX A;  2HRF A;  1THO A;  1VF4 A;  3E0U A;  1T7P B;  2HYX A;  1ERV A;  3KGK A;  4EC0 A;  2H0I A;  2L59 A;  4GQC A;  4PUF C;  4YQM A;  1SEN A;  1B48 A;  5AN1 A;  5E4W A;  3TOU A;  3PIN A;  2HFD A;  2E7P A;  4N0Z A;  3US3 A;  3WGD A;  4K6X A;  1K0B A;  5IMD A;  2H1G A;  2B1L A;  3L9U A;  4EF0 A;  1SJZ A;  2I81 A;  4ECI A;  1GP1 A;  2DBC A;  3GKX A;  2WS2 A;  2VCQ A;  2HXK A;  1BG5 A;  3QD9 A;  4OCF A;  5J9B A;  2IMD A;  1A8L A;  3HXS A;  2OAC A;  1VF1 A;  4BPY A;  5CRE A;  4P3Y B;  3L9S A;  1AQW A;  3IBH A;  3F4R A;  9GSS A;  1EOH A;  2YWN A;  1GRX A;  2ZCT A;  4ZB9 A;  3QR6 A;  2LJR A;  4E8E A;  3ZLP A;  3GKK A;  3HHV A;  3ME8 A;  1CQG A;  3HY2 A;  1WIK A;  4K5S A;  1DBY A;  4IW9 A;  4CW9 A;  3AY8 A;  3ZIV A;  4I6X A;  5IIZ A;  1XFL A;  2HRA A;  3KXO A;  3H4K A;  4GQF A;  1GUH A;  2KP1 A;  2IN3 A;  3DXB A;  2XPD A;  4WF4 A;  3UIW A;  1EP7 A;  1K0M A;  22GS A;  2ON5 A;  1E2Y A;  3ZYW A;  2WRT A;  4G9H A;  4F03 A;  4MCU A;  2LUS A;  4PQH A;  2B3S A;  2H8L A;  3KP9 A;  2D2Z A;  4OWY A;  5DVB A;  2AJQ B;  4RUV A;  3DIE A;  1M9B A;  3GL5 A;  3EPT A;  2E2M A;  5KN0 A;  4IS0 A;  4FYB A;  4F0B A;  3KIJ A;  2UZ8 A;  3CXG A;  2JAC A;  2OJL A;  1CQH A;  4K2X A;  5B7C A;  5IMV A;  4GRF A;  4XHM A;  5ABR A;  2CAI A;  5IM9 A;  3FR6 A;  5JCU A;  4X0X A;  3HJP A;  3GHA A;  2VIM A;  3VWW A;  1TK0 B;  1KNG A;  2JSY A;  2P5Q A;  4POL A;  1OC9 B;  4MAB A;  4XRA A;  4IJI A;  1SL2 B;  2DJ2 A;  4MZW A;  4MNN A;  4BWS A;  2B5X A;  1PL1 A;  4Q5F A;  4F82 A;  3ZFL A;  4MH3 A;  1PMT A;  3GH9 A;  2AV4 A;  3L4N A;  4MP4 A;  2J9H A;  3KP8 A;  3G7J A;  4EL1 A;  1JZR A;  4LL1 B;  2R5G A;  3PH9 A;  1K3O A;  5D9V A;  4L5O A;  2A2P A;  4ZIL A;  3LEF A;  1SJ6 A;  4GLT A;  4MMM A;  2OE1 A;  4EO3 A;  1MD4 A;  1QGV A;  1O85 A;  5C04 A;  1BJX A;  1H4O A;  2FD3 A;  3ERF A;  2H30 A;  2REM A;  3C71 A;  1ZYP A;  5EL8 A;  3MWH A;  2H0H A;  2XBQ A;  2QSI A;  3VWX A;  1VGL A;  4KDX A;  2AHE A;  2R2J A;  3IR4 A;  3UBK A;  2CZ2 A;  1R5A A;  1FVJ A;  2QA1 A;  3QAV A;  1S3C A;  3K8N A;  1SYX A;  4BVY B;  3IXR A;  3M8N A;  4ZB8 A;  4AGS A;  5J3R A;  2GGT A;  3I43 A;  2LV3 A;  5B8A A;  4MLY A;  3HD5 A;  1MD3 A;  1Z9H A;  3TUE A;  1XWB A;  1TXX A;  2XPE A;  3I6A A;  1ERU A;  2EIQ A;  2YZU A;  4KX4 A;  2IFQ B;  2GQL A;  3MSZ A;  1MEK A;  3QOU A;  4I2T A;  3IRA A;  4G0L A;  4NMU A;  4BA7 A;  3CSJ A;  1FB6 A;  3P90 A;  2XC2 A;  4KSO A;  4ECJ A;  4V2L A;  4HJM A;  2OAD A;  4K8M A;  2B7J A;  3APS A;  5CRH A;  1AW9 A;  3C1R A;  1J08 A;  1AUC A;  2LQQ A;  3EE2 A;  4IBP A;  1B9Y C;  3FZA A;  4HEA 2;  4EIQ A;  2GLR A;  5DJL A;  4MDC A;  1OC9 A;  4KW6 A;  2YV9 A;  1Z7P A;  3KMO A;  1V9W A;  1ON4 A;  2IMK A;  2PMT A;  2H76 A;  1N2A A;  1TU7 A;  2C3T A;  4PNG A;  1TU8 A;  2YAN A;  2KHP A;  1JZO A;  2X99 A;  3EVI A;  5D8I A;  1PKW A;  2KUC A;  1GH2 A;  3TRX A;  2CX3 A;  3FZ4 A;  3EWL A;  1JLV A;  4K7O A;  4RI7 A;  3KMN A;  4N30 A;  4PTS A;  4JR4 A;  1YKA A;  1T3B A;  3GKN A;  4XRD A;  5ECO B;  5CRD A;  1U3A A;  1XZO A;  4TR4 A;  3EC3 A;  2A2S A;  5INY A;  1GLQ A;  2MYG A;  2OBK A;  1O7U A;  5J4U A;  3VFI A;  1J0F A;  4HDE A;  3F6F A;  1M9A A;  2VD1 A;  3BOA A;  3DGQ A;  1SKS B;  5A4U A;  2F8F A;  2LNT A;  4N0V A;  3M1G A;  1EV9 A;  4ECC A;  2PVO C;  5D96 A;  1M2B A;  5G1L A;  5CRG A;  2G0F A;  2A4H A;  5HR2 A;  4BVY A;  3TKQ A;  1Z3E A;  4N11 A;  1TK8 B;  3H1N A;  4MF5 A;  2HRN A;  5HR3 A;  1BX9 A;  1SD8 A;  1X5D A;  1HD2 A;  2TRC P;  3Q19 A;  2KLX A;  2HNL A;  3HA9 A;  2GSS A;  3HVS A;  2IFQ A;  4BL7 B;  5B8B A;  4EE0 A;  1PN9 A;  4DSR A;  3IC4 A;  1RK4 A;  2H6Y A;  1YDK A;  5J41 A;  3VPT A;  1Z7R A;  5C00 A;  4F9Z A;  2P5R A;  1PX7 A;  3CTG A;  2WFC A;  4JE1 A;  5EY6 A;  1J9B A;  3FW2 A;  3MNG A;  3LOR A;  4PX1 A;  1A0F A;  1ACV A;  3FR3 A;  2JAD A;  4O92 A;  3ZIT A;  4KE3 A;  4PNF A;  2DIZ A;  4ZBD A;  2C8U A;  5GAP D;  4V1A g;  3IHG A;  1H75 A;  4ZBB A;  3NIV A;  3L78 A;  4Z2R A;  6GSS A;  1IYI A;  4KH7 A;  5ENU A;  2K6V A;  1LJR A;  1EV4 A;  5IMA A;  2R0C A;  1WP0 A;  4NV5 A;  4ILF A;  3UVH A;  2M80 A;  5DQY A;  1NW2 A;  3U6V A;  2FWE A;  3TKS E;  1K3L A;  3DML A;  4TOP A;  5ECP B;  3UOM A;  3VWU A;  4IGJ A;  3DVX A;  3DEX A;  2VOC A;  2VM1 A;  1GSE A;  2BJX A;  4ULX A;  8GSS A;  1GUL A;  5DAL B;  2DJ0 A;  4DSS A;  11GS A;  2FA8 A;  2WZ9 A;  3O76 A;  3GTU B;  2TRX A;  3N5O A;  4GSS A;  5HFK A;  1NHY A;  3KM6 A;  2GQK A;  5J5N A;  3LG6 A;  1B9X C;  2MZC A;  5HFG A;  2L5L A;  5ID2 B;  5ECM B;  1XOA A;  2H70 A;  1X9S B;  1I5G A;  2R0G A;  3TJK A;  2IMI A;  5CAX A;  5AIS A;  2XBI A;  3WT1 A;  2DLX A;  1GSS A;  3KTL A;  2OBI A;  4Q5R A;  4MJC A;  2FGX A;  3DRN A;  1SL0 B;  2DJ3 A;  1WOU A;  3QFA C;  2H0G A;  1O73 A;  2FWG A;  4IP6 A;  2HSY A;  5IMZ A;  3A2W A;  2WCI A;  1A8Y A;  4BL7 A;  2G2Q A;  1GSU A;  7GSS A;  4PQI A;  3LGC A;  5A4V A;  3R2Q A;  5G31 A;  4I97 A;  2VM2 A;  3VUR A;  2PGT A;  1WMJ A;  3A2X A;  4K0G A;  2X8G A;  3ED3 A;  4OFN A;  2PPT A;  1V40 A;  3CYN A;  3GKM A;  1HYU A;  3LW9 A;  1M7T A;  2YV7 A;  3CRT A;  3P7X A;  5B6M A;  2ES7 A;  1SKR B;  1ZYN A;  1UA5 A;  2HI7 A;  2LST A;  1SJI A;  20GS A;  3LXZ A;  2FUG 2;  1YEP A;  3LXT A;  5A4W A;  3FY7 A;  2IMF A;  1OKD A;  1AIU A;  4LLR A;  5ECQ B;  3IOS A;  3RHC A;  1NHO A;  1LBK A;  1URM A;  3WT2 A;  2GSR A;  2WB9 A;  5F0G A;  1B8X A;  3UJ1 A;  2RII A;  5DQS A;  2H71 A;  3D5J A;  1GLP A;  2H1B A;  2FCH A;  1GNE A;  4L0U A;  3CTF A;  1PA3 A;  2FY6 A;  4MJB A;  3MDK A;  3GN3 A;  1YF1 A;  4K2D A;  4XS4 B;  5ECN B;  4NWY A;  4HQZ A;  5GZZ B;  3LSZ A;  5ECI B;  3CSH A;  2F9S A;  1O8X A;  1TRU A;  2IJY A;  4FYC A;  2B5Y A;  3F4T A;  2VLT A;  4XIH A;  5DAL A;  3M3M A;  4PQ1 A;  5KN2 A;  3KEB A;  3JCM L;  3FR9 A;  2FWF A;  3GTU A;  1GTU A;  1V58 A;  3HZ8 A;  3GH6 A;  1YY7 A;  5G5F A;  1M0U A;  2IME A;  2F51 A;  1GTA A;  5ID2 A;  4D73 B;  3D22 A;  1V57 A;  3FKF A;  2I3Y A;  6GSY A;  1OC3 A;  3D4T A;  1HQO A;  1OKT A;  5D9X A;  4K5R A;  2RUF A;  2V41 A;  3ZMK A;  4F0C A;  4FQU A;  1GSD A;  4FIW A;  2CAQ A;  4AF2 A;  4CY8 A;  3KTB A;  10GS A;  1SD9 A;  3UL3 A;  1MDI A;  3QCP A;  2DJJ A;  3KD0 A;  1SKW B;  1F6M C;  3BBY A;  4E8H A;  2C0E A;  5DCG A;  3UAP A;  3L9V A;  2X8H A;  3N9J A;  4WEY A;  4YH2 A;  1EGO A;  4K0N A;  3IA1 A;  2FHE A;  1M2A A;  1ZMA A;  1X5E A;  1JFU A;  4QL7 A;  5H5S A;  1PGT A;  1HNA A;  4MPG A;  2R37 A;  2LRT A;  2C3Q A;  2LNS A;  1GUK A;  4G19 A;  1GSQ A;  2LQO A;  2VLV A;  2CQ9 A;  5F07 A;  4MF7 A;  4G2E A;  1XW9 A;  2R0P A;  2RLI A;  3IV4 A;  17GS A;  2DIY A;  3IHQ A;  4OD7 A;  2MMO A;  4YAP A;  1ST9 A;  1X9W B;  2N5F A;  3LYK A;  1A23 A;  5A5K A;  1NM3 A;  2YN1 A;  1U3I A;  3APQ A;  1BAY A;  1PKZ A;  4HJ2 A;  4K7N A;  4XCS A;  3ZL5 A;  5IOW A;  5GAN D;  1V2A A;  3IK7 A;  1XWA A;  3G7Y A;  3FK8 A;  4XS4 A;  2L6C A;  1W4V A;  1GL8 A;  2LRC A;  2GDR A;  2CX4 A;  4Z7X A;  1YZX A;  4FO5 A;  4X4J A;  4RI6 A;  2CVB A;  2DKH A;  2H73 A;  2MBS A;  3U5R E;  2PN8 A;  4TKY A;  4Z2T A;  4NPB A;  4ISD A;  1JZD A;  5LCZ A;  2GS3 A;  3DWV A;  1M99 A;  2LRN A;  1FVK A;  2MMZ A;  3UBL A;  4D73 A;  1SYR A;  5CP1 A;  2VCW A;  4IVF A;  2C0F A;  4I2U A;  3ZRD A;  5JWQ B;  5COH A;  5AIV A;  1BYE A;  1BQ7 A;  2MMN A;  2K18 A;  2KOK A;  1YKC A;  2OKA A;  1O81 A;  4G10 A;  2EC4 A;  4NXI A;  1TKD B;  1Z6N A;  2O8V B;  4HU7 A;  1ZZY A;  3PGT A;  1E6B A;  3VWV A;  1F2E A;  4LL4 B;  5H5Q A;  1ZL9 A;  1QMV A;  3CMI A;  1TRS A;  1YJ6 A;  3O6T A;  4Q5Q A;  1QFN A;  5G30 A;  3GIX A;  1DE1 A;  2C3N A;  2YNX A;  1FB0 A;  2K8S A;  4G0K A;  4ACS A;  1OC8 A;  3KZQ A;  3EU3 A;  2WJU A;  3GRX A;  2PU9 C;  1SU9 A;  2X8C A;  2O85 A;  3TDG A;  1GNW A;  1MDJ A;  4KAE A;  1TI1 A;  4ZL7 A;  4ZXG A;  5BMU A;  3VK9 A;  2FWH A;  1T4Z A;  1U88 A;  5D73 A;  5JCW A;  1PX6 A;  3ZRE A;  4NAX A;  1PN0 A;  3EIN A;  4WR5 A;  2N5A A;  4YQV A;  6GSX A;  2DML A;  1TRV A;  4EXJ A;  1G7O A;  1JLW A;  4WET A;  1ML6 A;  4ICY A;  1A2L A;  3TRP A;  1F3A A;  3TB2 A;  4AJ8 A;  3MAK A;  3I69 A;  4TVE A;  3QMX A;  5BRT A;  3RDW A;  3I9V 2;  1ZOF A;  2YOI A;  4AJ6 A;  4DEJ A;  1JZW A;  2O89 A;  4TRX A;  3CRU A;  1DE2 A;  4OFT A;  2A2R A;  4GF0 A;  5G1K A;  2MMA A;  1WRY A;  4IEL A;  2CZ3 A;  3Q6O A;  4WKW A;  3RPN A;  5D9W A;  4MZB A;  3HCZ A;  3ZFB A;  3A5I A;  4LMV A;  1A24 A;  2JZS A;  1FOH A;  1PL2 A;  3H8Q A;  2Z9S A;  2XHF A;  19GS A;  2NPB A;  5F06 A;  1FO5 A;  5ECH B;  3HVV A;  3HZ4 A;  1HNB A;  1YQ1 A;  3TRQ A;  1KBN A;  1B4P A;  4GCI A;  4J57 E;  2BMX A;  4MJE A;  2DSA A;  2V6O A;  1VF3 A;  3M0F A;  2H19 A;  3PR8 A;  3IC8 A;  2H75 A;  4GSN A;  1EZK A;  1EP8 A;  1ABA A;  4TR1 B;  3J7Y b;  13GS A;  3GX0 A;  1QK8 A;  4L8E A;  4ECB A;  4PUR A;  3LQ7 A;  5ECR B;  2O7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...