4TXOA

Crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
177
structure length
177
Chain Sequence
PTGDPACRAAVATAQKIAPLAHGEVAALTMASAPLKLPDLAFEDADGKPKKLSDFRGKTLLVNLWATWCVPSRKEMPALDELQGKLSGPNFEVVAINIDTRDPEKPKTFLKEANLTRLGYFNDQKAKVFQDLKAIGRALGMPTSVLVDPQGCEIATIAGPAEWASEDALKLIRAATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein TlpA
publication title How Periplasmic Thioredoxin TlpA Reduces Bacterial Copper Chaperone ScoI and Cytochrome Oxidase Subunit II (CoxB) Prior to Metallation.
pubmed doi rcsb
source organism Bradyrhizobium diazoefficiens usda 110
molecule tags Oxidodreductase/copper binding protein
total genus 47
structure length 177
sequence length 177
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4txoA00
3RPNA 1EWXA 5DBQA 5ID2B 1FOVA 3GTUB 1RK4A 2K9FA 5CP1A 8GSSA 2H70A 5G1LA 4IBPA 4QL7A 4DSRA 2WFCA 3H8QA 3KJYA 1MDKA 4MH2A 2OE0A 2C8UA 10GSA 4MZWA 3F4SA 3OR5A 4O7HA 5KN3A 5DALB 1MTCA 3I9V2 3F6FA 1F3AA 1Q4JA 4OCEA 1A8YA 3TRQA 1PX7A 1T4ZA 2L6DA 3TKPA 6GSVA 1F3BA 3I43A 2EIOA 1K0CA 4TRXA 4KH7A 3E3EA 5G31A 5GZZB 4KW6A 5D8IA 3RAZA 2VM1A 3Q74A 3FEUA 2O85A 4EL1A 5F0GA 2FWGA 4KAEA 4MF6A 6GSSA 2DIZA 1ZL9A 1R4WA 2GQMA 4WXTA 4ML1A 5DJLA 2RIIA 3TJGA 3ISOA 2CT6A 1EP7A 4NV2A 2LQQA 2DJ2A 5CYYA 1X9MB 3EVIA 2HI7A 2VLVA 1FVKA 3MSZA 3UJ1A 3QPMA 5FT3A 3J7Yk 1N2AA 2YNXA 1YY7A 3HA9A 3BD2A 3ZL5A 2R4VA 5ELAA 3IC4A 4ZIJA 3MAKA 1JFUA 1PL2A 2WRTA 4ZBDA 2WGRA 2JSZA 5DCGA 4YAVA 3QFAC 4EE0A 5DJMA 1UN2A 5ID2A 3J7Yb 3GTUA 2FD3A 2H71A 4ULXA 4XS6A 1Z3EA 2MMAA 4TKYA 1XW9A 3GMFA 2LJAA 1PQNA 4OO5A 5F8BA 3TOUA 2L59A 1QMVA 3E0UA 4HQZA 4HJ2A 4NWYA 1EGOA 4MCUA 4XCSA 2GSRA 1XVWA 2DLXA 2HFDA 5DALA 1THOA 2LNTA 1TI3A 3QOUA 1A0FA 14GSA 1Z6NA 1PKZA 3FR9A 4HU7A 3R2QA 3TOTA 3QR6A 3GKKA 1YEXA 2GTUA 2HRFA 4TXOB 6GSXA 1XPVA 4TR1B 4F82A 1BX9A 2GSQA 3KEBA 4ZL8A 4WETA 2H6YA 1M2DA 4MDCA 4OFNA 2R3XA 3CBUA 1MD4A 4IGJA 5CREA 3LJRA 5DAKB 4HQSA 5JCGA 4J56E 3M3MA 13GSA 4GQCA 2A2RA 1HNCA 2EIRA 4XS4A 3ZVJD 3DWVA 5ECNB 4AJ8A 6GSYA 1V9WA 4KCAA 2X8GA 5CNWA 4FYBA 2IJYA 4PXOA 2HNLA 3UVTA 1J9BA 4POLA 1OKDA 2MYGA 3IRAA 5KN0A 1ZYQB 1XWGA 3C7MA 4GSSA 3MWHA 4TVEA 1YEPA 1RQMA 2VAFA 1F37A 3ZVJA 3GYKA 3LWAA 4PQHA 2C4JA 4PNFA 4AJ7A 3TJFA 1VGLA 2CV4A 4XS1A 3G7IA 2M46A 1TXXA 5D9VA 4RI7A 2R2JA 1AQWA 3IAM2 2JZRA 3SWLA 3LYPA 4TN8A 2O7KA 3LSZA 4CW9A 1DBYA 1W4VA 3FZ9A 4GXZA 3EURA 5ECLB 3IA1A 4EDYA 5CRHA 1YKCA 1B4PA 1O6JA 1JZDA 3IR4A 3N5OA 4WF4A 5F05A 2N5AA 1SKRB 3ERFA 3ZFLA 5KN2A 2H72A 1OC3A 2CVBA 1FG4A 11GSA 3HJOA 4KGIA 2H0IA 3VWUA 1WP0A 1T8EB 1TRVA 2YV9A 2DJKA 5ECIB 2FA4A 2LRCA 3VI7A 2L4QA 2HE3A 3HZ8A 4DSSA 2GQKA 1TU8A 3TCOA 1OC8A 2E2GA 2HT9A 5FHIA 2A2SA 4TXOA 1MDJA 5B6MA 4K0NA 1SU9A 3F6DA 3UL3A 1SK0A 1SL0B 4X1UA 3KMNA 2H1DA 3GHAA 2B7JA 4K2DA 1SD8A 5DAKA 5KEJA 4HI7A 3FKFA 2PMTA 4ZBAA 2E2MA 1UVZA 4WR5A 4MJAA 5ECMB 3G7JA 5ENUA 3WD6A 2YP6A 3IBHA 2REMA 3KMOA 4KSOA 1K0MA 2VCWA 4L0WA 1TI1A 1O7UA 4Q5RA 4ZL7A 4GWRA 6GSTA 4MLYA 4ILFA 3L4NA 2B5EA 4RUVA 3RBTA 1VF4A 2Z9SA 5HFIA 4L8EA 3ZREA 1V98A 3QDNA 2ALBA 4I97A 5GSTA 1I5GA 2IPAA 1S3DA 3LGCA 5EPFA 5CAXA 2B5XA 3GSSA 3LEFA 3GX8A 3DRNA 3UEMA 2D2ZA 1F6MC 3HVVA 3M9JA 3KM6A 2GGTA 2HSYA 1XFLA 2GVPA 2OE1A 4FIWA 1BJXA 3UBLA 1GTAA 5D9TA 2OACA 3HY2A 1BEDA 1O81A 4TW5A 6GSUA 3KTBA 4V1Ap 5IPHA 3CSIA 2GT5A 3RDWA 5IOXA 3LORA 5HFKA 2AB6A 4XRDA 1G7EA 5JWRB 3QAWA 5DCHA 5IMZA 2H75A 4L0UA 5C00A 3MDKA 5A4UA 3TJBA 2LKUA 1TW9A 2FUG2 3IXRA 1M9BA 2FCHA 4OD7A 3O3TA 4ECIA 3ZFBA 3KGKA 2ZUPA 2RLIA 2OADA 3CRUA 3ED3A 2HLSA 1WJKA 1K0AA 5JWOB 5H5SA 5HR1A 3DMLA 1H4OA 3HD5A 2AJQB 1PSQA 2LTKA 4MJEA 2XHFA 2IMFA 3EU4A 1HD2A 1A23A 4KA0A 4KB3A 4Z7XA 3QCPA 3TKRA 5IMDA 4NPBA 3L78A 3C71A 1ZYEA 2VL2C 3GV1A 3HZ4A 4ECJA 5C04A 4BWQA 4PUFC 1GSEA 2R6KA 3IHQA 2CVKA 3FK8A 4GTUA 4DVCA 18GSA 1EV9A 4RQXA 1FB6A 1OC9B 5ECPB 1YJ6A 3VLNA 3GA4A 5ECSA 2B3SA 3W6GA 2R5GA 3M9KA 3H1NA 3VWWA 1XWBA 4D73A 2HZEB 4TXVA 5ECQB 3KH9A 2VD0A 5INYA 2OA7A 1J08A 4JR6A 2OJLA 4IJIA 3C1SA 3EC3A 1M7TA 1U87A 4BVYA 2B1KA 4JBBA 3JCML 2FY6A 3TDGA 4RI6A 1FW1A 1GLPA 1GTIA 2F8FA 2DJ3A 2I4AA 3D5JA 1CQGA 3H93A 1M0UA 2DJJA 2PGTA 1SYXA 2NTOA 2O8VB 4HJMA 3RHCA 1K0OA 4I5QA 1VF2A 17GSA 3H79A 4MJCA 4MMMA 3GFKA 1QFNA 3GKNA 3ZMKA 4XIHA 1Y6EA 2J9HA 1PX6A 4K6XA 4EC0A 3IAS2 2FWHA 1TK8B 3ZITA 3EE2A 4CDOA 1A8LA 3Q18A 3WGDA 2ON5A 4XTSA 4ECBA 2H30A 5LCZA 1SENA 4QQ7A 4I2TA 3FR6A 1XWAA 2LSTA 2AYTA 4WF5A 4E8HA 2DSAA 2JZSA 2H73A 1BQ7A 2BJXA 1ERTA 3MNGA 3VFIA 3C1RA 1PMTA 3FZ5A 19GSA 2V2GA 2YWNA 2DJ0A 3CYNA 4IVFA 1OE8A 22GSA 4YQVA 2HXKA 20GSA 1Z7RA 4ECCA 1TK0B 5EVOA 2VO4A 2IMKA 2P0GA 4EO3A 1GUHA 2F8AA 1DSBA 4AJ6A 3M0FA 3RHBA 4WBRD 3F8UA 1WRYA 3U6VA 4QL9A 2FNOA 3HVXA 4MH3A 3KD0A 1T1VA 5HQPA 1EEMA 3L0HA 1JZWA 3DEXA 1AUCA 2N5BA 4PQIA 4EUYA 4K9ZA 3D6IA 3C8EA 2GZPA 1NW2A 1ZMAA 1ERWA 4KCEA 2O87A 3HKRA 2RM5A 1IYIA 1B8XA 2ZCTA 5CRDA 2XPDA 3GH9A 4KNDA 1SYRA 4O5RA 2C3NA 1EOGA 1HQOA 2VCZA 1PRXA 4DEJA 2QSIA 1T00A 3DGQA 2L6CA 2NBSA 3EMXA 1QGVA 4LL4B 4IN0A 1TRSA 2LV3A 5ELGA 2MBSA 1F9MA 4NHZA 1HNAA 3I69A 2G0FA 5HFGA 4BWSA 2H1BA 3FW2A 4K1FA 1NM3A 1DE1A 1GSFA 4I6XA 2P5RA 2VLTA 3GKXA 4WEYA 5B7CA 3L9UA 3GH6A 1GTBA 2IFQB 2VOCA 2VCXA 4ZB9A 2FHEA 3IV4A 5CRGA 4EDZA 3G9BA 4LL1B 2C3QA 3WT1A 1EEJA 1HNBA 4GLTA 3KP9A 3U5RE 1R5PA 5DVBA 1THXA 4PNGA 1TP9A 2ES7A 1U88A 1PL1A 4GCIA 9GSSA 3FR3A 2WZ9A 4POMA 1M9AA 1X5DA 1SKSB 1ABAA 4CHSA 1I9DA 1PGTA 5E4WA 4V1Ag 5B8AA 4EKZA 2YJ7A 4JEDA 1S3AA 3FYGA 2GT6A 5ECRB 2PVOC 5GAND 4F2IA 5KN1A 1O85A 2I3YA 1B9YC 4FYCA 1QUWA 5AGYA 5H5QA 1CQHA 3HDCA 1T7PB 2YCDA 4HS1A 1OAZA 1GUKA 1NSWA 3A5WA 1XW6A 1VRSD 5IMAA 2OKAA 1M2BA 5CRWA 1YQ1A 1PKWA 2V32A 1SJZA 3GURA 2J23A 2I81A 2V1MA 2JU5A 1JHBA 1XCCA 5ECOB 4ID0A 1IYHA 3IK7A 3EU3A 2C0FA 3PH9A 1R5AA 4LMVA 4TR1A 4Q5FA 3F9UA 1SK2A 1EP8A 2A4VA 1G6YA 2IMDA 2X8CA 1GSUA 3VPTA 4HEA2 3QD9A 1Z6MA 1WPIA 2YV7A 3HHVA 5IMCA 1GSSA 4HZ4A 4GSTA 3ZYWA 3ERGA 2PBJA 4WKWA 4IKHA 2L4CA 4BA7A 2IFQA 4E8EA 1FVJA 1OKTA 1ZGNA 3HVSA 3TJJA 3BCIA 1XVQA 4YQMA 2LNSA 1NHOA 4G9HA 1Z9HA 2F9SA 1B4QA 1G6WA 3QAGA 4K7IA 2MMZA 3A3TA 3IPZA 3NOFA 2V6KA 3APQA 1TRUA 3DYRA 1JZOA 1WIKA 2VCVA 2VIMA 2QGVA 4MABA 2CVDA 2B6MA 2M72A 3GKMA 3GL3A 3FHKA 2DC5A 4ZXGA 2PERA 1X0RA 4ZL9A 5LNKe 3P90A 4P3YB 3DVXA 1TDIA 2VCTA 3D4TA 1K3OA 2XC2A 2H66A 2X8HA 1YF0A 2H6XA 4I8BA 4EF0A 2LJRA 4PURA 4GQFA 1FHEA 4IQ1A 3K8NA 5AISA 5EL8A 2VD1A 5IMFA 1X5CA 4MJBA 1BAYA 1ERUA 5COHA 2V41A 1EZKA 4PX1A 1GP1A 3CXGA 2FWFA 1AIUA 4JRRA 4IP1A 4G2EA 2VL2A 2WB9A 4N0ZA 2CZ3A 2B5YA 2M80A 5G2ZA 3UAPA 3VURA 2K8SA 1FAAA 3BOAA 3LXZA 4JE1A 4KSMA 2DMMA 4G19A 3TKSC 1GLQA 3A2WA 1WOUA 4NV5A 4K7OA 1ZCPA 2FA8A 4IW9A 2EIQA 3IDVA 2MBTA 4F03A 5D9WA 1AC1A 5B6NA 4IJ3A 1NHYA 1XBSA 2LRNA 4MP4A 3CRTA 5JWQB 4FYUA 1ML6A 5AIXA 2LJKA 5ECKB 1E2YA 4H86A 3TKQA 4ZBBA 2YZUA 2YWMA 3W8JA 4IS0A 3QFBC 2KHPA 3M8NA 4IP6A 1KNGA 4HOJA 3BJ5A 2IL3A 3GUSA 1XOAA 3Q6OA 2TIRA 3SBCA 4F0CA 3FY7A 4IHUA 1GNWA 3L9VA 1N8JA 2ON7A 2PU9C 3AY8A 2JACA 3DIEA 3O76A 1K0BA 5L71A 2DIYA 4IELA 1E6BA 3FRCA 3HYPA 5B8BA 2X64A 3N9JA 3WGXA 1QQ2A 2YOIA 4NHWA 4TR4A 3KZQA 2CX4A 1PD21 1GUMA 2LEGA 2PPTA 1SKWB 2K8VA 1TJDA 2K6VA 4AF2A 2L5OA 1ACVA 4GSNA 4YH2A 1AXDA 3UMAA 2KOKA 1KEBA 2BMXA 1TTZA 5HR0A 2RM6A 1BYEA 5ECHB 1YKAA 5AIVA 1XWKA 4POBA 2OE3A 2VL3A 2L57A 4G10A 1USBA 2YWIA 4HZ2A 4O92A 2MZCA 2AV4A 3DKSA 2YJHA 2MMNA 4MPGA 1JZRA 4ZB8A 1A2MA 5D9XA 2CAIA 1YDKA 3DXBA 3TGZA 5FWGA 4V2MA 1X9WB 1DUGA 2H1AA 2IMEA 2XBQA 1TKDB 3VWVA 1ERVA 1EOHA 12GSA 1GTUA 2IWTA 5G5FA 4MZCA 2GSTA 5IQYA 4LMWA 2F3MA 2EC4A 2VL9A 3M1GA 2H19A 2QKEA 5IO0A 2IN3A 3FZAA 2H8LA 3DD3A 1LU4A 5A5KA 4MZBA 5IOWA 2FGXA 2C0EA 3P2AA 1RW1A 1LBKA 1HYUA 3FZ4A 2LRTA 4MF5A 2DMLA 2JL4A 4N30A 1OC9A 2JSYA 3BCKA 1SL2B 2NDOA 2V6OA 1TOFA 4XS4B 1XOBA 2KP1A 3G7YA 1MD3A 5A4WA 2O89A 2TRXA 2X99A 3EYTA 1UA5A 2HZEA 5IO2A 2C80A 2TRCP 2B7KA 3L9SA 5D96A 4X43A 5EY6A 2E0QA 5F06A 4ACSA 1V58A 3WYWA 1EGRA 3NZNA 2XBIA 1R7HA 2WS2A 2VLUA 3UIWA 2VUPA 1GL8A 1A24A 2YPMA 3F4RA 2YN1A 2C0GA 4L5LA 2HZFA 2VCQA 4EXJA 3PR8A 2H01A 3EMPA 4F9ZA 3GN3A 1GULA 4KDUA 1O8XA 5IIZA 3KXOA 1V40A 1ST9A 1SK1A 2WCIA 2FLSA 1T3BA 3PGTA 3LFLA 5GAPD 2LQOA 2IIYA 1R26A 4AGSA 1MDIA 3UVHA 1Z5YE 4V2NA 3IOSA 4JZQA 3HJPA 1XIYA 2QC7A 2GSSA 3V1WA 1TK5B 1DE2A 5IMVA 4DSSB 3KCMA 4FH8A 4HUAA 4KE3A 4TOPA 2KUCA 1J0FA 3TRXA 4GRFA 3VPQA 4EVMA 3TB2A 1AQVA 3GIXA 2GDRA 1V57A 3GL5A 2I1UA 3KH7A 3LYKA 1A2JA 5A4VA 2GS3A 5IM9A 2KP2A 4N10A 4Q5QA 7GSSA 2H76A 1JLVA 1F2EA 1M99A 4POKA 4PUAA 4WR4A 1GSDA 3I6AA 1QXHA 4ZB6A 3APOA 4XRAA 4GF0A 1SL1B 2GZYA 3ME7A 1T4YA 1SD9A 2LS5A 2NVLA 5DQYA 4F0BA 1ON4A 2I9HA 4X0XA 5J9BA 3ZRDA 4Q5NA 1VF3A 3APSA 3VI5A 3QAVA 4J2FA 3A2XA 1ZZYA 2LUSA 3GNJA 2CA8A 1URMA 2PN8A 2L5LA 3F0IA 3PINA 1PN9A 2H0GA 3RPPA 5AN1A 3ZMLA 1U6TA 4JR4A 5J4UA 4NXIA 1X5EA 2DJ1A 2CX3A 3VWXA 2YWOA 1G0TA 2F51A 2ZNMA 4MK3A 1ZOFA 1W89A 1FO5A 1JLWA 4KUNA 3E9JB 2OBIA 1GRXA 2MMOA 2H1GA 3F3QA 3A2VA 4OMVA 2H6ZA 1VF1A 4ISDA 1XW5A 1GSYA 5JCUA 6GSWA 5IPGA 3US3A 3TRPA 4NMUA 1AW9A 1KBNA 4KDXA 2KLXA 4O32A 4BVXA 3BBYA 1TRWA 1WWJA 2RUFA 2VM2A 4K0GA 1V2AA 4HDEA 4LLRA 3EWLA 2YZHA 4DSQA 4PQ1A 3QMXA 3LG6A 1AQXA 3LXTA 1XZOA 4I2UA 4K8MA 2PWJA 1G7OA 3D0ZA 4HU9A 4BPYA 2NPBA 3WGEA 5F07A 1U3IA 5HR2A 2B1LA 3UARA 2AUVA 2GLRA 4OO4A 1A2LA 4J57E 3GSTA 3KP8A 2BTOT 2CQ9A 3TJKA 4NAXA 1MEKA 2CAQA 3EINA 2PUKC 4ML6A 5J9CA 3ME8A 3UBKA 4K7NA 1WE0A 3LQ7A 5DQSA 3DVWA 4N11A 1YF1A 1Y25A 4FO5A 4TR0A 4YAPA 5DDLA 4OFTA 3ERWA 3TKSA 5D73A 3P8WA 3C73A 5G30A 3D22A 3HCZA 3F4TA 2H74A 3CSJA 4YQUA 3UOMA 3NIVA 2E7PA 1Z7PA 3GRXA 1AAZA 1B9XC 4IQAA 1GWCA 3W8SA 1XXUA 2G2QA 3WT2A 2YANA 1SJIA 1OVNA 3IK9A 1S3CA 1O73A 1OYJA 2DBCA 5CO3A 4KX4A 1BG5A 3P7XA 4D73B 3D21A 5G1KA 1O8WA 2JZTA 5JCWA 4MPFA 1ILOA 1WMJA 2GQLA 4OFMA 4BL7A 3D4MA 1QK8A 3Q19A 1XWCA 1LJRA 2GZZA 2WJUA 2XPEA 2HYXA 5H5RA 5J41A 1X9SB 4LA1A 1A0RP 2N5FA 1H75A 4MA9A 5GSSA 2IMIA 4TR3A 2RUEA 3ZZXA 2R37A 3CSHA 1K0NA 1TU7A 4KDYA 1KTEA 2CZ2A 4XHMA 4ZILA 5HR3A 3IE3A 2JADA 2P31A 1GSQA 2AHEA 2WULA 3F3RA 1UC7A 1C72A 2HRNA 1FB0A 4PGTA 2C3TA 2C1YA 4MF7A 3H4KA 1U3AA 1Q98A 4L5OA 1EV4A 3GX0A 5LD0A 4OCFA 4OWYA 5D93A 5J5NA 3CMIA 3KIJA 2WDUA 3ZLPA 2FWEA 4N0VA 1K3YA 3CTFA 2P5QA 3VK9A 2C0DA 1B48A 2H0HA 3CTGA 1YZXA 3S9FA 3KTLA 2PVQA 2HSHA 5J3RA 1M2AA 3ZIVA 2K18A 5G5EA 4RQRA 3TUEA 5E59A 1PA3A 4JU5A 1GNEA 1OE7A 2AAWA 1SJ6A 3HXSA 3HJMA 1GH2A 5ABRA 1K3LA 3O6TA 3TKSE 16GSA 4V2LA 2OBKA 1K0DA 3F63A 3ZTLA 4WBJA 3ZIJA
chains in the Genus database with same CATH superfamily
3RPNA 1EWXA 5DBQA 5ID2B 1FOVA 4FQUA 3GTUB 1RK4A 2K9FA 5CP1A 4K5RA 8GSSA 2H70A 5G1LA 4IBPA 4QL7A 4DSRA 2WFCA 3H8QA 3KJYA 1MDKA 4MH2A 2OE0A 2C8UA 10GSA 1XG8A 4MZWA 3F4SA 3OR5A 4O7HA 5KN3A 5DALB 1MTCA 3I9V2 3F6FA 1F3AA 1Q4JA 4OCEA 1A8YA 3TRQA 1PX7A 1T4ZA 2L6DA 3TKPA 6GSVA 1F3BA 3I43A 2EIOA 1K0CA 4TRXA 4KH7A 3E3EA 5G31A 5GZZB 4KW6A 5D8IA 3RAZA 2VM1A 3Q74A 3FEUA 2O85A 4EL1A 5F0GA 2FWGA 4KAEA 4MF6A 6GSSA 2DIZA 1ZL9A 1R4WA 2GQMA 4WXTA 4ML1A 5DJLA 2RIIA 3TJGA 3ISOA 2CT6A 1EP7A 4NV2A 2LQQA 2DJ2A 5CYYA 1X9MB 3EVIA 2HI7A 2VLVA 4PTSA 1FVKA 3MSZA 3UJ1A 3QPMA 5FT3A 3J7Yk 1N2AA 2YNXA 1YY7A 3HA9A 3BD2A 3ZL5A 2R4VA 5ELAA 3IC4A 4ZIJA 3MAKA 1JFUA 1PL2A 2WRTA 4ZBDA 2WGRA 2JSZA 5DCGA 4YAVA 3QFAC 4EE0A 5DJMA 1UN2A 5ID2A 3J7Yb 3GTUA 2FD3A 2H71A 4ULXA 4XS6A 1Z3EA 2MMAA 4TKYA 4G0IA 1XW9A 3GMFA 2LJAA 1PQNA 4OO5A 5F8BA 3TOUA 5KOWA 2L59A 1QMVA 3E0UA 4HQZA 4HJ2A 4NWYA 1EGOA 4MCUA 4XCSA 2GSRA 1XVWA 2DLXA 2HFDA 5DALA 1THOA 2LNTA 1TI3A 3QOUA 1A0FA 14GSA 1Z6NA 3FMWA 1PKZA 3FR9A 4HU7A 3R2QA 3EPTA 3TOTA 3QR6A 3GKKA 1YEXA 4X4JA 2GTUA 2HRFA 4TXOB 6GSXA 1XPVA 4TR1B 4F82A 1BX9A 2GSQA 3KEBA 4ZL8A 2UZ8A 4WETA 2H6YA 1M2DA 4MDCA 2X49A 4OFNA 2R3XA 3CBUA 1MD4A 4IGJA 5CREA 3LJRA 5DAKB 4HQSA 5JCGA 4J56E 3M3MA 13GSA 4GQCA 2A2RA 1HNCA 2EIRA 4XS4A 3ZVJD 3DWVA 5ECNB 4AJ8A 6GSYA 1V9WA 4KCAA 2X8GA 5CNWA 4FYBA 2IJYA 4PXOA 2HNLA 3UVTA 1J9BA 4POLA 1OKDA 2MYGA 3IRAA 5KN0A 1ZYQB 1XWGA 3C7MA 4GSSA 3MWHA 4TVEA 1YEPA 1RQMA 2VAFA 1F37A 3ZVJA 3GYKA 3LWAA 4PQHA 2C4JA 4PNFA 4AJ7A 3TJFA 1VGLA 2CV4A 3MIXA 4XS1A 3G7IA 2HSMA 2M46A 1TXXA 5D9VA 4RI7A 2R2JA 1AQWA 3IAM2 2JZRA 3SWLA 3LYPA 4TN8A 2O7KA 3LSZA 4CW9A 1DBYA 1W4VA 3FZ9A 4GXZA 3EURA 5ECLB 3IA1A 4EDYA 5CRHA 1YKCA 1B4PA 1O6JA 1JZDA 3IR4A 3N5OA 4WF4A 5F05A 2N5AA 1SKRB 3ERFA 3ZFLA 5KN2A 2H72A 1OC3A 2CVBA 1FG4A 11GSA 3HJOA 4KGIA 2H0IA 3VWUA 1WP0A 1T8EB 1TRVA 2YV9A 2DJKA 5ECIB 2FA4A 2LRCA 3VI7A 2L4QA 2HE3A 3HZ8A 4DSSA 2GQKA 1TU8A 3TCOA 1OC8A 2E2GA 2HT9A 5FHIA 2A2SA 4TXOA 4YKFA 1MDJA 5B6MA 4K0NA 1SU9A 3F6DA 3UL3A 1SK0A 1SL0B 4X1UA 3KMNA 2H1DA 3GHAA 2B7JA 4K2DA 1SD8A 5DAKA 5KEJA 4HI7A 3FKFA 2PMTA 4ZBAA 2E2MA 1UVZA 4WR5A 4MJAA 5ECMB 3G7JA 5ENUA 3WD6A 2YP6A 3IBHA 2REMA 3KMOA 4KSOA 1K0MA 2VCWA 4L0WA 1TI1A 1O7UA 4Q5RA 4ZL7A 2HRKA 4GWRA 6GSTA 4MLYA 4ILFA 3L4NA 2B5EA 4RUVA 3RBTA 1VF4A 2Z9SA 5HFIA 4L8EA 3ZREA 1V98A 3QDNA 2ALBA 4I97A 5GSTA 1I5GA 2IPAA 1S3DA 3LGCA 5EPFA 5CAXA 2B5XA 3GSSA 3LEFA 3GX8A 3DRNA 3UEMA 2D2ZA 1F6MC 3HVVA 3M9JA 3KM6A 2GGTA 2HSYA 2HRAA 1XFLA 2GVPA 2OE1A 4FIWA 1BJXA 3UBLA 1GTAA 5D9TA 2OACA 3HY2A 1BEDA 1O81A 4TW5A 6GSUA 3KTBA 4V1Ap 5IPHA 3CSIA 2GT5A 3RDWA 5IOXA 3LORA 5HFKA 2AB6A 4XRDA 1G7EA 5JWRB 3QAWA 5DCHA 5IMZA 2H75A 4L0UA 5C00A 3MDKA 5A4UA 3TJBA 2LKUA 1TW9A 2R0GA 2FUG2 3IXRA 1M9BA 2FCHA 4OD7A 3O3TA 4ECIA 3ZFBA 3KGKA 2ZUPA 2RLIA 2OADA 3CRUA 3ED3A 2HLSA 1WJKA 1K0AA 5JWOB 5H5SA 4EIPA 5HR1A 3DMLA 1H4OA 3HD5A 2AJQB 1PSQA 2LTKA 4MJEA 2XHFA 2IMFA 3EU4A 1HD2A 1A23A 4KA0A 4KB3A 4Z7XA 3QCPA 3TKRA 5IMDA 4NPBA 3L78A 3C71A 1ZYEA 2VL2C 3GV1A 5BMUA 3HZ4A 4ECJA 5C04A 4BWQA 4PUFC 1GSEA 2R6KA 3IHQA 2CVKA 3FK8A 4GTUA 4DVCA 18GSA 1EV9A 4RQXA 1FB6A 1OC9B 5ECPB 1YJ6A 3VLNA 3GA4A 5ECSA 2B3SA 3W6GA 2R5GA 3M9KA 3H1NA 3R3EA 3VWWA 1XWBA 4D73A 2DKIA 2HZEB 4TXVA 5ECQB 3KH9A 2VD0A 5INYA 2OA7A 1J08A 4JR6A 2OJLA 4IJIA 3C1SA 3EC3A 1M7TA 1U87A 4BVYA 2B1KA 4JBBA 3JCML 2FY6A 4Z2TA 4EIQA 3TDGA 4RI6A 1FW1A 1GLPA 1GTIA 2F8FA 2DJ3A 2I4AA 3D5JA 1CQGA 3H93A 1M0UA 2DJJA 2PGTA 1SYXA 2NTOA 4A5PA 2O8VB 4HJMA 3RHCA 1K0OA 4I5QA 1VF2A 17GSA 3H79A 4MJCA 4MMMA 3GFKA 1QFNA 3GKNA 3ZMKA 4XIHA 1Y6EA 2J9HA 1PX6A 4K6XA 4EC0A 3IAS2 2FWHA 1TK8B 3ZITA 3EE2A 4CDOA 1A8LA 3Q18A 3WGDA 2ON5A 4XTSA 4ECBA 2H30A 5LCZA 1SENA 4QQ7A 4USSA 4I2TA 3FR6A 1XWAA 2LSTA 1ZYPA 2AYTA 4WF5A 3HVNA 4E8HA 2DSAA 2JZSA 2H73A 1BQ7A 2A2PA 2BJXA 1ERTA 3MNGA 3VFIA 3C1RA 3FZ5A 1PMTA 19GSA 2V2GA 2YWNA 2DJ0A 3CYNA 4IVFA 1OE8A 22GSA 4YQVA 2HXKA 2QA2A 20GSA 1Z7RA 4ECCA 1TK0B 5EVOA 2VO4A 2IMKA 2P0GA 4EO3A 1GUHA 2F8AA 1DSBA 4AJ6A 3M0FA 3RHBA 4WBRD 1FOHA 3F8UA 1WRYA 3U6VA 4QL9A 2FNOA 3HVXA 4MH3A 3KD0A 1T1VA 4K5SA 5HQPA 1EEMA 3L0HA 1JZWA 3DEXA 1AUCA 2N5BA 4PQIA 4EUYA 5KOXA 4K9ZA 3D6IA 3C8EA 2GZPA 1NW2A 1ZMAA 1ERWA 4KCEA 2O87A 3HKRA 2RM5A 1IYIA 1B8XA 2ZCTA 5CRDA 2XPDA 3GH9A 4KNDA 1SYRA 4O5RA 2C3NA 1EOGA 1HQOA 2VCZA 1PRXA 4DEJA 2QSIA 1T00A 3DGQA 2L6CA 2NBSA 3EMXA 1QGVA 4LL4B 4IN0A 1TRSA 2LV3A 5ELGA 2MBSA 1F9MA 4NHZA 1HNAA 3I69A 2G0FA 5HFGA 4BVXB 4BWSA 2H1BA 3FW2A 4K1FA 1NM3A 1DE1A 1GSFA 4I6XA 2P5RA 2VLTA 3GKXA 4WEYA 5B7CA 3L9UA 3GH6A 1GTBA 2IFQB 2VOCA 2VCXA 4ZB9A 2FHEA 3IV4A 5CRGA 4EDZA 3G9BA 4YKGA 4LL1B 2C3QA 5BRTA 3WT1A 1EEJA 1HNBA 4GLTA 3KP9A 3U5RE 1R5PA 5DVBA 1THXA 4PNGA 1TP9A 2ES7A 1U88A 1PL1A 4GCIA 9GSSA 3FR3A 2WZ9A 4POMA 1M9AA 1X5DA 1SKSB 1ABAA 4CHSA 1I9DA 1PGTA 5E4WA 4V1Ag 5B8AA 4EKZA 2YJ7A 4JEDA 1S3AA 3FYGA 2GT6A 5ECRB 2PVOC 5GAND 4F2IA 5KN1A 1O85A 2I3YA 1B9YC 4FYCA 1M3IA 1QUWA 5AGYA 5H5QA 1CQHA 3HDCA 1T7PB 3LW9A 2YCDA 4HS1A 1OAZA 1GUKA 1NSWA 3A5WA 1XW6A 1VRSD 5IMAA 2OKAA 1M2BA 5CRWA 1YQ1A 1PKWA 2V32A 1SJZA 3GURA 2J23A 2I81A 2V1MA 2JU5A 4Z2RA 1JHBA 1XCCA 5ECOB 4ID0A 1IYHA 3IK7A 3EU3A 2C0FA 3PH9A 1R5AA 4LMVA 4TR1A 4Q5FA 3F9UA 1SK2A 1EP8A 2A4VA 1G6YA 2IMDA 2X8CA 1GSUA 3VPTA 4HEA2 3QD9A 1Z6MA 1WPIA 2YV7A 3HHVA 5IMCA 1GSSA 4HZ4A 4GSTA 3ZYWA 3ERGA 2PBJA 4WKWA 4O5UA 4IKHA 2L4CA 4BA7A 2IFQA 4E8EA 1FVJA 1OKTA 1ZGNA 3HVSA 3TJJA 3BCIA 1XVQA 4YQMA 2LNSA 1NHOA 4G9HA 1Z9HA 2F9SA 1B4QA 1G6WA 3QAGA 4K7IA 2MMZA 3A3TA 3IPZA 4G0LA 3NOFA 2V6KA 3APQA 1TRUA 3DYRA 1JZOA 1WIKA 2VCVA 2VIMA 2QGVA 4MABA 2CVDA 2B6MA 2M72A 3GKMA 3GL3A 3FHKA 2DC5A 4ZXGA 2PERA 1X0RA 4ZL9A 5LNKe 3P90A 4P3YB 3DVXA 1TDIA 2VCTA 3D4TA 1K3OA 2XC2A 2H66A 2X8HA 1YF0A 2H6XA 4I8BA 4EF0A 2LJRA 4PURA 4GQFA 1FHEA 4IQ1A 3K8NA 5AISA 5EL8A 2VD1A 5IMFA 1X5CA 4MJBA 1BAYA 1ERUA 5COHA 2V41A 1EZKA 4PX1A 1GP1A 3CXGA 2FWFA 1AIUA 4JRRA 4IP1A 4G2EA 2VL2A 2WB9A 4N0ZA 2CZ3A 2B5YA 2M80A 5G2ZA 3UAPA 3VURA 2K8SA 1FAAA 3BOAA 3LXZA 4JE1A 4KSMA 2DMMA 4G19A 3TKSC 1GLQA 3A2WA 1WOUA 4NV5A 4K7OA 1ZCPA 2FA8A 4IW9A 2EIQA 3IDVA 2MBTA 4F03A 5D9WA 1AC1A 5B6NA 4IJ3A 1NHYA 1XBSA 2LRNA 4MP4A 3CRTA 5JWQB 4FYUA 1ML6A 5AIXA 2LJKA 4HSCX 5ECKB 1E2YA 4H86A 3TKQA 4ZBBA 2YZUA 2YWMA 3W8JA 4IS0A 3QFBC 4IP6A 2KHPA 3M8NA 1KNGA 1ZYNA 4HOJA 3BJ5A 2IL3A 3GUSA 1XOAA 3Q6OA 3IHGA 2TIRA 2R0PA 3SBCA 2X4AA 4F0CA 3FY7A 4IHUA 1GNWA 3L9VA 1N8JA 2ON7A 2PU9C 3AY8A 2JACA 3DIEA 4KF9A 3O76A 1K0BA 5L71A 2DIYA 4IELA 1E6BA 3FRCA 3HYPA 5B8BA 2X64A 2DKHA 3N9JA 3WGXA 1QQ2A 2YOIA 4NHWA 4MNNA 4TR4A 3KZQA 2CX4A 1PD21 1GUMA 2LEGA 2PPTA 1SKWB 2K8VA 1TJDA 2K6VA 4AF2A 2L5OA 1ACVA 4GSNA 4YH2A 1AXDA 3UMAA 2KOKA 1KEBA 2BMXA 1TTZA 1S3RA 5HR0A 2RM6A 1BYEA 5ECHB 1YKAA 5AIVA 1XWKA 4POBA 2OE3A 2VL3A 2L57A 4G10A 1USBA 2YWIA 2A4HA 4HZ2A 4O92A 2MZCA 2AV4A 3DKSA 2YJHA 2MMNA 4MPGA 1JZRA 4ZB8A 1A2MA 5D9XA 4O5QA 2CAIA 1YDKA 3DXBA 3TGZA 5FWGA 4V2MA 1X9WB 1DUGA 2H1AA 2IMEA 2XBQA 1TKDB 3VWVA 1ERVA 1EOHA 12GSA 1GTUA 2IWTA 5G5FA 4MZCA 3CQFA 2GSTA 5IQYA 4LMWA 2F3MA 2EC4A 2VL9A 3M1GA 2H19A 2QKEA 5IO0A 2IN3A 3FZAA 2H8LA 3DD3A 1LU4A 5A5KA 4MZBA 3IC8A 5IOWA 2FGXA 2C0EA 3P2AA 1RW1A 1LBKA 1HYUA 3FZ4A 2LRTA 4MF5A 2DMLA 2JL4A 4N30A 4G0KA 1OC9A 2JSYA 3BCKA 1SL2B 3MYDA 2NDOA 2V6OA 1TOFA 4XS4B 1XOBA 2KP1A 3G7YA 1MD3A 5A4WA 2O89A 2TRXA 2X99A 3EYTA 1UA5A 3PPUA 2HZEA 5IO2A 2C80A 2TRCP 2B7KA 3L9SA 5D96A 4X43A 5EY6A 2E0QA 5F06A 4ACSA 1V58A 3WYWA 1EGRA 3NZNA 2XBIA 1R7HA 2WS2A 2VLUA 3UIWA 2VUPA 1GL8A 1A24A 2YPMA 3F4RA 2YN1A 2C0GA 4L5LA 2HZFA 2VCQA 4EXJA 3PR8A 2H01A 3EMPA 4F9ZA 3GN3A 4ICYA 1GULA 4KDUA 1O8XA 5IIZA 3KXOA 1V40A 1ST9A 1SK1A 2WCIA 2FLSA 1T3BA 3PGTA 4BIKA 3LFLA 5GAPD 2LQOA 2IIYA 1R26A 4AGSA 1MDIA 3UVHA 1Z5YE 4V2NA 3IOSA 4JZQA 3HJPA 1XIYA 2QC7A 2GSSA 3V1WA 1TK5B 1DE2A 5IMVA 4DSSB 3KCMA 4FH8A 4HUAA 4KE3A 4TOPA 2KUCA 1J0FA 3TRXA 4GRFA 3VPQA 4EVMA 3TB2A 1AQVA 3GIXA 2GDRA 1V57A 3GL5A 2I1UA 3KH7A 3LYKA 1A2JA 5A4VA 2GS3A 5IM9A 2KP2A 4N10A 4Z2UA 4Q5QA 7GSSA 2H76A 1JLVA 1F2EA 1M99A 4POKA 4PUAA 4WR4A 1GSDA 3I6AA 1QXHA 4ZB6A 3APOA 4XRAA 4GF0A 1SL1B 2GZYA 3ME7A 1T4YA 1SD9A 2LS5A 2NVLA 5DQYA 4F0BA 1ON4A 2I9HA 4X0XA 5J9BA 3ZRDA 4Q5NA 1VF3A 3APSA 3VI5A 3QAVA 4J2FA 3A2XA 1ZZYA 2LUSA 3GNJA 2CA8A 1URMA 2PN8A 2L5LA 3F0IA 3PINA 1PN9A 2H0GA 3RPPA 5AN1A 3ZMLA 1U6TA 4JR4A 5J4UA 4NXIA 1X5EA 2DJ1A 2CX3A 3VWXA 4K2XA 2YWOA 1G0TA 2F51A 2ZNMA 4MK3A 1ZOFA 4BL7B 1W89A 1FO5A 1JLWA 4KUNA 3E9JB 2OBIA 1GRXA 2MMOA 2H1GA 3F3QA 2QA1A 3A2VA 4OMVA 2H6ZA 1VF1A 4ISDA 1XW5A 1GSYA 5JCUA 6GSWA 5IPGA 3US3A 3TRPA 4NMUA 1PN0A 1AW9A 1KBNA 4KDXA 2KLXA 4O32A 4BVXA 3BBYA 1TRWA 1WWJA 2RUFA 2VM2A 4K0GA 1V2AA 4HDEA 4LLRA 3EWLA 2YZHA 4DSQA 4PQ1A 3QMXA 3LG6A 1AQXA 3LXTA 1XZOA 4I2UA 4K8MA 2PWJA 1G7OA 3D0ZA 4HU9A 4BPYA 2NPBA 3WGEA 5F07A 1U3IA 5HR2A 2B1LA 3UARA 2AUVA 2GLRA 4OO4A 1A2LA 4J57E 3GSTA 3KP8A 2BTOT 2CQ9A 3TJKA 4NAXA 1MEKA 2CAQA 3EINA 2PUKC 4ML6A 5J9CA 3ME8A 3UBKA 4K7NA 1WE0A 3LQ7A 5DQSA 3DVWA 4N11A 1YF1A 1Y25A 4FO5A 4TR0A 4YAPA 5DDLA 4OFTA 3ERWA 3TKSA 5D73A 3P8WA 3C73A 5G30A 3D22A 3HCZA 3F4TA 2H74A 3CSJA 4YQUA 3UOMA 3NIVA 2E7PA 1Z7PA 3GRXA 1AAZA 1B9XC 4IQAA 1GWCA 3W8SA 1XXUA 2G2QA 3WT2A 2YANA 1SJIA 1OVNA 3IK9A 1S3CA 1O73A 1OYJA 2DBCA 5CO3A 4KX4A 1BG5A 3P7XA 4D73B 3D21A 5G1KA 1O8WA 2JZTA 5JCWA 4MPFA 1ILOA 1WMJA 2GQLA 4OFMA 4BL7A 3D4MA 1QK8A 3Q19A 1XWCA 1LJRA 4BVYB 2GZZA 2WJUA 2XPEA 2HYXA 5H5RA 5J41A 1X9SB 4LA1A 1A0RP 2N5FA 1H75A 4MA9A 5GSSA 2IMIA 4TR3A 2RUEA 3ZZXA 2R37A 3CSHA 1M3JA 1K0NA 1TU7A 4KDYA 1KTEA 2CZ2A 4XHMA 4ZILA 5HR3A 3IE3A 2JADA 4CY6A 2P31A 1GSQA 2AHEA 2WULA 3F3RA 1UC7A 1C72A 2HRNA 1FB0A 4PGTA 2C3TA 2C1YA 4MF7A 3H4KA 1U3AA 1Q98A 4L5OA 1EV4A 3GX0A 5LD0A 1PFOA 4OCFA 4OWYA 5D93A 5J5NA 3CMIA 3KIJA 2WDUA 3ZLPA 2FWEA 4N0VA 1K3YA 3CTFA 2P5QA 3VK9A 2C0DA 1B48A 2H0HA 3CTGA 1YZXA 3S9FA 4CY8A 3KTLA 2PVQA 2HSHA 5J3RA 1M2AA 3ZIVA 2K18A 2R0CA 5G5EA 4RQRA 3TUEA 5E59A 1PA3A 4JU5A 1GNEA 1OE7A 2AAWA 1SJ6A 3HXSA 3HJMA 1GH2A 5ABRA 1K3LA 3O6TA 3TKSE 16GSA 4V2LA 2OBKA 1K0DA 3F63A 3ZTLA 3A5IA 4WBJA 3ZIJA
chains in the Genus database with same CATH topology
3RPNA 1EWXA 5DBQA 5ID2B 1FOVA 4FQUA 3GTUB 1RK4A 2K9FA 5CP1A 4K5RA 8GSSA 2H70A 5G1LA 4IBPA 4QL7A 4DSRA 2WFCA 3H8QA 3KJYA 1MDKA 4MH2A 2OE0A 2C8UA 10GSA 4MZWA 3F4SA 3OR5A 4O7HA 5KN3A 5DALB 1MTCA 3I9V2 3F6FA 1F3AA 1Q4JA 4OCEA 1A8YA 3TRQA 1PX7A 1T4ZA 2L6DA 3TKPA 6GSVA 1F3BA 3I43A 2EIOA 1K0CA 4TRXA 4KH7A 3E3EA 5G31A 5GZZB 4KW6A 5D8IA 3RAZA 2VM1A 3Q74A 3FEUA 2O85A 4EL1A 5F0GA 2FWGA 4KAEA 4MF6A 6GSSA 2DIZA 1ZL9A 1R4WA 2GQMA 4WXTA 4ML1A 5DJLA 2RIIA 3TJGA 3ISOA 2CT6A 1EP7A 4NV2A 2LQQA 2DJ2A 5CYYA 1X9MB 3EVIA 2HI7A 2VLVA 4PTSA 1FVKA 3MSZA 3UJ1A 3QPMA 5FT3A 3J7Yk 1N2AA 2YNXA 1YY7A 3HA9A 3BD2A 3ZL5A 2R4VA 5ELAA 3IC4A 4ZIJA 3MAKA 1JFUA 1PL2A 2WRTA 4ZBDA 2WGRA 2JSZA 5DCGA 4YAVA 3QFAC 4EE0A 5DJMA 1UN2A 5ID2A 3J7Yb 3GTUA 2FD3A 2H71A 4ULXA 4XS6A 1Z3EA 2MMAA 4TKYA 4G0IA 1XW9A 3GMFA 2LJAA 1PQNA 4OO5A 5F8BA 3TOUA 5KOWA 2L59A 1QMVA 3E0UA 4HQZA 4HJ2A 4NWYA 1EGOA 4MCUA 4XCSA 2GSRA 1XVWA 2DLXA 2HFDA 5DALA 1THOA 2LNTA 1TI3A 3QOUA 1A0FA 14GSA 1Z6NA 3FMWA 1PKZA 3FR9A 4HU7A 3R2QA 3EPTA 3TOTA 3QR6A 3GKKA 1YEXA 4X4JA 2GTUA 2HRFA 4TXOB 6GSXA 1XPVA 4TR1B 4F82A 1BX9A 2GSQA 3KEBA 4ZL8A 2UZ8A 4WETA 2H6YA 1M2DA 4MDCA 2X49A 4OFNA 2R3XA 3CBUA 1MD4A 4IGJA 5CREA 3LJRA 5DAKB 4HQSA 5JCGA 4J56E 3M3MA 13GSA 4GQCA 2A2RA 1HNCA 2EIRA 4XS4A 3ZVJD 3DWVA 5ECNB 4AJ8A 6GSYA 1V9WA 4KCAA 2X8GA 5CNWA 4FYBA 2IJYA 4PXOA 2HNLA 3UVTA 1J9BA 4POLA 1OKDA 2MYGA 3IRAA 5KN0A 1ZYQB 1XWGA 3C7MA 4GSSA 3MWHA 4TVEA 1YEPA 1RQMA 2VAFA 1F37A 3ZVJA 3GYKA 3LWAA 4PQHA 2C4JA 4PNFA 4AJ7A 3TJFA 1VGLA 2CV4A 3MIXA 4XS1A 3G7IA 2HSMA 2M46A 1TXXA 5D9VA 4RI7A 2R2JA 1AQWA 3IAM2 2JZRA 3SWLA 3LYPA 4TN8A 2O7KA 3LSZA 4CW9A 1DBYA 1W4VA 3FZ9A 4GXZA 3EURA 5ECLB 3IA1A 4EDYA 5CRHA 1YKCA 1B4PA 1O6JA 1JZDA 3IR4A 3N5OA 4WF4A 5F05A 2N5AA 1SKRB 3ERFA 3ZFLA 5KN2A 2H72A 1OC3A 2CVBA 1FG4A 11GSA 3HJOA 4KGIA 2H0IA 3VWUA 1WP0A 1T8EB 1TRVA 2YV9A 2DJKA 5ECIB 2FA4A 2LRCA 3VI7A 2L4QA 2HE3A 3HZ8A 4DSSA 2GQKA 1TU8A 3TCOA 1OC8A 2E2GA 2HT9A 5FHIA 2A2SA 4TXOA 4YKFA 1MDJA 5B6MA 4K0NA 1SU9A 3F6DA 3UL3A 1SK0A 1SL0B 4X1UA 3KMNA 2H1DA 3GHAA 2B7JA 4K2DA 1SD8A 5DAKA 5KEJA 4HI7A 3FKFA 2PMTA 4ZBAA 2E2MA 1UVZA 4WR5A 4MJAA 5ECMB 3G7JA 5ENUA 3WD6A 2YP6A 3IBHA 2REMA 3KMOA 4KSOA 1K0MA 2VCWA 4L0WA 1TI1A 1O7UA 4Q5RA 4ZL7A 2HRKA 4GWRA 6GSTA 4MLYA 4ILFA 3L4NA 2B5EA 4RUVA 3RBTA 1VF4A 2Z9SA 5HFIA 4L8EA 3ZREA 1V98A 3QDNA 2ALBA 4I97A 5GSTA 1I5GA 2IPAA 1S3DA 3LGCA 5EPFA 5CAXA 2B5XA 3GSSA 3LEFA 3GX8A 3DRNA 3UEMA 2D2ZA 1F6MC 3HVVA 3M9JA 3KM6A 2GGTA 2HSYA 2HRAA 1XFLA 2GVPA 2OE1A 4FIWA 1BJXA 3UBLA 1GTAA 5D9TA 2OACA 3HY2A 1BEDA 1O81A 4TW5A 6GSUA 3KTBA 4V1Ap 5IPHA 3CSIA 2GT5A 3RDWA 5IOXA 3LORA 5HFKA 2AB6A 4XRDA 1G7EA 5JWRB 3QAWA 5DCHA 5IMZA 2H75A 4L0UA 5C00A 3MDKA 5A4UA 3TJBA 2LKUA 1TW9A 2R0GA 2FUG2 3IXRA 1M9BA 2FCHA 4OD7A 3O3TA 4ECIA 3ZFBA 3KGKA 2ZUPA 2RLIA 2OADA 3CRUA 3ED3A 2HLSA 1WJKA 1K0AA 5JWOB 5H5SA 4EIPA 5HR1A 3DMLA 1H4OA 3HD5A 2AJQB 1PSQA 2LTKA 4MJEA 2XHFA 2IMFA 3EU4A 1HD2A 1A23A 4KA0A 4KB3A 4Z7XA 3QCPA 3TKRA 5IMDA 4NPBA 3L78A 3C71A 1ZYEA 2VL2C 3GV1A 5BMUA 3HZ4A 4ECJA 5C04A 4BWQA 4PUFC 1GSEA 2R6KA 3IHQA 2CVKA 3FK8A 4GTUA 4DVCA 18GSA 1EV9A 4RQXA 1FB6A 1OC9B 5ECPB 1YJ6A 3VLNA 3GA4A 5ECSA 2B3SA 3W6GA 2R5GA 3M9KA 3H1NA 3R3EA 3VWWA 1XWBA 4D73A 2DKIA 2HZEB 4TXVA 5ECQB 3KH9A 2VD0A 5INYA 2OA7A 1J08A 4JR6A 2OJLA 4IJIA 3C1SA 3EC3A 1M7TA 1U87A 4BVYA 2B1KA 4JBBA 3JCML 2FY6A 4Z2TA 4EIQA 3TDGA 4RI6A 1FW1A 1GLPA 1GTIA 2F8FA 2DJ3A 2I4AA 3D5JA 1CQGA 3H93A 1M0UA 2DJJA 2PGTA 1SYXA 2NTOA 4A5PA 2O8VB 4HJMA 3RHCA 1K0OA 4I5QA 1VF2A 17GSA 3H79A 4MJCA 4MMMA 3GFKA 1QFNA 3GKNA 3ZMKA 4XIHA 1Y6EA 2J9HA 1PX6A 4K6XA 4EC0A 3IAS2 2FWHA 1TK8B 3ZITA 3EE2A 4CDOA 1A8LA 3Q18A 3WGDA 2ON5A 4XTSA 4ECBA 2H30A 5LCZA 1SENA 4QQ7A 4USSA 4I2TA 3FR6A 1XWAA 2LSTA 1ZYPA 2AYTA 4WF5A 4E8HA 2DSAA 2JZSA 2H73A 1BQ7A 2A2PA 2BJXA 1ERTA 3MNGA 3VFIA 3C1RA 3FZ5A 1PMTA 19GSA 2V2GA 2YWNA 2DJ0A 3CYNA 4IVFA 1OE8A 22GSA 4YQVA 2HXKA 2QA2A 20GSA 1Z7RA 4ECCA 1TK0B 5EVOA 2VO4A 2IMKA 2P0GA 4EO3A 1GUHA 2F8AA 1DSBA 4AJ6A 3M0FA 3RHBA 4WBRD 1FOHA 3F8UA 1WRYA 3U6VA 4QL9A 2FNOA 3HVXA 4MH3A 3KD0A 1T1VA 4K5SA 5HQPA 1EEMA 3L0HA 1JZWA 3DEXA 1AUCA 2N5BA 4PQIA 4EUYA 5KOXA 4K9ZA 3D6IA 3C8EA 2GZPA 1NW2A 1ZMAA 1ERWA 4KCEA 2O87A 3HKRA 2RM5A 1IYIA 1B8XA 2ZCTA 5CRDA 2XPDA 3GH9A 4KNDA 1SYRA 4O5RA 2C3NA 1EOGA 1HQOA 2VCZA 1PRXA 4DEJA 2QSIA 1T00A 3DGQA 2L6CA 2NBSA 3EMXA 1QGVA 4LL4B 4IN0A 1TRSA 2LV3A 5ELGA 2MBSA 1F9MA 4NHZA 1HNAA 3I69A 2G0FA 5HFGA 4BVXB 4BWSA 2H1BA 3FW2A 4K1FA 1NM3A 1DE1A 1GSFA 4I6XA 2P5RA 2VLTA 3GKXA 4WEYA 5B7CA 3L9UA 3GH6A 1GTBA 2IFQB 2VOCA 2VCXA 4ZB9A 2FHEA 3IV4A 5CRGA 4EDZA 3G9BA 4YKGA 4LL1B 2C3QA 5BRTA 3WT1A 1EEJA 1HNBA 4GLTA 3KP9A 3U5RE 1R5PA 5DVBA 1THXA 4PNGA 1TP9A 2ES7A 1U88A 1PL1A 4GCIA 9GSSA 3FR3A 2WZ9A 4POMA 1M9AA 1X5DA 1SKSB 1ABAA 4CHSA 1I9DA 1PGTA 5E4WA 4V1Ag 5B8AA 4EKZA 2YJ7A 4JEDA 1S3AA 3FYGA 2GT6A 5ECRB 2PVOC 5GAND 4F2IA 5KN1A 1O85A 2I3YA 1B9YC 4FYCA 1QUWA 5AGYA 5H5QA 1CQHA 3HDCA 1T7PB 3LW9A 2YCDA 4HS1A 1OAZA 1GUKA 1NSWA 3A5WA 1XW6A 1VRSD 5IMAA 2OKAA 1M2BA 5CRWA 1YQ1A 1PKWA 2V32A 1SJZA 3GURA 2J23A 2I81A 2V1MA 2JU5A 4Z2RA 1JHBA 1XCCA 5ECOB 4ID0A 1IYHA 3IK7A 3EU3A 2C0FA 3PH9A 1R5AA 4LMVA 4TR1A 4Q5FA 3F9UA 1SK2A 1EP8A 2A4VA 1G6YA 2IMDA 2X8CA 1GSUA 3VPTA 4HEA2 3QD9A 1Z6MA 1WPIA 2YV7A 3HHVA 5IMCA 1GSSA 4HZ4A 4GSTA 3ZYWA 3ERGA 2PBJA 4WKWA 4O5UA 4IKHA 2L4CA 4BA7A 2IFQA 4E8EA 1FVJA 1OKTA 1ZGNA 3HVSA 3TJJA 3BCIA 1XVQA 4YQMA 2LNSA 1NHOA 4G9HA 1Z9HA 2F9SA 1B4QA 1G6WA 3QAGA 4K7IA 2MMZA 3A3TA 3IPZA 4G0LA 3NOFA 2V6KA 3APQA 1TRUA 3DYRA 1JZOA 1WIKA 2VCVA 2VIMA 2QGVA 4MABA 2CVDA 2B6MA 2M72A 3GKMA 3GL3A 3FHKA 2DC5A 4ZXGA 2PERA 1X0RA 4ZL9A 5LNKe 3P90A 4P3YB 3DVXA 1TDIA 2VCTA 3D4TA 1K3OA 2XC2A 2H66A 2X8HA 1YF0A 2H6XA 4I8BA 4EF0A 2LJRA 4PURA 4GQFA 1FHEA 4IQ1A 3K8NA 5AISA 5EL8A 2VD1A 5IMFA 1X5CA 4MJBA 1BAYA 1ERUA 5COHA 2V41A 1EZKA 4PX1A 1GP1A 3CXGA 2FWFA 1AIUA 4JRRA 4IP1A 4G2EA 2VL2A 2WB9A 4N0ZA 2CZ3A 2B5YA 2M80A 5G2ZA 3UAPA 3VURA 2K8SA 1FAAA 3BOAA 3LXZA 4JE1A 4KSMA 2DMMA 4G19A 3TKSC 1GLQA 3A2WA 1WOUA 4NV5A 4K7OA 1ZCPA 2FA8A 4IW9A 2EIQA 3IDVA 2MBTA 4F03A 5D9WA 1AC1A 5B6NA 4IJ3A 1NHYA 1XBSA 2LRNA 4MP4A 3CRTA 5JWQB 4FYUA 1ML6A 5AIXA 2LJKA 5ECKB 1E2YA 4H86A 3TKQA 4ZBBA 2YZUA 2YWMA 3W8JA 4IS0A 3QFBC 4IP6A 2KHPA 3M8NA 1KNGA 1ZYNA 4HOJA 3BJ5A 2IL3A 3GUSA 1XOAA 3Q6OA 3IHGA 2TIRA 2R0PA 3SBCA 2X4AA 4F0CA 3FY7A 4IHUA 1GNWA 3L9VA 1N8JA 2ON7A 2PU9C 3AY8A 2JACA 3DIEA 4KF9A 3O76A 1K0BA 5L71A 2DIYA 4IELA 1E6BA 3FRCA 3HYPA 5B8BA 2X64A 2DKHA 3N9JA 3WGXA 1QQ2A 2YOIA 4NHWA 4MNNA 4TR4A 3KZQA 2CX4A 1PD21 1GUMA 2LEGA 2PPTA 1SKWB 2K8VA 1TJDA 2K6VA 4AF2A 2L5OA 1ACVA 4GSNA 4YH2A 1AXDA 3UMAA 2KOKA 1KEBA 2BMXA 1TTZA 5HR0A 2RM6A 1BYEA 5ECHB 1YKAA 5AIVA 1XWKA 4POBA 2OE3A 2VL3A 2L57A 4G10A 1USBA 2YWIA 2A4HA 4HZ2A 4O92A 2MZCA 2AV4A 3DKSA 2YJHA 2MMNA 4MPGA 1JZRA 4ZB8A 1A2MA 5D9XA 4O5QA 2CAIA 1YDKA 3DXBA 3TGZA 5FWGA 4V2MA 1X9WB 1DUGA 2H1AA 2IMEA 2XBQA 1TKDB 3VWVA 1ERVA 1EOHA 12GSA 1GTUA 2IWTA 5G5FA 4MZCA 2GSTA 5IQYA 4LMWA 2F3MA 2EC4A 2VL9A 3M1GA 2H19A 2QKEA 5IO0A 2IN3A 3FZAA 2H8LA 3DD3A 1LU4A 5A5KA 4MZBA 3IC8A 5IOWA 2FGXA 2C0EA 3P2AA 1RW1A 1LBKA 1HYUA 3FZ4A 2LRTA 4MF5A 2DMLA 2JL4A 4N30A 4G0KA 1OC9A 2JSYA 3BCKA 1SL2B 3MYDA 2NDOA 2V6OA 1TOFA 4XS4B 1XOBA 2KP1A 3G7YA 1MD3A 5A4WA 2O89A 2TRXA 2X99A 3EYTA 1UA5A 3PPUA 2HZEA 5IO2A 2C80A 2TRCP 2B7KA 3L9SA 5D96A 4X43A 5EY6A 2E0QA 5F06A 4ACSA 1V58A 3WYWA 1EGRA 3NZNA 2XBIA 1R7HA 2WS2A 2VLUA 3UIWA 2VUPA 1GL8A 1A24A 2YPMA 3F4RA 2YN1A 2C0GA 4L5LA 2HZFA 2VCQA 4EXJA 3PR8A 2H01A 3EMPA 4F9ZA 3GN3A 4ICYA 1GULA 4KDUA 1O8XA 5IIZA 3KXOA 1V40A 1ST9A 1SK1A 2WCIA 2FLSA 1T3BA 3PGTA 3LFLA 5GAPD 2LQOA 2IIYA 1R26A 4AGSA 1MDIA 3UVHA 1Z5YE 4V2NA 3IOSA 4JZQA 3HJPA 1XIYA 2QC7A 2GSSA 3V1WA 1TK5B 1DE2A 5IMVA 4DSSB 3KCMA 4FH8A 4HUAA 4KE3A 4TOPA 2KUCA 1J0FA 3TRXA 4GRFA 3VPQA 4EVMA 3TB2A 1AQVA 3GIXA 2GDRA 1V57A 3GL5A 2I1UA 3KH7A 3LYKA 1A2JA 5A4VA 2GS3A 5IM9A 2KP2A 4N10A 4Z2UA 4Q5QA 7GSSA 2H76A 1JLVA 1F2EA 1M99A 4POKA 4PUAA 4WR4A 1GSDA 3I6AA 1QXHA 4ZB6A 3APOA 4XRAA 4GF0A 1SL1B 2GZYA 3ME7A 1T4YA 1SD9A 2LS5A 2NVLA 5DQYA 4F0BA 1ON4A 2I9HA 4X0XA 5J9BA 3ZRDA 4Q5NA 1VF3A 3APSA 3VI5A 3QAVA 4J2FA 3A2XA 1ZZYA 2LUSA 3GNJA 2CA8A 1URMA 2PN8A 2L5LA 3F0IA 3PINA 1PN9A 2H0GA 3RPPA 5AN1A 3ZMLA 1U6TA 4JR4A 5J4UA 4NXIA 1X5EA 2DJ1A 2CX3A 3VWXA 4K2XA 2YWOA 1G0TA 2F51A 2ZNMA 4MK3A 1ZOFA 4BL7B 1W89A 1FO5A 1JLWA 4KUNA 3E9JB 2OBIA 1GRXA 2MMOA 2H1GA 3F3QA 2QA1A 3A2VA 4OMVA 2H6ZA 1VF1A 4ISDA 1XW5A 1GSYA 5JCUA 6GSWA 5IPGA 3US3A 3TRPA 4NMUA 1PN0A 1AW9A 1KBNA 4KDXA 2KLXA 4O32A 4BVXA 3BBYA 1TRWA 1WWJA 2RUFA 2VM2A 4K0GA 1V2AA 4HDEA 4LLRA 3EWLA 2YZHA 4DSQA 4PQ1A 3QMXA 3LG6A 1AQXA 3LXTA 1XZOA 4I2UA 4K8MA 2PWJA 1G7OA 3D0ZA 4HU9A 4BPYA 2NPBA 3WGEA 5F07A 1U3IA 5HR2A 2B1LA 3UARA 2AUVA 2GLRA 4OO4A 1A2LA 4J57E 3GSTA 3KP8A 2BTOT 2CQ9A 3TJKA 4NAXA 1MEKA 2CAQA 3EINA 2PUKC 4ML6A 5J9CA 3ME8A 3UBKA 4K7NA 1WE0A 3LQ7A 5DQSA 3DVWA 4N11A 1YF1A 1Y25A 4FO5A 4TR0A 4YAPA 5DDLA 4OFTA 3ERWA 3TKSA 5D73A 3P8WA 3C73A 5G30A 3D22A 3HCZA 3F4TA 2H74A 3CSJA 4YQUA 3UOMA 3NIVA 2E7PA 1Z7PA 3GRXA 1AAZA 1B9XC 4IQAA 1GWCA 3W8SA 1XXUA 2G2QA 3WT2A 2YANA 1SJIA 1OVNA 3IK9A 1S3CA 1O73A 1OYJA 2DBCA 5CO3A 4KX4A 1BG5A 3P7XA 4D73B 3D21A 5G1KA 1O8WA 2JZTA 5JCWA 4MPFA 1ILOA 1WMJA 2GQLA 4OFMA 4BL7A 3D4MA 1QK8A 3Q19A 1XWCA 1LJRA 4BVYB 2GZZA 2WJUA 2XPEA 2HYXA 5H5RA 5J41A 1X9SB 4LA1A 1A0RP 2N5FA 1H75A 4MA9A 5GSSA 2IMIA 4TR3A 2RUEA 3ZZXA 2R37A 3CSHA 1K0NA 1TU7A 4KDYA 1KTEA 2CZ2A 4XHMA 4ZILA 5HR3A 3IE3A 2JADA 4CY6A 2P31A 1GSQA 2AHEA 2WULA 3F3RA 1UC7A 1C72A 2HRNA 1FB0A 4PGTA 2C3TA 2C1YA 4MF7A 3H4KA 1U3AA 1Q98A 4L5OA 1EV4A 3GX0A 5LD0A 4OCFA 4OWYA 5D93A 5J5NA 3CMIA 3KIJA 2WDUA 3ZLPA 2FWEA 4N0VA 1K3YA 3CTFA 2P5QA 3VK9A 2C0DA 1B48A 2H0HA 3CTGA 1YZXA 3S9FA 4CY8A 3KTLA 2PVQA 2HSHA 5J3RA 1M2AA 3ZIVA 2K18A 2R0CA 5G5EA 4RQRA 3TUEA 5E59A 1PA3A 4JU5A 1GNEA 1OE7A 2AAWA 1SJ6A 3HXSA 3HJMA 1GH2A 5ABRA 1K3LA 3O6TA 3TKSE 16GSA 4V2LA 2OBKA 1K0DA 3F63A 3ZTLA 3A5IA 4WBJA 3ZIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPN A;  1EWX A;  5DBQ A;  5ID2 B;  1FOV A;  3GTU B;  1RK4 A;  2K9F A;  5CP1 A;  8GSS A;  2H70 A;  5G1L A;  4IBP A;  4QL7 A;  4DSR A;  2WFC A;  3H8Q A;  3KJY A;  1MDK A;  4MH2 A;  2OE0 A;  2C8U A;  10GS A;  4MZW A;  3F4S A;  3OR5 A;  4O7H A;  5KN3 A;  5DAL B;  1MTC A;  3I9V 2;  3F6F A;  1F3A A;  1Q4J A;  4OCE A;  1A8Y A;  3TRQ A;  1PX7 A;  1T4Z A;  2L6D A;  3TKP A;  6GSV A;  1F3B A;  3I43 A;  2EIO A;  1K0C A;  4TRX A;  4KH7 A;  3E3E A;  5G31 A;  5GZZ B;  4KW6 A;  5D8I A;  3RAZ A;  2VM1 A;  3Q74 A;  3FEU A;  2O85 A;  4EL1 A;  5F0G A;  2FWG A;  4KAE A;  4MF6 A;  6GSS A;  2DIZ A;  1ZL9 A;  1R4W A;  2GQM A;  4WXT A;  4ML1 A;  5DJL A;  2RII A;  3TJG A;  3ISO A;  2CT6 A;  1EP7 A;  4NV2 A;  2LQQ A;  2DJ2 A;  5CYY A;  1X9M B;  3EVI A;  2HI7 A;  2VLV A;  1FVK A;  3MSZ A;  3UJ1 A;  3QPM A;  5FT3 A;  3J7Y k;  1N2A A;  2YNX A;  1YY7 A;  3HA9 A;  3BD2 A;  3ZL5 A;  2R4V A;  5ELA A;  3IC4 A;  4ZIJ A;  3MAK A;  1JFU A;  1PL2 A;  2WRT A;  4ZBD A;  2WGR A;  2JSZ A;  5DCG A;  4YAV A;  3QFA C;  4EE0 A;  5DJM A;  1UN2 A;  5ID2 A;  3J7Y b;  3GTU A;  2FD3 A;  2H71 A;  4ULX A;  4XS6 A;  1Z3E A;  2MMA A;  4TKY A;  1XW9 A;  3GMF A;  2LJA A;  1PQN A;  4OO5 A;  5F8B A;  3TOU A;  2L59 A;  1QMV A;  3E0U A;  4HQZ A;  4HJ2 A;  4NWY A;  1EGO A;  4MCU A;  4XCS A;  2GSR A;  1XVW A;  2DLX A;  2HFD A;  5DAL A;  1THO A;  2LNT A;  1TI3 A;  3QOU A;  1A0F A;  14GS A;  1Z6N A;  1PKZ A;  3FR9 A;  4HU7 A;  3R2Q A;  3TOT A;  3QR6 A;  3GKK A;  1YEX A;  2GTU A;  2HRF A;  4TXO B;  6GSX A;  1XPV A;  4TR1 B;  4F82 A;  1BX9 A;  2GSQ A;  3KEB A;  4ZL8 A;  4WET A;  2H6Y A;  1M2D A;  4MDC A;  4OFN A;  2R3X A;  3CBU A;  1MD4 A;  4IGJ A;  5CRE A;  3LJR A;  5DAK B;  4HQS A;  5JCG A;  4J56 E;  3M3M A;  13GS A;  4GQC A;  2A2R A;  1HNC A;  2EIR A;  4XS4 A;  3ZVJ D;  3DWV A;  5ECN B;  4AJ8 A;  6GSY A;  1V9W A;  4KCA A;  2X8G A;  5CNW A;  4FYB A;  2IJY A;  4PXO A;  2HNL A;  3UVT A;  1J9B A;  4POL A;  1OKD A;  2MYG A;  3IRA A;  5KN0 A;  1ZYQ B;  1XWG A;  3C7M A;  4GSS A;  3MWH A;  4TVE A;  1YEP A;  1RQM A;  2VAF A;  1F37 A;  3ZVJ A;  3GYK A;  3LWA A;  4PQH A;  2C4J A;  4PNF A;  4AJ7 A;  3TJF A;  1VGL A;  2CV4 A;  4XS1 A;  3G7I A;  2M46 A;  1TXX A;  5D9V A;  4RI7 A;  2R2J A;  1AQW A;  3IAM 2;  2JZR A;  3SWL A;  3LYP A;  4TN8 A;  2O7K A;  3LSZ A;  4CW9 A;  1DBY A;  1W4V A;  3FZ9 A;  4GXZ A;  3EUR A;  5ECL B;  3IA1 A;  4EDY A;  5CRH A;  1YKC A;  1B4P A;  1O6J A;  1JZD A;  3IR4 A;  3N5O A;  4WF4 A;  5F05 A;  2N5A A;  1SKR B;  3ERF A;  3ZFL A;  5KN2 A;  2H72 A;  1OC3 A;  2CVB A;  1FG4 A;  11GS A;  3HJO A;  4KGI A;  2H0I A;  3VWU A;  1WP0 A;  1T8E B;  1TRV A;  2YV9 A;  2DJK A;  5ECI B;  2FA4 A;  2LRC A;  3VI7 A;  2L4Q A;  2HE3 A;  3HZ8 A;  4DSS A;  2GQK A;  1TU8 A;  3TCO A;  1OC8 A;  2E2G A;  2HT9 A;  5FHI A;  2A2S A;  4TXO A;  1MDJ A;  5B6M A;  4K0N A;  1SU9 A;  3F6D A;  3UL3 A;  1SK0 A;  1SL0 B;  4X1U A;  3KMN A;  2H1D A;  3GHA A;  2B7J A;  4K2D A;  1SD8 A;  5DAK A;  5KEJ A;  4HI7 A;  3FKF A;  2PMT A;  4ZBA A;  2E2M A;  1UVZ A;  4WR5 A;  4MJA A;  5ECM B;  3G7J A;  5ENU A;  3WD6 A;  2YP6 A;  3IBH A;  2REM A;  3KMO A;  4KSO A;  1K0M A;  2VCW A;  4L0W A;  1TI1 A;  1O7U A;  4Q5R A;  4ZL7 A;  4GWR A;  6GST A;  4MLY A;  4ILF A;  3L4N A;  2B5E A;  4RUV A;  3RBT A;  1VF4 A;  2Z9S A;  5HFI A;  4L8E A;  3ZRE A;  1V98 A;  3QDN A;  2ALB A;  4I97 A;  5GST A;  1I5G A;  2IPA A;  1S3D A;  3LGC A;  5EPF A;  5CAX A;  2B5X A;  3GSS A;  3LEF A;  3GX8 A;  3DRN A;  3UEM A;  2D2Z A;  1F6M C;  3HVV A;  3M9J A;  3KM6 A;  2GGT A;  2HSY A;  1XFL A;  2GVP A;  2OE1 A;  4FIW A;  1BJX A;  3UBL A;  1GTA A;  5D9T A;  2OAC A;  3HY2 A;  1BED A;  1O81 A;  4TW5 A;  6GSU A;  3KTB A;  4V1A p;  5IPH A;  3CSI A;  2GT5 A;  3RDW A;  5IOX A;  3LOR A;  5HFK A;  2AB6 A;  4XRD A;  1G7E A;  5JWR B;  3QAW A;  5DCH A;  5IMZ A;  2H75 A;  4L0U A;  5C00 A;  3MDK A;  5A4U A;  3TJB A;  2LKU A;  1TW9 A;  2FUG 2;  3IXR A;  1M9B A;  2FCH A;  4OD7 A;  3O3T A;  4ECI A;  3ZFB A;  3KGK A;  2ZUP A;  2RLI A;  2OAD A;  3CRU A;  3ED3 A;  2HLS A;  1WJK A;  1K0A A;  5JWO B;  5H5S A;  5HR1 A;  3DML A;  1H4O A;  3HD5 A;  2AJQ B;  1PSQ A;  2LTK A;  4MJE A;  2XHF A;  2IMF A;  3EU4 A;  1HD2 A;  1A23 A;  4KA0 A;  4KB3 A;  4Z7X A;  3QCP A;  3TKR A;  5IMD A;  4NPB A;  3L78 A;  3C71 A;  1ZYE A;  2VL2 C;  3GV1 A;  3HZ4 A;  4ECJ A;  5C04 A;  4BWQ A;  4PUF C;  1GSE A;  2R6K A;  3IHQ A;  2CVK A;  3FK8 A;  4GTU A;  4DVC A;  18GS A;  1EV9 A;  4RQX A;  1FB6 A;  1OC9 B;  5ECP B;  1YJ6 A;  3VLN A;  3GA4 A;  5ECS A;  2B3S A;  3W6G A;  2R5G A;  3M9K A;  3H1N A;  3VWW A;  1XWB A;  4D73 A;  2HZE B;  4TXV A;  5ECQ B;  3KH9 A;  2VD0 A;  5INY A;  2OA7 A;  1J08 A;  4JR6 A;  2OJL A;  4IJI A;  3C1S A;  3EC3 A;  1M7T A;  1U87 A;  4BVY A;  2B1K A;  4JBB A;  3JCM L;  2FY6 A;  3TDG A;  4RI6 A;  1FW1 A;  1GLP A;  1GTI A;  2F8F A;  2DJ3 A;  2I4A A;  3D5J A;  1CQG A;  3H93 A;  1M0U A;  2DJJ A;  2PGT A;  1SYX A;  2NTO A;  2O8V B;  4HJM A;  3RHC A;  1K0O A;  4I5Q A;  1VF2 A;  17GS A;  3H79 A;  4MJC A;  4MMM A;  3GFK A;  1QFN A;  3GKN A;  3ZMK A;  4XIH A;  1Y6E A;  2J9H A;  1PX6 A;  4K6X A;  4EC0 A;  3IAS 2;  2FWH A;  1TK8 B;  3ZIT A;  3EE2 A;  4CDO A;  1A8L A;  3Q18 A;  3WGD A;  2ON5 A;  4XTS A;  4ECB A;  2H30 A;  5LCZ A;  1SEN A;  4QQ7 A;  4I2T A;  3FR6 A;  1XWA A;  2LST A;  2AYT A;  4WF5 A;  4E8H A;  2DSA A;  2JZS A;  2H73 A;  1BQ7 A;  2BJX A;  1ERT A;  3MNG A;  3VFI A;  3C1R A;  1PMT A;  3FZ5 A;  19GS A;  2V2G A;  2YWN A;  2DJ0 A;  3CYN A;  4IVF A;  1OE8 A;  22GS A;  4YQV A;  2HXK A;  20GS A;  1Z7R A;  4ECC A;  1TK0 B;  5EVO A;  2VO4 A;  2IMK A;  2P0G A;  4EO3 A;  1GUH A;  2F8A A;  1DSB A;  4AJ6 A;  3M0F A;  3RHB A;  4WBR D;  3F8U A;  1WRY A;  3U6V A;  4QL9 A;  2FNO A;  3HVX A;  4MH3 A;  3KD0 A;  1T1V A;  5HQP A;  1EEM A;  3L0H A;  1JZW A;  3DEX A;  1AUC A;  2N5B A;  4PQI A;  4EUY A;  4K9Z A;  3D6I A;  3C8E A;  2GZP A;  1NW2 A;  1ZMA A;  1ERW A;  4KCE A;  2O87 A;  3HKR A;  2RM5 A;  1IYI A;  1B8X A;  2ZCT A;  5CRD A;  2XPD A;  3GH9 A;  4KND A;  1SYR A;  4O5R A;  2C3N A;  1EOG A;  1HQO A;  2VCZ A;  1PRX A;  4DEJ A;  2QSI A;  1T00 A;  3DGQ A;  2L6C A;  2NBS A;  3EMX A;  1QGV A;  4LL4 B;  4IN0 A;  1TRS A;  2LV3 A;  5ELG A;  2MBS A;  1F9M A;  4NHZ A;  1HNA A;  3I69 A;  2G0F A;  5HFG A;  4BWS A;  2H1B A;  3FW2 A;  4K1F A;  1NM3 A;  1DE1 A;  1GSF A;  4I6X A;  2P5R A;  2VLT A;  3GKX A;  4WEY A;  5B7C A;  3L9U A;  3GH6 A;  1GTB A;  2IFQ B;  2VOC A;  2VCX A;  4ZB9 A;  2FHE A;  3IV4 A;  5CRG A;  4EDZ A;  3G9B A;  4LL1 B;  2C3Q A;  3WT1 A;  1EEJ A;  1HNB A;  4GLT A;  3KP9 A;  3U5R E;  1R5P A;  5DVB A;  1THX A;  4PNG A;  1TP9 A;  2ES7 A;  1U88 A;  1PL1 A;  4GCI A;  9GSS A;  3FR3 A;  2WZ9 A;  4POM A;  1M9A A;  1X5D A;  1SKS B;  1ABA A;  4CHS A;  1I9D A;  1PGT A;  5E4W A;  4V1A g;  5B8A A;  4EKZ A;  2YJ7 A;  4JED A;  1S3A A;  3FYG A;  2GT6 A;  5ECR B;  2PVO C;  5GAN D;  4F2I A;  5KN1 A;  1O85 A;  2I3Y A;  1B9Y C;  4FYC A;  1QUW A;  5AGY A;  5H5Q A;  1CQH A;  3HDC A;  1T7P B;  2YCD A;  4HS1 A;  1OAZ A;  1GUK A;  1NSW A;  3A5W A;  1XW6 A;  1VRS D;  5IMA A;  2OKA A;  1M2B A;  5CRW A;  1YQ1 A;  1PKW A;  2V32 A;  1SJZ A;  3GUR A;  2J23 A;  2I81 A;  2V1M A;  2JU5 A;  1JHB A;  1XCC A;  5ECO B;  4ID0 A;  1IYH A;  3IK7 A;  3EU3 A;  2C0F A;  3PH9 A;  1R5A A;  4LMV A;  4TR1 A;  4Q5F A;  3F9U A;  1SK2 A;  1EP8 A;  2A4V A;  1G6Y A;  2IMD A;  2X8C A;  1GSU A;  3VPT A;  4HEA 2;  3QD9 A;  1Z6M A;  1WPI A;  2YV7 A;  3HHV A;  5IMC A;  1GSS A;  4HZ4 A;  4GST A;  3ZYW A;  3ERG A;  2PBJ A;  4WKW A;  4IKH A;  2L4C A;  4BA7 A;  2IFQ A;  4E8E A;  1FVJ A;  1OKT A;  1ZGN A;  3HVS A;  3TJJ A;  3BCI A;  1XVQ A;  4YQM A;  2LNS A;  1NHO A;  4G9H A;  1Z9H A;  2F9S A;  1B4Q A;  1G6W A;  3QAG A;  4K7I A;  2MMZ A;  3A3T A;  3IPZ A;  3NOF A;  2V6K A;  3APQ A;  1TRU A;  3DYR A;  1JZO A;  1WIK A;  2VCV A;  2VIM A;  2QGV A;  4MAB A;  2CVD A;  2B6M A;  2M72 A;  3GKM A;  3GL3 A;  3FHK A;  2DC5 A;  4ZXG A;  2PER A;  1X0R A;  4ZL9 A;  5LNK e;  3P90 A;  4P3Y B;  3DVX A;  1TDI A;  2VCT A;  3D4T A;  1K3O A;  2XC2 A;  2H66 A;  2X8H A;  1YF0 A;  2H6X A;  4I8B A;  4EF0 A;  2LJR A;  4PUR A;  4GQF A;  1FHE A;  4IQ1 A;  3K8N A;  5AIS A;  5EL8 A;  2VD1 A;  5IMF A;  1X5C A;  4MJB A;  1BAY A;  1ERU A;  5COH A;  2V41 A;  1EZK A;  4PX1 A;  1GP1 A;  3CXG A;  2FWF A;  1AIU A;  4JRR A;  4IP1 A;  4G2E A;  2VL2 A;  2WB9 A;  4N0Z A;  2CZ3 A;  2B5Y A;  2M80 A;  5G2Z A;  3UAP A;  3VUR A;  2K8S A;  1FAA A;  3BOA A;  3LXZ A;  4JE1 A;  4KSM A;  2DMM A;  4G19 A;  3TKS C;  1GLQ A;  3A2W A;  1WOU A;  4NV5 A;  4K7O A;  1ZCP A;  2FA8 A;  4IW9 A;  2EIQ A;  3IDV A;  2MBT A;  4F03 A;  5D9W A;  1AC1 A;  5B6N A;  4IJ3 A;  1NHY A;  1XBS A;  2LRN A;  4MP4 A;  3CRT A;  5JWQ B;  4FYU A;  1ML6 A;  5AIX A;  2LJK A;  5ECK B;  1E2Y A;  4H86 A;  3TKQ A;  4ZBB A;  2YZU A;  2YWM A;  3W8J A;  4IS0 A;  3QFB C;  2KHP A;  3M8N A;  4IP6 A;  1KNG A;  4HOJ A;  3BJ5 A;  2IL3 A;  3GUS A;  1XOA A;  3Q6O A;  2TIR A;  3SBC A;  4F0C A;  3FY7 A;  4IHU A;  1GNW A;  3L9V A;  1N8J A;  2ON7 A;  2PU9 C;  3AY8 A;  2JAC A;  3DIE A;  3O76 A;  1K0B A;  5L71 A;  2DIY A;  4IEL A;  1E6B A;  3FRC A;  3HYP A;  5B8B A;  2X64 A;  3N9J A;  3WGX A;  1QQ2 A;  2YOI A;  4NHW A;  4TR4 A;  3KZQ A;  2CX4 A;  1PD2 1;  1GUM A;  2LEG A;  2PPT A;  1SKW B;  2K8V A;  1TJD A;  2K6V A;  4AF2 A;  2L5O A;  1ACV A;  4GSN A;  4YH2 A;  1AXD A;  3UMA A;  2KOK A;  1KEB A;  2BMX A;  1TTZ A;  5HR0 A;  2RM6 A;  1BYE A;  5ECH B;  1YKA A;  5AIV A;  1XWK A;  4POB A;  2OE3 A;  2VL3 A;  2L57 A;  4G10 A;  1USB A;  2YWI A;  4HZ2 A;  4O92 A;  2MZC A;  2AV4 A;  3DKS A;  2YJH A;  2MMN A;  4MPG A;  1JZR A;  4ZB8 A;  1A2M A;  5D9X A;  2CAI A;  1YDK A;  3DXB A;  3TGZ A;  5FWG A;  4V2M A;  1X9W B;  1DUG A;  2H1A A;  2IME A;  2XBQ A;  1TKD B;  3VWV A;  1ERV A;  1EOH A;  12GS A;  1GTU A;  2IWT A;  5G5F A;  4MZC A;  2GST A;  5IQY A;  4LMW A;  2F3M A;  2EC4 A;  2VL9 A;  3M1G A;  2H19 A;  2QKE A;  5IO0 A;  2IN3 A;  3FZA A;  2H8L A;  3DD3 A;  1LU4 A;  5A5K A;  4MZB A;  5IOW A;  2FGX A;  2C0E A;  3P2A A;  1RW1 A;  1LBK A;  1HYU A;  3FZ4 A;  2LRT A;  4MF5 A;  2DML A;  2JL4 A;  4N30 A;  1OC9 A;  2JSY A;  3BCK A;  1SL2 B;  2NDO A;  2V6O A;  1TOF A;  4XS4 B;  1XOB A;  2KP1 A;  3G7Y A;  1MD3 A;  5A4W A;  2O89 A;  2TRX A;  2X99 A;  3EYT A;  1UA5 A;  2HZE A;  5IO2 A;  2C80 A;  2TRC P;  2B7K A;  3L9S A;  5D96 A;  4X43 A;  5EY6 A;  2E0Q A;  5F06 A;  4ACS A;  1V58 A;  3WYW A;  1EGR A;  3NZN A;  2XBI A;  1R7H A;  2WS2 A;  2VLU A;  3UIW A;  2VUP A;  1GL8 A;  1A24 A;  2YPM A;  3F4R A;  2YN1 A;  2C0G A;  4L5L A;  2HZF A;  2VCQ A;  4EXJ A;  3PR8 A;  2H01 A;  3EMP A;  4F9Z A;  3GN3 A;  1GUL A;  4KDU A;  1O8X A;  5IIZ A;  3KXO A;  1V40 A;  1ST9 A;  1SK1 A;  2WCI A;  2FLS A;  1T3B A;  3PGT A;  3LFL A;  5GAP D;  2LQO A;  2IIY A;  1R26 A;  4AGS A;  1MDI A;  3UVH A;  1Z5Y E;  4V2N A;  3IOS A;  4JZQ A;  3HJP A;  1XIY A;  2QC7 A;  2GSS A;  3V1W A;  1TK5 B;  1DE2 A;  5IMV A;  4DSS B;  3KCM A;  4FH8 A;  4HUA A;  4KE3 A;  4TOP A;  2KUC A;  1J0F A;  3TRX A;  4GRF A;  3VPQ A;  4EVM A;  3TB2 A;  1AQV A;  3GIX A;  2GDR A;  1V57 A;  3GL5 A;  2I1U A;  3KH7 A;  3LYK A;  1A2J A;  5A4V A;  2GS3 A;  5IM9 A;  2KP2 A;  4N10 A;  4Q5Q A;  7GSS A;  2H76 A;  1JLV A;  1F2E A;  1M99 A;  4POK A;  4PUA A;  4WR4 A;  1GSD A;  3I6A A;  1QXH A;  4ZB6 A;  3APO A;  4XRA A;  4GF0 A;  1SL1 B;  2GZY A;  3ME7 A;  1T4Y A;  1SD9 A;  2LS5 A;  2NVL A;  5DQY A;  4F0B A;  1ON4 A;  2I9H A;  4X0X A;  5J9B A;  3ZRD A;  4Q5N A;  1VF3 A;  3APS A;  3VI5 A;  3QAV A;  4J2F A;  3A2X A;  1ZZY A;  2LUS A;  3GNJ A;  2CA8 A;  1URM A;  2PN8 A;  2L5L A;  3F0I A;  3PIN A;  1PN9 A;  2H0G A;  3RPP A;  5AN1 A;  3ZML A;  1U6T A;  4JR4 A;  5J4U A;  4NXI A;  1X5E A;  2DJ1 A;  2CX3 A;  3VWX A;  2YWO A;  1G0T A;  2F51 A;  2ZNM A;  4MK3 A;  1ZOF A;  1W89 A;  1FO5 A;  1JLW A;  4KUN A;  3E9J B;  2OBI A;  1GRX A;  2MMO A;  2H1G A;  3F3Q A;  3A2V A;  4OMV A;  2H6Z A;  1VF1 A;  4ISD A;  1XW5 A;  1GSY A;  5JCU A;  6GSW A;  5IPG A;  3US3 A;  3TRP A;  4NMU A;  1AW9 A;  1KBN A;  4KDX A;  2KLX A;  4O32 A;  4BVX A;  3BBY A;  1TRW A;  1WWJ A;  2RUF A;  2VM2 A;  4K0G A;  1V2A A;  4HDE A;  4LLR A;  3EWL A;  2YZH A;  4DSQ A;  4PQ1 A;  3QMX A;  3LG6 A;  1AQX A;  3LXT A;  1XZO A;  4I2U A;  4K8M A;  2PWJ A;  1G7O A;  3D0Z A;  4HU9 A;  4BPY A;  2NPB A;  3WGE A;  5F07 A;  1U3I A;  5HR2 A;  2B1L A;  3UAR A;  2AUV A;  2GLR A;  4OO4 A;  1A2L A;  4J57 E;  3GST A;  3KP8 A;  2BTO T;  2CQ9 A;  3TJK A;  4NAX A;  1MEK A;  2CAQ A;  3EIN A;  2PUK C;  4ML6 A;  5J9C A;  3ME8 A;  3UBK A;  4K7N A;  1WE0 A;  3LQ7 A;  5DQS A;  3DVW A;  4N11 A;  1YF1 A;  1Y25 A;  4FO5 A;  4TR0 A;  4YAP A;  5DDL A;  4OFT A;  3ERW A;  3TKS A;  5D73 A;  3P8W A;  3C73 A;  5G30 A;  3D22 A;  3HCZ A;  3F4T A;  2H74 A;  3CSJ A;  4YQU A;  3UOM A;  3NIV A;  2E7P A;  1Z7P A;  3GRX A;  1AAZ A;  1B9X C;  4IQA A;  1GWC A;  3W8S A;  1XXU A;  2G2Q A;  3WT2 A;  2YAN A;  1SJI A;  1OVN A;  3IK9 A;  1S3C A;  1O73 A;  1OYJ A;  2DBC A;  5CO3 A;  4KX4 A;  1BG5 A;  3P7X A;  4D73 B;  3D21 A;  5G1K A;  1O8W A;  2JZT A;  5JCW A;  4MPF A;  1ILO A;  1WMJ A;  2GQL A;  4OFM A;  4BL7 A;  3D4M A;  1QK8 A;  3Q19 A;  1XWC A;  1LJR A;  2GZZ A;  2WJU A;  2XPE A;  2HYX A;  5H5R A;  5J41 A;  1X9S B;  4LA1 A;  1A0R P;  2N5F A;  1H75 A;  4MA9 A;  5GSS A;  2IMI A;  4TR3 A;  2RUE A;  3ZZX A;  2R37 A;  3CSH A;  1K0N A;  1TU7 A;  4KDY A;  1KTE A;  2CZ2 A;  4XHM A;  4ZIL A;  5HR3 A;  3IE3 A;  2JAD A;  2P31 A;  1GSQ A;  2AHE A;  2WUL A;  3F3R A;  1UC7 A;  1C72 A;  2HRN A;  1FB0 A;  4PGT A;  2C3T A;  2C1Y A;  4MF7 A;  3H4K A;  1U3A A;  1Q98 A;  4L5O A;  1EV4 A;  3GX0 A;  5LD0 A;  4OCF A;  4OWY A;  5D93 A;  5J5N A;  3CMI A;  3KIJ A;  2WDU A;  3ZLP A;  2FWE A;  4N0V A;  1K3Y A;  3CTF A;  2P5Q A;  3VK9 A;  2C0D A;  1B48 A;  2H0H A;  3CTG A;  1YZX A;  3S9F A;  3KTL A;  2PVQ A;  2HSH A;  5J3R A;  1M2A A;  3ZIV A;  2K18 A;  5G5E A;  4RQR A;  3TUE A;  5E59 A;  1PA3 A;  4JU5 A;  1GNE A;  1OE7 A;  2AAW A;  1SJ6 A;  3HXS A;  3HJM A;  1GH2 A;  5ABR A;  1K3L A;  3O6T A;  3TKS E;  16GS A;  4V2L A;  2OBK A;  1K0D A;  3F63 A;  3ZTL A;  4WBJ A;  3ZIJ A; 
#chains in the Genus database with same CATH topology
 3RPN A;  1EWX A;  5DBQ A;  5ID2 B;  1FOV A;  4FQU A;  3GTU B;  1RK4 A;  2K9F A;  5CP1 A;  4K5R A;  8GSS A;  2H70 A;  5G1L A;  4IBP A;  4QL7 A;  4DSR A;  2WFC A;  3H8Q A;  3KJY A;  1MDK A;  4MH2 A;  2OE0 A;  2C8U A;  10GS A;  1XG8 A;  4MZW A;  3F4S A;  3OR5 A;  4O7H A;  5KN3 A;  5DAL B;  1MTC A;  3I9V 2;  3F6F A;  1F3A A;  1Q4J A;  4OCE A;  1A8Y A;  3TRQ A;  1PX7 A;  1T4Z A;  2L6D A;  3TKP A;  6GSV A;  1F3B A;  3I43 A;  2EIO A;  1K0C A;  4TRX A;  4KH7 A;  3E3E A;  5G31 A;  5GZZ B;  4KW6 A;  5D8I A;  3RAZ A;  2VM1 A;  3Q74 A;  3FEU A;  2O85 A;  4EL1 A;  5F0G A;  2FWG A;  4KAE A;  4MF6 A;  6GSS A;  2DIZ A;  1ZL9 A;  1R4W A;  2GQM A;  4WXT A;  4ML1 A;  5DJL A;  2RII A;  3TJG A;  3ISO A;  2CT6 A;  1EP7 A;  4NV2 A;  2LQQ A;  2DJ2 A;  5CYY A;  1X9M B;  3EVI A;  2HI7 A;  2VLV A;  4PTS A;  1FVK A;  3MSZ A;  3UJ1 A;  3QPM A;  5FT3 A;  3J7Y k;  1N2A A;  2YNX A;  1YY7 A;  3HA9 A;  3BD2 A;  3ZL5 A;  2R4V A;  5ELA A;  3IC4 A;  4ZIJ A;  3MAK A;  1JFU A;  1PL2 A;  2WRT A;  4ZBD A;  2WGR A;  2JSZ A;  5DCG A;  4YAV A;  3QFA C;  4EE0 A;  5DJM A;  1UN2 A;  5ID2 A;  3J7Y b;  3GTU A;  2FD3 A;  2H71 A;  4ULX A;  4XS6 A;  1Z3E A;  2MMA A;  4TKY A;  4G0I A;  1XW9 A;  3GMF A;  2LJA A;  1PQN A;  4OO5 A;  5F8B A;  3TOU A;  5KOW A;  2L59 A;  1QMV A;  3E0U A;  4HQZ A;  4HJ2 A;  4NWY A;  1EGO A;  4MCU A;  4XCS A;  2GSR A;  1XVW A;  2DLX A;  2HFD A;  5DAL A;  1THO A;  2LNT A;  1TI3 A;  3QOU A;  1A0F A;  14GS A;  1Z6N A;  3FMW A;  1PKZ A;  3FR9 A;  4HU7 A;  3R2Q A;  3EPT A;  3TOT A;  3QR6 A;  3GKK A;  1YEX A;  4X4J A;  2GTU A;  2HRF A;  4TXO B;  6GSX A;  1XPV A;  4TR1 B;  4F82 A;  1BX9 A;  2GSQ A;  3KEB A;  4ZL8 A;  2UZ8 A;  4WET A;  2H6Y A;  1M2D A;  4MDC A;  2X49 A;  4OFN A;  2R3X A;  3CBU A;  1MD4 A;  4IGJ A;  5CRE A;  3LJR A;  5DAK B;  4HQS A;  5JCG A;  4J56 E;  3M3M A;  13GS A;  4GQC A;  2A2R A;  1HNC A;  2EIR A;  4XS4 A;  3ZVJ D;  3DWV A;  5ECN B;  4AJ8 A;  6GSY A;  1V9W A;  4KCA A;  2X8G A;  5CNW A;  4FYB A;  2IJY A;  4PXO A;  2HNL A;  3UVT A;  1J9B A;  4POL A;  1OKD A;  2MYG A;  3IRA A;  5KN0 A;  1ZYQ B;  1XWG A;  3C7M A;  4GSS A;  3MWH A;  4TVE A;  1YEP A;  1RQM A;  2VAF A;  1F37 A;  3ZVJ A;  3GYK A;  3LWA A;  4PQH A;  2C4J A;  4PNF A;  4AJ7 A;  3TJF A;  1VGL A;  2CV4 A;  3MIX A;  4XS1 A;  3G7I A;  2HSM A;  2M46 A;  1TXX A;  5D9V A;  4RI7 A;  2R2J A;  1AQW A;  3IAM 2;  2JZR A;  3SWL A;  3LYP A;  4TN8 A;  2O7K A;  3LSZ A;  4CW9 A;  1DBY A;  1W4V A;  3FZ9 A;  4GXZ A;  3EUR A;  5ECL B;  3IA1 A;  4EDY A;  5CRH A;  1YKC A;  1B4P A;  1O6J A;  1JZD A;  3IR4 A;  3N5O A;  4WF4 A;  5F05 A;  2N5A A;  1SKR B;  3ERF A;  3ZFL A;  5KN2 A;  2H72 A;  1OC3 A;  2CVB A;  1FG4 A;  11GS A;  3HJO A;  4KGI A;  2H0I A;  3VWU A;  1WP0 A;  1T8E B;  1TRV A;  2YV9 A;  2DJK A;  5ECI B;  2FA4 A;  2LRC A;  3VI7 A;  2L4Q A;  2HE3 A;  3HZ8 A;  4DSS A;  2GQK A;  1TU8 A;  3TCO A;  1OC8 A;  2E2G A;  2HT9 A;  5FHI A;  2A2S A;  4TXO A;  4YKF A;  1MDJ A;  5B6M A;  4K0N A;  1SU9 A;  3F6D A;  3UL3 A;  1SK0 A;  1SL0 B;  4X1U A;  3KMN A;  2H1D A;  3GHA A;  2B7J A;  4K2D A;  1SD8 A;  5DAK A;  5KEJ A;  4HI7 A;  3FKF A;  2PMT A;  4ZBA A;  2E2M A;  1UVZ A;  4WR5 A;  4MJA A;  5ECM B;  3G7J A;  5ENU A;  3WD6 A;  2YP6 A;  3IBH A;  2REM A;  3KMO A;  4KSO A;  1K0M A;  2VCW A;  4L0W A;  1TI1 A;  1O7U A;  4Q5R A;  4ZL7 A;  2HRK A;  4GWR A;  6GST A;  4MLY A;  4ILF A;  3L4N A;  2B5E A;  4RUV A;  3RBT A;  1VF4 A;  2Z9S A;  5HFI A;  4L8E A;  3ZRE A;  1V98 A;  3QDN A;  2ALB A;  4I97 A;  5GST A;  1I5G A;  2IPA A;  1S3D A;  3LGC A;  5EPF A;  5CAX A;  2B5X A;  3GSS A;  3LEF A;  3GX8 A;  3DRN A;  3UEM A;  2D2Z A;  1F6M C;  3HVV A;  3M9J A;  3KM6 A;  2GGT A;  2HSY A;  2HRA A;  1XFL A;  2GVP A;  2OE1 A;  4FIW A;  1BJX A;  3UBL A;  1GTA A;  5D9T A;  2OAC A;  3HY2 A;  1BED A;  1O81 A;  4TW5 A;  6GSU A;  3KTB A;  4V1A p;  5IPH A;  3CSI A;  2GT5 A;  3RDW A;  5IOX A;  3LOR A;  5HFK A;  2AB6 A;  4XRD A;  1G7E A;  5JWR B;  3QAW A;  5DCH A;  5IMZ A;  2H75 A;  4L0U A;  5C00 A;  3MDK A;  5A4U A;  3TJB A;  2LKU A;  1TW9 A;  2R0G A;  2FUG 2;  3IXR A;  1M9B A;  2FCH A;  4OD7 A;  3O3T A;  4ECI A;  3ZFB A;  3KGK A;  2ZUP A;  2RLI A;  2OAD A;  3CRU A;  3ED3 A;  2HLS A;  1WJK A;  1K0A A;  5JWO B;  5H5S A;  4EIP A;  5HR1 A;  3DML A;  1H4O A;  3HD5 A;  2AJQ B;  1PSQ A;  2LTK A;  4MJE A;  2XHF A;  2IMF A;  3EU4 A;  1HD2 A;  1A23 A;  4KA0 A;  4KB3 A;  4Z7X A;  3QCP A;  3TKR A;  5IMD A;  4NPB A;  3L78 A;  3C71 A;  1ZYE A;  2VL2 C;  3GV1 A;  5BMU A;  3HZ4 A;  4ECJ A;  5C04 A;  4BWQ A;  4PUF C;  1GSE A;  2R6K A;  3IHQ A;  2CVK A;  3FK8 A;  4GTU A;  4DVC A;  18GS A;  1EV9 A;  4RQX A;  1FB6 A;  1OC9 B;  5ECP B;  1YJ6 A;  3VLN A;  3GA4 A;  5ECS A;  2B3S A;  3W6G A;  2R5G A;  3M9K A;  3H1N A;  3R3E A;  3VWW A;  1XWB A;  4D73 A;  2DKI A;  2HZE B;  4TXV A;  5ECQ B;  3KH9 A;  2VD0 A;  5INY A;  2OA7 A;  1J08 A;  4JR6 A;  2OJL A;  4IJI A;  3C1S A;  3EC3 A;  1M7T A;  1U87 A;  4BVY A;  2B1K A;  4JBB A;  3JCM L;  2FY6 A;  4Z2T A;  4EIQ A;  3TDG A;  4RI6 A;  1FW1 A;  1GLP A;  1GTI A;  2F8F A;  2DJ3 A;  2I4A A;  3D5J A;  1CQG A;  3H93 A;  1M0U A;  2DJJ A;  2PGT A;  1SYX A;  2NTO A;  4A5P A;  2O8V B;  4HJM A;  3RHC A;  1K0O A;  4I5Q A;  1VF2 A;  17GS A;  3H79 A;  4MJC A;  4MMM A;  3GFK A;  1QFN A;  3GKN A;  3ZMK A;  4XIH A;  1Y6E A;  2J9H A;  1PX6 A;  4K6X A;  4EC0 A;  3IAS 2;  2FWH A;  1TK8 B;  3ZIT A;  3EE2 A;  4CDO A;  1A8L A;  3Q18 A;  3WGD A;  2ON5 A;  4XTS A;  4ECB A;  2H30 A;  5LCZ A;  1SEN A;  4QQ7 A;  4USS A;  4I2T A;  3FR6 A;  1XWA A;  2LST A;  1ZYP A;  2AYT A;  4WF5 A;  3HVN A;  4E8H A;  2DSA A;  2JZS A;  2H73 A;  1BQ7 A;  2A2P A;  2BJX A;  1ERT A;  3MNG A;  3VFI A;  3C1R A;  3FZ5 A;  1PMT A;  19GS A;  2V2G A;  2YWN A;  2DJ0 A;  3CYN A;  4IVF A;  1OE8 A;  22GS A;  4YQV A;  2HXK A;  2QA2 A;  20GS A;  1Z7R A;  4ECC A;  1TK0 B;  5EVO A;  2VO4 A;  2IMK A;  2P0G A;  4EO3 A;  1GUH A;  2F8A A;  1DSB A;  4AJ6 A;  3M0F A;  3RHB A;  4WBR D;  1FOH A;  3F8U A;  1WRY A;  3U6V A;  4QL9 A;  2FNO A;  3HVX A;  4MH3 A;  3KD0 A;  1T1V A;  4K5S A;  5HQP A;  1EEM A;  3L0H A;  1JZW A;  3DEX A;  1AUC A;  2N5B A;  4PQI A;  4EUY A;  5KOX A;  4K9Z A;  3D6I A;  3C8E A;  2GZP A;  1NW2 A;  1ZMA A;  1ERW A;  4KCE A;  2O87 A;  3HKR A;  2RM5 A;  1IYI A;  1B8X A;  2ZCT A;  5CRD A;  2XPD A;  3GH9 A;  4KND A;  1SYR A;  4O5R A;  2C3N A;  1EOG A;  1HQO A;  2VCZ A;  1PRX A;  4DEJ A;  2QSI A;  1T00 A;  3DGQ A;  2L6C A;  2NBS A;  3EMX A;  1QGV A;  4LL4 B;  4IN0 A;  1TRS A;  2LV3 A;  5ELG A;  2MBS A;  1F9M A;  4NHZ A;  1HNA A;  3I69 A;  2G0F A;  5HFG A;  4BVX B;  4BWS A;  2H1B A;  3FW2 A;  4K1F A;  1NM3 A;  1DE1 A;  1GSF A;  4I6X A;  2P5R A;  2VLT A;  3GKX A;  4WEY A;  5B7C A;  3L9U A;  3GH6 A;  1GTB A;  2IFQ B;  2VOC A;  2VCX A;  4ZB9 A;  2FHE A;  3IV4 A;  5CRG A;  4EDZ A;  3G9B A;  4YKG A;  4LL1 B;  2C3Q A;  5BRT A;  3WT1 A;  1EEJ A;  1HNB A;  4GLT A;  3KP9 A;  3U5R E;  1R5P A;  5DVB A;  1THX A;  4PNG A;  1TP9 A;  2ES7 A;  1U88 A;  1PL1 A;  4GCI A;  9GSS A;  3FR3 A;  2WZ9 A;  4POM A;  1M9A A;  1X5D A;  1SKS B;  1ABA A;  4CHS A;  1I9D A;  1PGT A;  5E4W A;  4V1A g;  5B8A A;  4EKZ A;  2YJ7 A;  4JED A;  1S3A A;  3FYG A;  2GT6 A;  5ECR B;  2PVO C;  5GAN D;  4F2I A;  5KN1 A;  1O85 A;  2I3Y A;  1B9Y C;  4FYC A;  1M3I A;  1QUW A;  5AGY A;  5H5Q A;  1CQH A;  3HDC A;  1T7P B;  3LW9 A;  2YCD A;  4HS1 A;  1OAZ A;  1GUK A;  1NSW A;  3A5W A;  1XW6 A;  1VRS D;  5IMA A;  2OKA A;  1M2B A;  5CRW A;  1YQ1 A;  1PKW A;  2V32 A;  1SJZ A;  3GUR A;  2J23 A;  2I81 A;  2V1M A;  2JU5 A;  4Z2R A;  1JHB A;  1XCC A;  5ECO B;  4ID0 A;  1IYH A;  3IK7 A;  3EU3 A;  2C0F A;  3PH9 A;  1R5A A;  4LMV A;  4TR1 A;  4Q5F A;  3F9U A;  1SK2 A;  1EP8 A;  2A4V A;  1G6Y A;  2IMD A;  2X8C A;  1GSU A;  3VPT A;  4HEA 2;  3QD9 A;  1Z6M A;  1WPI A;  2YV7 A;  3HHV A;  5IMC A;  1GSS A;  4HZ4 A;  4GST A;  3ZYW A;  3ERG A;  2PBJ A;  4WKW A;  4O5U A;  4IKH A;  2L4C A;  4BA7 A;  2IFQ A;  4E8E A;  1FVJ A;  1OKT A;  1ZGN A;  3HVS A;  3TJJ A;  3BCI A;  1XVQ A;  4YQM A;  2LNS A;  1NHO A;  4G9H A;  1Z9H A;  2F9S A;  1B4Q A;  1G6W A;  3QAG A;  4K7I A;  2MMZ A;  3A3T A;  3IPZ A;  4G0L A;  3NOF A;  2V6K A;  3APQ A;  1TRU A;  3DYR A;  1JZO A;  1WIK A;  2VCV A;  2VIM A;  2QGV A;  4MAB A;  2CVD A;  2B6M A;  2M72 A;  3GKM A;  3GL3 A;  3FHK A;  2DC5 A;  4ZXG A;  2PER A;  1X0R A;  4ZL9 A;  5LNK e;  3P90 A;  4P3Y B;  3DVX A;  1TDI A;  2VCT A;  3D4T A;  1K3O A;  2XC2 A;  2H66 A;  2X8H A;  1YF0 A;  2H6X A;  4I8B A;  4EF0 A;  2LJR A;  4PUR A;  4GQF A;  1FHE A;  4IQ1 A;  3K8N A;  5AIS A;  5EL8 A;  2VD1 A;  5IMF A;  1X5C A;  4MJB A;  1BAY A;  1ERU A;  5COH A;  2V41 A;  1EZK A;  4PX1 A;  1GP1 A;  3CXG A;  2FWF A;  1AIU A;  4JRR A;  4IP1 A;  4G2E A;  2VL2 A;  2WB9 A;  4N0Z A;  2CZ3 A;  2B5Y A;  2M80 A;  5G2Z A;  3UAP A;  3VUR A;  2K8S A;  1FAA A;  3BOA A;  3LXZ A;  4JE1 A;  4KSM A;  2DMM A;  4G19 A;  3TKS C;  1GLQ A;  3A2W A;  1WOU A;  4NV5 A;  4K7O A;  1ZCP A;  2FA8 A;  4IW9 A;  2EIQ A;  3IDV A;  2MBT A;  4F03 A;  5D9W A;  1AC1 A;  5B6N A;  4IJ3 A;  1NHY A;  1XBS A;  2LRN A;  4MP4 A;  3CRT A;  5JWQ B;  4FYU A;  1ML6 A;  5AIX A;  2LJK A;  4HSC X;  5ECK B;  1E2Y A;  4H86 A;  3TKQ A;  4ZBB A;  2YZU A;  2YWM A;  3W8J A;  4IS0 A;  3QFB C;  4IP6 A;  2KHP A;  3M8N A;  1KNG A;  1ZYN A;  4HOJ A;  3BJ5 A;  2IL3 A;  3GUS A;  1XOA A;  3Q6O A;  3IHG A;  2TIR A;  2R0P A;  3SBC A;  2X4A A;  4F0C A;  3FY7 A;  4IHU A;  1GNW A;  3L9V A;  1N8J A;  2ON7 A;  2PU9 C;  3AY8 A;  2JAC A;  3DIE A;  4KF9 A;  3O76 A;  1K0B A;  5L71 A;  2DIY A;  4IEL A;  1E6B A;  3FRC A;  3HYP A;  5B8B A;  2X64 A;  2DKH A;  3N9J A;  3WGX A;  1QQ2 A;  2YOI A;  4NHW A;  4MNN A;  4TR4 A;  3KZQ A;  2CX4 A;  1PD2 1;  1GUM A;  2LEG A;  2PPT A;  1SKW B;  2K8V A;  1TJD A;  2K6V A;  4AF2 A;  2L5O A;  1ACV A;  4GSN A;  4YH2 A;  1AXD A;  3UMA A;  2KOK A;  1KEB A;  2BMX A;  1TTZ A;  1S3R A;  5HR0 A;  2RM6 A;  1BYE A;  5ECH B;  1YKA A;  5AIV A;  1XWK A;  4POB A;  2OE3 A;  2VL3 A;  2L57 A;  4G10 A;  1USB A;  2YWI A;  2A4H A;  4HZ2 A;  4O92 A;  2MZC A;  2AV4 A;  3DKS A;  2YJH A;  2MMN A;  4MPG A;  1JZR A;  4ZB8 A;  1A2M A;  5D9X A;  4O5Q A;  2CAI A;  1YDK A;  3DXB A;  3TGZ A;  5FWG A;  4V2M A;  1X9W B;  1DUG A;  2H1A A;  2IME A;  2XBQ A;  1TKD B;  3VWV A;  1ERV A;  1EOH A;  12GS A;  1GTU A;  2IWT A;  5G5F A;  4MZC A;  3CQF A;  2GST A;  5IQY A;  4LMW A;  2F3M A;  2EC4 A;  2VL9 A;  3M1G A;  2H19 A;  2QKE A;  5IO0 A;  2IN3 A;  3FZA A;  2H8L A;  3DD3 A;  1LU4 A;  5A5K A;  4MZB A;  3IC8 A;  5IOW A;  2FGX A;  2C0E A;  3P2A A;  1RW1 A;  1LBK A;  1HYU A;  3FZ4 A;  2LRT A;  4MF5 A;  2DML A;  2JL4 A;  4N30 A;  4G0K A;  1OC9 A;  2JSY A;  3BCK A;  1SL2 B;  3MYD A;  2NDO A;  2V6O A;  1TOF A;  4XS4 B;  1XOB A;  2KP1 A;  3G7Y A;  1MD3 A;  5A4W A;  2O89 A;  2TRX A;  2X99 A;  3EYT A;  1UA5 A;  3PPU A;  2HZE A;  5IO2 A;  2C80 A;  2TRC P;  2B7K A;  3L9S A;  5D96 A;  4X43 A;  5EY6 A;  2E0Q A;  5F06 A;  4ACS A;  1V58 A;  3WYW A;  1EGR A;  3NZN A;  2XBI A;  1R7H A;  2WS2 A;  2VLU A;  3UIW A;  2VUP A;  1GL8 A;  1A24 A;  2YPM A;  3F4R A;  2YN1 A;  2C0G A;  4L5L A;  2HZF A;  2VCQ A;  4EXJ A;  3PR8 A;  2H01 A;  3EMP A;  4F9Z A;  3GN3 A;  4ICY A;  1GUL A;  4KDU A;  1O8X A;  5IIZ A;  3KXO A;  1V40 A;  1ST9 A;  1SK1 A;  2WCI A;  2FLS A;  1T3B A;  3PGT A;  4BIK A;  3LFL A;  5GAP D;  2LQO A;  2IIY A;  1R26 A;  4AGS A;  1MDI A;  3UVH A;  1Z5Y E;  4V2N A;  3IOS A;  4JZQ A;  3HJP A;  1XIY A;  2QC7 A;  2GSS A;  3V1W A;  1TK5 B;  1DE2 A;  5IMV A;  4DSS B;  3KCM A;  4FH8 A;  4HUA A;  4KE3 A;  4TOP A;  2KUC A;  1J0F A;  3TRX A;  4GRF A;  3VPQ A;  4EVM A;  3TB2 A;  1AQV A;  3GIX A;  2GDR A;  1V57 A;  3GL5 A;  2I1U A;  3KH7 A;  3LYK A;  1A2J A;  5A4V A;  2GS3 A;  5IM9 A;  2KP2 A;  4N10 A;  4Z2U A;  4Q5Q A;  7GSS A;  2H76 A;  1JLV A;  1F2E A;  1M99 A;  4POK A;  4PUA A;  4WR4 A;  1GSD A;  3I6A A;  1QXH A;  4ZB6 A;  3APO A;  4XRA A;  4GF0 A;  1SL1 B;  2GZY A;  3ME7 A;  1T4Y A;  1SD9 A;  2LS5 A;  2NVL A;  5DQY A;  4F0B A;  1ON4 A;  2I9H A;  4X0X A;  5J9B A;  3ZRD A;  4Q5N A;  1VF3 A;  3APS A;  3VI5 A;  3QAV A;  4J2F A;  3A2X A;  1ZZY A;  2LUS A;  3GNJ A;  2CA8 A;  1URM A;  2PN8 A;  2L5L A;  3F0I A;  3PIN A;  1PN9 A;  2H0G A;  3RPP A;  5AN1 A;  3ZML A;  1U6T A;  4JR4 A;  5J4U A;  4NXI A;  1X5E A;  2DJ1 A;  2CX3 A;  3VWX A;  4K2X A;  2YWO A;  1G0T A;  2F51 A;  2ZNM A;  4MK3 A;  1ZOF A;  4BL7 B;  1W89 A;  1FO5 A;  1JLW A;  4KUN A;  3E9J B;  2OBI A;  1GRX A;  2MMO A;  2H1G A;  3F3Q A;  2QA1 A;  3A2V A;  4OMV A;  2H6Z A;  1VF1 A;  4ISD A;  1XW5 A;  1GSY A;  5JCU A;  6GSW A;  5IPG A;  3US3 A;  3TRP A;  4NMU A;  1PN0 A;  1AW9 A;  1KBN A;  4KDX A;  2KLX A;  4O32 A;  4BVX A;  3BBY A;  1TRW A;  1WWJ A;  2RUF A;  2VM2 A;  4K0G A;  1V2A A;  4HDE A;  4LLR A;  3EWL A;  2YZH A;  4DSQ A;  4PQ1 A;  3QMX A;  3LG6 A;  1AQX A;  3LXT A;  1XZO A;  4I2U A;  4K8M A;  2PWJ A;  1G7O A;  3D0Z A;  4HU9 A;  4BPY A;  2NPB A;  3WGE A;  5F07 A;  1U3I A;  5HR2 A;  2B1L A;  3UAR A;  2AUV A;  2GLR A;  4OO4 A;  1A2L A;  4J57 E;  3GST A;  3KP8 A;  2BTO T;  2CQ9 A;  3TJK A;  4NAX A;  1MEK A;  2CAQ A;  3EIN A;  2PUK C;  4ML6 A;  5J9C A;  3ME8 A;  3UBK A;  4K7N A;  1WE0 A;  3LQ7 A;  5DQS A;  3DVW A;  4N11 A;  1YF1 A;  1Y25 A;  4FO5 A;  4TR0 A;  4YAP A;  5DDL A;  4OFT A;  3ERW A;  3TKS A;  5D73 A;  3P8W A;  3C73 A;  5G30 A;  3D22 A;  3HCZ A;  3F4T A;  2H74 A;  3CSJ A;  4YQU A;  3UOM A;  3NIV A;  2E7P A;  1Z7P A;  3GRX A;  1AAZ A;  1B9X C;  4IQA A;  1GWC A;  3W8S A;  1XXU A;  2G2Q A;  3WT2 A;  2YAN A;  1SJI A;  1OVN A;  3IK9 A;  1S3C A;  1O73 A;  1OYJ A;  2DBC A;  5CO3 A;  4KX4 A;  1BG5 A;  3P7X A;  4D73 B;  3D21 A;  5G1K A;  1O8W A;  2JZT A;  5JCW A;  4MPF A;  1ILO A;  1WMJ A;  2GQL A;  4OFM A;  4BL7 A;  3D4M A;  1QK8 A;  3Q19 A;  1XWC A;  1LJR A;  4BVY B;  2GZZ A;  2WJU A;  2XPE A;  2HYX A;  5H5R A;  5J41 A;  1X9S B;  4LA1 A;  1A0R P;  2N5F A;  1H75 A;  4MA9 A;  5GSS A;  2IMI A;  4TR3 A;  2RUE A;  3ZZX A;  2R37 A;  3CSH A;  1M3J A;  1K0N A;  1TU7 A;  4KDY A;  1KTE A;  2CZ2 A;  4XHM A;  4ZIL A;  5HR3 A;  3IE3 A;  2JAD A;  4CY6 A;  2P31 A;  1GSQ A;  2AHE A;  2WUL A;  3F3R A;  1UC7 A;  1C72 A;  2HRN A;  1FB0 A;  4PGT A;  2C3T A;  2C1Y A;  4MF7 A;  3H4K A;  1U3A A;  1Q98 A;  4L5O A;  1EV4 A;  3GX0 A;  5LD0 A;  1PFO A;  4OCF A;  4OWY A;  5D93 A;  5J5N A;  3CMI A;  3KIJ A;  2WDU A;  3ZLP A;  2FWE A;  4N0V A;  1K3Y A;  3CTF A;  2P5Q A;  3VK9 A;  2C0D A;  1B48 A;  2H0H A;  3CTG A;  1YZX A;  3S9F A;  4CY8 A;  3KTL A;  2PVQ A;  2HSH A;  5J3R A;  1M2A A;  3ZIV A;  2K18 A;  2R0C A;  5G5E A;  4RQR A;  3TUE A;  5E59 A;  1PA3 A;  4JU5 A;  1GNE A;  1OE7 A;  2AAW A;  1SJ6 A;  3HXS A;  3HJM A;  1GH2 A;  5ABR A;  1K3L A;  3O6T A;  3TKS E;  16GS A;  4V2L A;  2OBK A;  1K0D A;  3F63 A;  3ZTL A;  3A5I A;  4WBJ A;  3ZIJ A; 
#chains in the Genus database with same CATH homology
 3RPN A;  1EWX A;  5DBQ A;  5ID2 B;  1FOV A;  4FQU A;  3GTU B;  1RK4 A;  2K9F A;  5CP1 A;  4K5R A;  8GSS A;  2H70 A;  5G1L A;  4IBP A;  4QL7 A;  4DSR A;  2WFC A;  3H8Q A;  3KJY A;  1MDK A;  4MH2 A;  2OE0 A;  2C8U A;  10GS A;  4MZW A;  3F4S A;  3OR5 A;  4O7H A;  5KN3 A;  5DAL B;  1MTC A;  3I9V 2;  3F6F A;  1F3A A;  1Q4J A;  4OCE A;  1A8Y A;  3TRQ A;  1PX7 A;  1T4Z A;  2L6D A;  3TKP A;  6GSV A;  1F3B A;  3I43 A;  2EIO A;  1K0C A;  4TRX A;  4KH7 A;  3E3E A;  5G31 A;  5GZZ B;  4KW6 A;  5D8I A;  3RAZ A;  2VM1 A;  3Q74 A;  3FEU A;  2O85 A;  4EL1 A;  5F0G A;  2FWG A;  4KAE A;  4MF6 A;  6GSS A;  2DIZ A;  1ZL9 A;  1R4W A;  2GQM A;  4WXT A;  4ML1 A;  5DJL A;  2RII A;  3TJG A;  3ISO A;  2CT6 A;  1EP7 A;  4NV2 A;  2LQQ A;  2DJ2 A;  5CYY A;  1X9M B;  3EVI A;  2HI7 A;  2VLV A;  4PTS A;  1FVK A;  3MSZ A;  3UJ1 A;  3QPM A;  5FT3 A;  3J7Y k;  1N2A A;  2YNX A;  1YY7 A;  3HA9 A;  3BD2 A;  3ZL5 A;  2R4V A;  5ELA A;  3IC4 A;  4ZIJ A;  3MAK A;  1JFU A;  1PL2 A;  2WRT A;  4ZBD A;  2WGR A;  2JSZ A;  5DCG A;  4YAV A;  3QFA C;  4EE0 A;  5DJM A;  1UN2 A;  5ID2 A;  3J7Y b;  3GTU A;  2FD3 A;  2H71 A;  4ULX A;  4XS6 A;  1Z3E A;  2MMA A;  4TKY A;  4G0I A;  1XW9 A;  3GMF A;  2LJA A;  1PQN A;  4OO5 A;  5F8B A;  3TOU A;  5KOW A;  2L59 A;  1QMV A;  3E0U A;  4HQZ A;  4HJ2 A;  4NWY A;  1EGO A;  4MCU A;  4XCS A;  2GSR A;  1XVW A;  2DLX A;  2HFD A;  5DAL A;  1THO A;  2LNT A;  1TI3 A;  3QOU A;  1A0F A;  14GS A;  1Z6N A;  3FMW A;  1PKZ A;  3FR9 A;  4HU7 A;  3R2Q A;  3EPT A;  3TOT A;  3QR6 A;  3GKK A;  1YEX A;  4X4J A;  2GTU A;  2HRF A;  4TXO B;  6GSX A;  1XPV A;  4TR1 B;  4F82 A;  1BX9 A;  2GSQ A;  3KEB A;  4ZL8 A;  2UZ8 A;  4WET A;  2H6Y A;  1M2D A;  4MDC A;  2X49 A;  4OFN A;  2R3X A;  3CBU A;  1MD4 A;  4IGJ A;  5CRE A;  3LJR A;  5DAK B;  4HQS A;  5JCG A;  4J56 E;  3M3M A;  13GS A;  4GQC A;  2A2R A;  1HNC A;  2EIR A;  4XS4 A;  3ZVJ D;  3DWV A;  5ECN B;  4AJ8 A;  6GSY A;  1V9W A;  4KCA A;  2X8G A;  5CNW A;  4FYB A;  2IJY A;  4PXO A;  2HNL A;  3UVT A;  1J9B A;  4POL A;  1OKD A;  2MYG A;  3IRA A;  5KN0 A;  1ZYQ B;  1XWG A;  3C7M A;  4GSS A;  3MWH A;  4TVE A;  1YEP A;  1RQM A;  2VAF A;  1F37 A;  3ZVJ A;  3GYK A;  3LWA A;  4PQH A;  2C4J A;  4PNF A;  4AJ7 A;  3TJF A;  1VGL A;  2CV4 A;  3MIX A;  4XS1 A;  3G7I A;  2HSM A;  2M46 A;  1TXX A;  5D9V A;  4RI7 A;  2R2J A;  1AQW A;  3IAM 2;  2JZR A;  3SWL A;  3LYP A;  4TN8 A;  2O7K A;  3LSZ A;  4CW9 A;  1DBY A;  1W4V A;  3FZ9 A;  4GXZ A;  3EUR A;  5ECL B;  3IA1 A;  4EDY A;  5CRH A;  1YKC A;  1B4P A;  1O6J A;  1JZD A;  3IR4 A;  3N5O A;  4WF4 A;  5F05 A;  2N5A A;  1SKR B;  3ERF A;  3ZFL A;  5KN2 A;  2H72 A;  1OC3 A;  2CVB A;  1FG4 A;  11GS A;  3HJO A;  4KGI A;  2H0I A;  3VWU A;  1WP0 A;  1T8E B;  1TRV A;  2YV9 A;  2DJK A;  5ECI B;  2FA4 A;  2LRC A;  3VI7 A;  2L4Q A;  2HE3 A;  3HZ8 A;  4DSS A;  2GQK A;  1TU8 A;  3TCO A;  1OC8 A;  2E2G A;  2HT9 A;  5FHI A;  2A2S A;  4TXO A;  4YKF A;  1MDJ A;  5B6M A;  4K0N A;  1SU9 A;  3F6D A;  3UL3 A;  1SK0 A;  1SL0 B;  4X1U A;  3KMN A;  2H1D A;  3GHA A;  2B7J A;  4K2D A;  1SD8 A;  5DAK A;  5KEJ A;  4HI7 A;  3FKF A;  2PMT A;  4ZBA A;  2E2M A;  1UVZ A;  4WR5 A;  4MJA A;  5ECM B;  3G7J A;  5ENU A;  3WD6 A;  2YP6 A;  3IBH A;  2REM A;  3KMO A;  4KSO A;  1K0M A;  2VCW A;  4L0W A;  1TI1 A;  1O7U A;  4Q5R A;  4ZL7 A;  2HRK A;  4GWR A;  6GST A;  4MLY A;  4ILF A;  3L4N A;  2B5E A;  4RUV A;  3RBT A;  1VF4 A;  2Z9S A;  5HFI A;  4L8E A;  3ZRE A;  1V98 A;  3QDN A;  2ALB A;  4I97 A;  5GST A;  1I5G A;  2IPA A;  1S3D A;  3LGC A;  5EPF A;  5CAX A;  2B5X A;  3GSS A;  3LEF A;  3GX8 A;  3DRN A;  3UEM A;  2D2Z A;  1F6M C;  3HVV A;  3M9J A;  3KM6 A;  2GGT A;  2HSY A;  2HRA A;  1XFL A;  2GVP A;  2OE1 A;  4FIW A;  1BJX A;  3UBL A;  1GTA A;  5D9T A;  2OAC A;  3HY2 A;  1BED A;  1O81 A;  4TW5 A;  6GSU A;  3KTB A;  4V1A p;  5IPH A;  3CSI A;  2GT5 A;  3RDW A;  5IOX A;  3LOR A;  5HFK A;  2AB6 A;  4XRD A;  1G7E A;  5JWR B;  3QAW A;  5DCH A;  5IMZ A;  2H75 A;  4L0U A;  5C00 A;  3MDK A;  5A4U A;  3TJB A;  2LKU A;  1TW9 A;  2R0G A;  2FUG 2;  3IXR A;  1M9B A;  2FCH A;  4OD7 A;  3O3T A;  4ECI A;  3ZFB A;  3KGK A;  2ZUP A;  2RLI A;  2OAD A;  3CRU A;  3ED3 A;  2HLS A;  1WJK A;  1K0A A;  5JWO B;  5H5S A;  4EIP A;  5HR1 A;  3DML A;  1H4O A;  3HD5 A;  2AJQ B;  1PSQ A;  2LTK A;  4MJE A;  2XHF A;  2IMF A;  3EU4 A;  1HD2 A;  1A23 A;  4KA0 A;  4KB3 A;  4Z7X A;  3QCP A;  3TKR A;  5IMD A;  4NPB A;  3L78 A;  3C71 A;  1ZYE A;  2VL2 C;  3GV1 A;  5BMU A;  3HZ4 A;  4ECJ A;  5C04 A;  4BWQ A;  4PUF C;  1GSE A;  2R6K A;  3IHQ A;  2CVK A;  3FK8 A;  4GTU A;  4DVC A;  18GS A;  1EV9 A;  4RQX A;  1FB6 A;  1OC9 B;  5ECP B;  1YJ6 A;  3VLN A;  3GA4 A;  5ECS A;  2B3S A;  3W6G A;  2R5G A;  3M9K A;  3H1N A;  3R3E A;  3VWW A;  1XWB A;  4D73 A;  2DKI A;  2HZE B;  4TXV A;  5ECQ B;  3KH9 A;  2VD0 A;  5INY A;  2OA7 A;  1J08 A;  4JR6 A;  2OJL A;  4IJI A;  3C1S A;  3EC3 A;  1M7T A;  1U87 A;  4BVY A;  2B1K A;  4JBB A;  3JCM L;  2FY6 A;  4Z2T A;  4EIQ A;  3TDG A;  4RI6 A;  1FW1 A;  1GLP A;  1GTI A;  2F8F A;  2DJ3 A;  2I4A A;  3D5J A;  1CQG A;  3H93 A;  1M0U A;  2DJJ A;  2PGT A;  1SYX A;  2NTO A;  4A5P A;  2O8V B;  4HJM A;  3RHC A;  1K0O A;  4I5Q A;  1VF2 A;  17GS A;  3H79 A;  4MJC A;  4MMM A;  3GFK A;  1QFN A;  3GKN A;  3ZMK A;  4XIH A;  1Y6E A;  2J9H A;  1PX6 A;  4K6X A;  4EC0 A;  3IAS 2;  2FWH A;  1TK8 B;  3ZIT A;  3EE2 A;  4CDO A;  1A8L A;  3Q18 A;  3WGD A;  2ON5 A;  4XTS A;  4ECB A;  2H30 A;  5LCZ A;  1SEN A;  4QQ7 A;  4USS A;  4I2T A;  3FR6 A;  1XWA A;  2LST A;  1ZYP A;  2AYT A;  4WF5 A;  4E8H A;  2DSA A;  2JZS A;  2H73 A;  1BQ7 A;  2A2P A;  2BJX A;  1ERT A;  3MNG A;  3VFI A;  3C1R A;  3FZ5 A;  1PMT A;  19GS A;  2V2G A;  2YWN A;  2DJ0 A;  3CYN A;  4IVF A;  1OE8 A;  22GS A;  4YQV A;  2HXK A;  2QA2 A;  20GS A;  1Z7R A;  4ECC A;  1TK0 B;  5EVO A;  2VO4 A;  2IMK A;  2P0G A;  4EO3 A;  1GUH A;  2F8A A;  1DSB A;  4AJ6 A;  3M0F A;  3RHB A;  4WBR D;  1FOH A;  3F8U A;  1WRY A;  3U6V A;  4QL9 A;  2FNO A;  3HVX A;  4MH3 A;  3KD0 A;  1T1V A;  4K5S A;  5HQP A;  1EEM A;  3L0H A;  1JZW A;  3DEX A;  1AUC A;  2N5B A;  4PQI A;  4EUY A;  5KOX A;  4K9Z A;  3D6I A;  3C8E A;  2GZP A;  1NW2 A;  1ZMA A;  1ERW A;  4KCE A;  2O87 A;  3HKR A;  2RM5 A;  1IYI A;  1B8X A;  2ZCT A;  5CRD A;  2XPD A;  3GH9 A;  4KND A;  1SYR A;  4O5R A;  2C3N A;  1EOG A;  1HQO A;  2VCZ A;  1PRX A;  4DEJ A;  2QSI A;  1T00 A;  3DGQ A;  2L6C A;  2NBS A;  3EMX A;  1QGV A;  4LL4 B;  4IN0 A;  1TRS A;  2LV3 A;  5ELG A;  2MBS A;  1F9M A;  4NHZ A;  1HNA A;  3I69 A;  2G0F A;  5HFG A;  4BVX B;  4BWS A;  2H1B A;  3FW2 A;  4K1F A;  1NM3 A;  1DE1 A;  1GSF A;  4I6X A;  2P5R A;  2VLT A;  3GKX A;  4WEY A;  5B7C A;  3L9U A;  3GH6 A;  1GTB A;  2IFQ B;  2VOC A;  2VCX A;  4ZB9 A;  2FHE A;  3IV4 A;  5CRG A;  4EDZ A;  3G9B A;  4YKG A;  4LL1 B;  2C3Q A;  5BRT A;  3WT1 A;  1EEJ A;  1HNB A;  4GLT A;  3KP9 A;  3U5R E;  1R5P A;  5DVB A;  1THX A;  4PNG A;  1TP9 A;  2ES7 A;  1U88 A;  1PL1 A;  4GCI A;  9GSS A;  3FR3 A;  2WZ9 A;  4POM A;  1M9A A;  1X5D A;  1SKS B;  1ABA A;  4CHS A;  1I9D A;  1PGT A;  5E4W A;  4V1A g;  5B8A A;  4EKZ A;  2YJ7 A;  4JED A;  1S3A A;  3FYG A;  2GT6 A;  5ECR B;  2PVO C;  5GAN D;  4F2I A;  5KN1 A;  1O85 A;  2I3Y A;  1B9Y C;  4FYC A;  1QUW A;  5AGY A;  5H5Q A;  1CQH A;  3HDC A;  1T7P B;  3LW9 A;  2YCD A;  4HS1 A;  1OAZ A;  1GUK A;  1NSW A;  3A5W A;  1XW6 A;  1VRS D;  5IMA A;  2OKA A;  1M2B A;  5CRW A;  1YQ1 A;  1PKW A;  2V32 A;  1SJZ A;  3GUR A;  2J23 A;  2I81 A;  2V1M A;  2JU5 A;  4Z2R A;  1JHB A;  1XCC A;  5ECO B;  4ID0 A;  1IYH A;  3IK7 A;  3EU3 A;  2C0F A;  3PH9 A;  1R5A A;  4LMV A;  4TR1 A;  4Q5F A;  3F9U A;  1SK2 A;  1EP8 A;  2A4V A;  1G6Y A;  2IMD A;  2X8C A;  1GSU A;  3VPT A;  4HEA 2;  3QD9 A;  1Z6M A;  1WPI A;  2YV7 A;  3HHV A;  5IMC A;  1GSS A;  4HZ4 A;  4GST A;  3ZYW A;  3ERG A;  2PBJ A;  4WKW A;  4O5U A;  4IKH A;  2L4C A;  4BA7 A;  2IFQ A;  4E8E A;  1FVJ A;  1OKT A;  1ZGN A;  3HVS A;  3TJJ A;  3BCI A;  1XVQ A;  4YQM A;  2LNS A;  1NHO A;  4G9H A;  1Z9H A;  2F9S A;  1B4Q A;  1G6W A;  3QAG A;  4K7I A;  2MMZ A;  3A3T A;  3IPZ A;  4G0L A;  3NOF A;  2V6K A;  3APQ A;  1TRU A;  3DYR A;  1JZO A;  1WIK A;  2VCV A;  2VIM A;  2QGV A;  4MAB A;  2CVD A;  2B6M A;  2M72 A;  3GKM A;  3GL3 A;  3FHK A;  2DC5 A;  4ZXG A;  2PER A;  1X0R A;  4ZL9 A;  5LNK e;  3P90 A;  4P3Y B;  3DVX A;  1TDI A;  2VCT A;  3D4T A;  1K3O A;  2XC2 A;  2H66 A;  2X8H A;  1YF0 A;  2H6X A;  4I8B A;  4EF0 A;  2LJR A;  4PUR A;  4GQF A;  1FHE A;  4IQ1 A;  3K8N A;  5AIS A;  5EL8 A;  2VD1 A;  5IMF A;  1X5C A;  4MJB A;  1BAY A;  1ERU A;  5COH A;  2V41 A;  1EZK A;  4PX1 A;  1GP1 A;  3CXG A;  2FWF A;  1AIU A;  4JRR A;  4IP1 A;  4G2E A;  2VL2 A;  2WB9 A;  4N0Z A;  2CZ3 A;  2B5Y A;  2M80 A;  5G2Z A;  3UAP A;  3VUR A;  2K8S A;  1FAA A;  3BOA A;  3LXZ A;  4JE1 A;  4KSM A;  2DMM A;  4G19 A;  3TKS C;  1GLQ A;  3A2W A;  1WOU A;  4NV5 A;  4K7O A;  1ZCP A;  2FA8 A;  4IW9 A;  2EIQ A;  3IDV A;  2MBT A;  4F03 A;  5D9W A;  1AC1 A;  5B6N A;  4IJ3 A;  1NHY A;  1XBS A;  2LRN A;  4MP4 A;  3CRT A;  5JWQ B;  4FYU A;  1ML6 A;  5AIX A;  2LJK A;  5ECK B;  1E2Y A;  4H86 A;  3TKQ A;  4ZBB A;  2YZU A;  2YWM A;  3W8J A;  4IS0 A;  3QFB C;  4IP6 A;  2KHP A;  3M8N A;  1KNG A;  1ZYN A;  4HOJ A;  3BJ5 A;  2IL3 A;  3GUS A;  1XOA A;  3Q6O A;  3IHG A;  2TIR A;  2R0P A;  3SBC A;  2X4A A;  4F0C A;  3FY7 A;  4IHU A;  1GNW A;  3L9V A;  1N8J A;  2ON7 A;  2PU9 C;  3AY8 A;  2JAC A;  3DIE A;  4KF9 A;  3O76 A;  1K0B A;  5L71 A;  2DIY A;  4IEL A;  1E6B A;  3FRC A;  3HYP A;  5B8B A;  2X64 A;  2DKH A;  3N9J A;  3WGX A;  1QQ2 A;  2YOI A;  4NHW A;  4MNN A;  4TR4 A;  3KZQ A;  2CX4 A;  1PD2 1;  1GUM A;  2LEG A;  2PPT A;  1SKW B;  2K8V A;  1TJD A;  2K6V A;  4AF2 A;  2L5O A;  1ACV A;  4GSN A;  4YH2 A;  1AXD A;  3UMA A;  2KOK A;  1KEB A;  2BMX A;  1TTZ A;  5HR0 A;  2RM6 A;  1BYE A;  5ECH B;  1YKA A;  5AIV A;  1XWK A;  4POB A;  2OE3 A;  2VL3 A;  2L57 A;  4G10 A;  1USB A;  2YWI A;  2A4H A;  4HZ2 A;  4O92 A;  2MZC A;  2AV4 A;  3DKS A;  2YJH A;  2MMN A;  4MPG A;  1JZR A;  4ZB8 A;  1A2M A;  5D9X A;  4O5Q A;  2CAI A;  1YDK A;  3DXB A;  3TGZ A;  5FWG A;  4V2M A;  1X9W B;  1DUG A;  2H1A A;  2IME A;  2XBQ A;  1TKD B;  3VWV A;  1ERV A;  1EOH A;  12GS A;  1GTU A;  2IWT A;  5G5F A;  4MZC A;  2GST A;  5IQY A;  4LMW A;  2F3M A;  2EC4 A;  2VL9 A;  3M1G A;  2H19 A;  2QKE A;  5IO0 A;  2IN3 A;  3FZA A;  2H8L A;  3DD3 A;  1LU4 A;  5A5K A;  4MZB A;  3IC8 A;  5IOW A;  2FGX A;  2C0E A;  3P2A A;  1RW1 A;  1LBK A;  1HYU A;  3FZ4 A;  2LRT A;  4MF5 A;  2DML A;  2JL4 A;  4N30 A;  4G0K A;  1OC9 A;  2JSY A;  3BCK A;  1SL2 B;  3MYD A;  2NDO A;  2V6O A;  1TOF A;  4XS4 B;  1XOB A;  2KP1 A;  3G7Y A;  1MD3 A;  5A4W A;  2O89 A;  2TRX A;  2X99 A;  3EYT A;  1UA5 A;  3PPU A;  2HZE A;  5IO2 A;  2C80 A;  2TRC P;  2B7K A;  3L9S A;  5D96 A;  4X43 A;  5EY6 A;  2E0Q A;  5F06 A;  4ACS A;  1V58 A;  3WYW A;  1EGR A;  3NZN A;  2XBI A;  1R7H A;  2WS2 A;  2VLU A;  3UIW A;  2VUP A;  1GL8 A;  1A24 A;  2YPM A;  3F4R A;  2YN1 A;  2C0G A;  4L5L A;  2HZF A;  2VCQ A;  4EXJ A;  3PR8 A;  2H01 A;  3EMP A;  4F9Z A;  3GN3 A;  4ICY A;  1GUL A;  4KDU A;  1O8X A;  5IIZ A;  3KXO A;  1V40 A;  1ST9 A;  1SK1 A;  2WCI A;  2FLS A;  1T3B A;  3PGT A;  3LFL A;  5GAP D;  2LQO A;  2IIY A;  1R26 A;  4AGS A;  1MDI A;  3UVH A;  1Z5Y E;  4V2N A;  3IOS A;  4JZQ A;  3HJP A;  1XIY A;  2QC7 A;  2GSS A;  3V1W A;  1TK5 B;  1DE2 A;  5IMV A;  4DSS B;  3KCM A;  4FH8 A;  4HUA A;  4KE3 A;  4TOP A;  2KUC A;  1J0F A;  3TRX A;  4GRF A;  3VPQ A;  4EVM A;  3TB2 A;  1AQV A;  3GIX A;  2GDR A;  1V57 A;  3GL5 A;  2I1U A;  3KH7 A;  3LYK A;  1A2J A;  5A4V A;  2GS3 A;  5IM9 A;  2KP2 A;  4N10 A;  4Z2U A;  4Q5Q A;  7GSS A;  2H76 A;  1JLV A;  1F2E A;  1M99 A;  4POK A;  4PUA A;  4WR4 A;  1GSD A;  3I6A A;  1QXH A;  4ZB6 A;  3APO A;  4XRA A;  4GF0 A;  1SL1 B;  2GZY A;  3ME7 A;  1T4Y A;  1SD9 A;  2LS5 A;  2NVL A;  5DQY A;  4F0B A;  1ON4 A;  2I9H A;  4X0X A;  5J9B A;  3ZRD A;  4Q5N A;  1VF3 A;  3APS A;  3VI5 A;  3QAV A;  4J2F A;  3A2X A;  1ZZY A;  2LUS A;  3GNJ A;  2CA8 A;  1URM A;  2PN8 A;  2L5L A;  3F0I A;  3PIN A;  1PN9 A;  2H0G A;  3RPP A;  5AN1 A;  3ZML A;  1U6T A;  4JR4 A;  5J4U A;  4NXI A;  1X5E A;  2DJ1 A;  2CX3 A;  3VWX A;  4K2X A;  2YWO A;  1G0T A;  2F51 A;  2ZNM A;  4MK3 A;  1ZOF A;  4BL7 B;  1W89 A;  1FO5 A;  1JLW A;  4KUN A;  3E9J B;  2OBI A;  1GRX A;  2MMO A;  2H1G A;  3F3Q A;  2QA1 A;  3A2V A;  4OMV A;  2H6Z A;  1VF1 A;  4ISD A;  1XW5 A;  1GSY A;  5JCU A;  6GSW A;  5IPG A;  3US3 A;  3TRP A;  4NMU A;  1PN0 A;  1AW9 A;  1KBN A;  4KDX A;  2KLX A;  4O32 A;  4BVX A;  3BBY A;  1TRW A;  1WWJ A;  2RUF A;  2VM2 A;  4K0G A;  1V2A A;  4HDE A;  4LLR A;  3EWL A;  2YZH A;  4DSQ A;  4PQ1 A;  3QMX A;  3LG6 A;  1AQX A;  3LXT A;  1XZO A;  4I2U A;  4K8M A;  2PWJ A;  1G7O A;  3D0Z A;  4HU9 A;  4BPY A;  2NPB A;  3WGE A;  5F07 A;  1U3I A;  5HR2 A;  2B1L A;  3UAR A;  2AUV A;  2GLR A;  4OO4 A;  1A2L A;  4J57 E;  3GST A;  3KP8 A;  2BTO T;  2CQ9 A;  3TJK A;  4NAX A;  1MEK A;  2CAQ A;  3EIN A;  2PUK C;  4ML6 A;  5J9C A;  3ME8 A;  3UBK A;  4K7N A;  1WE0 A;  3LQ7 A;  5DQS A;  3DVW A;  4N11 A;  1YF1 A;  1Y25 A;  4FO5 A;  4TR0 A;  4YAP A;  5DDL A;  4OFT A;  3ERW A;  3TKS A;  5D73 A;  3P8W A;  3C73 A;  5G30 A;  3D22 A;  3HCZ A;  3F4T A;  2H74 A;  3CSJ A;  4YQU A;  3UOM A;  3NIV A;  2E7P A;  1Z7P A;  3GRX A;  1AAZ A;  1B9X C;  4IQA A;  1GWC A;  3W8S A;  1XXU A;  2G2Q A;  3WT2 A;  2YAN A;  1SJI A;  1OVN A;  3IK9 A;  1S3C A;  1O73 A;  1OYJ A;  2DBC A;  5CO3 A;  4KX4 A;  1BG5 A;  3P7X A;  4D73 B;  3D21 A;  5G1K A;  1O8W A;  2JZT A;  5JCW A;  4MPF A;  1ILO A;  1WMJ A;  2GQL A;  4OFM A;  4BL7 A;  3D4M A;  1QK8 A;  3Q19 A;  1XWC A;  1LJR A;  4BVY B;  2GZZ A;  2WJU A;  2XPE A;  2HYX A;  5H5R A;  5J41 A;  1X9S B;  4LA1 A;  1A0R P;  2N5F A;  1H75 A;  4MA9 A;  5GSS A;  2IMI A;  4TR3 A;  2RUE A;  3ZZX A;  2R37 A;  3CSH A;  1K0N A;  1TU7 A;  4KDY A;  1KTE A;  2CZ2 A;  4XHM A;  4ZIL A;  5HR3 A;  3IE3 A;  2JAD A;  4CY6 A;  2P31 A;  1GSQ A;  2AHE A;  2WUL A;  3F3R A;  1UC7 A;  1C72 A;  2HRN A;  1FB0 A;  4PGT A;  2C3T A;  2C1Y A;  4MF7 A;  3H4K A;  1U3A A;  1Q98 A;  4L5O A;  1EV4 A;  3GX0 A;  5LD0 A;  4OCF A;  4OWY A;  5D93 A;  5J5N A;  3CMI A;  3KIJ A;  2WDU A;  3ZLP A;  2FWE A;  4N0V A;  1K3Y A;  3CTF A;  2P5Q A;  3VK9 A;  2C0D A;  1B48 A;  2H0H A;  3CTG A;  1YZX A;  3S9F A;  4CY8 A;  3KTL A;  2PVQ A;  2HSH A;  5J3R A;  1M2A A;  3ZIV A;  2K18 A;  2R0C A;  5G5E A;  4RQR A;  3TUE A;  5E59 A;  1PA3 A;  4JU5 A;  1GNE A;  1OE7 A;  2AAW A;  1SJ6 A;  3HXS A;  3HJM A;  1GH2 A;  5ABR A;  1K3L A;  3O6T A;  3TKS E;  16GS A;  4V2L A;  2OBK A;  1K0D A;  3F63 A;  3ZTL A;  3A5I A;  4WBJ A;  3ZIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...