4TXVA

Crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
GDPACRAAVATAQKIAPLAHGEVAALTMASAPLKLPDLAFEDADGKPKKLSDFRGKTLLVNLWATWCVPSRKEMPALDELQGKLSGPNFEVVAINIDTRDPEKPKTFLKEANLTRLGYFNDQKAKVFQDLKAIGRALGMPTSVLVDPQGCEIATIAGPAEWASEDALKLIRAATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein TlpA
publication title How Periplasmic Thioredoxin TlpA Reduces Bacterial Copper Chaperone ScoI and Cytochrome Oxidase Subunit II (CoxB) Prior to Metallation.
pubmed doi rcsb
source organism Bradyrhizobium diazoefficiens
molecule tags Protein binding
total genus 46
structure length 175
sequence length 175
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4txvA00
1XW5A 4XIHA 4K1FA 4PUFC 3IAS2 4I2TA 5G31A 1M7TA 1X0RA 5GAPD 3DGQA 4G9HA 1X9MB 5ECRB 1ZOFA 4KSOA 2L4CA 4X1UA 3VWUA 1XFLA 3TJBA 2I81A 4PXOA 1PKZA 2V1MA 4ZBBA 4ZIJA 1TU8A 2HI7A 1JLVA 2VO4A 1ZMAA 1Z7PA 1IYHA 4K6XA 4AJ7A 1WE0A 3QAWA 1RK4A 2H19A 2P31A 2CVDA 5DALA 4YH2A 2GZYA 1G6WA 1XPVA 2NTOA 4LL1B 1ST9A 2DJ1A 3KH9A 1UVZA 1PA3A 4EL1A 3H93A 5D73A 4JBBA 4JZQA 4AGSA 3BOAA 1IYIA 3MSZA 16GSA 3CYNA 5ID2A 4K0GA 2C3TA 3HA9A 3FZ4A 4NV5A 1MTCA 2FWEA 3I69A 5ECOB 1SK1A 1EV4A 4JEDA 1FB6A 1KNGA 18GSA 1SENA 1NW2A 1PX6A 1ZCPA 2XPDA 3G7YA 3KTLA 5L71A 3E9JB 1XWCA 3EURA 4K9ZA 1QFNA 2DMMA 2VCWA 4G2EA 2GTUA 4OFMA 2VD0A 3S9FA 2CZ2A 2OE0A 1DE2A 2VL9A 4MPGA 2H72A 2F8FA 3SBCA 2K9FA 1A2JA 4RQXA 4HU7A 2DJJA 1OKDA 4WR5A 5JCUA 1SK0A 2KP1A 2CX3A 4HU9A 4MPFA 1QQ2A 2VCTA 1WRYA 3E3EA 4PGTA 4POLA 1UA5A 1NM3A 3L0HA 2BTOT 5F07A 5CYYA 5KN3A 3UL3A 2X8HA 2LKUA 1U6TA 2WJUA 5EL8A 6GSVA 3IE3A 2TIRA 3TGZA 1M0UA 3L9SA 1YKAA 2FLSA 4FYBA 5G1LA 2R3XA 4MH2A 3GIXA 3KH7A 2GGTA 5B6NA 4L5OA 2REMA 1OKTA 4P3YB 3HD5A 4NXIA 4IKHA 1K3OA 5CP1A 3I9V2 4LL4B 1QK8A 1XOAA 1OC3A 3TRQA 3HVSA 4EE0A 2ZUPA 5GSTA 2HRFA 2RIIA 1EP7A 4ZBAA 4EDYA 3FEUA 2PPTA 3CSJA 4NV2A 2R37A 2B7KA 4L0UA 3KP8A 4K2DA 1WMJA 1OC8A 3WYWA 3LORA 1X5CA 3QAVA 1YKCA 1O6JA 3FZ9A 2PMTA 2H1AA 2YPMA 4J56E 1M2BA 2I1UA 2VL3A 3TKPA 2C0EA 3ZVJA 4N11A 6GSUA 1V58A 4NWYA 5ABRA 1PGTA 2JL4A 2LS5A 3VI5A 2OE1A 2K8VA 8GSSA 5ECKB 5DDLA 4IJIA 3P7XA 3WGXA 1GSDA 3EMPA 1XW6A 2DIZA 1A0RP 3BCKA 2QC7A 2LJRA 5KN1A 3TUEA 4FYCA 3EC3A 3D4TA 1S3AA 5B8AA 2WZ9A 3JCML 3IPZA 1X5DA 2PBJA 1GUHA 5ECQB 4OFNA 5F8BA 3M3MA 3FR3A 3APSA 2JZSA 4TRXA 4IGJA 4D73B 2R4VA 1FVJA 3KGKA 3F8UA 2MZCA 4Z7XA 1Y25A 2N5FA 4ML1A 2RM6A 2FY6A 4AJ8A 3GX0A 1GP1A 1GUKA 3UMAA 1N2AA 2YP6A 3RBTA 3PINA 2YJHA 4OCFA 3APOA 3VFIA 3IK7A 2XHFA 10GSA 5CREA 1I9DA 2OBKA 2K6VA 3W8SA 4F82A 2VM1A 3KM6A 6GSYA 3TKSC 1RW1A 2CT6A 1K0AA 4EXJA 2XPEA 3FR9A 5G5EA 4DSSB 1EGOA 5DJLA 3MNGA 3CSHA 4TR3A 1M99A 3LG6A 1SJIA 2GSQA 2DJ0A 2MBSA 2L6CA 4BVYA 1TKDB 1GSSA 2HRNA 3N5OA 5FT3A 1Z7RA 2IFQA 4YQMA 2I3YA 3LGCA 2YV9A 2LRNA 1SL2B 5DJMA 5D9WA 3LSZA 2E0QA 1VF2A 1EZKA 1ZZYA 4V1Ag 3RHCA 4YAVA 3I6AA 1TI3A 2F51A 3VK9A 3GFKA 3GKXA 2IMEA 3U6VA 4MJCA 3QD9A 3HJMA 3OR5A 1A8YA 2VLVA 4D73A 1AW9A 9GSSA 1Z3EA 1BQ7A 1B4QA 1MDKA 4XRDA 1PD21 4WKWA 2IMKA 3IV4A 3LYPA 2H30A 2JZRA 3GSSA 2HSYA 4KCAA 1G7OA 2B6MA 4CHSA 2V6OA 2RUFA 4ECBA 3IA1A 1PQNA 4MJAA 1A0FA 1KBNA 3CRUA 2ALBA 1GL8A 2CA8A 4PNGA 1S3CA 4IQAA 4MK3A 3ZMLA 2GQMA 5LNKe 1JLWA 5IPGA 4ILFA 2AB6A 2CX4A 2GSRA 3WGDA 2B7JA 5D9XA 1FO5A 4I8BA 3M9KA 3D4MA 1GTAA 2LRCA 4Q5RA 1UC7A 2AYTA 2WFCA 2ZCTA 3Q74A 2GS3A 4ZL7A 3IDVA 4IP1A 3UAPA 3DXBA 1DUGA 2OACA 3HCZA 4OCEA 4J2FA 13GSA 2YCDA 5DAKA 3FRCA 4N30A 1USBA 3UOMA 3FW2A 2E2GA 2B1KA 4CDOA 2JADA 2L57A 1K3LA 1BG5A 3HYPA 4BPYA 2WS2A 3G7JA 4QL9A 4OD7A 5J3RA 3M9JA 1F6MC 3EINA 2H6XA 5JWOB 3D0ZA 3CBUA 6GSXA 1GRXA 1SL1B 2JSZA 3PGTA 1HNBA 2E2MA 4MZWA 3LFLA 3HZ4A 4GQCA 2LJAA 4NHWA 3VLNA 5IMVA 4MF5A 3TKRA 1SKWB 3LXTA 22GSA 1FG4A 2AJQB 5IMZA 2B5EA 2WDUA 4ACSA 4JE1A 4NPBA 2XBQA 4F0BA 3HJOA 2NBSA 4EVMA 4WBJA 5EY6A 2GZZA 3ZREA 1U3AA 3GKMA 2A2RA 4XTSA 5G5FA 5KN0A 1K0BA 2DSAA 1XWKA 2XBIA 4IP6A 2I9HA 1HD2A 3HKRA 1FOVA 1ERWA 4KNDA 2MMZA 5IMCA 1J08A 4GCIA 2VLUA 3E0UA 4TR0A 4DEJA 4OWYA 2H74A 5IO2A 1O81A 1KTEA 3ZIVA 2BMXA 4ZB9A 5A4VA 3HJPA 4F0CA 3CRTA 4KH7A 3ZVJD 1THOA 2I4AA 1NHYA 2CAIA 2FWHA 4QL7A 4IHUA 5J4UA 4KDUA 1GLQA 3KMNA 3UBLA 5ECSA 2DC5A 3GTUB 1YEXA 1KEBA 4PQIA 3APQA 1WPIA 5JWQB 3F6FA 3P2AA 5DBQA 2LEGA 4KDYA 4N0VA 3IR4A 4G10A 4DSRA 4KAEA 2L5LA 5COHA 1JZOA 2OA7A 5LD0A 3GKNA 4LMWA 5AISA 5HR3A 5F0GA 1XXUA 2YOIA 1TOFA 1QUWA 2VLTA 3GL5A 3LWAA 3GUSA 3VPTA 5ECMB 4TVEA 2YWIA 2P0GA 1YDKA 1SL0B 4OFTA 1J9BA 3ISOA 3ZYWA 1TRUA 3ZZXA 3A2WA 2L6DA 3EWLA 2X8GA 5IOXA 3GN3A 2L5OA 2EC4A 3IAM2 4K7NA 4XCSA 1W89A 4RUVA 3L4NA 2E7PA 4CW9A 4I2UA 1EV9A 1M9BA 1UN2A 2MMNA 3ZFBA 3PR8A 4ZL9A 2G0FA 1G6YA 2D2ZA 2O8VB 4BWQA 1AC1A 3QR6A 3M8NA 3ZITA 2MMAA 1ILOA 3AY8A 1R4WA 2NDOA 1MDIA 4O32A 2J23A 4OO5A 4HOJA 3CMIA 2JZTA 5CRWA 2WGRA 1H4OA 1CQHA 3LYKA 3EMXA 3NZNA 3ZIJA 3U5RE 4LA1A 5IMAA 5EPFA 3KP9A 4JRRA 2FHEA 3TJJA 2IL3A 4JU5A 3BBYA 3RHBA 1VF3A 3GTUA 3GX8A 4J57E 2OADA 2EIQA 2H0IA 3IC4A 2XC2A 3G9BA 4KA0A 2YZUA 3M0FA 2GSSA 2J9HA 1PMTA 2IWTA 2HNLA 3IHQA 5HR2A 2LV3A 1GTIA 1XCCA 3QMXA 2H66A 3QOUA 4K8MA 3F0IA 2HZEB 2VCXA 1SJ6A 1GSQA 1MD3A 3V1WA 1PSQA 2C3QA 1EOHA 4BWSA 1OYJA 5H5QA 2GVPA 2M72A 3FKFA 4JR6A 2O7KA 2PN8A 2RM5A 4GLTA 4XS1A 3F9UA 2VAFA 3D21A 4ZL8A 5HFGA 2ON5A 2CZ3A 4Q5QA 3TKSE 2A4VA 3GL3A 2VD1A 3FR6A 4YQVA 1YQ1A 2LTKA 3BJ5A 3TDGA 1OE8A 1R5AA 2LQOA 3GKKA 4GSNA 1SD9A 2C80A 11GSA 1TK0B 3K8NA 3HDCA 3UEMA 4DSQA 3TKSA 2Z9SA 3QAGA 4MABA 5H5RA 2C0DA 2H1GA 5AN1A 3MAKA 4HEA2 1WWJA 1SYRA 2R5GA 2K8SA 3IK9A 4KGIA 4L8EA 3P90A 3GSTA 4YAPA 4MCUA 1G7EA 3BD2A 1T3BA 2FA8A 1F3AA 1YF0A 5JWRB 4ZBDA 4MZCA 4ZB8A 2H6ZA 1FHEA 1TRVA 1GWCA 1NHOA 4G19A 1AIUA 3F4RA 2GQKA 4X43A 5HR0A 2VCZA 3A5WA 1Y6EA 2A2SA 4TR4A 4ECJA 2HZEA 1XIYA 2CVBA 2DJ3A 3NIVA 1T00A 4ISDA 4I6XA 3TRPA 1EWXA 4NHZA 1R5PA 4HS1A 2H0HA 2VM2A 4ML6A 3RPNA 1WOUA 3QCPA 1Q4JA 2OKAA 1URMA 1EGRA 2DJ2A 19GSA 1SKSB 2F3MA 3D5JA 4TXVA 1V98A 2JSYA 1B9XC 2FCHA 3TJKA 1V40A 1OE7A 2KHPA 3DRNA 1XVWA 4XHMA 3ZFLA 5DCHA 5JCGA 3UBKA 1GSEA 2QKEA 2LUSA 5CO3A 3EE2A 5G2ZA 3SWLA 2YN1A 1GTUA 5ECPB 3KZQA 3DMLA 3FHKA 2H8LA 2V32A 2YANA 1XBSA 5DVBA 2HYXA 1X9WB 1QGVA 4IS0A 3HZ8A 1A8LA 2LJKA 2VL2C 4L0WA 3FYGA 3HVXA 1A2LA 4O92A 3GMFA 1GLPA 4PQHA 1X9SB 3VWXA 4WF5A 1F37A 2G2QA 2AAWA 2H75A 1XW9A 3F4SA 3DEXA 1FW1A 1ZYQB 2IMDA 1LJRA 4K7OA 1TW9A 2HFDA 1AXDA 1SD8A 2F8AA 2FD3A 3DD3A 3A3TA 2EIOA 4PQ1A 1DSBA 4DSSA 3TOUA 4POBA 4TOPA 2C4JA 1K0MA 1ML6A 2PVOC 3I43A 2N5BA 1ZYEA 5IQYA 1E2YA 1PRXA 1AAZA 3HXSA 1YF1A 3NOFA 5E4WA 1G0TA 3C71A 3DIEA 3P8WA 2LNSA 5DALB 4PX1A 5J9CA 3H4KA 1BAYA 1AUCA 4Q5FA 4DVCA 4TW5A 3M1GA 1GTBA 3HHVA 5A5KA 1ZL9A 2IMFA 3EU4A 2KOKA 4N0ZA 2KUCA 5ID2B 5IOWA 1AQXA 4E8EA 1R7HA 5JCWA 3G7IA 4FO5A 4IBPA 1A24A 3ME7A 2NPBA 1OVNA 2LQQA 2AHEA 2PVQA 3Q19A 2HZFA 1PL2A 1O73A 4OMVA 2MBTA 4FIWA 2RLIA 1HYUA 2CV4A 3LXZA 3LEFA 1Z9HA 2FA4A 14GSA 2L59A 2OJLA 4V2NA 3QFBC 4KCEA 3GH6A 4WBRD 1RQMA 5CRHA 3KMOA 3TJFA 2B1LA 2C0FA 5ENUA 2QGVA 1WIKA 1YY7A 1ABAA 3HY2A 20GSA 4GWRA 2GSTA 3EU3A 3CSIA 2H76A 1VGLA 3GNJA 4MZBA 2FWFA 3H79A 4JR4A 1GULA 5C04A 3ZRDA 3VPQA 4POMA 2V2GA 3D6IA 5ELGA 4GRFA 4RQRA 4L5LA 12GSA 2VOCA 3WT1A 1F3BA 5FWGA 4K0NA 1BX9A 2F9SA 4HDEA 1TK5B 3KEBA 2M80A 5HFKA 2YNXA 3MWHA 4MP4A 4EO3A 1TRSA 4F2IA 3GH9A 1OAZA 2HT9A 5ELAA 3H8QA 1ERVA 2NVLA 5E59A 1F2EA 3WT2A 4TR1B 3WD6A 1EEMA 4MF6A 2GT6A 4TKYA 4IELA 1JZWA 2HSHA 4MJEA 3ZL5A 4IN0A 1JZDA 3C7MA 3BCIA 1M2DA 4HUAA 1T8EB 1MEKA 4WR4A 4HJMA 3R2QA 3F3RA 4E8HA 1EEJA 1DBYA 1T4ZA 5ECLB 1X5EA 1A2MA 1SU9A 1B4PA 2IMIA 4WXTA 1PL1A 4TN8A 2B3SA 1VF1A 3GURA 1J0FA 5ECIB 4RI6A 3F3QA 2PGTA 2DLXA 4MH3A 2C3NA 3PH9A 1TK8B 1SYXA 1T4YA 2O85A 2BJXA 2IJYA 4POKA 1K0NA 3DWVA 4IJ3A 3GHAA 1R26A 1GSFA 3TOTA 4BL7A 4PURA 4ZXGA 4GXZA 5FHIA 5H5SA 4YQUA 3ZLPA 5IPHA 4GSSA 2X99A 1B8XA 4ULXA 1AQVA 5B6MA 2TRCP 5D96A 2DJKA 3TB2A 2KLXA 2RUEA 2R6KA 3LJRA 1YEPA 1THXA 1TJDA 2H73A 5ECNB 3J7Yk 2H70A 2DMLA 3GRXA 4O5RA 2C0GA 4V2LA 7GSSA 4HJ2A 1SK2A 3FZAA 2M46A 5IO0A 3GA4A 1I5GA 2VCVA 1H75A 1S3DA 3RPPA 4IQ1A 5C00A 1U87A 1ERUA 4KUNA 2ON7A 1A23A 5G30A 1ON4A 3C1SA 3Q18A 1HQOA 4F03A 2AUVA 2P5QA 3J7Yb 4TR1A 2OE3A 2WB9A 4LLRA 4XS4B 4LMVA 2LSTA 1XWAA 4ECCA 1TTZA 3CTFA 1CQGA 4EKZA 1EP8A 2GZPA 2KP2A 4V2MA 4FYUA 1MDJA 4EC0A 4X0XA 2PERA 1JHBA 2X64A 2WRTA 5F05A 4XRAA 3QFAC 3ZMKA 1K3YA 2X8CA 4PNFA 2JACA 1V57A 3ERGA 6GSSA 4KB3A 6GSTA 1FAAA 1JZRA 1YJ6A 1O7UA 4KX4A 4ZILA 2L4QA 3O3TA 5EVOA 2IFQB 3F6DA 3IOSA 3EYTA 1U3IA 4NAXA 4HQZA 2VCQA 2VUPA 4IW9A 5GZZB 4N10A 3ME8A 1VRSD 3KIJA 1B48A 1WP0A 2LNTA 4FH8A 1O8WA 2YV7A 2C8UA 1V2AA 5IMDA 1TI1A 4MA9A 3C8EA 4F9ZA 5AIXA 2H1DA 2H1BA 4ID0A 3ERFA 3KCMA 2EIRA 4IVFA 1TXXA 3WGEA 5AGYA 2IN3A 5CNWA 4EUYA 1PN9A 5A4UA 4HZ4A 4V1Ap 3KXOA 5DQSA 3FZ5A 5DQYA 2FGXA 2CAQA 4HZ2A 4BVXA 4RI7A 1W4VA 3C73A 1K0OA 2MYGA 4NMUA 3O76A 1GNWA 6GSWA 2C1YA 3GYKA 3H1NA 2WCIA 4HQSA 2O89A 3IXRA 2OBIA 1YZXA 1T1VA 2R2JA 3EVIA 3TRXA 4GF0A 2VIMA 4MMMA 3VWVA 1QXHA 2HLSA 4XS4A 1TP9A 2PU9C 4GQFA 3L9UA 3RAZA 4KE3A 5LCZA 1XWBA 2YWMA 4BA7A 2DIYA 1Z6MA 1SKRB 1K0CA 17GSA 5IMFA 2AV4A 1M2AA 1OC9B 1C72A 4MJBA 2FUG2 2H01A 1Z6NA 2K18A 2JU5A 4AF2A 3UIWA 3DKSA 5D9VA 3O6TA 4EDZA 5INYA 3DVWA 3CXGA 3A2VA 1GH2A 1EOGA 3FK8A 1NSWA 1XWGA 4QQ7A 2GQLA 1F9MA 4ECIA 1BEDA 5DAKB 2N5AA 2YJ7A 4TXOB 5KN2A 3UVHA 2VL2A 4MLYA 2P5RA 3TCOA 1K0DA 2V41A 2HE3A 3W8JA 5HQPA 5KEJA 2H0GA 1BJXA 1XZOA 5G1KA 4KSMA 3RDWA 1U88A 5CRGA 1ZGNA 1HNAA 1FVKA 5GAND 1FB0A 5CAXA 2PUKC 1HNCA 1BYEA 4H86A 1XVQA 5IM9A 1LBKA 3TKQA 4WETA 4GTUA 1AQWA 3QPMA 5B8BA 3MDKA 3F63A 1SJZA 1O8XA 3IRAA 1TDIA 4I97A 2YZHA 3IBHA 1XOBA 1WJKA 5DCGA 5IIZA 1JFUA 4I5QA 1Z5YE 3L78A 2FWGA 3A2XA 2H6YA 1GUMA 3N9JA 5J5NA 5F06A 1T7PB 2FNOA 3VWWA 2V6KA 3LQ7A 5D9TA 1PKWA 2CQ9A 4XS6A 2GLRA 1O85A 5B7CA 1GNEA 2H71A 2GDRA 3VI7A 3CTGA 2B5YA 3W6GA 4MDCA 1VF4A 3D22A 2IPAA 3KTBA 4KW6A 2WULA 4KDXA 1PX7A 5J41A 2GT5A 1TU7A 5ECHB 2YWOA 5GSSA 3F4TA 4WF4A 3GV1A 1E6BA 1ERTA 3QDNA 5HR1A 1OC9A 2TRXA 5J9BA 2DBCA 2LRTA 2YWNA 2ES7A 3US3A 2O87A 1MD4A 3ED3A 3VURA 3UARA 1TRWA 4PUAA 2CVKA 2QSIA 3ZTLA 4WEYA 4TXOA 1LU4A 5D93A 4HI7A 3L9VA 1Q98A 4GSTA 3HVVA 2PWJA 4Q5NA 4OO4A 3KJYA 5D8IA 2MMOA 1DE1A 4O7HA 4MF7A 3ERWA 5A4WA 3DYRA 4ZB6A 5CRDA 5HFIA 1V9WA 1QMVA 1M9AA 1B9YC 3DVXA 3TJGA 2HXKA 2ZNMA 4AJ6A 5AIVA 3Q6OA 1N8JA 4K7IA 3UJ1A 1ACVA 2B5XA 3UVTA 1GSYA 2IIYA 3C1RA 4EF0A 1GSUA 3FY7A 3KD0A
chains in the Genus database with same CATH superfamily
1XW5A 4XIHA 4K1FA 4PUFC 3IAS2 4I2TA 5G31A 1M7TA 1X0RA 5GAPD 3DGQA 4G9HA 1X9MB 5ECRB 1ZOFA 4KSOA 2L4CA 4X1UA 3VWUA 1XFLA 3TJBA 2I81A 4PXOA 1PKZA 2V1MA 2R0PA 4ZBBA 4ZIJA 1TU8A 2HI7A 1JLVA 2VO4A 1ZMAA 1Z7PA 1IYHA 4K6XA 4AJ7A 1WE0A 3QAWA 2X4AA 1RK4A 2H19A 2P31A 2CVDA 5DALA 4YH2A 2GZYA 1G6WA 1XPVA 2NTOA 4LL1B 1ST9A 2DJ1A 4ICYA 3KH9A 1UVZA 1PA3A 4EL1A 3H93A 4Z2RA 5D73A 4JBBA 4JZQA 4AGSA 3BOAA 1IYIA 3MSZA 16GSA 3CYNA 5ID2A 4K0GA 2C3TA 3HA9A 3FZ4A 4NV5A 1MTCA 2FWEA 3I69A 5ECOB 1SK1A 1EV4A 4JEDA 1FB6A 1KNGA 18GSA 1SENA 1NW2A 1PX6A 1ZCPA 2XPDA 3G7YA 3KTLA 5L71A 3E9JB 1XWCA 3EURA 4K9ZA 1QFNA 1S3RA 2DMMA 2VCWA 4G2EA 1ZYPA 2GTUA 4OFMA 2VD0A 3S9FA 2CZ2A 2OE0A 1DE2A 2VL9A 4MPGA 2H72A 2F8FA 3SBCA 2K9FA 1A2JA 4RQXA 3FMWA 4HU7A 2DJJA 1OKDA 4WR5A 5JCUA 1SK0A 2KP1A 2CX3A 4HU9A 4MPFA 1QQ2A 2VCTA 1WRYA 1PN0A 3E3EA 4PGTA 4POLA 1UA5A 1NM3A 3L0HA 2BTOT 5F07A 5CYYA 5KN3A 3UL3A 2X8HA 2LKUA 1U6TA 2WJUA 5EL8A 6GSVA 3IE3A 2TIRA 3TGZA 1M0UA 3L9SA 1YKAA 2FLSA 4FYBA 5G1LA 2R3XA 4MH2A 3GIXA 3KH7A 2GGTA 5B6NA 4L5OA 2REMA 1OKTA 4P3YB 3HD5A 4NXIA 4IKHA 1K3OA 5CP1A 3I9V2 4LL4B 1QK8A 1XOAA 1OC3A 3TRQA 3HVSA 4EE0A 2ZUPA 5GSTA 2HRFA 2RIIA 1EP7A 4ZBAA 4EDYA 3FEUA 2PPTA 3CSJA 4NV2A 2R37A 2B7KA 4L0UA 3KP8A 4K2DA 1WMJA 1OC8A 3WYWA 3LORA 1X5CA 3QAVA 1YKCA 4K5SA 1O6JA 3FZ9A 2PMTA 2H1AA 2YPMA 4J56E 1M2BA 2I1UA 2VL3A 3TKPA 2C0EA 3ZVJA 4N11A 6GSUA 1V58A 4NWYA 5ABRA 4BVYB 1PGTA 2JL4A 2LS5A 3IC8A 3VI5A 2OE1A 2K8VA 8GSSA 5ECKB 5DDLA 2X49A 4IJIA 3P7XA 3WGXA 1GSDA 3EMPA 1XW6A 2DIZA 1A0RP 3BCKA 2QC7A 2LJRA 5KN1A 3TUEA 4FYCA 3EC3A 3D4TA 1S3AA 5B8AA 1PFOA 2HSMA 2WZ9A 3JCML 3IPZA 1X5DA 2PBJA 1GUHA 5ECQB 4OFNA 5F8BA 3M3MA 3FR3A 3APSA 2JZSA 4TRXA 4IGJA 4D73B 2R4VA 1FVJA 1FOHA 3KGKA 4Z7XA 2MZCA 3F8UA 1Y25A 2N5FA 4ML1A 2RM6A 2FY6A 4AJ8A 5BMUA 3GX0A 1GP1A 1GUKA 3UMAA 1N2AA 2YP6A 3RBTA 3PINA 2YJHA 4OCFA 3APOA 3VFIA 3IK7A 2XHFA 10GSA 5CREA 4YKGA 1XG8A 1I9DA 2OBKA 2K6VA 3W8SA 4F82A 2VM1A 3KM6A 6GSYA 3TKSC 1RW1A 1ZYNA 2CT6A 1K0AA 4EXJA 2XPEA 3FR9A 5G5EA 4DSSB 1EGOA 5DJLA 3MNGA 3CSHA 4TR3A 1M99A 3LG6A 1SJIA 2GSQA 2DJ0A 2MBSA 2L6CA 4BVYA 1TKDB 1GSSA 2HRNA 3N5OA 5FT3A 1Z7RA 2IFQA 4YQMA 2I3YA 3LGCA 2YV9A 4Z2TA 2LRNA 1SL2B 5DJMA 5D9WA 3LSZA 2E0QA 1VF2A 1EZKA 1ZZYA 4V1Ag 3RHCA 4YAVA 3I6AA 1TI3A 2F51A 3VK9A 3GFKA 3GKXA 2IMEA 3U6VA 4MJCA 3QD9A 3HJMA 3OR5A 1A8YA 2VLVA 4D73A 1AW9A 2DKIA 9GSSA 1Z3EA 1BQ7A 1B4QA 1MDKA 4XRDA 1PD21 4WKWA 2IMKA 3IV4A 3LYPA 2H30A 2QA1A 5KOWA 2JZRA 3GSSA 2HSYA 4KCAA 1G7OA 2DKHA 2B6MA 4CHSA 2V6OA 2RUFA 4ECBA 3IA1A 1PQNA 4MJAA 1A0FA 1KBNA 3CRUA 2ALBA 1GL8A 2CA8A 4PNGA 1S3CA 4IQAA 4MK3A 3ZMLA 2GQMA 5LNKe 1JLWA 5IPGA 4ILFA 2AB6A 2CX4A 2GSRA 3WGDA 2B7JA 5D9XA 1FO5A 4I8BA 3M9KA 3D4MA 1GTAA 2LRCA 4Q5RA 1UC7A 2AYTA 2WFCA 2ZCTA 3Q74A 2GS3A 4ZL7A 3MIXA 3IDVA 4IP1A 3UAPA 3DXBA 1DUGA 2OACA 3HCZA 4EIQA 4OCEA 4J2FA 13GSA 2YCDA 5DAKA 3FRCA 4N30A 1USBA 3UOMA 3FW2A 2E2GA 2B1KA 4CDOA 2JADA 2L57A 1K3LA 1BG5A 3HYPA 4O5QA 4BPYA 2WS2A 3G7JA 4QL9A 4K2XA 4OD7A 5J3RA 3M9JA 1F6MC 3EINA 4G0KA 2H6XA 4A5PA 5JWOB 3D0ZA 3CBUA 6GSXA 1GRXA 1SL1B 2JSZA 3PGTA 1HNBA 2E2MA 4MZWA 3LFLA 3HZ4A 4GQCA 2LJAA 4NHWA 3VLNA 5IMVA 4MF5A 3TKRA 1SKWB 3LXTA 22GSA 1FG4A 4YKFA 2AJQB 5IMZA 2B5EA 2WDUA 4ACSA 4JE1A 4NPBA 2XBQA 4F0BA 3HJOA 2NBSA 4EVMA 4WBJA 5EY6A 2GZZA 3ZREA 1U3AA 4PTSA 3GKMA 2A2RA 4XTSA 5G5FA 5KN0A 1K0BA 2DSAA 1XWKA 2XBIA 4IP6A 2I9HA 2UZ8A 1HD2A 3HKRA 1FOVA 1ERWA 4KNDA 2MMZA 5IMCA 4BL7B 1J08A 4GCIA 2VLUA 3E0UA 4TR0A 4DEJA 4OWYA 2H74A 5IO2A 1O81A 1KTEA 3ZIVA 2BMXA 4ZB9A 4EIPA 5A4VA 3HJPA 4F0CA 3CRTA 4KH7A 3ZVJD 1THOA 2I4AA 1NHYA 2CAIA 2FWHA 4QL7A 4IHUA 5J4UA 4KDUA 1GLQA 3KMNA 3UBLA 5ECSA 2DC5A 3GTUB 1YEXA 1KEBA 4PQIA 3APQA 1WPIA 5JWQB 3F6FA 3P2AA 5DBQA 2LEGA 4KDYA 4N0VA 3IR4A 4G10A 4DSRA 4KAEA 2L5LA 5COHA 1JZOA 2OA7A 5LD0A 3GKNA 4LMWA 5AISA 5HR3A 5F0GA 1XXUA 2YOIA 1TOFA 1QUWA 2VLTA 3GL5A 3LWAA 3GUSA 3VPTA 5ECMB 4TVEA 2YWIA 2P0GA 1YDKA 1SL0B 4OFTA 1J9BA 3ISOA 3ZYWA 1TRUA 3ZZXA 3A2WA 2L6DA 3EWLA 2X8GA 5IOXA 3GN3A 2L5OA 2EC4A 3IAM2 4K7NA 4XCSA 1W89A 4RUVA 3L4NA 2E7PA 4CW9A 4I2UA 1EV9A 1M9BA 1UN2A 2MMNA 3ZFBA 3PR8A 4ZL9A 2G0FA 1G6YA 2D2ZA 2O8VB 4BWQA 1AC1A 3QR6A 3M8NA 3ZITA 2MMAA 1ILOA 3AY8A 1R4WA 2NDOA 1MDIA 4O32A 1M3JA 2J23A 4OO5A 4HOJA 3CMIA 2JZTA 5CRWA 2WGRA 4MNNA 1H4OA 1CQHA 3LYKA 3EMXA 3NZNA 3ZIJA 3U5RE 4LA1A 5IMAA 5EPFA 3KP9A 4JRRA 2FHEA 3TJJA 2IL3A 4JU5A 3BBYA 3RHBA 4CY8A 1VF3A 3GTUA 3GX8A 4BVXB 4J57E 2OADA 2EIQA 2H0IA 3IC4A 2XC2A 3G9BA 4KA0A 2YZUA 3M0FA 2GSSA 2J9HA 1PMTA 2IWTA 2HNLA 3IHQA 5HR2A 2LV3A 1GTIA 1XCCA 3QMXA 2H66A 3QOUA 4K8MA 3F0IA 2HZEB 2VCXA 1SJ6A 1GSQA 1MD3A 3V1WA 1PSQA 2C3QA 1EOHA 4BWSA 1OYJA 5H5QA 2GVPA 2M72A 3FKFA 4JR6A 2O7KA 3HVNA 2PN8A 2RM5A 4GLTA 4XS1A 3F9UA 2VAFA 3D21A 4ZL8A 5HFGA 2ON5A 3LW9A 2CZ3A 4Q5QA 3TKSE 2A4VA 3GL3A 2VD1A 3FR6A 4YQVA 1YQ1A 2LTKA 3BJ5A 3TDGA 1OE8A 1R5AA 2LQOA 3GKKA 4GSNA 1SD9A 2C80A 11GSA 1TK0B 3K8NA 3HDCA 3UEMA 4DSQA 3TKSA 2Z9SA 3QAGA 4MABA 5H5RA 2C0DA 2H1GA 5AN1A 3MAKA 4HEA2 1WWJA 1SYRA 2R5GA 2K8SA 3IK9A 4KGIA 4L8EA 3P90A 3GSTA 4YAPA 4MCUA 1G7EA 3BD2A 1T3BA 2FA8A 1F3AA 1YF0A 5JWRB 4ZBDA 4G0IA 3MYDA 4MZCA 4ZB8A 2H6ZA 1FHEA 1TRVA 1GWCA 1NHOA 4G19A 1AIUA 3F4RA 2GQKA 4X43A 5HR0A 2VCZA 3A5WA 1Y6EA 2A2SA 4TR4A 4ECJA 2HZEA 1XIYA 2CVBA 2DJ3A 3NIVA 4USSA 1T00A 4ISDA 4I6XA 3TRPA 1EWXA 4NHZA 1R5PA 4HS1A 2H0HA 2VM2A 4ML6A 3RPNA 1WOUA 3QCPA 1Q4JA 2OKAA 1URMA 1EGRA 2DJ2A 19GSA 1SKSB 2F3MA 3D5JA 4TXVA 1V98A 2JSYA 1B9XC 2FCHA 3TJKA 1V40A 1OE7A 2KHPA 3DRNA 1XVWA 4XHMA 3ZFLA 5DCHA 5JCGA 3UBKA 1GSEA 2QKEA 2LUSA 5CO3A 3EE2A 5G2ZA 3SWLA 2YN1A 1GTUA 5ECPB 3KZQA 3DMLA 3FHKA 2H8LA 2V32A 2YANA 1XBSA 5DVBA 2HYXA 1X9WB 1QGVA 4IS0A 3HZ8A 1A8LA 2LJKA 2VL2C 4L0WA 3FYGA 3HVXA 1A2LA 4O92A 3GMFA 1GLPA 4PQHA 1X9SB 3VWXA 4BIKA 4WF5A 1F37A 2G2QA 2AAWA 2H75A 1XW9A 3F4SA 3DEXA 1FW1A 1ZYQB 2IMDA 1LJRA 4K7OA 1TW9A 2HFDA 1AXDA 2A2PA 1SD8A 2F8AA 2FD3A 3DD3A 3A3TA 2EIOA 4PQ1A 1DSBA 4DSSA 3TOUA 4POBA 4TOPA 2C4JA 1K0MA 1ML6A 2PVOC 3I43A 2N5BA 1ZYEA 5IQYA 1E2YA 1PRXA 1AAZA 3HXSA 1YF1A 3NOFA 5E4WA 1G0TA 3C71A 3EPTA 3DIEA 3P8WA 2LNSA 5DALB 4PX1A 5J9CA 3H4KA 1BAYA 1AUCA 4Q5FA 4DVCA 4TW5A 3M1GA 1GTBA 3HHVA 5A5KA 1ZL9A 2IMFA 3EU4A 2KOKA 4N0ZA 2KUCA 4KF9A 5KOXA 5ID2B 5IOWA 1AQXA 4E8EA 1R7HA 5JCWA 3G7IA 4FO5A 4IBPA 1A24A 3ME7A 2NPBA 1OVNA 2LQQA 2AHEA 2PVQA 3Q19A 2HZFA 1PL2A 1O73A 4OMVA 2MBTA 4FIWA 3CQFA 2RLIA 1HYUA 2CV4A 3LXZA 3LEFA 1Z9HA 2FA4A 14GSA 2L59A 2OJLA 4V2NA 3R3EA 3QFBC 4KCEA 3GH6A 4WBRD 1RQMA 5CRHA 3KMOA 3TJFA 2B1LA 2R0CA 2C0FA 5ENUA 2QGVA 1WIKA 1YY7A 1ABAA 3HY2A 20GSA 4GWRA 2GSTA 3EU3A 3CSIA 4X4JA 2H76A 1VGLA 3GNJA 4MZBA 2FWFA 3H79A 4JR4A 1GULA 5C04A 3A5IA 3ZRDA 3VPQA 4POMA 2V2GA 3D6IA 5ELGA 5BRTA 4GRFA 4RQRA 4L5LA 12GSA 2VOCA 3WT1A 1F3BA 5FWGA 4K0NA 1BX9A 2F9SA 4HDEA 1TK5B 3KEBA 3IHGA 2M80A 5HFKA 2YNXA 3MWHA 4MP4A 4EO3A 2R0GA 1TRSA 4F2IA 3GH9A 1OAZA 2HT9A 5ELAA 3H8QA 1ERVA 2NVLA 5E59A 1F2EA 3WT2A 4TR1B 3WD6A 1EEMA 4MF6A 2GT6A 4TKYA 4IELA 1JZWA 2HSHA 4MJEA 4K5RA 3ZL5A 4IN0A 1JZDA 3PPUA 3C7MA 3BCIA 1M2DA 4HUAA 1T8EB 1MEKA 4WR4A 4HJMA 3R2QA 3F3RA 4E8HA 1EEJA 1DBYA 1T4ZA 5ECLB 1X5EA 1A2MA 1SU9A 1B4PA 2IMIA 4WXTA 1PL1A 4TN8A 2B3SA 1VF1A 3GURA 1J0FA 5ECIB 4RI6A 3F3QA 2PGTA 2DLXA 4MH3A 2C3NA 3PH9A 1TK8B 1SYXA 1T4YA 2O85A 2BJXA 2IJYA 4POKA 1K0NA 3DWVA 4IJ3A 3GHAA 1R26A 1GSFA 3TOTA 4BL7A 4PURA 4ZXGA 4GXZA 5FHIA 5H5SA 4YQUA 3ZLPA 5IPHA 4GSSA 2X99A 4FQUA 1B8XA 4ULXA 1AQVA 4Z2UA 5B6MA 2TRCP 5D96A 2DJKA 3TB2A 2KLXA 2RUEA 2R6KA 3LJRA 1YEPA 1THXA 1TJDA 2H73A 5ECNB 3J7Yk 2H70A 2DMLA 3GRXA 4O5RA 2C0GA 4V2LA 7GSSA 4HJ2A 4G0LA 1SK2A 3FZAA 2M46A 5IO0A 3GA4A 1I5GA 2VCVA 1H75A 1S3DA 3RPPA 4IQ1A 5C00A 1U87A 1ERUA 4KUNA 2ON7A 1A23A 5G30A 1ON4A 3C1SA 3Q18A 1M3IA 1HQOA 4F03A 2AUVA 2P5QA 2QA2A 3J7Yb 4TR1A 2OE3A 2WB9A 4LLRA 4XS4B 4LMVA 2LSTA 1XWAA 4ECCA 1TTZA 3CTFA 1CQGA 4EKZA 1EP8A 2GZPA 2KP2A 4V2MA 4FYUA 1MDJA 4EC0A 4X0XA 2PERA 1JHBA 2X64A 2WRTA 5F05A 4XRAA 3QFAC 3ZMKA 1K3YA 2X8CA 4PNFA 2JACA 1V57A 3ERGA 6GSSA 4KB3A 6GSTA 1FAAA 1JZRA 1YJ6A 1O7UA 4KX4A 4ZILA 2L4QA 3O3TA 5EVOA 2IFQB 3F6DA 3IOSA 3EYTA 1U3IA 4NAXA 4HQZA 2VCQA 2VUPA 4IW9A 5GZZB 4N10A 3ME8A 1VRSD 3KIJA 1B48A 1WP0A 2LNTA 4FH8A 1O8WA 2YV7A 2C8UA 1V2AA 5IMDA 1TI1A 4MA9A 3C8EA 4F9ZA 5AIXA 2H1DA 2H1BA 4ID0A 3ERFA 3KCMA 2EIRA 4IVFA 1TXXA 3WGEA 5AGYA 2IN3A 5CNWA 4EUYA 1PN9A 5A4UA 4HZ4A 4V1Ap 3KXOA 5DQSA 3FZ5A 5DQYA 2FGXA 2CAQA 4HZ2A 4BVXA 4RI7A 1W4VA 3C73A 1K0OA 2MYGA 4NMUA 3O76A 1GNWA 6GSWA 2C1YA 3GYKA 3H1NA 2WCIA 4HQSA 2O89A 3IXRA 2OBIA 1YZXA 1T1VA 2R2JA 3EVIA 3TRXA 4GF0A 2VIMA 4MMMA 3VWVA 1QXHA 2HLSA 4XS4A 1TP9A 2PU9C 2A4HA 4GQFA 3L9UA 3RAZA 4KE3A 5LCZA 1XWBA 2YWMA 4BA7A 2DIYA 1Z6MA 1SKRB 1K0CA 17GSA 5IMFA 2AV4A 1M2AA 1OC9B 1C72A 4MJBA 2FUG2 2H01A 1Z6NA 2K18A 2JU5A 4AF2A 3UIWA 3DKSA 5D9VA 3O6TA 4EDZA 5INYA 3DVWA 3CXGA 3A2VA 1GH2A 1EOGA 3FK8A 1NSWA 1XWGA 4QQ7A 2GQLA 1F9MA 4ECIA 1BEDA 5DAKB 2N5AA 2YJ7A 4TXOB 5KN2A 3UVHA 2VL2A 4MLYA 4CY6A 2P5RA 3TCOA 1K0DA 2V41A 2HE3A 3W8JA 5HQPA 5KEJA 2H0GA 1BJXA 1XZOA 5G1KA 4KSMA 3RDWA 1U88A 5CRGA 1ZGNA 1HNAA 1FVKA 5GAND 1FB0A 5CAXA 2PUKC 1HNCA 1BYEA 4H86A 1XVQA 5IM9A 1LBKA 3TKQA 4WETA 4GTUA 1AQWA 3QPMA 5B8BA 3MDKA 3F63A 1SJZA 1O8XA 3IRAA 1TDIA 4I97A 2YZHA 3IBHA 2HRKA 1XOBA 1WJKA 5DCGA 5IIZA 1JFUA 4I5QA 1Z5YE 3L78A 2FWGA 3A2XA 2H6YA 1GUMA 3N9JA 5J5NA 5F06A 1T7PB 2FNOA 3VWWA 2V6KA 3LQ7A 5D9TA 1PKWA 2CQ9A 4XS6A 2GLRA 1O85A 5B7CA 1GNEA 2H71A 2GDRA 3VI7A 3CTGA 2B5YA 3W6GA 4MDCA 4HSCX 1VF4A 3D22A 2IPAA 3KTBA 4KW6A 2WULA 4KDXA 4O5UA 1PX7A 5J41A 2GT5A 1TU7A 5ECHB 2YWOA 5GSSA 3F4TA 4WF4A 3GV1A 1E6BA 1ERTA 3QDNA 5HR1A 1OC9A 2TRXA 5J9BA 2DBCA 2LRTA 2YWNA 2ES7A 3US3A 2O87A 1MD4A 3ED3A 3VURA 3UARA 1TRWA 4PUAA 2CVKA 2QSIA 3ZTLA 4WEYA 4TXOA 1LU4A 5D93A 4HI7A 3L9VA 1Q98A 4GSTA 3HVVA 2PWJA 4Q5NA 4OO4A 3KJYA 5D8IA 2MMOA 1DE1A 4O7HA 4MF7A 3ERWA 5A4WA 3DYRA 4ZB6A 5CRDA 5HFIA 1V9WA 1QMVA 1M9AA 1B9YC 3DVXA 3TJGA 2HXKA 2ZNMA 4AJ6A 5AIVA 3Q6OA 1N8JA 4K7IA 3UJ1A 1ACVA 2B5XA 3UVTA 1GSYA 2IIYA 3C1RA 2HRAA 4EF0A 1GSUA 3FY7A 3KD0A
chains in the Genus database with same CATH topology
1XW5A 4XIHA 4K1FA 4PUFC 3IAS2 4I2TA 5G31A 1M7TA 1X0RA 5GAPD 3DGQA 4G9HA 1X9MB 5ECRB 1ZOFA 4KSOA 2L4CA 4X1UA 3VWUA 1XFLA 3TJBA 2I81A 4PXOA 1PKZA 2V1MA 2R0PA 4ZBBA 4ZIJA 1TU8A 2HI7A 1JLVA 2VO4A 1ZMAA 1Z7PA 1IYHA 4K6XA 4AJ7A 1WE0A 3QAWA 2X4AA 1RK4A 2H19A 2P31A 2CVDA 5DALA 4YH2A 2GZYA 1G6WA 1XPVA 2NTOA 4LL1B 1ST9A 2DJ1A 4ICYA 3KH9A 1UVZA 1PA3A 4EL1A 3H93A 4Z2RA 5D73A 4JBBA 4JZQA 4AGSA 3BOAA 1IYIA 3MSZA 16GSA 3CYNA 5ID2A 4K0GA 2C3TA 3HA9A 3FZ4A 4NV5A 1MTCA 2FWEA 3I69A 5ECOB 1SK1A 1EV4A 4JEDA 1FB6A 1KNGA 18GSA 1SENA 1NW2A 1PX6A 1ZCPA 2XPDA 3G7YA 3KTLA 5L71A 3E9JB 1XWCA 3EURA 4K9ZA 1QFNA 2DMMA 2VCWA 4G2EA 1ZYPA 2GTUA 4OFMA 2VD0A 3S9FA 2CZ2A 2OE0A 1DE2A 2VL9A 4MPGA 2H72A 2F8FA 3SBCA 2K9FA 1A2JA 4RQXA 3FMWA 4HU7A 2DJJA 1OKDA 4WR5A 5JCUA 1SK0A 2KP1A 2CX3A 4HU9A 4MPFA 1QQ2A 2VCTA 1WRYA 1PN0A 3E3EA 4PGTA 4POLA 1UA5A 1NM3A 3L0HA 2BTOT 5F07A 5CYYA 5KN3A 3UL3A 2X8HA 2LKUA 1U6TA 2WJUA 5EL8A 6GSVA 3IE3A 2TIRA 3TGZA 1M0UA 3L9SA 1YKAA 2FLSA 4FYBA 5G1LA 2R3XA 4MH2A 3GIXA 3KH7A 2GGTA 5B6NA 4L5OA 2REMA 1OKTA 4P3YB 3HD5A 4NXIA 4IKHA 1K3OA 5CP1A 3I9V2 4LL4B 1QK8A 1XOAA 1OC3A 3TRQA 3HVSA 4EE0A 2ZUPA 5GSTA 2HRFA 2RIIA 1EP7A 4ZBAA 4EDYA 3FEUA 2PPTA 3CSJA 4NV2A 2R37A 2B7KA 4L0UA 3KP8A 4K2DA 1WMJA 1OC8A 3WYWA 3LORA 1X5CA 3QAVA 1YKCA 4K5SA 1O6JA 3FZ9A 2PMTA 2H1AA 2YPMA 4J56E 1M2BA 2I1UA 2VL3A 3TKPA 2C0EA 3ZVJA 4N11A 6GSUA 1V58A 4NWYA 5ABRA 4BVYB 1PGTA 2JL4A 2LS5A 3IC8A 3VI5A 2OE1A 2K8VA 8GSSA 5ECKB 5DDLA 2X49A 4IJIA 3P7XA 3WGXA 1GSDA 3EMPA 1XW6A 2DIZA 1A0RP 3BCKA 2QC7A 2LJRA 5KN1A 3TUEA 4FYCA 3EC3A 3D4TA 1S3AA 5B8AA 2HSMA 2WZ9A 3JCML 3IPZA 1X5DA 2PBJA 1GUHA 5ECQB 4OFNA 5F8BA 3M3MA 3FR3A 3APSA 2JZSA 4TRXA 4IGJA 4D73B 2R4VA 1FVJA 1FOHA 3KGKA 4Z7XA 2MZCA 3F8UA 1Y25A 2N5FA 4ML1A 2RM6A 2FY6A 4AJ8A 5BMUA 3GX0A 1GP1A 1GUKA 3UMAA 1N2AA 2YP6A 3RBTA 3PINA 2YJHA 4OCFA 3APOA 3VFIA 3IK7A 2XHFA 10GSA 5CREA 4YKGA 1I9DA 2OBKA 2K6VA 3W8SA 4F82A 2VM1A 3KM6A 6GSYA 3TKSC 1RW1A 1ZYNA 2CT6A 1K0AA 4EXJA 2XPEA 3FR9A 5G5EA 4DSSB 1EGOA 5DJLA 3MNGA 3CSHA 4TR3A 1M99A 3LG6A 1SJIA 2GSQA 2DJ0A 2MBSA 2L6CA 4BVYA 1TKDB 1GSSA 2HRNA 3N5OA 5FT3A 1Z7RA 2IFQA 4YQMA 2I3YA 3LGCA 2YV9A 4Z2TA 2LRNA 1SL2B 5DJMA 5D9WA 3LSZA 2E0QA 1VF2A 1EZKA 1ZZYA 4V1Ag 3RHCA 4YAVA 3I6AA 1TI3A 2F51A 3VK9A 3GFKA 3GKXA 2IMEA 3U6VA 4MJCA 3QD9A 3HJMA 3OR5A 1A8YA 2VLVA 4D73A 1AW9A 2DKIA 9GSSA 1Z3EA 1BQ7A 1B4QA 1MDKA 4XRDA 1PD21 4WKWA 2IMKA 3IV4A 3LYPA 2H30A 2QA1A 5KOWA 2JZRA 3GSSA 2HSYA 4KCAA 1G7OA 2DKHA 2B6MA 4CHSA 2V6OA 2RUFA 4ECBA 3IA1A 1PQNA 4MJAA 1A0FA 1KBNA 3CRUA 2ALBA 1GL8A 2CA8A 4PNGA 1S3CA 4IQAA 4MK3A 3ZMLA 2GQMA 5LNKe 1JLWA 5IPGA 4ILFA 2AB6A 2CX4A 2GSRA 3WGDA 2B7JA 5D9XA 1FO5A 4I8BA 3M9KA 3D4MA 1GTAA 2LRCA 4Q5RA 1UC7A 2AYTA 2WFCA 2ZCTA 3Q74A 2GS3A 4ZL7A 3MIXA 3IDVA 4IP1A 3UAPA 3DXBA 1DUGA 2OACA 3HCZA 4EIQA 4OCEA 4J2FA 13GSA 2YCDA 5DAKA 3FRCA 4N30A 1USBA 3UOMA 3FW2A 2E2GA 2B1KA 4CDOA 2JADA 2L57A 1K3LA 1BG5A 3HYPA 4O5QA 4BPYA 2WS2A 3G7JA 4QL9A 4K2XA 4OD7A 5J3RA 3M9JA 1F6MC 3EINA 4G0KA 2H6XA 4A5PA 5JWOB 3D0ZA 3CBUA 6GSXA 1GRXA 1SL1B 2JSZA 3PGTA 1HNBA 2E2MA 4MZWA 3LFLA 3HZ4A 4GQCA 2LJAA 4NHWA 3VLNA 5IMVA 4MF5A 3TKRA 1SKWB 3LXTA 22GSA 1FG4A 4YKFA 2AJQB 5IMZA 2B5EA 2WDUA 4ACSA 4JE1A 4NPBA 2XBQA 4F0BA 3HJOA 2NBSA 4EVMA 4WBJA 5EY6A 2GZZA 3ZREA 1U3AA 4PTSA 3GKMA 2A2RA 4XTSA 5G5FA 5KN0A 1K0BA 2DSAA 1XWKA 2XBIA 4IP6A 2I9HA 2UZ8A 1HD2A 3HKRA 1FOVA 1ERWA 4KNDA 2MMZA 5IMCA 4BL7B 1J08A 4GCIA 2VLUA 3E0UA 4TR0A 4DEJA 4OWYA 2H74A 5IO2A 1O81A 1KTEA 3ZIVA 2BMXA 4ZB9A 4EIPA 5A4VA 3HJPA 4F0CA 3CRTA 4KH7A 3ZVJD 1THOA 2I4AA 1NHYA 2CAIA 2FWHA 4QL7A 4IHUA 5J4UA 4KDUA 1GLQA 3KMNA 3UBLA 5ECSA 2DC5A 3GTUB 1YEXA 1KEBA 4PQIA 3APQA 1WPIA 5JWQB 3F6FA 3P2AA 5DBQA 2LEGA 4KDYA 4N0VA 3IR4A 4G10A 4DSRA 4KAEA 2L5LA 5COHA 1JZOA 2OA7A 5LD0A 3GKNA 4LMWA 5AISA 5HR3A 5F0GA 1XXUA 2YOIA 1TOFA 1QUWA 2VLTA 3GL5A 3LWAA 3GUSA 3VPTA 5ECMB 4TVEA 2YWIA 2P0GA 1YDKA 1SL0B 4OFTA 1J9BA 3ISOA 3ZYWA 1TRUA 3ZZXA 3A2WA 2L6DA 3EWLA 2X8GA 5IOXA 3GN3A 2L5OA 2EC4A 3IAM2 4K7NA 4XCSA 1W89A 4RUVA 3L4NA 2E7PA 4CW9A 4I2UA 1EV9A 1M9BA 1UN2A 2MMNA 3ZFBA 3PR8A 4ZL9A 2G0FA 1G6YA 2D2ZA 2O8VB 4BWQA 1AC1A 3QR6A 3M8NA 3ZITA 2MMAA 1ILOA 3AY8A 1R4WA 2NDOA 1MDIA 4O32A 2J23A 4OO5A 4HOJA 3CMIA 2JZTA 5CRWA 2WGRA 4MNNA 1H4OA 1CQHA 3LYKA 3EMXA 3NZNA 3ZIJA 3U5RE 4LA1A 5IMAA 5EPFA 3KP9A 4JRRA 2FHEA 3TJJA 2IL3A 4JU5A 3BBYA 3RHBA 4CY8A 1VF3A 3GTUA 3GX8A 4BVXB 4J57E 2OADA 2EIQA 2H0IA 3IC4A 2XC2A 3G9BA 4KA0A 2YZUA 3M0FA 2GSSA 2J9HA 1PMTA 2IWTA 2HNLA 3IHQA 5HR2A 2LV3A 1GTIA 1XCCA 3QMXA 2H66A 3QOUA 4K8MA 3F0IA 2HZEB 2VCXA 1SJ6A 1GSQA 1MD3A 3V1WA 1PSQA 2C3QA 1EOHA 4BWSA 1OYJA 5H5QA 2GVPA 2M72A 3FKFA 4JR6A 2O7KA 2PN8A 2RM5A 4GLTA 4XS1A 3F9UA 2VAFA 3D21A 4ZL8A 5HFGA 2ON5A 3LW9A 2CZ3A 4Q5QA 3TKSE 2A4VA 3GL3A 2VD1A 3FR6A 4YQVA 1YQ1A 2LTKA 3BJ5A 3TDGA 1OE8A 1R5AA 2LQOA 3GKKA 4GSNA 1SD9A 2C80A 11GSA 1TK0B 3K8NA 3HDCA 3UEMA 4DSQA 3TKSA 2Z9SA 3QAGA 4MABA 5H5RA 2C0DA 2H1GA 5AN1A 3MAKA 4HEA2 1WWJA 1SYRA 2R5GA 2K8SA 3IK9A 4KGIA 4L8EA 3P90A 3GSTA 4YAPA 4MCUA 1G7EA 3BD2A 1T3BA 2FA8A 1F3AA 1YF0A 5JWRB 4ZBDA 4G0IA 3MYDA 4MZCA 4ZB8A 2H6ZA 1FHEA 1TRVA 1GWCA 1NHOA 4G19A 1AIUA 3F4RA 2GQKA 4X43A 5HR0A 2VCZA 3A5WA 1Y6EA 2A2SA 4TR4A 4ECJA 2HZEA 1XIYA 2CVBA 2DJ3A 3NIVA 4USSA 1T00A 4ISDA 4I6XA 3TRPA 1EWXA 4NHZA 1R5PA 4HS1A 2H0HA 2VM2A 4ML6A 3RPNA 1WOUA 3QCPA 1Q4JA 2OKAA 1URMA 1EGRA 2DJ2A 19GSA 1SKSB 2F3MA 3D5JA 4TXVA 1V98A 2JSYA 1B9XC 2FCHA 3TJKA 1V40A 1OE7A 2KHPA 3DRNA 1XVWA 4XHMA 3ZFLA 5DCHA 5JCGA 3UBKA 1GSEA 2QKEA 2LUSA 5CO3A 3EE2A 5G2ZA 3SWLA 2YN1A 1GTUA 5ECPB 3KZQA 3DMLA 3FHKA 2H8LA 2V32A 2YANA 1XBSA 5DVBA 2HYXA 1X9WB 1QGVA 4IS0A 3HZ8A 1A8LA 2LJKA 2VL2C 4L0WA 3FYGA 3HVXA 1A2LA 4O92A 3GMFA 1GLPA 4PQHA 1X9SB 3VWXA 4WF5A 1F37A 2G2QA 2AAWA 2H75A 1XW9A 3F4SA 3DEXA 1FW1A 1ZYQB 2IMDA 1LJRA 4K7OA 1TW9A 2HFDA 1AXDA 2A2PA 1SD8A 2F8AA 2FD3A 3DD3A 3A3TA 2EIOA 4PQ1A 1DSBA 4DSSA 3TOUA 4POBA 4TOPA 2C4JA 1K0MA 1ML6A 2PVOC 3I43A 2N5BA 1ZYEA 5IQYA 1E2YA 1PRXA 1AAZA 3HXSA 1YF1A 3NOFA 5E4WA 1G0TA 3C71A 3EPTA 3DIEA 3P8WA 2LNSA 5DALB 4PX1A 5J9CA 3H4KA 1BAYA 1AUCA 4Q5FA 4DVCA 4TW5A 3M1GA 1GTBA 3HHVA 5A5KA 1ZL9A 2IMFA 3EU4A 2KOKA 4N0ZA 2KUCA 4KF9A 5KOXA 5ID2B 5IOWA 1AQXA 4E8EA 1R7HA 5JCWA 3G7IA 4FO5A 4IBPA 1A24A 3ME7A 2NPBA 1OVNA 2LQQA 2AHEA 2PVQA 3Q19A 2HZFA 1PL2A 1O73A 4OMVA 2MBTA 4FIWA 2RLIA 1HYUA 2CV4A 3LXZA 3LEFA 1Z9HA 2FA4A 14GSA 2L59A 2OJLA 4V2NA 3R3EA 3QFBC 4KCEA 3GH6A 4WBRD 1RQMA 5CRHA 3KMOA 3TJFA 2B1LA 2R0CA 2C0FA 5ENUA 2QGVA 1WIKA 1YY7A 1ABAA 3HY2A 20GSA 4GWRA 2GSTA 3EU3A 3CSIA 4X4JA 2H76A 1VGLA 3GNJA 4MZBA 2FWFA 3H79A 4JR4A 1GULA 5C04A 3A5IA 3ZRDA 3VPQA 4POMA 2V2GA 3D6IA 5ELGA 5BRTA 4GRFA 4RQRA 4L5LA 12GSA 2VOCA 3WT1A 1F3BA 5FWGA 4K0NA 1BX9A 2F9SA 4HDEA 1TK5B 3KEBA 3IHGA 2M80A 5HFKA 2YNXA 3MWHA 4MP4A 4EO3A 2R0GA 1TRSA 4F2IA 3GH9A 1OAZA 2HT9A 5ELAA 3H8QA 1ERVA 2NVLA 5E59A 1F2EA 3WT2A 4TR1B 3WD6A 1EEMA 4MF6A 2GT6A 4TKYA 4IELA 1JZWA 2HSHA 4MJEA 4K5RA 3ZL5A 4IN0A 1JZDA 3PPUA 3C7MA 3BCIA 1M2DA 4HUAA 1T8EB 1MEKA 4WR4A 4HJMA 3R2QA 3F3RA 4E8HA 1EEJA 1DBYA 1T4ZA 5ECLB 1X5EA 1A2MA 1SU9A 1B4PA 2IMIA 4WXTA 1PL1A 4TN8A 2B3SA 1VF1A 3GURA 1J0FA 5ECIB 4RI6A 3F3QA 2PGTA 2DLXA 4MH3A 2C3NA 3PH9A 1TK8B 1SYXA 1T4YA 2O85A 2BJXA 2IJYA 4POKA 1K0NA 3DWVA 4IJ3A 3GHAA 1R26A 1GSFA 3TOTA 4BL7A 4PURA 4ZXGA 4GXZA 5FHIA 5H5SA 4YQUA 3ZLPA 5IPHA 4GSSA 2X99A 4FQUA 1B8XA 4ULXA 1AQVA 4Z2UA 5B6MA 2TRCP 5D96A 2DJKA 3TB2A 2KLXA 2RUEA 2R6KA 3LJRA 1YEPA 1THXA 1TJDA 2H73A 5ECNB 3J7Yk 2H70A 2DMLA 3GRXA 4O5RA 2C0GA 4V2LA 7GSSA 4HJ2A 4G0LA 1SK2A 3FZAA 2M46A 5IO0A 3GA4A 1I5GA 2VCVA 1H75A 1S3DA 3RPPA 4IQ1A 5C00A 1U87A 1ERUA 4KUNA 2ON7A 1A23A 5G30A 1ON4A 3C1SA 3Q18A 1HQOA 4F03A 2AUVA 2P5QA 2QA2A 3J7Yb 4TR1A 2OE3A 2WB9A 4LLRA 4XS4B 4LMVA 2LSTA 1XWAA 4ECCA 1TTZA 3CTFA 1CQGA 4EKZA 1EP8A 2GZPA 2KP2A 4V2MA 4FYUA 1MDJA 4EC0A 4X0XA 2PERA 1JHBA 2X64A 2WRTA 5F05A 4XRAA 3QFAC 3ZMKA 1K3YA 2X8CA 4PNFA 2JACA 1V57A 3ERGA 6GSSA 4KB3A 6GSTA 1FAAA 1JZRA 1YJ6A 1O7UA 4KX4A 4ZILA 2L4QA 3O3TA 5EVOA 2IFQB 3F6DA 3IOSA 3EYTA 1U3IA 4NAXA 4HQZA 2VCQA 2VUPA 4IW9A 5GZZB 4N10A 3ME8A 1VRSD 3KIJA 1B48A 1WP0A 2LNTA 4FH8A 1O8WA 2YV7A 2C8UA 1V2AA 5IMDA 1TI1A 4MA9A 3C8EA 4F9ZA 5AIXA 2H1DA 2H1BA 4ID0A 3ERFA 3KCMA 2EIRA 4IVFA 1TXXA 3WGEA 5AGYA 2IN3A 5CNWA 4EUYA 1PN9A 5A4UA 4HZ4A 4V1Ap 3KXOA 5DQSA 3FZ5A 5DQYA 2FGXA 2CAQA 4HZ2A 4BVXA 4RI7A 1W4VA 3C73A 1K0OA 2MYGA 4NMUA 3O76A 1GNWA 6GSWA 2C1YA 3GYKA 3H1NA 2WCIA 4HQSA 2O89A 3IXRA 2OBIA 1YZXA 1T1VA 2R2JA 3EVIA 3TRXA 4GF0A 2VIMA 4MMMA 3VWVA 1QXHA 2HLSA 4XS4A 1TP9A 2PU9C 2A4HA 4GQFA 3L9UA 3RAZA 4KE3A 5LCZA 1XWBA 2YWMA 4BA7A 2DIYA 1Z6MA 1SKRB 1K0CA 17GSA 5IMFA 2AV4A 1M2AA 1OC9B 1C72A 4MJBA 2FUG2 2H01A 1Z6NA 2K18A 2JU5A 4AF2A 3UIWA 3DKSA 5D9VA 3O6TA 4EDZA 5INYA 3DVWA 3CXGA 3A2VA 1GH2A 1EOGA 3FK8A 1NSWA 1XWGA 4QQ7A 2GQLA 1F9MA 4ECIA 1BEDA 5DAKB 2N5AA 2YJ7A 4TXOB 5KN2A 3UVHA 2VL2A 4MLYA 4CY6A 2P5RA 3TCOA 1K0DA 2V41A 2HE3A 3W8JA 5HQPA 5KEJA 2H0GA 1BJXA 1XZOA 5G1KA 4KSMA 3RDWA 1U88A 5CRGA 1ZGNA 1HNAA 1FVKA 5GAND 1FB0A 5CAXA 2PUKC 1HNCA 1BYEA 4H86A 1XVQA 5IM9A 1LBKA 3TKQA 4WETA 4GTUA 1AQWA 3QPMA 5B8BA 3MDKA 3F63A 1SJZA 1O8XA 3IRAA 1TDIA 4I97A 2YZHA 3IBHA 2HRKA 1XOBA 1WJKA 5DCGA 5IIZA 1JFUA 4I5QA 1Z5YE 3L78A 2FWGA 3A2XA 2H6YA 1GUMA 3N9JA 5J5NA 5F06A 1T7PB 2FNOA 3VWWA 2V6KA 3LQ7A 5D9TA 1PKWA 2CQ9A 4XS6A 2GLRA 1O85A 5B7CA 1GNEA 2H71A 2GDRA 3VI7A 3CTGA 2B5YA 3W6GA 4MDCA 1VF4A 3D22A 2IPAA 3KTBA 4KW6A 2WULA 4KDXA 4O5UA 1PX7A 5J41A 2GT5A 1TU7A 5ECHB 2YWOA 5GSSA 3F4TA 4WF4A 3GV1A 1E6BA 1ERTA 3QDNA 5HR1A 1OC9A 2TRXA 5J9BA 2DBCA 2LRTA 2YWNA 2ES7A 3US3A 2O87A 1MD4A 3ED3A 3VURA 3UARA 1TRWA 4PUAA 2CVKA 2QSIA 3ZTLA 4WEYA 4TXOA 1LU4A 5D93A 4HI7A 3L9VA 1Q98A 4GSTA 3HVVA 2PWJA 4Q5NA 4OO4A 3KJYA 5D8IA 2MMOA 1DE1A 4O7HA 4MF7A 3ERWA 5A4WA 3DYRA 4ZB6A 5CRDA 5HFIA 1V9WA 1QMVA 1M9AA 1B9YC 3DVXA 3TJGA 2HXKA 2ZNMA 4AJ6A 5AIVA 3Q6OA 1N8JA 4K7IA 3UJ1A 1ACVA 2B5XA 3UVTA 1GSYA 2IIYA 3C1RA 2HRAA 4EF0A 1GSUA 3FY7A 3KD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XW5 A;  4XIH A;  4K1F A;  4PUF C;  3IAS 2;  4I2T A;  5G31 A;  1M7T A;  1X0R A;  5GAP D;  3DGQ A;  4G9H A;  1X9M B;  5ECR B;  1ZOF A;  4KSO A;  2L4C A;  4X1U A;  3VWU A;  1XFL A;  3TJB A;  2I81 A;  4PXO A;  1PKZ A;  2V1M A;  4ZBB A;  4ZIJ A;  1TU8 A;  2HI7 A;  1JLV A;  2VO4 A;  1ZMA A;  1Z7P A;  1IYH A;  4K6X A;  4AJ7 A;  1WE0 A;  3QAW A;  1RK4 A;  2H19 A;  2P31 A;  2CVD A;  5DAL A;  4YH2 A;  2GZY A;  1G6W A;  1XPV A;  2NTO A;  4LL1 B;  1ST9 A;  2DJ1 A;  3KH9 A;  1UVZ A;  1PA3 A;  4EL1 A;  3H93 A;  5D73 A;  4JBB A;  4JZQ A;  4AGS A;  3BOA A;  1IYI A;  3MSZ A;  16GS A;  3CYN A;  5ID2 A;  4K0G A;  2C3T A;  3HA9 A;  3FZ4 A;  4NV5 A;  1MTC A;  2FWE A;  3I69 A;  5ECO B;  1SK1 A;  1EV4 A;  4JED A;  1FB6 A;  1KNG A;  18GS A;  1SEN A;  1NW2 A;  1PX6 A;  1ZCP A;  2XPD A;  3G7Y A;  3KTL A;  5L71 A;  3E9J B;  1XWC A;  3EUR A;  4K9Z A;  1QFN A;  2DMM A;  2VCW A;  4G2E A;  2GTU A;  4OFM A;  2VD0 A;  3S9F A;  2CZ2 A;  2OE0 A;  1DE2 A;  2VL9 A;  4MPG A;  2H72 A;  2F8F A;  3SBC A;  2K9F A;  1A2J A;  4RQX A;  4HU7 A;  2DJJ A;  1OKD A;  4WR5 A;  5JCU A;  1SK0 A;  2KP1 A;  2CX3 A;  4HU9 A;  4MPF A;  1QQ2 A;  2VCT A;  1WRY A;  3E3E A;  4PGT A;  4POL A;  1UA5 A;  1NM3 A;  3L0H A;  2BTO T;  5F07 A;  5CYY A;  5KN3 A;  3UL3 A;  2X8H A;  2LKU A;  1U6T A;  2WJU A;  5EL8 A;  6GSV A;  3IE3 A;  2TIR A;  3TGZ A;  1M0U A;  3L9S A;  1YKA A;  2FLS A;  4FYB A;  5G1L A;  2R3X A;  4MH2 A;  3GIX A;  3KH7 A;  2GGT A;  5B6N A;  4L5O A;  2REM A;  1OKT A;  4P3Y B;  3HD5 A;  4NXI A;  4IKH A;  1K3O A;  5CP1 A;  3I9V 2;  4LL4 B;  1QK8 A;  1XOA A;  1OC3 A;  3TRQ A;  3HVS A;  4EE0 A;  2ZUP A;  5GST A;  2HRF A;  2RII A;  1EP7 A;  4ZBA A;  4EDY A;  3FEU A;  2PPT A;  3CSJ A;  4NV2 A;  2R37 A;  2B7K A;  4L0U A;  3KP8 A;  4K2D A;  1WMJ A;  1OC8 A;  3WYW A;  3LOR A;  1X5C A;  3QAV A;  1YKC A;  1O6J A;  3FZ9 A;  2PMT A;  2H1A A;  2YPM A;  4J56 E;  1M2B A;  2I1U A;  2VL3 A;  3TKP A;  2C0E A;  3ZVJ A;  4N11 A;  6GSU A;  1V58 A;  4NWY A;  5ABR A;  1PGT A;  2JL4 A;  2LS5 A;  3VI5 A;  2OE1 A;  2K8V A;  8GSS A;  5ECK B;  5DDL A;  4IJI A;  3P7X A;  3WGX A;  1GSD A;  3EMP A;  1XW6 A;  2DIZ A;  1A0R P;  3BCK A;  2QC7 A;  2LJR A;  5KN1 A;  3TUE A;  4FYC A;  3EC3 A;  3D4T A;  1S3A A;  5B8A A;  2WZ9 A;  3JCM L;  3IPZ A;  1X5D A;  2PBJ A;  1GUH A;  5ECQ B;  4OFN A;  5F8B A;  3M3M A;  3FR3 A;  3APS A;  2JZS A;  4TRX A;  4IGJ A;  4D73 B;  2R4V A;  1FVJ A;  3KGK A;  3F8U A;  2MZC A;  4Z7X A;  1Y25 A;  2N5F A;  4ML1 A;  2RM6 A;  2FY6 A;  4AJ8 A;  3GX0 A;  1GP1 A;  1GUK A;  3UMA A;  1N2A A;  2YP6 A;  3RBT A;  3PIN A;  2YJH A;  4OCF A;  3APO A;  3VFI A;  3IK7 A;  2XHF A;  10GS A;  5CRE A;  1I9D A;  2OBK A;  2K6V A;  3W8S A;  4F82 A;  2VM1 A;  3KM6 A;  6GSY A;  3TKS C;  1RW1 A;  2CT6 A;  1K0A A;  4EXJ A;  2XPE A;  3FR9 A;  5G5E A;  4DSS B;  1EGO A;  5DJL A;  3MNG A;  3CSH A;  4TR3 A;  1M99 A;  3LG6 A;  1SJI A;  2GSQ A;  2DJ0 A;  2MBS A;  2L6C A;  4BVY A;  1TKD B;  1GSS A;  2HRN A;  3N5O A;  5FT3 A;  1Z7R A;  2IFQ A;  4YQM A;  2I3Y A;  3LGC A;  2YV9 A;  2LRN A;  1SL2 B;  5DJM A;  5D9W A;  3LSZ A;  2E0Q A;  1VF2 A;  1EZK A;  1ZZY A;  4V1A g;  3RHC A;  4YAV A;  3I6A A;  1TI3 A;  2F51 A;  3VK9 A;  3GFK A;  3GKX A;  2IME A;  3U6V A;  4MJC A;  3QD9 A;  3HJM A;  3OR5 A;  1A8Y A;  2VLV A;  4D73 A;  1AW9 A;  9GSS A;  1Z3E A;  1BQ7 A;  1B4Q A;  1MDK A;  4XRD A;  1PD2 1;  4WKW A;  2IMK A;  3IV4 A;  3LYP A;  2H30 A;  2JZR A;  3GSS A;  2HSY A;  4KCA A;  1G7O A;  2B6M A;  4CHS A;  2V6O A;  2RUF A;  4ECB A;  3IA1 A;  1PQN A;  4MJA A;  1A0F A;  1KBN A;  3CRU A;  2ALB A;  1GL8 A;  2CA8 A;  4PNG A;  1S3C A;  4IQA A;  4MK3 A;  3ZML A;  2GQM A;  5LNK e;  1JLW A;  5IPG A;  4ILF A;  2AB6 A;  2CX4 A;  2GSR A;  3WGD A;  2B7J A;  5D9X A;  1FO5 A;  4I8B A;  3M9K A;  3D4M A;  1GTA A;  2LRC A;  4Q5R A;  1UC7 A;  2AYT A;  2WFC A;  2ZCT A;  3Q74 A;  2GS3 A;  4ZL7 A;  3IDV A;  4IP1 A;  3UAP A;  3DXB A;  1DUG A;  2OAC A;  3HCZ A;  4OCE A;  4J2F A;  13GS A;  2YCD A;  5DAK A;  3FRC A;  4N30 A;  1USB A;  3UOM A;  3FW2 A;  2E2G A;  2B1K A;  4CDO A;  2JAD A;  2L57 A;  1K3L A;  1BG5 A;  3HYP A;  4BPY A;  2WS2 A;  3G7J A;  4QL9 A;  4OD7 A;  5J3R A;  3M9J A;  1F6M C;  3EIN A;  2H6X A;  5JWO B;  3D0Z A;  3CBU A;  6GSX A;  1GRX A;  1SL1 B;  2JSZ A;  3PGT A;  1HNB A;  2E2M A;  4MZW A;  3LFL A;  3HZ4 A;  4GQC A;  2LJA A;  4NHW A;  3VLN A;  5IMV A;  4MF5 A;  3TKR A;  1SKW B;  3LXT A;  22GS A;  1FG4 A;  2AJQ B;  5IMZ A;  2B5E A;  2WDU A;  4ACS A;  4JE1 A;  4NPB A;  2XBQ A;  4F0B A;  3HJO A;  2NBS A;  4EVM A;  4WBJ A;  5EY6 A;  2GZZ A;  3ZRE A;  1U3A A;  3GKM A;  2A2R A;  4XTS A;  5G5F A;  5KN0 A;  1K0B A;  2DSA A;  1XWK A;  2XBI A;  4IP6 A;  2I9H A;  1HD2 A;  3HKR A;  1FOV A;  1ERW A;  4KND A;  2MMZ A;  5IMC A;  1J08 A;  4GCI A;  2VLU A;  3E0U A;  4TR0 A;  4DEJ A;  4OWY A;  2H74 A;  5IO2 A;  1O81 A;  1KTE A;  3ZIV A;  2BMX A;  4ZB9 A;  5A4V A;  3HJP A;  4F0C A;  3CRT A;  4KH7 A;  3ZVJ D;  1THO A;  2I4A A;  1NHY A;  2CAI A;  2FWH A;  4QL7 A;  4IHU A;  5J4U A;  4KDU A;  1GLQ A;  3KMN A;  3UBL A;  5ECS A;  2DC5 A;  3GTU B;  1YEX A;  1KEB A;  4PQI A;  3APQ A;  1WPI A;  5JWQ B;  3F6F A;  3P2A A;  5DBQ A;  2LEG A;  4KDY A;  4N0V A;  3IR4 A;  4G10 A;  4DSR A;  4KAE A;  2L5L A;  5COH A;  1JZO A;  2OA7 A;  5LD0 A;  3GKN A;  4LMW A;  5AIS A;  5HR3 A;  5F0G A;  1XXU A;  2YOI A;  1TOF A;  1QUW A;  2VLT A;  3GL5 A;  3LWA A;  3GUS A;  3VPT A;  5ECM B;  4TVE A;  2YWI A;  2P0G A;  1YDK A;  1SL0 B;  4OFT A;  1J9B A;  3ISO A;  3ZYW A;  1TRU A;  3ZZX A;  3A2W A;  2L6D A;  3EWL A;  2X8G A;  5IOX A;  3GN3 A;  2L5O A;  2EC4 A;  3IAM 2;  4K7N A;  4XCS A;  1W89 A;  4RUV A;  3L4N A;  2E7P A;  4CW9 A;  4I2U A;  1EV9 A;  1M9B A;  1UN2 A;  2MMN A;  3ZFB A;  3PR8 A;  4ZL9 A;  2G0F A;  1G6Y A;  2D2Z A;  2O8V B;  4BWQ A;  1AC1 A;  3QR6 A;  3M8N A;  3ZIT A;  2MMA A;  1ILO A;  3AY8 A;  1R4W A;  2NDO A;  1MDI A;  4O32 A;  2J23 A;  4OO5 A;  4HOJ A;  3CMI A;  2JZT A;  5CRW A;  2WGR A;  1H4O A;  1CQH A;  3LYK A;  3EMX A;  3NZN A;  3ZIJ A;  3U5R E;  4LA1 A;  5IMA A;  5EPF A;  3KP9 A;  4JRR A;  2FHE A;  3TJJ A;  2IL3 A;  4JU5 A;  3BBY A;  3RHB A;  1VF3 A;  3GTU A;  3GX8 A;  4J57 E;  2OAD A;  2EIQ A;  2H0I A;  3IC4 A;  2XC2 A;  3G9B A;  4KA0 A;  2YZU A;  3M0F A;  2GSS A;  2J9H A;  1PMT A;  2IWT A;  2HNL A;  3IHQ A;  5HR2 A;  2LV3 A;  1GTI A;  1XCC A;  3QMX A;  2H66 A;  3QOU A;  4K8M A;  3F0I A;  2HZE B;  2VCX A;  1SJ6 A;  1GSQ A;  1MD3 A;  3V1W A;  1PSQ A;  2C3Q A;  1EOH A;  4BWS A;  1OYJ A;  5H5Q A;  2GVP A;  2M72 A;  3FKF A;  4JR6 A;  2O7K A;  2PN8 A;  2RM5 A;  4GLT A;  4XS1 A;  3F9U A;  2VAF A;  3D21 A;  4ZL8 A;  5HFG A;  2ON5 A;  2CZ3 A;  4Q5Q A;  3TKS E;  2A4V A;  3GL3 A;  2VD1 A;  3FR6 A;  4YQV A;  1YQ1 A;  2LTK A;  3BJ5 A;  3TDG A;  1OE8 A;  1R5A A;  2LQO A;  3GKK A;  4GSN A;  1SD9 A;  2C80 A;  11GS A;  1TK0 B;  3K8N A;  3HDC A;  3UEM A;  4DSQ A;  3TKS A;  2Z9S A;  3QAG A;  4MAB A;  5H5R A;  2C0D A;  2H1G A;  5AN1 A;  3MAK A;  4HEA 2;  1WWJ A;  1SYR A;  2R5G A;  2K8S A;  3IK9 A;  4KGI A;  4L8E A;  3P90 A;  3GST A;  4YAP A;  4MCU A;  1G7E A;  3BD2 A;  1T3B A;  2FA8 A;  1F3A A;  1YF0 A;  5JWR B;  4ZBD A;  4MZC A;  4ZB8 A;  2H6Z A;  1FHE A;  1TRV A;  1GWC A;  1NHO A;  4G19 A;  1AIU A;  3F4R A;  2GQK A;  4X43 A;  5HR0 A;  2VCZ A;  3A5W A;  1Y6E A;  2A2S A;  4TR4 A;  4ECJ A;  2HZE A;  1XIY A;  2CVB A;  2DJ3 A;  3NIV A;  1T00 A;  4ISD A;  4I6X A;  3TRP A;  1EWX A;  4NHZ A;  1R5P A;  4HS1 A;  2H0H A;  2VM2 A;  4ML6 A;  3RPN A;  1WOU A;  3QCP A;  1Q4J A;  2OKA A;  1URM A;  1EGR A;  2DJ2 A;  19GS A;  1SKS B;  2F3M A;  3D5J A;  4TXV A;  1V98 A;  2JSY A;  1B9X C;  2FCH A;  3TJK A;  1V40 A;  1OE7 A;  2KHP A;  3DRN A;  1XVW A;  4XHM A;  3ZFL A;  5DCH A;  5JCG A;  3UBK A;  1GSE A;  2QKE A;  2LUS A;  5CO3 A;  3EE2 A;  5G2Z A;  3SWL A;  2YN1 A;  1GTU A;  5ECP B;  3KZQ A;  3DML A;  3FHK A;  2H8L A;  2V32 A;  2YAN A;  1XBS A;  5DVB A;  2HYX A;  1X9W B;  1QGV A;  4IS0 A;  3HZ8 A;  1A8L A;  2LJK A;  2VL2 C;  4L0W A;  3FYG A;  3HVX A;  1A2L A;  4O92 A;  3GMF A;  1GLP A;  4PQH A;  1X9S B;  3VWX A;  4WF5 A;  1F37 A;  2G2Q A;  2AAW A;  2H75 A;  1XW9 A;  3F4S A;  3DEX A;  1FW1 A;  1ZYQ B;  2IMD A;  1LJR A;  4K7O A;  1TW9 A;  2HFD A;  1AXD A;  1SD8 A;  2F8A A;  2FD3 A;  3DD3 A;  3A3T A;  2EIO A;  4PQ1 A;  1DSB A;  4DSS A;  3TOU A;  4POB A;  4TOP A;  2C4J A;  1K0M A;  1ML6 A;  2PVO C;  3I43 A;  2N5B A;  1ZYE A;  5IQY A;  1E2Y A;  1PRX A;  1AAZ A;  3HXS A;  1YF1 A;  3NOF A;  5E4W A;  1G0T A;  3C71 A;  3DIE A;  3P8W A;  2LNS A;  5DAL B;  4PX1 A;  5J9C A;  3H4K A;  1BAY A;  1AUC A;  4Q5F A;  4DVC A;  4TW5 A;  3M1G A;  1GTB A;  3HHV A;  5A5K A;  1ZL9 A;  2IMF A;  3EU4 A;  2KOK A;  4N0Z A;  2KUC A;  5ID2 B;  5IOW A;  1AQX A;  4E8E A;  1R7H A;  5JCW A;  3G7I A;  4FO5 A;  4IBP A;  1A24 A;  3ME7 A;  2NPB A;  1OVN A;  2LQQ A;  2AHE A;  2PVQ A;  3Q19 A;  2HZF A;  1PL2 A;  1O73 A;  4OMV A;  2MBT A;  4FIW A;  2RLI A;  1HYU A;  2CV4 A;  3LXZ A;  3LEF A;  1Z9H A;  2FA4 A;  14GS A;  2L59 A;  2OJL A;  4V2N A;  3QFB C;  4KCE A;  3GH6 A;  4WBR D;  1RQM A;  5CRH A;  3KMO A;  3TJF A;  2B1L A;  2C0F A;  5ENU A;  2QGV A;  1WIK A;  1YY7 A;  1ABA A;  3HY2 A;  20GS A;  4GWR A;  2GST A;  3EU3 A;  3CSI A;  2H76 A;  1VGL A;  3GNJ A;  4MZB A;  2FWF A;  3H79 A;  4JR4 A;  1GUL A;  5C04 A;  3ZRD A;  3VPQ A;  4POM A;  2V2G A;  3D6I A;  5ELG A;  4GRF A;  4RQR A;  4L5L A;  12GS A;  2VOC A;  3WT1 A;  1F3B A;  5FWG A;  4K0N A;  1BX9 A;  2F9S A;  4HDE A;  1TK5 B;  3KEB A;  2M80 A;  5HFK A;  2YNX A;  3MWH A;  4MP4 A;  4EO3 A;  1TRS A;  4F2I A;  3GH9 A;  1OAZ A;  2HT9 A;  5ELA A;  3H8Q A;  1ERV A;  2NVL A;  5E59 A;  1F2E A;  3WT2 A;  4TR1 B;  3WD6 A;  1EEM A;  4MF6 A;  2GT6 A;  4TKY A;  4IEL A;  1JZW A;  2HSH A;  4MJE A;  3ZL5 A;  4IN0 A;  1JZD A;  3C7M A;  3BCI A;  1M2D A;  4HUA A;  1T8E B;  1MEK A;  4WR4 A;  4HJM A;  3R2Q A;  3F3R A;  4E8H A;  1EEJ A;  1DBY A;  1T4Z A;  5ECL B;  1X5E A;  1A2M A;  1SU9 A;  1B4P A;  2IMI A;  4WXT A;  1PL1 A;  4TN8 A;  2B3S A;  1VF1 A;  3GUR A;  1J0F A;  5ECI B;  4RI6 A;  3F3Q A;  2PGT A;  2DLX A;  4MH3 A;  2C3N A;  3PH9 A;  1TK8 B;  1SYX A;  1T4Y A;  2O85 A;  2BJX A;  2IJY A;  4POK A;  1K0N A;  3DWV A;  4IJ3 A;  3GHA A;  1R26 A;  1GSF A;  3TOT A;  4BL7 A;  4PUR A;  4ZXG A;  4GXZ A;  5FHI A;  5H5S A;  4YQU A;  3ZLP A;  5IPH A;  4GSS A;  2X99 A;  1B8X A;  4ULX A;  1AQV A;  5B6M A;  2TRC P;  5D96 A;  2DJK A;  3TB2 A;  2KLX A;  2RUE A;  2R6K A;  3LJR A;  1YEP A;  1THX A;  1TJD A;  2H73 A;  5ECN B;  3J7Y k;  2H70 A;  2DML A;  3GRX A;  4O5R A;  2C0G A;  4V2L A;  7GSS A;  4HJ2 A;  1SK2 A;  3FZA A;  2M46 A;  5IO0 A;  3GA4 A;  1I5G A;  2VCV A;  1H75 A;  1S3D A;  3RPP A;  4IQ1 A;  5C00 A;  1U87 A;  1ERU A;  4KUN A;  2ON7 A;  1A23 A;  5G30 A;  1ON4 A;  3C1S A;  3Q18 A;  1HQO A;  4F03 A;  2AUV A;  2P5Q A;  3J7Y b;  4TR1 A;  2OE3 A;  2WB9 A;  4LLR A;  4XS4 B;  4LMV A;  2LST A;  1XWA A;  4ECC A;  1TTZ A;  3CTF A;  1CQG A;  4EKZ A;  1EP8 A;  2GZP A;  2KP2 A;  4V2M A;  4FYU A;  1MDJ A;  4EC0 A;  4X0X A;  2PER A;  1JHB A;  2X64 A;  2WRT A;  5F05 A;  4XRA A;  3QFA C;  3ZMK A;  1K3Y A;  2X8C A;  4PNF A;  2JAC A;  1V57 A;  3ERG A;  6GSS A;  4KB3 A;  6GST A;  1FAA A;  1JZR A;  1YJ6 A;  1O7U A;  4KX4 A;  4ZIL A;  2L4Q A;  3O3T A;  5EVO A;  2IFQ B;  3F6D A;  3IOS A;  3EYT A;  1U3I A;  4NAX A;  4HQZ A;  2VCQ A;  2VUP A;  4IW9 A;  5GZZ B;  4N10 A;  3ME8 A;  1VRS D;  3KIJ A;  1B48 A;  1WP0 A;  2LNT A;  4FH8 A;  1O8W A;  2YV7 A;  2C8U A;  1V2A A;  5IMD A;  1TI1 A;  4MA9 A;  3C8E A;  4F9Z A;  5AIX A;  2H1D A;  2H1B A;  4ID0 A;  3ERF A;  3KCM A;  2EIR A;  4IVF A;  1TXX A;  3WGE A;  5AGY A;  2IN3 A;  5CNW A;  4EUY A;  1PN9 A;  5A4U A;  4HZ4 A;  4V1A p;  3KXO A;  5DQS A;  3FZ5 A;  5DQY A;  2FGX A;  2CAQ A;  4HZ2 A;  4BVX A;  4RI7 A;  1W4V A;  3C73 A;  1K0O A;  2MYG A;  4NMU A;  3O76 A;  1GNW A;  6GSW A;  2C1Y A;  3GYK A;  3H1N A;  2WCI A;  4HQS A;  2O89 A;  3IXR A;  2OBI A;  1YZX A;  1T1V A;  2R2J A;  3EVI A;  3TRX A;  4GF0 A;  2VIM A;  4MMM A;  3VWV A;  1QXH A;  2HLS A;  4XS4 A;  1TP9 A;  2PU9 C;  4GQF A;  3L9U A;  3RAZ A;  4KE3 A;  5LCZ A;  1XWB A;  2YWM A;  4BA7 A;  2DIY A;  1Z6M A;  1SKR B;  1K0C A;  17GS A;  5IMF A;  2AV4 A;  1M2A A;  1OC9 B;  1C72 A;  4MJB A;  2FUG 2;  2H01 A;  1Z6N A;  2K18 A;  2JU5 A;  4AF2 A;  3UIW A;  3DKS A;  5D9V A;  3O6T A;  4EDZ A;  5INY A;  3DVW A;  3CXG A;  3A2V A;  1GH2 A;  1EOG A;  3FK8 A;  1NSW A;  1XWG A;  4QQ7 A;  2GQL A;  1F9M A;  4ECI A;  1BED A;  5DAK B;  2N5A A;  2YJ7 A;  4TXO B;  5KN2 A;  3UVH A;  2VL2 A;  4MLY A;  2P5R A;  3TCO A;  1K0D A;  2V41 A;  2HE3 A;  3W8J A;  5HQP A;  5KEJ A;  2H0G A;  1BJX A;  1XZO A;  5G1K A;  4KSM A;  3RDW A;  1U88 A;  5CRG A;  1ZGN A;  1HNA A;  1FVK A;  5GAN D;  1FB0 A;  5CAX A;  2PUK C;  1HNC A;  1BYE A;  4H86 A;  1XVQ A;  5IM9 A;  1LBK A;  3TKQ A;  4WET A;  4GTU A;  1AQW A;  3QPM A;  5B8B A;  3MDK A;  3F63 A;  1SJZ A;  1O8X A;  3IRA A;  1TDI A;  4I97 A;  2YZH A;  3IBH A;  1XOB A;  1WJK A;  5DCG A;  5IIZ A;  1JFU A;  4I5Q A;  1Z5Y E;  3L78 A;  2FWG A;  3A2X A;  2H6Y A;  1GUM A;  3N9J A;  5J5N A;  5F06 A;  1T7P B;  2FNO A;  3VWW A;  2V6K A;  3LQ7 A;  5D9T A;  1PKW A;  2CQ9 A;  4XS6 A;  2GLR A;  1O85 A;  5B7C A;  1GNE A;  2H71 A;  2GDR A;  3VI7 A;  3CTG A;  2B5Y A;  3W6G A;  4MDC A;  1VF4 A;  3D22 A;  2IPA A;  3KTB A;  4KW6 A;  2WUL A;  4KDX A;  1PX7 A;  5J41 A;  2GT5 A;  1TU7 A;  5ECH B;  2YWO A;  5GSS A;  3F4T A;  4WF4 A;  3GV1 A;  1E6B A;  1ERT A;  3QDN A;  5HR1 A;  1OC9 A;  2TRX A;  5J9B A;  2DBC A;  2LRT A;  2YWN A;  2ES7 A;  3US3 A;  2O87 A;  1MD4 A;  3ED3 A;  3VUR A;  3UAR A;  1TRW A;  4PUA A;  2CVK A;  2QSI A;  3ZTL A;  4WEY A;  4TXO A;  1LU4 A;  5D93 A;  4HI7 A;  3L9V A;  1Q98 A;  4GST A;  3HVV A;  2PWJ A;  4Q5N A;  4OO4 A;  3KJY A;  5D8I A;  2MMO A;  1DE1 A;  4O7H A;  4MF7 A;  3ERW A;  5A4W A;  3DYR A;  4ZB6 A;  5CRD A;  5HFI A;  1V9W A;  1QMV A;  1M9A A;  1B9Y C;  3DVX A;  3TJG A;  2HXK A;  2ZNM A;  4AJ6 A;  5AIV A;  3Q6O A;  1N8J A;  4K7I A;  3UJ1 A;  1ACV A;  2B5X A;  3UVT A;  1GSY A;  2IIY A;  3C1R A;  4EF0 A;  1GSU A;  3FY7 A;  3KD0 A; 
#chains in the Genus database with same CATH topology
 1XW5 A;  4XIH A;  4K1F A;  4PUF C;  3IAS 2;  4I2T A;  5G31 A;  1M7T A;  1X0R A;  5GAP D;  3DGQ A;  4G9H A;  1X9M B;  5ECR B;  1ZOF A;  4KSO A;  2L4C A;  4X1U A;  3VWU A;  1XFL A;  3TJB A;  2I81 A;  4PXO A;  1PKZ A;  2V1M A;  2R0P A;  4ZBB A;  4ZIJ A;  1TU8 A;  2HI7 A;  1JLV A;  2VO4 A;  1ZMA A;  1Z7P A;  1IYH A;  4K6X A;  4AJ7 A;  1WE0 A;  3QAW A;  2X4A A;  1RK4 A;  2H19 A;  2P31 A;  2CVD A;  5DAL A;  4YH2 A;  2GZY A;  1G6W A;  1XPV A;  2NTO A;  4LL1 B;  1ST9 A;  2DJ1 A;  4ICY A;  3KH9 A;  1UVZ A;  1PA3 A;  4EL1 A;  3H93 A;  4Z2R A;  5D73 A;  4JBB A;  4JZQ A;  4AGS A;  3BOA A;  1IYI A;  3MSZ A;  16GS A;  3CYN A;  5ID2 A;  4K0G A;  2C3T A;  3HA9 A;  3FZ4 A;  4NV5 A;  1MTC A;  2FWE A;  3I69 A;  5ECO B;  1SK1 A;  1EV4 A;  4JED A;  1FB6 A;  1KNG A;  18GS A;  1SEN A;  1NW2 A;  1PX6 A;  1ZCP A;  2XPD A;  3G7Y A;  3KTL A;  5L71 A;  3E9J B;  1XWC A;  3EUR A;  4K9Z A;  1QFN A;  1S3R A;  2DMM A;  2VCW A;  4G2E A;  1ZYP A;  2GTU A;  4OFM A;  2VD0 A;  3S9F A;  2CZ2 A;  2OE0 A;  1DE2 A;  2VL9 A;  4MPG A;  2H72 A;  2F8F A;  3SBC A;  2K9F A;  1A2J A;  4RQX A;  3FMW A;  4HU7 A;  2DJJ A;  1OKD A;  4WR5 A;  5JCU A;  1SK0 A;  2KP1 A;  2CX3 A;  4HU9 A;  4MPF A;  1QQ2 A;  2VCT A;  1WRY A;  1PN0 A;  3E3E A;  4PGT A;  4POL A;  1UA5 A;  1NM3 A;  3L0H A;  2BTO T;  5F07 A;  5CYY A;  5KN3 A;  3UL3 A;  2X8H A;  2LKU A;  1U6T A;  2WJU A;  5EL8 A;  6GSV A;  3IE3 A;  2TIR A;  3TGZ A;  1M0U A;  3L9S A;  1YKA A;  2FLS A;  4FYB A;  5G1L A;  2R3X A;  4MH2 A;  3GIX A;  3KH7 A;  2GGT A;  5B6N A;  4L5O A;  2REM A;  1OKT A;  4P3Y B;  3HD5 A;  4NXI A;  4IKH A;  1K3O A;  5CP1 A;  3I9V 2;  4LL4 B;  1QK8 A;  1XOA A;  1OC3 A;  3TRQ A;  3HVS A;  4EE0 A;  2ZUP A;  5GST A;  2HRF A;  2RII A;  1EP7 A;  4ZBA A;  4EDY A;  3FEU A;  2PPT A;  3CSJ A;  4NV2 A;  2R37 A;  2B7K A;  4L0U A;  3KP8 A;  4K2D A;  1WMJ A;  1OC8 A;  3WYW A;  3LOR A;  1X5C A;  3QAV A;  1YKC A;  4K5S A;  1O6J A;  3FZ9 A;  2PMT A;  2H1A A;  2YPM A;  4J56 E;  1M2B A;  2I1U A;  2VL3 A;  3TKP A;  2C0E A;  3ZVJ A;  4N11 A;  6GSU A;  1V58 A;  4NWY A;  5ABR A;  4BVY B;  1PGT A;  2JL4 A;  2LS5 A;  3IC8 A;  3VI5 A;  2OE1 A;  2K8V A;  8GSS A;  5ECK B;  5DDL A;  2X49 A;  4IJI A;  3P7X A;  3WGX A;  1GSD A;  3EMP A;  1XW6 A;  2DIZ A;  1A0R P;  3BCK A;  2QC7 A;  2LJR A;  5KN1 A;  3TUE A;  4FYC A;  3EC3 A;  3D4T A;  1S3A A;  5B8A A;  1PFO A;  2HSM A;  2WZ9 A;  3JCM L;  3IPZ A;  1X5D A;  2PBJ A;  1GUH A;  5ECQ B;  4OFN A;  5F8B A;  3M3M A;  3FR3 A;  3APS A;  2JZS A;  4TRX A;  4IGJ A;  4D73 B;  2R4V A;  1FVJ A;  1FOH A;  3KGK A;  4Z7X A;  2MZC A;  3F8U A;  1Y25 A;  2N5F A;  4ML1 A;  2RM6 A;  2FY6 A;  4AJ8 A;  5BMU A;  3GX0 A;  1GP1 A;  1GUK A;  3UMA A;  1N2A A;  2YP6 A;  3RBT A;  3PIN A;  2YJH A;  4OCF A;  3APO A;  3VFI A;  3IK7 A;  2XHF A;  10GS A;  5CRE A;  4YKG A;  1XG8 A;  1I9D A;  2OBK A;  2K6V A;  3W8S A;  4F82 A;  2VM1 A;  3KM6 A;  6GSY A;  3TKS C;  1RW1 A;  1ZYN A;  2CT6 A;  1K0A A;  4EXJ A;  2XPE A;  3FR9 A;  5G5E A;  4DSS B;  1EGO A;  5DJL A;  3MNG A;  3CSH A;  4TR3 A;  1M99 A;  3LG6 A;  1SJI A;  2GSQ A;  2DJ0 A;  2MBS A;  2L6C A;  4BVY A;  1TKD B;  1GSS A;  2HRN A;  3N5O A;  5FT3 A;  1Z7R A;  2IFQ A;  4YQM A;  2I3Y A;  3LGC A;  2YV9 A;  4Z2T A;  2LRN A;  1SL2 B;  5DJM A;  5D9W A;  3LSZ A;  2E0Q A;  1VF2 A;  1EZK A;  1ZZY A;  4V1A g;  3RHC A;  4YAV A;  3I6A A;  1TI3 A;  2F51 A;  3VK9 A;  3GFK A;  3GKX A;  2IME A;  3U6V A;  4MJC A;  3QD9 A;  3HJM A;  3OR5 A;  1A8Y A;  2VLV A;  4D73 A;  1AW9 A;  2DKI A;  9GSS A;  1Z3E A;  1BQ7 A;  1B4Q A;  1MDK A;  4XRD A;  1PD2 1;  4WKW A;  2IMK A;  3IV4 A;  3LYP A;  2H30 A;  2QA1 A;  5KOW A;  2JZR A;  3GSS A;  2HSY A;  4KCA A;  1G7O A;  2DKH A;  2B6M A;  4CHS A;  2V6O A;  2RUF A;  4ECB A;  3IA1 A;  1PQN A;  4MJA A;  1A0F A;  1KBN A;  3CRU A;  2ALB A;  1GL8 A;  2CA8 A;  4PNG A;  1S3C A;  4IQA A;  4MK3 A;  3ZML A;  2GQM A;  5LNK e;  1JLW A;  5IPG A;  4ILF A;  2AB6 A;  2CX4 A;  2GSR A;  3WGD A;  2B7J A;  5D9X A;  1FO5 A;  4I8B A;  3M9K A;  3D4M A;  1GTA A;  2LRC A;  4Q5R A;  1UC7 A;  2AYT A;  2WFC A;  2ZCT A;  3Q74 A;  2GS3 A;  4ZL7 A;  3MIX A;  3IDV A;  4IP1 A;  3UAP A;  3DXB A;  1DUG A;  2OAC A;  3HCZ A;  4EIQ A;  4OCE A;  4J2F A;  13GS A;  2YCD A;  5DAK A;  3FRC A;  4N30 A;  1USB A;  3UOM A;  3FW2 A;  2E2G A;  2B1K A;  4CDO A;  2JAD A;  2L57 A;  1K3L A;  1BG5 A;  3HYP A;  4O5Q A;  4BPY A;  2WS2 A;  3G7J A;  4QL9 A;  4K2X A;  4OD7 A;  5J3R A;  3M9J A;  1F6M C;  3EIN A;  4G0K A;  2H6X A;  4A5P A;  5JWO B;  3D0Z A;  3CBU A;  6GSX A;  1GRX A;  1SL1 B;  2JSZ A;  3PGT A;  1HNB A;  2E2M A;  4MZW A;  3LFL A;  3HZ4 A;  4GQC A;  2LJA A;  4NHW A;  3VLN A;  5IMV A;  4MF5 A;  3TKR A;  1SKW B;  3LXT A;  22GS A;  1FG4 A;  4YKF A;  2AJQ B;  5IMZ A;  2B5E A;  2WDU A;  4ACS A;  4JE1 A;  4NPB A;  2XBQ A;  4F0B A;  3HJO A;  2NBS A;  4EVM A;  4WBJ A;  5EY6 A;  2GZZ A;  3ZRE A;  1U3A A;  4PTS A;  3GKM A;  2A2R A;  4XTS A;  5G5F A;  5KN0 A;  1K0B A;  2DSA A;  1XWK A;  2XBI A;  4IP6 A;  2I9H A;  2UZ8 A;  1HD2 A;  3HKR A;  1FOV A;  1ERW A;  4KND A;  2MMZ A;  5IMC A;  4BL7 B;  1J08 A;  4GCI A;  2VLU A;  3E0U A;  4TR0 A;  4DEJ A;  4OWY A;  2H74 A;  5IO2 A;  1O81 A;  1KTE A;  3ZIV A;  2BMX A;  4ZB9 A;  4EIP A;  5A4V A;  3HJP A;  4F0C A;  3CRT A;  4KH7 A;  3ZVJ D;  1THO A;  2I4A A;  1NHY A;  2CAI A;  2FWH A;  4QL7 A;  4IHU A;  5J4U A;  4KDU A;  1GLQ A;  3KMN A;  3UBL A;  5ECS A;  2DC5 A;  3GTU B;  1YEX A;  1KEB A;  4PQI A;  3APQ A;  1WPI A;  5JWQ B;  3F6F A;  3P2A A;  5DBQ A;  2LEG A;  4KDY A;  4N0V A;  3IR4 A;  4G10 A;  4DSR A;  4KAE A;  2L5L A;  5COH A;  1JZO A;  2OA7 A;  5LD0 A;  3GKN A;  4LMW A;  5AIS A;  5HR3 A;  5F0G A;  1XXU A;  2YOI A;  1TOF A;  1QUW A;  2VLT A;  3GL5 A;  3LWA A;  3GUS A;  3VPT A;  5ECM B;  4TVE A;  2YWI A;  2P0G A;  1YDK A;  1SL0 B;  4OFT A;  1J9B A;  3ISO A;  3ZYW A;  1TRU A;  3ZZX A;  3A2W A;  2L6D A;  3EWL A;  2X8G A;  5IOX A;  3GN3 A;  2L5O A;  2EC4 A;  3IAM 2;  4K7N A;  4XCS A;  1W89 A;  4RUV A;  3L4N A;  2E7P A;  4CW9 A;  4I2U A;  1EV9 A;  1M9B A;  1UN2 A;  2MMN A;  3ZFB A;  3PR8 A;  4ZL9 A;  2G0F A;  1G6Y A;  2D2Z A;  2O8V B;  4BWQ A;  1AC1 A;  3QR6 A;  3M8N A;  3ZIT A;  2MMA A;  1ILO A;  3AY8 A;  1R4W A;  2NDO A;  1MDI A;  4O32 A;  1M3J A;  2J23 A;  4OO5 A;  4HOJ A;  3CMI A;  2JZT A;  5CRW A;  2WGR A;  4MNN A;  1H4O A;  1CQH A;  3LYK A;  3EMX A;  3NZN A;  3ZIJ A;  3U5R E;  4LA1 A;  5IMA A;  5EPF A;  3KP9 A;  4JRR A;  2FHE A;  3TJJ A;  2IL3 A;  4JU5 A;  3BBY A;  3RHB A;  4CY8 A;  1VF3 A;  3GTU A;  3GX8 A;  4BVX B;  4J57 E;  2OAD A;  2EIQ A;  2H0I A;  3IC4 A;  2XC2 A;  3G9B A;  4KA0 A;  2YZU A;  3M0F A;  2GSS A;  2J9H A;  1PMT A;  2IWT A;  2HNL A;  3IHQ A;  5HR2 A;  2LV3 A;  1GTI A;  1XCC A;  3QMX A;  2H66 A;  3QOU A;  4K8M A;  3F0I A;  2HZE B;  2VCX A;  1SJ6 A;  1GSQ A;  1MD3 A;  3V1W A;  1PSQ A;  2C3Q A;  1EOH A;  4BWS A;  1OYJ A;  5H5Q A;  2GVP A;  2M72 A;  3FKF A;  4JR6 A;  2O7K A;  3HVN A;  2PN8 A;  2RM5 A;  4GLT A;  4XS1 A;  3F9U A;  2VAF A;  3D21 A;  4ZL8 A;  5HFG A;  2ON5 A;  3LW9 A;  2CZ3 A;  4Q5Q A;  3TKS E;  2A4V A;  3GL3 A;  2VD1 A;  3FR6 A;  4YQV A;  1YQ1 A;  2LTK A;  3BJ5 A;  3TDG A;  1OE8 A;  1R5A A;  2LQO A;  3GKK A;  4GSN A;  1SD9 A;  2C80 A;  11GS A;  1TK0 B;  3K8N A;  3HDC A;  3UEM A;  4DSQ A;  3TKS A;  2Z9S A;  3QAG A;  4MAB A;  5H5R A;  2C0D A;  2H1G A;  5AN1 A;  3MAK A;  4HEA 2;  1WWJ A;  1SYR A;  2R5G A;  2K8S A;  3IK9 A;  4KGI A;  4L8E A;  3P90 A;  3GST A;  4YAP A;  4MCU A;  1G7E A;  3BD2 A;  1T3B A;  2FA8 A;  1F3A A;  1YF0 A;  5JWR B;  4ZBD A;  4G0I A;  3MYD A;  4MZC A;  4ZB8 A;  2H6Z A;  1FHE A;  1TRV A;  1GWC A;  1NHO A;  4G19 A;  1AIU A;  3F4R A;  2GQK A;  4X43 A;  5HR0 A;  2VCZ A;  3A5W A;  1Y6E A;  2A2S A;  4TR4 A;  4ECJ A;  2HZE A;  1XIY A;  2CVB A;  2DJ3 A;  3NIV A;  4USS A;  1T00 A;  4ISD A;  4I6X A;  3TRP A;  1EWX A;  4NHZ A;  1R5P A;  4HS1 A;  2H0H A;  2VM2 A;  4ML6 A;  3RPN A;  1WOU A;  3QCP A;  1Q4J A;  2OKA A;  1URM A;  1EGR A;  2DJ2 A;  19GS A;  1SKS B;  2F3M A;  3D5J A;  4TXV A;  1V98 A;  2JSY A;  1B9X C;  2FCH A;  3TJK A;  1V40 A;  1OE7 A;  2KHP A;  3DRN A;  1XVW A;  4XHM A;  3ZFL A;  5DCH A;  5JCG A;  3UBK A;  1GSE A;  2QKE A;  2LUS A;  5CO3 A;  3EE2 A;  5G2Z A;  3SWL A;  2YN1 A;  1GTU A;  5ECP B;  3KZQ A;  3DML A;  3FHK A;  2H8L A;  2V32 A;  2YAN A;  1XBS A;  5DVB A;  2HYX A;  1X9W B;  1QGV A;  4IS0 A;  3HZ8 A;  1A8L A;  2LJK A;  2VL2 C;  4L0W A;  3FYG A;  3HVX A;  1A2L A;  4O92 A;  3GMF A;  1GLP A;  4PQH A;  1X9S B;  3VWX A;  4BIK A;  4WF5 A;  1F37 A;  2G2Q A;  2AAW A;  2H75 A;  1XW9 A;  3F4S A;  3DEX A;  1FW1 A;  1ZYQ B;  2IMD A;  1LJR A;  4K7O A;  1TW9 A;  2HFD A;  1AXD A;  2A2P A;  1SD8 A;  2F8A A;  2FD3 A;  3DD3 A;  3A3T A;  2EIO A;  4PQ1 A;  1DSB A;  4DSS A;  3TOU A;  4POB A;  4TOP A;  2C4J A;  1K0M A;  1ML6 A;  2PVO C;  3I43 A;  2N5B A;  1ZYE A;  5IQY A;  1E2Y A;  1PRX A;  1AAZ A;  3HXS A;  1YF1 A;  3NOF A;  5E4W A;  1G0T A;  3C71 A;  3EPT A;  3DIE A;  3P8W A;  2LNS A;  5DAL B;  4PX1 A;  5J9C A;  3H4K A;  1BAY A;  1AUC A;  4Q5F A;  4DVC A;  4TW5 A;  3M1G A;  1GTB A;  3HHV A;  5A5K A;  1ZL9 A;  2IMF A;  3EU4 A;  2KOK A;  4N0Z A;  2KUC A;  4KF9 A;  5KOX A;  5ID2 B;  5IOW A;  1AQX A;  4E8E A;  1R7H A;  5JCW A;  3G7I A;  4FO5 A;  4IBP A;  1A24 A;  3ME7 A;  2NPB A;  1OVN A;  2LQQ A;  2AHE A;  2PVQ A;  3Q19 A;  2HZF A;  1PL2 A;  1O73 A;  4OMV A;  2MBT A;  4FIW A;  3CQF A;  2RLI A;  1HYU A;  2CV4 A;  3LXZ A;  3LEF A;  1Z9H A;  2FA4 A;  14GS A;  2L59 A;  2OJL A;  4V2N A;  3R3E A;  3QFB C;  4KCE A;  3GH6 A;  4WBR D;  1RQM A;  5CRH A;  3KMO A;  3TJF A;  2B1L A;  2R0C A;  2C0F A;  5ENU A;  2QGV A;  1WIK A;  1YY7 A;  1ABA A;  3HY2 A;  20GS A;  4GWR A;  2GST A;  3EU3 A;  3CSI A;  4X4J A;  2H76 A;  1VGL A;  3GNJ A;  4MZB A;  2FWF A;  3H79 A;  4JR4 A;  1GUL A;  5C04 A;  3A5I A;  3ZRD A;  3VPQ A;  4POM A;  2V2G A;  3D6I A;  5ELG A;  5BRT A;  4GRF A;  4RQR A;  4L5L A;  12GS A;  2VOC A;  3WT1 A;  1F3B A;  5FWG A;  4K0N A;  1BX9 A;  2F9S A;  4HDE A;  1TK5 B;  3KEB A;  3IHG A;  2M80 A;  5HFK A;  2YNX A;  3MWH A;  4MP4 A;  4EO3 A;  2R0G A;  1TRS A;  4F2I A;  3GH9 A;  1OAZ A;  2HT9 A;  5ELA A;  3H8Q A;  1ERV A;  2NVL A;  5E59 A;  1F2E A;  3WT2 A;  4TR1 B;  3WD6 A;  1EEM A;  4MF6 A;  2GT6 A;  4TKY A;  4IEL A;  1JZW A;  2HSH A;  4MJE A;  4K5R A;  3ZL5 A;  4IN0 A;  1JZD A;  3PPU A;  3C7M A;  3BCI A;  1M2D A;  4HUA A;  1T8E B;  1MEK A;  4WR4 A;  4HJM A;  3R2Q A;  3F3R A;  4E8H A;  1EEJ A;  1DBY A;  1T4Z A;  5ECL B;  1X5E A;  1A2M A;  1SU9 A;  1B4P A;  2IMI A;  4WXT A;  1PL1 A;  4TN8 A;  2B3S A;  1VF1 A;  3GUR A;  1J0F A;  5ECI B;  4RI6 A;  3F3Q A;  2PGT A;  2DLX A;  4MH3 A;  2C3N A;  3PH9 A;  1TK8 B;  1SYX A;  1T4Y A;  2O85 A;  2BJX A;  2IJY A;  4POK A;  1K0N A;  3DWV A;  4IJ3 A;  3GHA A;  1R26 A;  1GSF A;  3TOT A;  4BL7 A;  4PUR A;  4ZXG A;  4GXZ A;  5FHI A;  5H5S A;  4YQU A;  3ZLP A;  5IPH A;  4GSS A;  2X99 A;  4FQU A;  1B8X A;  4ULX A;  1AQV A;  4Z2U A;  5B6M A;  2TRC P;  5D96 A;  2DJK A;  3TB2 A;  2KLX A;  2RUE A;  2R6K A;  3LJR A;  1YEP A;  1THX A;  1TJD A;  2H73 A;  5ECN B;  3J7Y k;  2H70 A;  2DML A;  3GRX A;  4O5R A;  2C0G A;  4V2L A;  7GSS A;  4HJ2 A;  4G0L A;  1SK2 A;  3FZA A;  2M46 A;  5IO0 A;  3GA4 A;  1I5G A;  2VCV A;  1H75 A;  1S3D A;  3RPP A;  4IQ1 A;  5C00 A;  1U87 A;  1ERU A;  4KUN A;  2ON7 A;  1A23 A;  5G30 A;  1ON4 A;  3C1S A;  3Q18 A;  1M3I A;  1HQO A;  4F03 A;  2AUV A;  2P5Q A;  2QA2 A;  3J7Y b;  4TR1 A;  2OE3 A;  2WB9 A;  4LLR A;  4XS4 B;  4LMV A;  2LST A;  1XWA A;  4ECC A;  1TTZ A;  3CTF A;  1CQG A;  4EKZ A;  1EP8 A;  2GZP A;  2KP2 A;  4V2M A;  4FYU A;  1MDJ A;  4EC0 A;  4X0X A;  2PER A;  1JHB A;  2X64 A;  2WRT A;  5F05 A;  4XRA A;  3QFA C;  3ZMK A;  1K3Y A;  2X8C A;  4PNF A;  2JAC A;  1V57 A;  3ERG A;  6GSS A;  4KB3 A;  6GST A;  1FAA A;  1JZR A;  1YJ6 A;  1O7U A;  4KX4 A;  4ZIL A;  2L4Q A;  3O3T A;  5EVO A;  2IFQ B;  3F6D A;  3IOS A;  3EYT A;  1U3I A;  4NAX A;  4HQZ A;  2VCQ A;  2VUP A;  4IW9 A;  5GZZ B;  4N10 A;  3ME8 A;  1VRS D;  3KIJ A;  1B48 A;  1WP0 A;  2LNT A;  4FH8 A;  1O8W A;  2YV7 A;  2C8U A;  1V2A A;  5IMD A;  1TI1 A;  4MA9 A;  3C8E A;  4F9Z A;  5AIX A;  2H1D A;  2H1B A;  4ID0 A;  3ERF A;  3KCM A;  2EIR A;  4IVF A;  1TXX A;  3WGE A;  5AGY A;  2IN3 A;  5CNW A;  4EUY A;  1PN9 A;  5A4U A;  4HZ4 A;  4V1A p;  3KXO A;  5DQS A;  3FZ5 A;  5DQY A;  2FGX A;  2CAQ A;  4HZ2 A;  4BVX A;  4RI7 A;  1W4V A;  3C73 A;  1K0O A;  2MYG A;  4NMU A;  3O76 A;  1GNW A;  6GSW A;  2C1Y A;  3GYK A;  3H1N A;  2WCI A;  4HQS A;  2O89 A;  3IXR A;  2OBI A;  1YZX A;  1T1V A;  2R2J A;  3EVI A;  3TRX A;  4GF0 A;  2VIM A;  4MMM A;  3VWV A;  1QXH A;  2HLS A;  4XS4 A;  1TP9 A;  2PU9 C;  2A4H A;  4GQF A;  3L9U A;  3RAZ A;  4KE3 A;  5LCZ A;  1XWB A;  2YWM A;  4BA7 A;  2DIY A;  1Z6M A;  1SKR B;  1K0C A;  17GS A;  5IMF A;  2AV4 A;  1M2A A;  1OC9 B;  1C72 A;  4MJB A;  2FUG 2;  2H01 A;  1Z6N A;  2K18 A;  2JU5 A;  4AF2 A;  3UIW A;  3DKS A;  5D9V A;  3O6T A;  4EDZ A;  5INY A;  3DVW A;  3CXG A;  3A2V A;  1GH2 A;  1EOG A;  3FK8 A;  1NSW A;  1XWG A;  4QQ7 A;  2GQL A;  1F9M A;  4ECI A;  1BED A;  5DAK B;  2N5A A;  2YJ7 A;  4TXO B;  5KN2 A;  3UVH A;  2VL2 A;  4MLY A;  4CY6 A;  2P5R A;  3TCO A;  1K0D A;  2V41 A;  2HE3 A;  3W8J A;  5HQP A;  5KEJ A;  2H0G A;  1BJX A;  1XZO A;  5G1K A;  4KSM A;  3RDW A;  1U88 A;  5CRG A;  1ZGN A;  1HNA A;  1FVK A;  5GAN D;  1FB0 A;  5CAX A;  2PUK C;  1HNC A;  1BYE A;  4H86 A;  1XVQ A;  5IM9 A;  1LBK A;  3TKQ A;  4WET A;  4GTU A;  1AQW A;  3QPM A;  5B8B A;  3MDK A;  3F63 A;  1SJZ A;  1O8X A;  3IRA A;  1TDI A;  4I97 A;  2YZH A;  3IBH A;  2HRK A;  1XOB A;  1WJK A;  5DCG A;  5IIZ A;  1JFU A;  4I5Q A;  1Z5Y E;  3L78 A;  2FWG A;  3A2X A;  2H6Y A;  1GUM A;  3N9J A;  5J5N A;  5F06 A;  1T7P B;  2FNO A;  3VWW A;  2V6K A;  3LQ7 A;  5D9T A;  1PKW A;  2CQ9 A;  4XS6 A;  2GLR A;  1O85 A;  5B7C A;  1GNE A;  2H71 A;  2GDR A;  3VI7 A;  3CTG A;  2B5Y A;  3W6G A;  4MDC A;  4HSC X;  1VF4 A;  3D22 A;  2IPA A;  3KTB A;  4KW6 A;  2WUL A;  4KDX A;  4O5U A;  1PX7 A;  5J41 A;  2GT5 A;  1TU7 A;  5ECH B;  2YWO A;  5GSS A;  3F4T A;  4WF4 A;  3GV1 A;  1E6B A;  1ERT A;  3QDN A;  5HR1 A;  1OC9 A;  2TRX A;  5J9B A;  2DBC A;  2LRT A;  2YWN A;  2ES7 A;  3US3 A;  2O87 A;  1MD4 A;  3ED3 A;  3VUR A;  3UAR A;  1TRW A;  4PUA A;  2CVK A;  2QSI A;  3ZTL A;  4WEY A;  4TXO A;  1LU4 A;  5D93 A;  4HI7 A;  3L9V A;  1Q98 A;  4GST A;  3HVV A;  2PWJ A;  4Q5N A;  4OO4 A;  3KJY A;  5D8I A;  2MMO A;  1DE1 A;  4O7H A;  4MF7 A;  3ERW A;  5A4W A;  3DYR A;  4ZB6 A;  5CRD A;  5HFI A;  1V9W A;  1QMV A;  1M9A A;  1B9Y C;  3DVX A;  3TJG A;  2HXK A;  2ZNM A;  4AJ6 A;  5AIV A;  3Q6O A;  1N8J A;  4K7I A;  3UJ1 A;  1ACV A;  2B5X A;  3UVT A;  1GSY A;  2IIY A;  3C1R A;  2HRA A;  4EF0 A;  1GSU A;  3FY7 A;  3KD0 A; 
#chains in the Genus database with same CATH homology
 1XW5 A;  4XIH A;  4K1F A;  4PUF C;  3IAS 2;  4I2T A;  5G31 A;  1M7T A;  1X0R A;  5GAP D;  3DGQ A;  4G9H A;  1X9M B;  5ECR B;  1ZOF A;  4KSO A;  2L4C A;  4X1U A;  3VWU A;  1XFL A;  3TJB A;  2I81 A;  4PXO A;  1PKZ A;  2V1M A;  2R0P A;  4ZBB A;  4ZIJ A;  1TU8 A;  2HI7 A;  1JLV A;  2VO4 A;  1ZMA A;  1Z7P A;  1IYH A;  4K6X A;  4AJ7 A;  1WE0 A;  3QAW A;  2X4A A;  1RK4 A;  2H19 A;  2P31 A;  2CVD A;  5DAL A;  4YH2 A;  2GZY A;  1G6W A;  1XPV A;  2NTO A;  4LL1 B;  1ST9 A;  2DJ1 A;  4ICY A;  3KH9 A;  1UVZ A;  1PA3 A;  4EL1 A;  3H93 A;  4Z2R A;  5D73 A;  4JBB A;  4JZQ A;  4AGS A;  3BOA A;  1IYI A;  3MSZ A;  16GS A;  3CYN A;  5ID2 A;  4K0G A;  2C3T A;  3HA9 A;  3FZ4 A;  4NV5 A;  1MTC A;  2FWE A;  3I69 A;  5ECO B;  1SK1 A;  1EV4 A;  4JED A;  1FB6 A;  1KNG A;  18GS A;  1SEN A;  1NW2 A;  1PX6 A;  1ZCP A;  2XPD A;  3G7Y A;  3KTL A;  5L71 A;  3E9J B;  1XWC A;  3EUR A;  4K9Z A;  1QFN A;  2DMM A;  2VCW A;  4G2E A;  1ZYP A;  2GTU A;  4OFM A;  2VD0 A;  3S9F A;  2CZ2 A;  2OE0 A;  1DE2 A;  2VL9 A;  4MPG A;  2H72 A;  2F8F A;  3SBC A;  2K9F A;  1A2J A;  4RQX A;  3FMW A;  4HU7 A;  2DJJ A;  1OKD A;  4WR5 A;  5JCU A;  1SK0 A;  2KP1 A;  2CX3 A;  4HU9 A;  4MPF A;  1QQ2 A;  2VCT A;  1WRY A;  1PN0 A;  3E3E A;  4PGT A;  4POL A;  1UA5 A;  1NM3 A;  3L0H A;  2BTO T;  5F07 A;  5CYY A;  5KN3 A;  3UL3 A;  2X8H A;  2LKU A;  1U6T A;  2WJU A;  5EL8 A;  6GSV A;  3IE3 A;  2TIR A;  3TGZ A;  1M0U A;  3L9S A;  1YKA A;  2FLS A;  4FYB A;  5G1L A;  2R3X A;  4MH2 A;  3GIX A;  3KH7 A;  2GGT A;  5B6N A;  4L5O A;  2REM A;  1OKT A;  4P3Y B;  3HD5 A;  4NXI A;  4IKH A;  1K3O A;  5CP1 A;  3I9V 2;  4LL4 B;  1QK8 A;  1XOA A;  1OC3 A;  3TRQ A;  3HVS A;  4EE0 A;  2ZUP A;  5GST A;  2HRF A;  2RII A;  1EP7 A;  4ZBA A;  4EDY A;  3FEU A;  2PPT A;  3CSJ A;  4NV2 A;  2R37 A;  2B7K A;  4L0U A;  3KP8 A;  4K2D A;  1WMJ A;  1OC8 A;  3WYW A;  3LOR A;  1X5C A;  3QAV A;  1YKC A;  4K5S A;  1O6J A;  3FZ9 A;  2PMT A;  2H1A A;  2YPM A;  4J56 E;  1M2B A;  2I1U A;  2VL3 A;  3TKP A;  2C0E A;  3ZVJ A;  4N11 A;  6GSU A;  1V58 A;  4NWY A;  5ABR A;  4BVY B;  1PGT A;  2JL4 A;  2LS5 A;  3IC8 A;  3VI5 A;  2OE1 A;  2K8V A;  8GSS A;  5ECK B;  5DDL A;  2X49 A;  4IJI A;  3P7X A;  3WGX A;  1GSD A;  3EMP A;  1XW6 A;  2DIZ A;  1A0R P;  3BCK A;  2QC7 A;  2LJR A;  5KN1 A;  3TUE A;  4FYC A;  3EC3 A;  3D4T A;  1S3A A;  5B8A A;  2HSM A;  2WZ9 A;  3JCM L;  3IPZ A;  1X5D A;  2PBJ A;  1GUH A;  5ECQ B;  4OFN A;  5F8B A;  3M3M A;  3FR3 A;  3APS A;  2JZS A;  4TRX A;  4IGJ A;  4D73 B;  2R4V A;  1FVJ A;  1FOH A;  3KGK A;  4Z7X A;  2MZC A;  3F8U A;  1Y25 A;  2N5F A;  4ML1 A;  2RM6 A;  2FY6 A;  4AJ8 A;  5BMU A;  3GX0 A;  1GP1 A;  1GUK A;  3UMA A;  1N2A A;  2YP6 A;  3RBT A;  3PIN A;  2YJH A;  4OCF A;  3APO A;  3VFI A;  3IK7 A;  2XHF A;  10GS A;  5CRE A;  4YKG A;  1I9D A;  2OBK A;  2K6V A;  3W8S A;  4F82 A;  2VM1 A;  3KM6 A;  6GSY A;  3TKS C;  1RW1 A;  1ZYN A;  2CT6 A;  1K0A A;  4EXJ A;  2XPE A;  3FR9 A;  5G5E A;  4DSS B;  1EGO A;  5DJL A;  3MNG A;  3CSH A;  4TR3 A;  1M99 A;  3LG6 A;  1SJI A;  2GSQ A;  2DJ0 A;  2MBS A;  2L6C A;  4BVY A;  1TKD B;  1GSS A;  2HRN A;  3N5O A;  5FT3 A;  1Z7R A;  2IFQ A;  4YQM A;  2I3Y A;  3LGC A;  2YV9 A;  4Z2T A;  2LRN A;  1SL2 B;  5DJM A;  5D9W A;  3LSZ A;  2E0Q A;  1VF2 A;  1EZK A;  1ZZY A;  4V1A g;  3RHC A;  4YAV A;  3I6A A;  1TI3 A;  2F51 A;  3VK9 A;  3GFK A;  3GKX A;  2IME A;  3U6V A;  4MJC A;  3QD9 A;  3HJM A;  3OR5 A;  1A8Y A;  2VLV A;  4D73 A;  1AW9 A;  2DKI A;  9GSS A;  1Z3E A;  1BQ7 A;  1B4Q A;  1MDK A;  4XRD A;  1PD2 1;  4WKW A;  2IMK A;  3IV4 A;  3LYP A;  2H30 A;  2QA1 A;  5KOW A;  2JZR A;  3GSS A;  2HSY A;  4KCA A;  1G7O A;  2DKH A;  2B6M A;  4CHS A;  2V6O A;  2RUF A;  4ECB A;  3IA1 A;  1PQN A;  4MJA A;  1A0F A;  1KBN A;  3CRU A;  2ALB A;  1GL8 A;  2CA8 A;  4PNG A;  1S3C A;  4IQA A;  4MK3 A;  3ZML A;  2GQM A;  5LNK e;  1JLW A;  5IPG A;  4ILF A;  2AB6 A;  2CX4 A;  2GSR A;  3WGD A;  2B7J A;  5D9X A;  1FO5 A;  4I8B A;  3M9K A;  3D4M A;  1GTA A;  2LRC A;  4Q5R A;  1UC7 A;  2AYT A;  2WFC A;  2ZCT A;  3Q74 A;  2GS3 A;  4ZL7 A;  3MIX A;  3IDV A;  4IP1 A;  3UAP A;  3DXB A;  1DUG A;  2OAC A;  3HCZ A;  4EIQ A;  4OCE A;  4J2F A;  13GS A;  2YCD A;  5DAK A;  3FRC A;  4N30 A;  1USB A;  3UOM A;  3FW2 A;  2E2G A;  2B1K A;  4CDO A;  2JAD A;  2L57 A;  1K3L A;  1BG5 A;  3HYP A;  4O5Q A;  4BPY A;  2WS2 A;  3G7J A;  4QL9 A;  4K2X A;  4OD7 A;  5J3R A;  3M9J A;  1F6M C;  3EIN A;  4G0K A;  2H6X A;  4A5P A;  5JWO B;  3D0Z A;  3CBU A;  6GSX A;  1GRX A;  1SL1 B;  2JSZ A;  3PGT A;  1HNB A;  2E2M A;  4MZW A;  3LFL A;  3HZ4 A;  4GQC A;  2LJA A;  4NHW A;  3VLN A;  5IMV A;  4MF5 A;  3TKR A;  1SKW B;  3LXT A;  22GS A;  1FG4 A;  4YKF A;  2AJQ B;  5IMZ A;  2B5E A;  2WDU A;  4ACS A;  4JE1 A;  4NPB A;  2XBQ A;  4F0B A;  3HJO A;  2NBS A;  4EVM A;  4WBJ A;  5EY6 A;  2GZZ A;  3ZRE A;  1U3A A;  4PTS A;  3GKM A;  2A2R A;  4XTS A;  5G5F A;  5KN0 A;  1K0B A;  2DSA A;  1XWK A;  2XBI A;  4IP6 A;  2I9H A;  2UZ8 A;  1HD2 A;  3HKR A;  1FOV A;  1ERW A;  4KND A;  2MMZ A;  5IMC A;  4BL7 B;  1J08 A;  4GCI A;  2VLU A;  3E0U A;  4TR0 A;  4DEJ A;  4OWY A;  2H74 A;  5IO2 A;  1O81 A;  1KTE A;  3ZIV A;  2BMX A;  4ZB9 A;  4EIP A;  5A4V A;  3HJP A;  4F0C A;  3CRT A;  4KH7 A;  3ZVJ D;  1THO A;  2I4A A;  1NHY A;  2CAI A;  2FWH A;  4QL7 A;  4IHU A;  5J4U A;  4KDU A;  1GLQ A;  3KMN A;  3UBL A;  5ECS A;  2DC5 A;  3GTU B;  1YEX A;  1KEB A;  4PQI A;  3APQ A;  1WPI A;  5JWQ B;  3F6F A;  3P2A A;  5DBQ A;  2LEG A;  4KDY A;  4N0V A;  3IR4 A;  4G10 A;  4DSR A;  4KAE A;  2L5L A;  5COH A;  1JZO A;  2OA7 A;  5LD0 A;  3GKN A;  4LMW A;  5AIS A;  5HR3 A;  5F0G A;  1XXU A;  2YOI A;  1TOF A;  1QUW A;  2VLT A;  3GL5 A;  3LWA A;  3GUS A;  3VPT A;  5ECM B;  4TVE A;  2YWI A;  2P0G A;  1YDK A;  1SL0 B;  4OFT A;  1J9B A;  3ISO A;  3ZYW A;  1TRU A;  3ZZX A;  3A2W A;  2L6D A;  3EWL A;  2X8G A;  5IOX A;  3GN3 A;  2L5O A;  2EC4 A;  3IAM 2;  4K7N A;  4XCS A;  1W89 A;  4RUV A;  3L4N A;  2E7P A;  4CW9 A;  4I2U A;  1EV9 A;  1M9B A;  1UN2 A;  2MMN A;  3ZFB A;  3PR8 A;  4ZL9 A;  2G0F A;  1G6Y A;  2D2Z A;  2O8V B;  4BWQ A;  1AC1 A;  3QR6 A;  3M8N A;  3ZIT A;  2MMA A;  1ILO A;  3AY8 A;  1R4W A;  2NDO A;  1MDI A;  4O32 A;  2J23 A;  4OO5 A;  4HOJ A;  3CMI A;  2JZT A;  5CRW A;  2WGR A;  4MNN A;  1H4O A;  1CQH A;  3LYK A;  3EMX A;  3NZN A;  3ZIJ A;  3U5R E;  4LA1 A;  5IMA A;  5EPF A;  3KP9 A;  4JRR A;  2FHE A;  3TJJ A;  2IL3 A;  4JU5 A;  3BBY A;  3RHB A;  4CY8 A;  1VF3 A;  3GTU A;  3GX8 A;  4BVX B;  4J57 E;  2OAD A;  2EIQ A;  2H0I A;  3IC4 A;  2XC2 A;  3G9B A;  4KA0 A;  2YZU A;  3M0F A;  2GSS A;  2J9H A;  1PMT A;  2IWT A;  2HNL A;  3IHQ A;  5HR2 A;  2LV3 A;  1GTI A;  1XCC A;  3QMX A;  2H66 A;  3QOU A;  4K8M A;  3F0I A;  2HZE B;  2VCX A;  1SJ6 A;  1GSQ A;  1MD3 A;  3V1W A;  1PSQ A;  2C3Q A;  1EOH A;  4BWS A;  1OYJ A;  5H5Q A;  2GVP A;  2M72 A;  3FKF A;  4JR6 A;  2O7K A;  2PN8 A;  2RM5 A;  4GLT A;  4XS1 A;  3F9U A;  2VAF A;  3D21 A;  4ZL8 A;  5HFG A;  2ON5 A;  3LW9 A;  2CZ3 A;  4Q5Q A;  3TKS E;  2A4V A;  3GL3 A;  2VD1 A;  3FR6 A;  4YQV A;  1YQ1 A;  2LTK A;  3BJ5 A;  3TDG A;  1OE8 A;  1R5A A;  2LQO A;  3GKK A;  4GSN A;  1SD9 A;  2C80 A;  11GS A;  1TK0 B;  3K8N A;  3HDC A;  3UEM A;  4DSQ A;  3TKS A;  2Z9S A;  3QAG A;  4MAB A;  5H5R A;  2C0D A;  2H1G A;  5AN1 A;  3MAK A;  4HEA 2;  1WWJ A;  1SYR A;  2R5G A;  2K8S A;  3IK9 A;  4KGI A;  4L8E A;  3P90 A;  3GST A;  4YAP A;  4MCU A;  1G7E A;  3BD2 A;  1T3B A;  2FA8 A;  1F3A A;  1YF0 A;  5JWR B;  4ZBD A;  4G0I A;  3MYD A;  4MZC A;  4ZB8 A;  2H6Z A;  1FHE A;  1TRV A;  1GWC A;  1NHO A;  4G19 A;  1AIU A;  3F4R A;  2GQK A;  4X43 A;  5HR0 A;  2VCZ A;  3A5W A;  1Y6E A;  2A2S A;  4TR4 A;  4ECJ A;  2HZE A;  1XIY A;  2CVB A;  2DJ3 A;  3NIV A;  4USS A;  1T00 A;  4ISD A;  4I6X A;  3TRP A;  1EWX A;  4NHZ A;  1R5P A;  4HS1 A;  2H0H A;  2VM2 A;  4ML6 A;  3RPN A;  1WOU A;  3QCP A;  1Q4J A;  2OKA A;  1URM A;  1EGR A;  2DJ2 A;  19GS A;  1SKS B;  2F3M A;  3D5J A;  4TXV A;  1V98 A;  2JSY A;  1B9X C;  2FCH A;  3TJK A;  1V40 A;  1OE7 A;  2KHP A;  3DRN A;  1XVW A;  4XHM A;  3ZFL A;  5DCH A;  5JCG A;  3UBK A;  1GSE A;  2QKE A;  2LUS A;  5CO3 A;  3EE2 A;  5G2Z A;  3SWL A;  2YN1 A;  1GTU A;  5ECP B;  3KZQ A;  3DML A;  3FHK A;  2H8L A;  2V32 A;  2YAN A;  1XBS A;  5DVB A;  2HYX A;  1X9W B;  1QGV A;  4IS0 A;  3HZ8 A;  1A8L A;  2LJK A;  2VL2 C;  4L0W A;  3FYG A;  3HVX A;  1A2L A;  4O92 A;  3GMF A;  1GLP A;  4PQH A;  1X9S B;  3VWX A;  4WF5 A;  1F37 A;  2G2Q A;  2AAW A;  2H75 A;  1XW9 A;  3F4S A;  3DEX A;  1FW1 A;  1ZYQ B;  2IMD A;  1LJR A;  4K7O A;  1TW9 A;  2HFD A;  1AXD A;  2A2P A;  1SD8 A;  2F8A A;  2FD3 A;  3DD3 A;  3A3T A;  2EIO A;  4PQ1 A;  1DSB A;  4DSS A;  3TOU A;  4POB A;  4TOP A;  2C4J A;  1K0M A;  1ML6 A;  2PVO C;  3I43 A;  2N5B A;  1ZYE A;  5IQY A;  1E2Y A;  1PRX A;  1AAZ A;  3HXS A;  1YF1 A;  3NOF A;  5E4W A;  1G0T A;  3C71 A;  3EPT A;  3DIE A;  3P8W A;  2LNS A;  5DAL B;  4PX1 A;  5J9C A;  3H4K A;  1BAY A;  1AUC A;  4Q5F A;  4DVC A;  4TW5 A;  3M1G A;  1GTB A;  3HHV A;  5A5K A;  1ZL9 A;  2IMF A;  3EU4 A;  2KOK A;  4N0Z A;  2KUC A;  4KF9 A;  5KOX A;  5ID2 B;  5IOW A;  1AQX A;  4E8E A;  1R7H A;  5JCW A;  3G7I A;  4FO5 A;  4IBP A;  1A24 A;  3ME7 A;  2NPB A;  1OVN A;  2LQQ A;  2AHE A;  2PVQ A;  3Q19 A;  2HZF A;  1PL2 A;  1O73 A;  4OMV A;  2MBT A;  4FIW A;  2RLI A;  1HYU A;  2CV4 A;  3LXZ A;  3LEF A;  1Z9H A;  2FA4 A;  14GS A;  2L59 A;  2OJL A;  4V2N A;  3R3E A;  3QFB C;  4KCE A;  3GH6 A;  4WBR D;  1RQM A;  5CRH A;  3KMO A;  3TJF A;  2B1L A;  2R0C A;  2C0F A;  5ENU A;  2QGV A;  1WIK A;  1YY7 A;  1ABA A;  3HY2 A;  20GS A;  4GWR A;  2GST A;  3EU3 A;  3CSI A;  4X4J A;  2H76 A;  1VGL A;  3GNJ A;  4MZB A;  2FWF A;  3H79 A;  4JR4 A;  1GUL A;  5C04 A;  3A5I A;  3ZRD A;  3VPQ A;  4POM A;  2V2G A;  3D6I A;  5ELG A;  5BRT A;  4GRF A;  4RQR A;  4L5L A;  12GS A;  2VOC A;  3WT1 A;  1F3B A;  5FWG A;  4K0N A;  1BX9 A;  2F9S A;  4HDE A;  1TK5 B;  3KEB A;  3IHG A;  2M80 A;  5HFK A;  2YNX A;  3MWH A;  4MP4 A;  4EO3 A;  2R0G A;  1TRS A;  4F2I A;  3GH9 A;  1OAZ A;  2HT9 A;  5ELA A;  3H8Q A;  1ERV A;  2NVL A;  5E59 A;  1F2E A;  3WT2 A;  4TR1 B;  3WD6 A;  1EEM A;  4MF6 A;  2GT6 A;  4TKY A;  4IEL A;  1JZW A;  2HSH A;  4MJE A;  4K5R A;  3ZL5 A;  4IN0 A;  1JZD A;  3PPU A;  3C7M A;  3BCI A;  1M2D A;  4HUA A;  1T8E B;  1MEK A;  4WR4 A;  4HJM A;  3R2Q A;  3F3R A;  4E8H A;  1EEJ A;  1DBY A;  1T4Z A;  5ECL B;  1X5E A;  1A2M A;  1SU9 A;  1B4P A;  2IMI A;  4WXT A;  1PL1 A;  4TN8 A;  2B3S A;  1VF1 A;  3GUR A;  1J0F A;  5ECI B;  4RI6 A;  3F3Q A;  2PGT A;  2DLX A;  4MH3 A;  2C3N A;  3PH9 A;  1TK8 B;  1SYX A;  1T4Y A;  2O85 A;  2BJX A;  2IJY A;  4POK A;  1K0N A;  3DWV A;  4IJ3 A;  3GHA A;  1R26 A;  1GSF A;  3TOT A;  4BL7 A;  4PUR A;  4ZXG A;  4GXZ A;  5FHI A;  5H5S A;  4YQU A;  3ZLP A;  5IPH A;  4GSS A;  2X99 A;  4FQU A;  1B8X A;  4ULX A;  1AQV A;  4Z2U A;  5B6M A;  2TRC P;  5D96 A;  2DJK A;  3TB2 A;  2KLX A;  2RUE A;  2R6K A;  3LJR A;  1YEP A;  1THX A;  1TJD A;  2H73 A;  5ECN B;  3J7Y k;  2H70 A;  2DML A;  3GRX A;  4O5R A;  2C0G A;  4V2L A;  7GSS A;  4HJ2 A;  4G0L A;  1SK2 A;  3FZA A;  2M46 A;  5IO0 A;  3GA4 A;  1I5G A;  2VCV A;  1H75 A;  1S3D A;  3RPP A;  4IQ1 A;  5C00 A;  1U87 A;  1ERU A;  4KUN A;  2ON7 A;  1A23 A;  5G30 A;  1ON4 A;  3C1S A;  3Q18 A;  1HQO A;  4F03 A;  2AUV A;  2P5Q A;  2QA2 A;  3J7Y b;  4TR1 A;  2OE3 A;  2WB9 A;  4LLR A;  4XS4 B;  4LMV A;  2LST A;  1XWA A;  4ECC A;  1TTZ A;  3CTF A;  1CQG A;  4EKZ A;  1EP8 A;  2GZP A;  2KP2 A;  4V2M A;  4FYU A;  1MDJ A;  4EC0 A;  4X0X A;  2PER A;  1JHB A;  2X64 A;  2WRT A;  5F05 A;  4XRA A;  3QFA C;  3ZMK A;  1K3Y A;  2X8C A;  4PNF A;  2JAC A;  1V57 A;  3ERG A;  6GSS A;  4KB3 A;  6GST A;  1FAA A;  1JZR A;  1YJ6 A;  1O7U A;  4KX4 A;  4ZIL A;  2L4Q A;  3O3T A;  5EVO A;  2IFQ B;  3F6D A;  3IOS A;  3EYT A;  1U3I A;  4NAX A;  4HQZ A;  2VCQ A;  2VUP A;  4IW9 A;  5GZZ B;  4N10 A;  3ME8 A;  1VRS D;  3KIJ A;  1B48 A;  1WP0 A;  2LNT A;  4FH8 A;  1O8W A;  2YV7 A;  2C8U A;  1V2A A;  5IMD A;  1TI1 A;  4MA9 A;  3C8E A;  4F9Z A;  5AIX A;  2H1D A;  2H1B A;  4ID0 A;  3ERF A;  3KCM A;  2EIR A;  4IVF A;  1TXX A;  3WGE A;  5AGY A;  2IN3 A;  5CNW A;  4EUY A;  1PN9 A;  5A4U A;  4HZ4 A;  4V1A p;  3KXO A;  5DQS A;  3FZ5 A;  5DQY A;  2FGX A;  2CAQ A;  4HZ2 A;  4BVX A;  4RI7 A;  1W4V A;  3C73 A;  1K0O A;  2MYG A;  4NMU A;  3O76 A;  1GNW A;  6GSW A;  2C1Y A;  3GYK A;  3H1N A;  2WCI A;  4HQS A;  2O89 A;  3IXR A;  2OBI A;  1YZX A;  1T1V A;  2R2J A;  3EVI A;  3TRX A;  4GF0 A;  2VIM A;  4MMM A;  3VWV A;  1QXH A;  2HLS A;  4XS4 A;  1TP9 A;  2PU9 C;  2A4H A;  4GQF A;  3L9U A;  3RAZ A;  4KE3 A;  5LCZ A;  1XWB A;  2YWM A;  4BA7 A;  2DIY A;  1Z6M A;  1SKR B;  1K0C A;  17GS A;  5IMF A;  2AV4 A;  1M2A A;  1OC9 B;  1C72 A;  4MJB A;  2FUG 2;  2H01 A;  1Z6N A;  2K18 A;  2JU5 A;  4AF2 A;  3UIW A;  3DKS A;  5D9V A;  3O6T A;  4EDZ A;  5INY A;  3DVW A;  3CXG A;  3A2V A;  1GH2 A;  1EOG A;  3FK8 A;  1NSW A;  1XWG A;  4QQ7 A;  2GQL A;  1F9M A;  4ECI A;  1BED A;  5DAK B;  2N5A A;  2YJ7 A;  4TXO B;  5KN2 A;  3UVH A;  2VL2 A;  4MLY A;  4CY6 A;  2P5R A;  3TCO A;  1K0D A;  2V41 A;  2HE3 A;  3W8J A;  5HQP A;  5KEJ A;  2H0G A;  1BJX A;  1XZO A;  5G1K A;  4KSM A;  3RDW A;  1U88 A;  5CRG A;  1ZGN A;  1HNA A;  1FVK A;  5GAN D;  1FB0 A;  5CAX A;  2PUK C;  1HNC A;  1BYE A;  4H86 A;  1XVQ A;  5IM9 A;  1LBK A;  3TKQ A;  4WET A;  4GTU A;  1AQW A;  3QPM A;  5B8B A;  3MDK A;  3F63 A;  1SJZ A;  1O8X A;  3IRA A;  1TDI A;  4I97 A;  2YZH A;  3IBH A;  2HRK A;  1XOB A;  1WJK A;  5DCG A;  5IIZ A;  1JFU A;  4I5Q A;  1Z5Y E;  3L78 A;  2FWG A;  3A2X A;  2H6Y A;  1GUM A;  3N9J A;  5J5N A;  5F06 A;  1T7P B;  2FNO A;  3VWW A;  2V6K A;  3LQ7 A;  5D9T A;  1PKW A;  2CQ9 A;  4XS6 A;  2GLR A;  1O85 A;  5B7C A;  1GNE A;  2H71 A;  2GDR A;  3VI7 A;  3CTG A;  2B5Y A;  3W6G A;  4MDC A;  1VF4 A;  3D22 A;  2IPA A;  3KTB A;  4KW6 A;  2WUL A;  4KDX A;  4O5U A;  1PX7 A;  5J41 A;  2GT5 A;  1TU7 A;  5ECH B;  2YWO A;  5GSS A;  3F4T A;  4WF4 A;  3GV1 A;  1E6B A;  1ERT A;  3QDN A;  5HR1 A;  1OC9 A;  2TRX A;  5J9B A;  2DBC A;  2LRT A;  2YWN A;  2ES7 A;  3US3 A;  2O87 A;  1MD4 A;  3ED3 A;  3VUR A;  3UAR A;  1TRW A;  4PUA A;  2CVK A;  2QSI A;  3ZTL A;  4WEY A;  4TXO A;  1LU4 A;  5D93 A;  4HI7 A;  3L9V A;  1Q98 A;  4GST A;  3HVV A;  2PWJ A;  4Q5N A;  4OO4 A;  3KJY A;  5D8I A;  2MMO A;  1DE1 A;  4O7H A;  4MF7 A;  3ERW A;  5A4W A;  3DYR A;  4ZB6 A;  5CRD A;  5HFI A;  1V9W A;  1QMV A;  1M9A A;  1B9Y C;  3DVX A;  3TJG A;  2HXK A;  2ZNM A;  4AJ6 A;  5AIV A;  3Q6O A;  1N8J A;  4K7I A;  3UJ1 A;  1ACV A;  2B5X A;  3UVT A;  1GSY A;  2IIY A;  3C1R A;  2HRA A;  4EF0 A;  1GSU A;  3FY7 A;  3KD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...