4TYDA

Structure-based design of a novel series of azetidine inhibitors of the hepatitis c virus ns3/4a serine protease
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
198
structure length
194
Chain Sequence
PITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRASKGSVVIVGRIILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease
publication title Structure-based design of a novel series of azetidine inhibitors of the hepatitis C virus NS3/4A serine protease.
pubmed doi rcsb
source organism Hepatitis c virus (isolate 1)
molecule tags Hydrolase
total genus 46
structure length 194
sequence length 198
chains with identical sequence B, C, D, E, F, G, H, J, K, L, M
ec nomenclature
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4tydA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4tydA01
5L6NH 1TGSZ 1YPEH 2B5TB 1W2KH 3SJIA 1KXFA 3O8DA 1O2TA 2VH0A 1F0SA 1SVPA 3LT3A 3GYLB 1T32A 1EXFA 1IQJA 1LPGB 4X1NU 1P2OA 4B75A 1DWEH 5E0GA 1MQ5A 4U32A 3SU4A 1HUTH 1G3EA 2WPJS 5JYIA 3E0NB 4NSVA 2ZHDA 1GL0E 2VWOA 1O3IA 3H09A 5JBTA 1NZQH 2STBE 1TX7A 1V2MT 4ISNA 1RTFB 3SU5A 1NPMA 2PKAA 3PV2A 1N6XA 4RI0A 3VB6A 2ZP0H 4KKDA 1HFDA 2SGFE 3CS0A 3OTPA 3D23A 4K60A 1HIAA 3QUMP 5TJXA 1TABE 1OKXA 1FN8A 5DG6A 3MU4A 4OS1A 4UEHH 3KEEA 4DW2U 4O3TA 1T8LA 3K65B 3BIUH 2XCFA 1NM6A 2FX6A 5AHGH 3OYPA 3LGYA 2PUXB 4NA9H 1O2OA 1PQ8A 1O2HA 1TONA 3E16B 3VFEA 1H8DH 1GDUA 3SOSA 2GDEH 1WTGH 3NPSA 3MHWU 1JIMA 2BDIA 3LH1A 2A7CA 4CR9A 2SNWA 4AFZA 3EGKH 1BT7A 2F9VA 3FFGA 2FEQH 4AYYB 1SGCA 1SMFE 1ZMNA 2YNBA 3RXCA 4JZEH 2BQWB 2ZCLP 3BTME 1DDJA 1JWTA 1Y3YA 2BVSH 2VB0A 6CHAC 1EASA 4Q7ZA 3U1IB 8KME2 3V13A 2D26C 1MTNB 2O8MA 2O8UA 2XWBI 1A5HA 2BY7X 3PTBA 3KHVA 3MTYA 1FAKH 5A0CA 4MVNA 1KLIH 3MNSA 2ZU3A 1ESAA 1MTWA 2F9OA 2QY0B 5DP4A 1AGJA 3LJJA 4FUIA 2R3YA 4HZHA 2Y5FA 3KQCA 3TJVA 4LOYH 3UQOA 1BTWA 1AVGH 4MPWA 1G9IE 2ZFFH 3DFLA 5FBEA 4ZXYH 3OU0A 7GCHF 4UFEH 3KGPA 1QA7A 1IOEA 1LHFH 2AYWA 2BMGB 4O3UA 4Y0YE 7KMEH 2G4TA 3TGIE 1TNKA 1P9UA 3HGPA 2V3OH 1SGNE 1GJCB 1OWIA 1ANBA 1BA8B 3BEIB 2H5CA 2FXRA 1GI1A 2ZIQH 1MKXK 1VCQA 2F9UA 4AGKA 5ABWA 1O3HA 1TE0A 3MYWA 2BQ6B 2STAE 1GBBA 1BMLA 3P92A 3MU1A 1L2EA 1MTVA 2W3KA 4J1YA 4TPIZ 5EODA 3TK6A 4NWKA 1Z1IA 3ATWA 3EDXB 3A8AA 1KLJH 1KXEA 1ZRBA 1V2ST 2CV3A 4D7GA 3C1KA 2GT7A 2Z9GA 2Z3DA 1MZAA 1ZLRA 2F9PA 4BAOB 2PKSC 5HM2A 3VB3A 1HYLA 3RMNH 1CVWH 1GJBB 5FX6A 1AKSA 1P2QA 2PSXA 3RM0H 4E06H 1BCUH 1C5OH 1CHGA 1NFWA 2ALPA 4FUBA 1DSTA 2J34A 2LNCA 2G51A 1A0HB 4X2VA 2VVCA 2J94A 1C2KA 1SGIB 1TGNA 1FY1A 4U01A 2PLXA 1Y3XA 2H6MA 1P2NA 4U30A 1EZQA 1QB1A 1FAXA 4F4OC 2A2QH 2A5KA 2ZDNA 1YPLH 2HGTH 1BBRK 1SQTA 4AB9A 1F92A 4TWWA 1P2MA 5FCKA 1ESTA 5C1XA 5CHAC 1ABIH 1W7GH 3RXGA 4VGCC 4DIIH 1AWHB 1H9HE 1YCPH 3M7QA 3M5LA 2F9BH 1TALA 1XUJA 2JH6D 1O39A 2BLWA 1GHWH 3A82A 1BRAA 2FX4A 3UY9A 1HAZB 2G00A 1SOZA 4BTUB 3MH6A 3SV9A 2BQ7B 3SU1A 1N8OC 1ETTH 3LPRA 1UTLM 1SQOA 3N7OA 5EU8A 2FLBH 1GI5A 3P70B 1A3BH 1L0ZA 1CGIE 1LPZB 2ALVA 1T7CA 1ELEE 2R9PA 2JH5D 1AY6H 2KAIB 1PJPA 3NCLA 2Z9LA 2H9EH 1GCTC 1OWEA 5CE1A 1GBCA 2F3CE 3Q3XA 5GXPA 2GCHG 1S81A 3A83A 2TBSA 1BHXB 1GCDA 4ABDA 1ELDE 3SI4H 1K22H 5T6FA 1C5MD 3A7ZA 1GHVH 2BVRH 2B7DH 3GCTG 3ZZ5A 1O35A 1O2NA 3ELAH 1WCZA 1HAVA 1P01A 4AOQA 3RXHA 4UDWH 1TBQH 2D8WA 4AFUA 1EB1H 1TMBH 1O3OA 1G32B 1FJSA 5G4BA 1GBFA 2WV5A 1PPFE 1PPZA 3A85A 1QCPA 1D6WA 3RXOA 2WPKS 1E36B 3MNBA 1K1MA 1OPHB 3T2NA 2ZNKH 3GDSA 2OC8A 1HAGE 1EUFA 1C2FA 2RA3A 1HV7A 5A8ZA 1ZGIA 1ZTKA 2NWNA 1T8NA 5FPSA 2FI4E 2C90B 2TPIZ 1ANDA 1C1WH 1O3LA 3OSYA 5JBAS 1AQ7A 3P8GA 4AX9H 3R0FA 2OD3B 2AGIX 1GBDA 4M7GA 4NGAH 3SI3H 3SJKA 1MAYA 1H9IE 1L1JA 1PPCE 1ELGA 1ETSH 3RXDA 4K1EA 4GHTA 1NU7B 5E0HA 1KDQB 1HLTH 1DOJA 1V2NT 2BY8X 1PPHE 2ZU4A 1GDNA 1C4Y2 1HJAC 1K1NA 4Y11E 3UNSA 2BLQA 1V2OT 1C5XB 1KXBA 1C5NH 2BOKA 4JCNA 4E7NA 2UUJB 4XDEA 3SZEA 4X2YA 4VGCB 1TX8A 3E90B 2HPQH 1C5TA 4XBDA 2ZQ2A 2ZDKA 4X8TH 4Y6DA 1DT2A 1NRSH 3TLOA 5EXMA 4BTIB 4E05H 1K21H 1DWBH 1V2VT 1GHBF 1A1RA 3PWBA 3UOPA 1MTSA 3E0PB 2VINA 2Y6TA 3TJUA 2WPLS 2A4RA 1SL3A 2HNTF 1OWKA 4X1SU 4JYUH 5ESTE 1YM0A 1V2UT 1WSSH 5FXLA 4ABFA 1N8OB 1UK3A 1C5VA 1BRCE 1CGHA 5GDSH 1UCYE 2GMTB 1BTYA 2ZO3H 1J9CH 1K1IA 4DCDA 5A2MH 4CBNA 3BN9A 1EP6A 6ESTA 4OS5A 3SNCA 3URCA 3RU4D 2I6SA 2VIWA 4X1PU 1Z8RA 2XWAA 3LGIA 2BDYA 5F8TA 4YOGA 2VNTA 4LK4A 3VPKA 4I8HA 1CA8B 1O37A 2AMPA 1C5LH 1TRYA 3U8TH 4YT7H 1GJ6A 2OBOA 3KN2A 3STJA 3A81A 4GCHG 1O2WA 2VIQA 3KQBA 2R2WU 3BG4C 2R2MB 3FANA 4A1TA 4DURA 1EAWA 3RXBA 1AHTH 1GJ4H 1P03A 3PM3A 5CMXH 3WY8A 1P04A 3PWCA 5AVDA 4GAWA 3B9FH 3ZZCA 1P3EA 2ZPSA 2BDGA 1IQKA 3S9AA 3UFAA 2JETC 1G2MA 3H5CB 1AFQB 1UVSH 4AFSA 4FXGH 1DXWA 3UUZA 2SGDE 2BDHA 1O2KA 3H7OA 1GHYH 2AS9A 1SGYE 5HGGA 4D76A 2SGPE 9ESTA 4M9FA 1UHBB 4CHAC 3TNTA 4IC5A 3AAUA 2ZGXH 2Z94A 3FP8E 1SOTA 3NXPA 1BTUA 3ATMA 3PO1B 1O2QA 3SV6A 1LTOA 2P59A 1ELBA 1GI3A 3P8NA 2H1UA 3RDZA 3LDXH 1DPOA 1J15A 1C2MA 1C2IA 4Y10E 2I6QA 4MQAA 1O5BB 2QGRA 5LGOA 3QWCH 1FZZA 1FDPA 1ELCA 1HPGA 1QA0A 2G55A 4Q80A 2IJD1 1A3EH 1TOMH 1CQQA 2W26A 1O3GA 1ZSJA 3A7VA 1HAXB 5AFZH 4LXBH 1P05A 5L30H 1QIXB 5I46H 1SG8B 2UUFB 2BLVA 2J92A 3GOVB 1C2GA 4WMFA 3GYMA 3PMBB 3L3TA 5FX5A 4FVDA 2PGBB 1QBVH 1G30B 3RMMH 1X7AC 2OC1A 1IAUA 3PROA 2WUBA 1KY9A 3MO9A 2BX3A 2UUYA 3RLYH 5C5NA 4A7IB 4I32A 1ZSLA 1TGTA 1S84A 1SLVB 2GCTC 3ZVBA 1BZXE 3M3SA 2ZFSA 3U8RH 3RXUA 3U8OH 1TQ0B 3A89A 3P8FA 4LZ4B 1GMHF 2NU4E 1V2KT 2ODPA 2OINA 2WYGA 1V2LT 2A4GA 4DJZB 2VGCC 2JH0D 1P2KA 3UWJH 2AIQA 1HAPH 1HXFH 3BG4B 1EQ9A 1O2MA 1A0LA 1EP5A 1A4WH 1YCPK 4BOHA 3VEQB 1G3BA 3S9CA 2F83A 4FU9A 1EKBB 1LO6A 1BRBE 1EOJA 3LC3A 3T26A 3SYJA 1RFNA 3L33A 4JYVH 4NFFA 1Z8IB 5EQRA 5C67A 1FPCH 1QB9A 2BDAA 2Q6GA 1CHOG 2ZDVH 2PW8H 1Z8JB 4BAHB 1E0FD 5BRRE 2Z9KA 5EW1H 2GP9B 1YBWA 1OP2A 1IQGA 1P06A 4YLQH 5T6GA 2GV7A 2AIPA 5EXNA 3K6ZA 3TPIZ 3D65E 3O8CA 4FVBA 1LMWB 1Q2WA 2C8ZB 5GWZA 1DITH 4TWYA 1T31A 4OM9A 1GBLA 2WYJA 1F7ZA 1SGPE 1C9PA 1VITG 2CN0H 1OYQA 1YCPM 2BYAX 2BZAA 2ZF0H 2XBXA 3GY2A 1HJ9A 1ORFA 2Z6BD 4WF8A 1EAXA 1TNGA 2Y82A 2GDDA 2GZ9A 2H9TH 4MLFB 4CREA 5PTPA 1GI4A 2OK5A 1K28D 5FBIA 5J4SA 4Y7BA 3FAOA 3A84A 1GBTA 1QTFA 3QGJA 1S6FA 2BY5X 2H9HA 2TGDA 2P94A 1MAXA 3MO3A 1SGTA 3A8DA 6GCHG 1C9TA 3SNBA 1ZTJA 2Z7FE 1JMOH 4Q7YA 1S82A 1QJ6B 4A1VA 2JKHA 5K0HA 1JIRA 3BTWE 1EAIA 2ZA5A 3EE0B 1SGEE 2G52A 2PKAB 2R0KA 1TNIA 1ACBE 1XKAC 2FOGA 1V2PT 4NA8A 1E34B 1XUHA 1TMUH 3OTJE 4ZKNU 3E3TA 2EA3A 2QXGA 3ZV8A 2BD2A 2ZGBH 5EPNA 1HIAB 3TGJE 2GKVE 3DFJA 3LGVA 5T6DA 3SV8A 2BD5A 4BAKB 1TFXA 2AGEX 4GSOA 4B74A 3VB5A 3SUGA 1T8MA 2FTMA 1BHXF 2GCTB 4XFQA 2ZCKP 3LGWA 5E8EH 3V7TA 2XW9A 2OC0A 3GDVA 3PTNA 1EJAA 4DVAU 1H8IH 4Z0KA 2Y7ZA 3STIA 2BB4A 1WBGB 2BD3A 3EA9A 2TGTA 4K3JA 1MCTA 2SNVA 3A7YA 3SU6A 5B6OA 3ITIA 1GJDB 1BRUP 2XYAA 2FPZA 1NFXA 1FQ3A 4JZIA 2FLRH 4XE4A 1EB2A 3BIVH 1XX9A 8ESTE 1E37B 1LHEH 2GCHF 1W11U 4MDSA 1WU1A 2FYQA 2XBWA 3RXIA 4J2YB 2FOBA 2GV6A 1MD7A 1QY6A 1ZHPA 2P16A 2QA9E 1EPTC 1QQUA 2CHAC 3T29A 5T1VA 5A09A 1QRWA 2BDBA 3RXJA 2P3TB 2ZC9H 1MTUA 4YT6H 3S7KB 7LPRA 1HXEH 2VH6A 2OLGA 1DLKB 1SHYA 3ZZ7A 2B0FA 1RIWC 3RU4E 1BUIA 3LGUA 1FN6A 3BTDE 1GI7B 3D62A 4ZKSU 4KGAA 2XCNA 4XSKU 2PV9B 1MBMA 3HKJB 1DVAH 1YLDA 4B71A 1FONA 1SGQE 1L1GA 1SB1H 2WPIS 1OS8A 1EATA 1GBAA 5E2PA 1BDAA 3EA8A 3QO6A 4TY7A 4X1RU 1THPB 2Q6DA 1MZDA 2HPPH 3IITA 4I8JA 2ANMH 3CP7A 3ZZ6A 2HALA 4ABGA 2BHGA 4NSYA 5GPIB 1O5AB 1B0FA 1TGBA 1P09A 1W8BH 1SFIA 3LIWA 1GJAB 1DX5M 1M9UA 2XXLA 3BV9B 1B5GH 1J8AA 1NFYA 1QURH 1RD3B 1C2JA 1W13U 1OP0A 1K1LA 2FOFA 4HI3A 1CSOE 2C8YB 2WUCA 2A5AA 1V2RT 2FOAA 1AKSB 1YPMH 3GCOA 1FPHH 2RCEA 1O5FH 3OY6U 3BG8A 2DE9A 4PROA 1AE5A 1S0RA 2VIDA 1YPJH 1GDQA 1PPBH 2SFAA 3SU2A 1GI6A 1G36A 3ODFA 1TPSA 2M5TA 1IQFA 1KXAA 5H4IB 3AAVA 1SFQB 1UCYH 4HTCH 1LVMA 1NESE 4UE7H 2ANWA 1D4PB 1SLUB 1T4VH 3A7TA 3AASA 4IW4E 4XBCA 2SGEE 3C27B 2Y5HA 6CHAB 3NZIA 2WV9A 1V6DA 3RMOH 5K7RA 1AZ8A 3O8RA 1VGCC 3A7WA 2Y81A 1RS0A 1V3XA 4ZHMU 3V3MA 4ABAA 4GUXA 1KTTB 1EJNA 3RXKA 1CA0C 3GY5A 5T3HA 1FXYA 1C1OA 3QK1A 2ZGCA 1EPTA 1KXDA 3UWIA 4MPXA 4DOQA 1IQHA 4X6NA 1NC6A 4AN7A 2VVVA 5DP9A 1LKAA 1OWDA 1S83A 1TAWA 3KL6A 1IQNA 1VCPA 1G3DA 2O9QA 1WQSA 3UTUH 4GCHF 3HGNA 3ZYDA 2ESTE 3P8OA 2G4UA 3TGKE 3U98H 1BQYA 1ZYOA 4AB8A 4D9RA 2QIQA 2YNAA 2C3SA 4B1TA 4RSPA 3ZV9A 4I31A 4KTCA 1QQ4A 2G5NA 3HATH 3QTVH 5GNDA 4KTUA 5I25A 1YPGH 3RMLH 1RIWB 1OOKB 4H6SB 2FYRA 3LJOA 3E6PH 1AE8H 2EEKA 4DGJA 3QN7A 2HVXA 2HLCA 2BXUH 1PPGE 1P9SA 2ZU1A 2F91A 1C5RA 3M5NA 4RKJB 3DD2H 1NY22 2EI8A 2VU8E 3Q76A 3M7TA 1EZSC 3FZZA 2GTBA 1GVKB 3KF2A 4NCYA 2PGQB 5GCHG 3QTOH 1HAVB 1HBTH 1YYY1 2FZZA 2RDLA 2ZU2A 3IWMA 5FPTA 1D9IA 2OQ5A 4AG1A 1BJUA 1MU8B 4FUGA 4Z6AH 3IG6B 3ZZBA 3SUDA 2V3HH 1OXGA 2BD8A 5AF9H 4O03A 3RC6A 2OTVA 2FOEA 1ARCA 5IYTA 1QJ7B 3KQDA 4YOIA 1O2JA 2PKSB 2Y7XA 3M5OA 4IC6A 1BITA 1UK4A 1UJ1A 2V0BA 3D49H 1GBMA 4JZFH 2XRCA 1NU9A 1TIOA 1WUNH 4CRFA 1ZRKA 2OXSA 7ESTE 1J14A 1ZHMA 2ZCHP 1Z6JH 1SGDE 1A7SA 1K2I1 1MU6B 2WINI 1E35B 4OS2A 5DP8A 1MKWH 3G01A 2ZPRA 1Z8GA 1HRTH 4H6TA 1UTPA 1A0JA 1QGFA 3ATKA 3GICB 1J17T 5CHAB 3AVZA 5DP3A 3BTHE 1TMTH 3SNAA 2WPMS 3URDA 2FMJA 2ANKH 4OS4A 5SGAE 2B9LA 3ZZAA 2QXHA 3RC5A 1JRSA 1UK2A 1CT4E 2YOLA 2ZG0H 3A88A 1GMCG 4YOJA 4WJG2 1HB0B 3RXMA 1SI5H 1AZZA 4MNWA 1V2TT 3SBKA 3A8BA 1CA0B 1O2GH 1CBWC 1C5QA 1OWHA 3SHCH 2C93B 1GBKA 4QT8C 1F0RA 4Y0ZE 2W5EA 1TPPA 5C20A 2QN5T 4NIWA 3SQEE 3RXEA 2OQUA 2XC4A 4K69A 1FUJA 5BPEA 4IN2A 3GISB 1Z6EA 3RXQA 5EW2H 1O2SA 1GCTB 4CR5A 4RKOB 2BX4A 3FP7E 1U6QA 2C4FH 2ZFTA 4IBLH 3ZVFA 2J2UA 5JDUB 2HWLB 4CRGA 1GG6C 2D1JA 3MNXA 2TGPZ 1DM4B 3SV7A 1DICA 1BJVA 1DLEA 5DPAA 4IN1A 1AVWA 1GHAF 4CH8B 1IQLA 3TIUA 2BY9X 1LQDB 4D9QA 2Y5GA 4ABBA 1O3FA 1ARBA 3HK6B 4CBOA 1ZPCA 3ZZ8A 1MKXH 1O3JA 3VB7A 3LONA 4WMDA 3EYDA 2ZDAH 2O8TA 2CF8H 4YZUA 3TK5A 2BZ6H 1V2JT 1Y3VA 1L1NA 5FPYA 9LPRA 2CGAA 4O97A 1ANCA 3LU9B 5E0JA 1PFXC 2P3FH 1UO6A 3QLPH 1GI9B 3RXFA 3UQVA 2FWWA 1ZZZA 1DSUA 3DA9B 1WV7H 1AD8H 1ABJH 1SQAA 2CXVA 1FY5A 3U69H 1AI8H 2EI7A 3F9GA 2EC9H 1P8VC 1V2WT 1IHTH 1TOCB 4WMEA 1GI0A 2PWXA 1ANEA 2GD4B 1QL9A 2P3UB 4X8SH 4H42U 3RM2H 3Q77A 2C8WB 1L4DA 4WVPE 2CF9H 1HJAB 4NWLA 1QFKH 1PYTC 2ZPQA 6GCHF 4I33A 1BMMH 1XKBC 1DY9A 3LH3A 4YTAA 1DANH 1O3CA 2A2XH 3MH5A 4I8KA 5EQQA 4LZ1H 1CT2E 2BTCE 3PMJA 2J9NA 2H5DA 3UOUA 1VJ9U 3E1XB 3T62A 3F9EA 1F5KU 1LDTT 1LHGH 1AIXH 1BTPA 1P57B 1XXFA 3QX5H 4WH6A 4I7YH 5A0AE 2ODYB 4UFDH 4O9VA 3SGBE 1Y5AT 3T5FH 3SJ9A 2O8LA 2XTTB 3SO3A 3LOXA 3SGQE 3LKWA 4U2WA 3SNEA 2QV1A 4YESB 1J16A 4BXSA 2WV4A 4ISHH 4JK5A 6LPRA 2ZDLA 4R0IA 1CBWB 3MO6A 3SZNA 1GL1A 3SJ8A 2W7UA 3A7XA 1UTKA 2ZGHA 3M3VA 1SGFG 2XC5A 2J4IA 1PYTD 2BLOA 1FMGA 5EG4A 2ZFQH 5EPYA 1O3NA 2BOHB 2P93A 1GHBG 8LPRA 3PMAB 3ZVCA 4AZ2B 1ZPZA 3UR9A 3MU8A 3GY7A 1XXDA 4NG9H 1Y3UA 1O5GH 1XUGA 3VGCC 1CE5A 4Y8YA 5C2ZA 1QJ1B 1BIOA 1SGFA 2FESH 1QB6A 3BTTE 3KNXA 2D2DA 3MNCA 4B6FA 1DUAA 5DP5A 5GJ4B 1PPEE 4FUJA 1Y8TA 1UCYK 1QRZA 4ZHLU 1DY8A 1WAYB 1W3CA 1C1PA 1VJAU 5HXFA 2VIOA 5F8XA 1Z1JA 2F4LA 1MTNC 3U1JB 3MOCA 1B7XB 2JETB 2OUAA 1QHRB 2ZTZA 2QYIA 2J38A 3SU0A 1SHHB 1HJ8A 3AK5A 3ZZ9A 2A4QA 2FODA 4KP0A 4HFPB 1ID5H 1P3CA 4R8TB 2R3UA 1YPKH 4UONA 4K8YA 3V12A 2FOHA 2AMQA 1RTKA 5FHTA 4CHAB 1LCYA 3H7TA 1BMNH 3W95A 8GCHG 1C5SA 1O5EH 5LPEA 3JZ2B 1PQ5A 2A31A 2NU0E 2ZHWH 1LVYA 1DXPA 2ZHFH 3SN8A 1K1OA 1LQEA 3QGNB 3ATLA 3ENSB 3PMHB 4X2XA 4YLUA 1GJ7B 4MTBA 3JZ1B 5EGMA 4MG3A 1O3EA 1CU1A 1A46H 1IQMA 2P8OC 1P2JA 3DUXH 1BTHH 1Y59T 3EQ0H 2ZU5A 3FP6E 1JOUB 3F1SB 1WOFA 1ZMLA 4NZLA 3RXSA 1C4V2 1K1JA 1F0UA 1YPHC 1P0SH 1C1UH 1EX3A 2UWPA 3Q3KA 5JPMH 4CH2B 3E8LA 1O36A 1D3PB 4X6OA 2GT8A 4NZQA 1GHZA 3DT0H 1LHCH 4K8BA 2DE8A 4HGCA 1OP8A 3RXVA 4BXWA 1NO9H 1XUIA 3F68H 4YO9A 1C2EA 2ILNA 1BBRE 1RTLA 3K9XB 4JZDH 3F9FA 2A45B 4ZUHA 2BD7A 4X1QU 2FOCA 3QZQA 4ASHA 1A5IA 1O2YA 2EI6A 2ZI2H 4AGJA 1ZPBA 1UTMA 3VXFH 2FOMB 5DK1A 4XOJA 3MI4A 1E38B 1MQ6A 2P95A 1QBOA 5DGJA 1QRXA 1ZR0A 1FLEE 1W12U 3HPTB 3FVFB 2AGGX 3MU0A 3S7HB 4B2CA 1MKWK 2XBVA 1DS2E 4TPYA 2NU3E 1NS3A 1UTQA 4TYDA 1SC8U 1GVZA 3CENA 1RGQA 2VVUA 1O0DH 4FUHA 5TCCA 3PV4A 1AUJA 2VGCB 3VGCB 1KLTA 3AW1A 1OX1A 3ZVGA 1VZQH 1UVTH 5C1UA 3RP2A 2ULLA 3TK9A 1WXRA 3KQEA 1O38A 1TLDA 1GHXH 3PLPA 2V35A 1SPJA 2VWLA 1TA2A 2A0QB 2VIPA 4CRCA 1Y5UT 1UTNA 1GMDG 4A6LA 1GBEA 4ISOA 4BAQB 2IOTA 3M3TA 1Z71A 3GCHC 1O3AA 3TVJB 1EJMA 4B2AA 5HM9A 1GMHG 1WQVH 4AORA 1BTZA 1DUEA 1O3MA 1S0QA 3GCTF 3KCGH 4FU7A 4BANB 1O33A 1ESBA 5LH8A 4THNH 3PYHA 4X2WA 2H2ZA 1XM1A 2UUKB 1O30A 1VITH 1G3CA 2PUQH 3SU3A 1O34A 5DJ7A 3V0XA 1GPZA 3PLBA 1AO5A 1C2DA 3U9AH 3RXPA 5C1YA 1OSSA 5GCHF 1EZXC 4CRDA 4X6PA 2ZWLH 1HGTH 1SSXA 2Z3CA 4FUCA 1FIWA 2BVXH 5IDKA 1XVOA 3S0NA 2P8OB 3MFJA 1AN1E 3LGTA 3A87A 1RRKA 3GY3A 1A61H 1GGDC 1O3BA 2IPHA 3HK3B 3BTQE 4KTSA 1D3DB 3RXAA 2FP7B 2PTCE 4DY7B 4ZKOU 2QF3A 2CMYA 4JMYA 1O2VA 2PFEA 4UD9H 4CRAA 4ABEA 1GJ9B 1ELVA 5DP7A 3M7UA 3RU4T 4KELA 1UVUH 1C4U2 5E2OA 1C5UA 1O2RA 3A8CA 3TH4H 1XUFA 1A2CH 1T8OA 4FUEA 3SV2H 1C1RA 1G37A 2O8WA 2QXIA 2VBCA 1THRH 4ABJA 1FNIA 1O2ZA 2WZQA 3HKIB 3S9BA 4SGAE 2ZZUH 2ZGJA 4XBBA 4NIYA 4MNVA 4B6EA 1SBWA 4X6MA 1KYNA 2OP9A 3RXTA 3QZRA 5JBBS 3NWUA 1MMJN 1TPAE 4E7RG 1S6HA 5EXLA 3F6UH 1C5WB 1LVBA 4FUFA 2W7SA 1XMNB 1LPKB 1F5RA 4I8GA 3UREA 2FI5E 1GMCF 2DUCA 1TWXB 1UTJA 3R3GB 5LPFA 1C1SA 3RXRA 3TNSA 1T4UH 3UIRA 1D3TB 1INCA 1XVMA 2FO9A 4AG2A 2VIVA 1NROH 1TGCA 2PR3A 3S69A 3FZDA 1H1BA 2HNTE 1Q31A 2AMDA 1KTSB 1ZSKA 1AB9C 3T25A 3TITA 3SW2B 3I78A 5F6MA 2AERH 4F49A 5FAHA 2A7JA 2TRMA 2BD4A 1H4WA 4OGYA 3BF6H 1JRTA 1TPOA 2A7HA 2R0LA 4MNXA 5DP6A 1NTPA 1KSNA 1ZJKA 5TCAA 1EOLA 3PV5A 3GCHB 1QBNA 1F5LA 3ZYEA 1HAOH 1V2QT 2KAIA 4Q7XA 1EPTB 1NT1A 2CHAB 4NA7A 1ZOMA 4MNYA 2GMTC 3M36A 1DWDH 1CT0E 1W14U 1O2XA 4ISIH 1BB0B 1LKBA 4INLA 1K9OE 2BXTH 1IHSH 5F03A 4DG4A 2WPHS 1NRNH 1W0ZU 1Y5BT 3M35A 2FIRH 5GIBA 3B23B 3PLKA 5ESBA 1ZJDA 1GJ8B 1MH0A 1RXPA 1TNJA 1P12E 1TBZH 1TYNA 2FS9A 1S5SA 3MH4A 1HCGA 7GCHG 4IGDA 5J4QA 1FY3A 4B2BA 1GGDB 2QC2A 1MUEB 2OBQA 2K1QA 4A1XA 5F8ZA 2GZ8A 1O3KA 1RJXB 2ZTYA 2AH4X 2CJIA 3SQHE 2ZKSA 3GY4A 3TH3H 2THFB 1TRNA 4OGXA 4GPGA 1AFQC 2B8OH 3ESTA 3F9HA 3I29A 4H4FA 1HDTH 4X0WU 2XNIA 2OC7A 3VB4A 1MD8A 3BTKE 1AU8A 2J95A 2FI3E 4JYTA 3MWIU 1N1LA 4NIVA 3I77A 5FCRA 3RC4A 1TB6H 1YGCH 2ZDMA 2ZHEH 1KDQA 4WWYA 3NKKA 2TGAA 1ZTLA 1EZUC 1P10A 4ESTE 1AVXA 1WTHD 3PO1C 3W94A 1NFUA 3P6ZB 1UMAH 1Y3WA 1IQIA 1O5CB 1DFPA 2A1DB 3P95A 1NRQH 1ELTA 3L6PA 3QDZB 3PB1E 2RG3A 1JBUH 1KIGH 4WXVA 1TNHA 1AWFH 1O2IA 2SGAA 1OWJA 3SUFA 2Z9IA 3TU7H 3SNDA 1FY4A 1O3PB 4Y8XA 1VGCB 3Q00A 4Y79A 4I8LA 5L2YH 2SGQE 5EQSA 3ZVEA 3UNRA 1F2SE 4JK6A 1Q3XA 4NIXA 1C1TA 3ZZ4A 1AB9B 4IMQA 1YF4A 2GVFA 2GX4A 1N6YA 3AW0A 1FY8E 1H9LB 3T27A 1QL7A 4CRBA 1ELFA 3BTGE 3GCNA 4UFGH 3UNQA 2C8XB 2ZQ1A 1TX6A 4K5ZA 3OX7U 1SLXB 1PQ7A 1G2LA 2XC0A 1HAIH 3Q3YA 4ZHAA 3UR6A 4ZXXH 4OS7A 4OS6A 2A4OA 4FU8A 1SGRE 4BNRA 2A32A 2PTNA 2HOBA 2W3IA 5DKMA 1YPHE 3VXEH 2QF0A 1GJ5H 4INKA 1C5ZB 1O31A 2Y80A 1IQEA 1ELAA 1LHDH 3BTEE 4K2YA 3TJNA 1QR3E 2ZHQH 3T28A 1YLCA 2ZECA 1GVLA 4GVUA 3M5MA 5ETXA 2ZEBA 1CHOF 4Y8ZA 2UWOA 4MPVA 3MH7A 1DWCH 1CGJE 3SUEA 3M37A 1L4ZA 1A5GH 1HAYB 3RUOA 1TRMA 1W10U 4INHA 3ZVDA 3M61U 1DE7H 1SLWB 8GCHF 4BAMB 3GDUA 1QL8A 5L2ZH 3RXLA 5EOKA 2HNTC 2PHBA 2ANYA 4WY3A 2V6NA 1VITF 5JB8S 1UTOA 3KIDU 5JBCS 3BEFB 1D3QB 1UHBA 3GY6A 1ZHRA 1GBHA 1P11E 1FI8A 2FM2A 1TQ7B 1HAHH 1C5YB 3TJOA 4YM9A 2ODQA 5JB9S 1BMAA 1C5PA 4Q2KA 1C1MA 4GHQA 2AFQB 4IMZA 2BY6X 2ZFPH 1XUKA 5DO4H 1MCVA 2GZ7A 3UPEA 1YKTA 2BM2A 1AFEH 3A86A 2G8TA 4D8NA 2Q1JA 2UWLA 1YP9A 1FIZA 4ZMAH 2G81E 1BBRH 3NUMA 1WYKA 3OY5U 4Y7AA 2A5IA 1FV9A 1LVOA 1O2LA 2Q6FA 3ATIA 1VR1H 4AFQA 5LPRA 1ETRH 3BTFE 3K2UA 3O8BA 2Z3EA 4B73A 3A80A 4BTTB 5A8XA 3EA7A 1W0YH 4ZROA 4NFEA 4ZAEA 1BTXA 1D6RA 1AUTC 3MMGA 2AEIH 1GBIA 3GY8A 4ABHA 1NRPH 4JZ1A 1C1QA 4DIHH 4K1TA 5C3NA 2QAAA 1TBRH 3RLWH 3ZVAA 1YC0A 3EAJA 4AYVB 3LC5A 2VJ1A 1NRRH 1THSH 4ZH8A 4Y71A 3BEUA 2ZFRH 1O5DH 3ODDA 1JXPA 1W7XH 2FS8A 4WH8A 1AMHA 4GLYA 4A92A 4RN6A 2G5VA 1GG6B 4Y76A 3NK8A 1O2UA 1QNJA 3SGAE 4D7FA 1GBJA 1ZMJA 2VWNA 4ZKRU 1C1NA 3ZZ3A 3BSQA 1C2LA 1UVOA 5C5OA 4IS5A 1GMDF 1ZGVA 2QCYA 2PSYA 1GI8B 1SR5C 1F0TA 4ISLA 5B6LA 1O32A 1EAUA 1BOQA 2IJOB 1P02A 2ASUB 5A8YA 2VWMA 2IN2A 1KXCA 3CS7A 4K1SA 4SGBE 1NN6A 5A0BA 1GWAA 1S85A 4FUDA 4ABIA 2RA0A 1C1VH 1OYTH 2TIOA 2FDAA 1K1PA 1Z7KA 2XBYA 2Z9JA 1O2PA 1GI2A 2GGVB 1GHAG 4MPUA 4X8VH 3TH2H 3ZZDA 2ZTXA 1PQAA 3E91A 1P2IA 1MBQA 2LPRA 3DHKH 3SORA 1C2HA 1UVPA 3MU5A 1B0EA 1TA6A 3SJOA 3SHAH 4UFFH 3B8JA 4TY6A 5AFYH 2F9NA 4DT7B 2QXJA 3P17H 1HNEE 2FTLE 2NU2E 4WXIA 3K6YA 2WHXA 2BDCA 2NU1E 1VCWA 5HYOA 4X8UH 2BD9A 2HRVA 1O3DA 4B76A 1TNLA 5HMAA 2OCVB 1CO7E 4A5TS
chains in the Genus database with same CATH superfamily
5L6NH 1TGSZ 1YPEH 2B5TB 1W2KH 3SJIA 1KXFA 3O8DA 1O2TA 2VH0A 1F0SA 1SVPA 3LT3A 1YLNA 3GYLB 1T32A 1EXFA 1IQJA 1LPGB 4X1NU 1P2OA 4B75A 1DWEH 5E0GA 1MQ5A 4U32A 3SU4A 1HUTH 1G3EA 2WPJS 5JYIA 3E0NB 4NSVA 2ZHDA 1GL0E 2VWOA 1O3IA 3H09A 5JBTA 1NZQH 2STBE 5C0UA 1TX7A 1V2MT 4ISNA 1RTFB 3SU5A 1NPMA 2PKAA 3PV2A 2AHME 1N6XA 4RI0A 3VB6A 2ZP0H 4KKDA 1HFDA 2SGFE 3CS0A 3KYGA 3OTPA 3D23A 4K60A 1HIAA 3QUMP 5TJXA 1TABE 1OKXA 1FN8A 5DG6A 1EFRD 3MU4A 4OS1A 4UEHH 3KEEA 4DW2U 4O3TA 1T8LA 3K65B 3BIUH 2XCFA 1NM6A 2FX6A 5AHGH 3OYPA 3LGYA 2PUXB 4NA9H 1O2OA 1PQ8A 1O2HA 1TONA 3E16B 3VFEA 1H8DH 1GDUA 3SOSA 2GDEH 1WTGH 3NPSA 3MHWU 1JIMA 2BDIA 3LH1A 2A7CA 4CR9A 2SNWA 4AFZA 3EGKH 1BT7A 2F9VA 3FFGA 2JDID 2FEQH 4AYYB 1SGCA 1SMFE 3F3BA 1ZMNA 2YNBA 3RXCA 3F2HA 4JZEH 2BQWB 2ZCLP 3BTME 1DDJA 1JWTA 1Y3YA 2BVSH 2VB0A 6CHAC 1EASA 4Q7ZA 4Q63A 3U1IB 8KME2 3V13A 2D26C 1MTNB 2O8MA 2O8UA 2XWBI 1A5HA 2BY7X 3PTBA 3KHVA 3MTYA 1FAKH 5A0CA 4MVNA 1KLIH 3MNSA 3EE7A 2ZU3A 1ESAA 1MTWA 2F9OA 2QY0B 3MQKC 1NBMD 5DP4A 1AGJA 3LJJA 4FUIA 2R3YA 4HZHA 2Y5FA 3KQCA 3TJVA 4LOYH 3UQOA 1BTWA 1AVGH 4MPWA 1G9IE 2ZFFH 3DFLA 5FBEA 4ZXYH 3OU0A 7GCHF 4UFEH 3KGPA 1QA7A 1IOEA 1LHFH 2AYWA 2BMGB 4O3UA 4Y0YE 7KMEH 2G4TA 3TGIE 1TNKA 1P9UA 3HGPA 2V3OH 1SGNE 1GJCB 1OWIA 1ANBA 1BA8B 3BEIB 2H5CA 4FETA 2FXRA 1GI1A 2ZIQH 1MKXK 1VCQA 3WWFA 2F9UA 4AGKA 5ABWA 1O3HA 1TE0A 3MYWA 2BQ6B 2STAE 1GBBA 1BMLA 3P92A 3MU1A 1L2EA 1MTVA 2W3KA 4J1YA 4TPIZ 5EODA 3TK6A 1S6LA 1Z1IA 4NWKA 3ATWA 3EDXB 3A8AA 1KLJH 1KXEA 1ZRBA 1V2ST 2CV3A 4D7GA 3C1KA 2GT7A 2Z9GA 2Z3DA 1MZAA 1ZLRA 2F9PA 4BAOB 2PKSC 5HM2A 3VB3A 1HYLA 3RMNH 1CVWH 1GJBB 5FX6A 1AKSA 1P2QA 2PSXA 3RM0H 4E06H 1BCUH 1C5OH 1CHGA 1NFWA 2ALPA 4FUBA 1DSTA 2J34A 2LNCA 2G51A 1A0HB 4X2VA 2VVCA 2J94A 1C2KA 1SGIB 1TGNA 4XRNA 5C0TA 1FY1A 3VG8A 4U01A 2PLXA 1Y3XA 1E1QD 2H6MA 1P2NA 4U30A 1EZQA 1QB1A 1FAXA 4F4OC 2A2QH 2A5KA 2ZDNA 1YPLH 2HGTH 1BBRK 1SQTA 4AB9A 5HIYA 1F92A 4TWWA 1P2MA 5FCKA 1ESTA 5C1XA 5CHAC 1ABIH 3OAAD 1W7GH 3RXGA 2QF4A 4VGCC 4DIIH 1AWHB 1H9HE 1YCPH 3M7QA 3M5LA 2F9BH 1TALA 1XUJA 2JH6D 1O39A 2BLWA 1GHWH 3A82A 1BRAA 2FX4A 3UY9A 1HAZB 2G00A 1SOZA 4BTUB 3MH6A 3SV9A 2BQ7B 3SU1A 1N8OC 1ETTH 3LPRA 1UTLM 1SQOA 3N7OA 5EU8A 2FLBH 1GI5A 3P70B 1A3BH 1L0ZA 1CGIE 1LPZB 2ALVA 1T7CA 1ELEE 2R9PA 2JH5D 1AY6H 2KAIB 1PJPA 3NCLA 2Z9LA 2H9EH 1GCTC 1OWEA 5CE1A 1GBCA 2F3CE 3Q3XA 5GXPA 2GCHG 1S81A 3A83A 2TBSA 1BHXB 1GCDA 4ABDA 1ELDE 3SI4H 1K22H 5T6FA 1C5MD 3A7ZA 1GHVH 2BVRH 2B7DH 5F53A 3GCTG 3ZZ5A 1O35A 1O2NA 3ELAH 1WCZA 1HAVA 1E79D 1P01A 4AOQA 3RXHA 4UDWH 1TBQH 2D8WA 4AFUA 1EB1H 1TMBH 1O3OA 4HG6A 1G32B 1FJSA 5G4BA 1GBFA 2WV5A 1PPFE 1PPZA 3A85A 1QCPA 4TSFD 1D6WA 3RXOA 2WPKS 1E36B 3MNBA 1K1MA 1OPHB 2WPDD 3T2NA 2ZNKH 3GDSA 2OC8A 1HAGE 1EUFA 1C2FA 2RA3A 4F48B 4DT4A 1HV7A 5A8ZA 1ZGIA 1ZTKA 2NWNA 1T8NA 5FPSA 2FI4E 2C90B 2TPIZ 1ANDA 1C1WH 1O3LA 3OSYA 5JBAS 1AQ7A 3P8GA 4AX9H 3R0FA 2OD3B 2AGIX 1GBDA 4M7GA 4NGAH 3SI3H 3SJKA 1MAYA 1H9IE 1L1JA 1PPCE 1ELGA 1ETSH 3RXDA 4K1EA 4GHTA 1NU7B 5E0HA 1KDQB 1HLTH 1DOJA 1V2NT 2BY8X 1PPHE 2ZU4A 1GDNA 1C4Y2 1HJAC 1K1NA 4Y11E 3UNSA 2BLQA 1V2OT 1C5XB 1KXBA 1C5NH 2BOKA 4JCNA 4E7NA 2UUJB 4XDEA 3SZEA 4X2YA 4VGCB 1TX8A 3E90B 2HPQH 1C5TA 4XBDA 2ZQ2A 2ZDKA 4X8TH 4Y6DA 1FX0B 1DT2A 1NRSH 3TLOA 5EXMA 4BTIB 4E05H 1K21H 1DWBH 1V2VT 1GHBF 1A1RA 2QF5A 3PWBA 3UOPA 1MTSA 3E0PB 2VINA 2Y6TA 3TJUA 5EIYA 2J98B 2WPLS 2A4RA 1SL3A 2HNTF 1OWKA 4X1SU 4JYUH 5ESTE 1YM0A 1V2UT 1WSSH 5FXLA 4ABFA 1N8OB 1UK3A 1C5VA 1BRCE 1CGHA 5GDSH 1UCYE 2GMTB 1BTYA 2ZO3H 1J9CH 1K1IA 4DCDA 3PRBA 5A2MH 4CBNA 3BN9A 1EP6A 2L74A 6ESTA 4OS5A 3SNCA 3URCA 3RU4D 2I6SA 2VIWA 4X1PU 1Z8RA 2XWAA 3LGIA 2BDYA 5F8TA 4YOGA 2VNTA 5CHBA 4LK4A 3VPKA 4I8HA 1CA8B 1O37A 2AMPA 1C5LH 1TRYA 3U8TH 4YT7H 1GJ6A 2OBOA 3KN2A 3STJA 3A81A 4GCHG 1O2WA 2VIQA 3KQBA 2R2WU 3BG4C 2R2MB 3FANA 4A1TA 4DURA 1EAWA 3RXBA 1AHTH 1GJ4H 1P03A 3PM3A 5CMXH 3WY8A 1P04A 3PWCA 5AVDA 4ACAA 4GAWA 3B9FH 3ZZCA 1P3EA 2ZPSA 2BDGA 5KGOA 1IQKA 3S9AA 3UFAA 2JETC 1G2MA 3H5CB 1AFQB 1UVSH 4AFSA 4FXGH 1DXWA 3UUZA 2SGDE 2BDHA 1O2KA 3H7OA 1GHYH 2AS9A 1SGYE 5HGGA 1NBME 4D76A 2SGPE 4M9FA 9ESTA 4I86A 1UHBB 4CHAC 3TNTA 4IC5A 3AAUA 2ZGXH 2Z94A 3FP8E 1SOTA 3NXPA 1BTUA 3ATMA 3PO1B 2JIZD 1O2QA 3SV6A 1LTOA 2P59A 1ELBA 1GI3A 3P8NA 2H1UA 3RDZA 3LDXH 1DPOA 1J15A 1C2MA 1C2IA 4Y10E 2I6QA 4MQAA 1O5BB 2QGRA 5LGOA 3QWCH 1FZZA 1FDPA 1ELCA 1HPGA 1QA0A 2G55A 4Q80A 2IJD1 1A3EH 1TOMH 1CQQA 2W26A 1O3GA 1ZSJA 3A7VA 1HAXB 5AFZH 4LXBH 2KCOA 1P05A 2XNDD 5L30H 1QIXB 5I46H 1SG8B 2UUFB 2BLVA 2J92A 3GOVB 1C2GA 4WMFA 3GYMA 3PMBB 3L3TA 5FX5A 4FVDA 2PGBB 1QBVH 1G30B 3RMMH 3DSPA 1X7AC 2OC1A 1IAUA 3PROA 2WUBA 1KY9A 3MO9A 2BX3A 2UUYA 3RLYH 5C5NA 4A7IB 4I32A 1ZSLA 1TGTA 1S84A 1SLVB 2GCTC 3ZVBA 3WW7A 1BZXE 3M3SA 2ZFSA 3U8RH 3RXUA 3U8OH 1TQ0B 3A89A 3N7EA 3P8FA 4LZ4B 1GMHF 1K0HA 2NU4E 1V2KT 2ODPA 2OINA 2WYGA 1V2LT 2A4GA 4DJZB 3GS9A 2VGCC 2JH0D 1P2KA 3UWJH 2AIQA 1HAPH 1HXFH 3BG4B 1EQ9A 1O2MA 1A0LA 1EP5A 1A4WH 1YCPK 4BOHA 3VEQB 1G3BA 3S9CA 2F83A 4FU9A 1EKBB 1LO6A 1BRBE 1EOJA 3LC3A 3T26A 3SYJA 1RFNA 4ZCNA 3L33A 4JYVH 4NFFA 1Z8IB 5EQRA 5C67A 1FPCH 1QB9A 2BDAA 2Q6GA 1CHOG 2ZDVH 2PW8H 1Z8JB 4BAHB 1E0FD 5BRRE 2Z9KA 5EW1H 2GP9B 1YBWA 1OP2A 1IQGA 1P06A 4YLQH 5T6GA 2GV7A 2AIPA 5EXNA 3K6ZA 3TPIZ 3D65E 3O8CA 4FVBA 1LMWB 1Q2WA 2C8ZB 5GWZA 1DITH 4TWYA 1T31A 4OM9A 1H8HD 1GBLA 2WYJA 1F7ZA 1SGPE 1C9PA 1VITG 2CN0H 1OYQA 1YCPM 2BYAX 2BZAA 2ZF0H 2XBXA 3GY2A 1HJ9A 1ORFA 2Z6BD 4WF8A 1EAXA 1TNGA 2Y82A 2GDDA 2GZ9A 2H9TH 4MLFB 4CREA 5PTPA 1GI4A 2OK5A 1K28D 5FBIA 5J4SA 4Y7BA 3FAOA 3A84A 1GBTA 1QTFA 3QGJA 1S6FA 2BY5X 2H9HA 2KCAA 2TGDA 2P94A 1MAXA 3MO3A 1SGTA 3A8DA 2HVYB 6GCHG 1C9TA 3SNBA 1ZTJA 2Z7FE 1JMOH 4Q7YA 1S82A 1QJ6B 4A1VA 2JKHA 5K0HA 1JIRA 3BTWE 1EAIA 2ZA5A 3EE0B 1SGEE 2G52A 2PKAB 2R0KA 1TNIA 4AC9A 1ACBE 1XKAC 2FOGA 1V2PT 4NA8A 1E34B 1XUHA 1TMUH 3OTJE 4ZKNU 3E3TA 2EA3A 2QXGA 3ZV8A 2BD2A 2ZGBH 5EPNA 1HIAB 3TGJE 2GKVE 3DFJA 5C17A 3LGVA 5T6DA 3SV8A 2BD5A 4BAKB 1TFXA 2AGEX 4GSOA 4B74A 3VB5A 3SUGA 1T8MA 2FTMA 1BHXF 2GCTB 4XFQA 3DSOA 2ZCKP 3LGWA 5E8EH 3V7TA 2XW9A 2OC0A 3GDVA 3PTNA 1EJAA 4DVAU 1H8IH 4Z0KA 2Y7ZA 3STIA 2BB4A 1WBGB 2BD3A 3EA9A 2TGTA 4K3JA 1MCTA 2SNVA 3A7YA 3SU6A 5B6OA 3ITIA 1GJDB 1BRUP 2XYAA 2FPZA 1NFXA 1FQ3A 4JZIA 2FLRH 4XE4A 1EB2A 3BIVH 1XX9A 8ESTE 1E37B 1LHEH 2GCHF 1W11U 4MDSA 1WU1A 2FYQA 2KCYA 2XBWA 3RXIA 4J2YB 2FOBA 2GV6A 1MD7A 1QY6A 1ZHPA 2P16A 2QA9E 1EPTC 1QQUA 2CHAC 3T29A 5T1VA 5FL7D 5A09A 1QRWA 2BDBA 3RXJA 2P3TB 2ZC9H 1MTUA 4YT6H 3S7KB 7LPRA 3F2GA 1HXEH 2VH6A 2OLGA 1DLKB 1SHYA 3ZZ7A 2B0FA 3DCLA 1RIWC 3RU4E 1BUIA 3LGUA 1FN6A 3BTDE 1GI7B 3D62A 4ZKSU 4KGAA 2XCNA 4XSKU 2PV9B 1MBMA 3HKJB 1DVAH 5IK2D 2EQNA 1YLDA 4B71A 1FONA 1SGQE 1L1GA 1SB1H 2WPIS 1OS8A 2V7QD 1EATA 1GBAA 5E2PA 1BDAA 3EA8A 3QO6A 4TY7A 4X1RU 1THPB 2Q6DA 1MZDA 2HPPH 3IITA 4I8JA 2ANMH 3PRDA 3CP7A 3ZZ6A 2HALA 4ABGA 2BHGA 4NSYA 5GPIB 1O5AB 1B0FA 1TGBA 1P09A 1W8BH 1SFIA 3LIWA 1GJAB 1DX5M 1BMFD 4P00A 1M9UA 2XXLA 3BV9B 1B5GH 1J8AA 1NFYA 1QURH 1RD3B 1C2JA 1W13U 1OP0A 1K1LA 2FOFA 4HI3A 1CSOE 2C8YB 2WUCA 2A5AA 5HKKD 1V2RT 2FOAA 1AKSB 1YPMH 3GCOA 1FPHH 2RCEA 1O5FH 3OY6U 3BG8A 2DE9A 4PROA 1AE5A 3N99A 1S0RA 2VIDA 1YPJH 1GDQA 1PPBH 2SFAA 3SU2A 1GI6A 1G36A 3ODFA 1TPSA 2M5TA 1IQFA 1KXAA 2KX4A 5H4IB 3AAVA 1SFQB 1UCYH 4HTCH 1LVMA 1NESE 4UE7H 2ANWA 1D4PB 1SLUB 1T4VH 3A7TA 3AASA 4IW4E 4XBCA 2SGEE 3C27B 2Y5HA 6CHAB 2WV9A 3NZIA 1V6DA 3RMOH 5K7RA 1AZ8A 3O8RA 1VGCC 3A7WA 2Y81A 1RS0A 1V3XA 4ZHMU 3V3MA 4ABAA 4GUXA 1KTTB 1EJNA 3RXKA 1CA0C 3GY5A 5T3HA 1FXYA 1C1OA 3QK1A 2ZGCA 1EPTA 1KXDA 3UWIA 4MPXA 4DOQA 1IQHA 4X6NA 1NC6A 4AN7A 2VVVA 5DP9A 1LKAA 1OWDA 1S83A 2W6ID 1TAWA 3KL6A 3OE7D 1IQNA 1VCPA 1G3DA 2O9QA 1WQSA 3UTUH 4GCHF 3HGNA 3ZYDA 2ESTE 3P8OA 2G4UA 3TGKE 3U98H 1BQYA 1ZYOA 4AB8A 4D9RA 2QIQA 2YNAA 2C3SA 4B1TA 4RSPA 3ZV9A 4I31A 4KTCA 1QQ4A 2G5NA 3HATH 3QTVH 5GNDA 4KTUA 5I25A 1YPGH 3RMLH 1RIWB 1OOKB 4H6SB 2FYRA 4Z1MD 3LJOA 3E6PH 1AE8H 2EEKA 4DGJA 3QN7A 2HVXA 2HLCA 2BXUH 1PPGE 1P9SA 2ZU1A 2F91A 1C5RA 3M5NA 4RKJB 3DD2H 1NY22 2EI8A 5KEDA 2VU8E 3Q76A 3M7TA 1EZSC 3FZZA 2KR7A 2GTBA 1OHHD 1GVKB 3KF2A 4NCYA 2PGQB 5GCHG 3QTOH 1HAVB 1HBTH 1YYY1 2FZZA 2RDLA 2ZU2A 3IWMA 5FPTA 1D9IA 2OQ5A 4AG1A 1BJUA 1MU8B 4FUGA 5EJ1A 2K8IA 2M2AA 4Z6AH 3IG6B 3ZZBA 3SUDA 2V3HH 1OXGA 2BD8A 5AF9H 4O03A 3RC6A 2OTVA 2FOEA 1ARCA 5IYTA 1QJ7B 3KQDA 4YOIA 1O2JA 2PKSB 2Y7XA 3M5OA 4IC6A 1BITA 1UK4A 1UJ1A 2V0BA 3D49H 1GBMA 3KQ5A 4JZFH 2XRCA 1NU9A 1TIOA 3OEED 1WUNH 4CRFA 1ZRKA 2OXSA 7ESTE 1J14A 1ZHMA 2ZCHP 3F0OA 2W6JD 1Z6JH 1SGDE 1A7SA 2J97A 5C94A 1K2I1 1MU6B 2WINI 1E35B 4OS2A 2L6OA 5DP8A 1MKWH 3G01A 2ZPRA 1Z8GA 1HRTH 4H6TA 1UTPA 1A0JA 1QGFA 2JJ2D 3ATKA 3GICB 1J17T 5CHAB 3AVZA 5DP3A 3BTHE 1TMTH 3SNAA 2WPMS 3URDA 2FMJA 2ANKH 4OS4A 5SGAE 2B9LA 3ZZAA 2QXHA 3RC5A 1JRSA 3ZIAD 1UK2A 1CT4E 2YOLA 2ZG0H 3A88A 1GMCG 4YOJA 4WJG2 1HB0B 3RXMA 1SI5H 1AZZA 4MNWA 1V2TT 2WSSD 3SBKA 2HLDD 3A8BA 1CA0B 1O2GH 1CBWC 1C5QA 1OWHA 3SHCH 2C93B 1GBKA 4QT8C 1F0RA 4Y0ZE 2W5EA 1TPPA 5C20A 2QN5T 4NIWA 3SQEE 3RXEA 2OQUA 2XC4A 3UAIC 4K69A 1FUJA 5BPEA 4IN2A 3GISB 1Z6EA 3RXQA 5EW2H 1O2SA 1GCTB 4CR5A 4RKOB 2BX4A 3FP7E 1U6QA 2C4FH 2ZFTA 4IBLH 3ZVFA 2J2UA 1W0JD 5JDUB 2HWLB 4CRGA 1GG6C 2D1JA 3MNXA 2TGPZ 1DM4B 3SV7A 1DICA 1BJVA 1DLEA 5DPAA 4IN1A 1AVWA 1GHAF 2CK3D 4CH8B 1IQLA 3TIUA 2BY9X 5DN6D 1LQDB 4D9QA 2Y5GA 4ABBA 1O3FA 1ARBA 3HK6B 4CBOA 1ZPCA 3ZZ8A 1MKXH 1O3JA 3VB7A 3LONA 4WMDA 3EYDA 2ZDAH 2O8TA 2CF8H 4YZUA 3TK5A 2BZ6H 1V2JT 1Y3VA 1L1NA 5FPYA 9LPRA 2CGAA 4O97A 1ANCA 3LU9B 5E0JA 1PFXC 2P3FH 2KFWA 3F2FA 1UO6A 3QLPH 1GI9B 3RXFA 4ASUD 3UQVA 2FWWA 1ZZZA 1DSUA 3DA9B 1WV7H 1AD8H 2IPQX 1ABJH 1SQAA 2CXVA 1FY5A 2QE7D 3U69H 1AI8H 2EI7A 3F9GA 2EC9H 1P8VC 1V2WT 1IHTH 1TOCB 4WMEA 1GI0A 2PWXA 1ANEA 2GD4B 1QL9A 2P3UB 4X8SH 4H42U 3RM2H 3Q77A 2C8WB 1L4DA 4WVPE 2CF9H 1HJAB 4NWLA 1YWUA 1QFKH 1PYTC 1UW7A 2ZPQA 4I33A 6GCHF 1BMMH 1XKBC 1DY9A 3UB0A 3LH3A 4YTAA 1DANH 1O3CA 2A2XH 3MH5A 4I8KA 2V3MA 5EQQA 4LZ1H 1CT2E 2BTCE 3PMJA 2J9NA 2H5DA 3UOUA 1VJ9U 3E1XB 3T62A 3F9EA 1F5KU 1LDTT 1LHGH 1AIXH 1BTPA 1P57B 1XXFA 3QX5H 4WH6A 4I7YH 5A0AE 2ODYB 4UFDH 4O9VA 3SGBE 1Y5AT 3T5FH 3SJ9A 2O8LA 2XTTB 3SO3A 3LOXA 3SGQE 3LKWA 4U2WA 3SNEA 2QV1A 4YESB 1J16A 4BXSA 2WV4A 4ISHH 4JK5A 6LPRA 2ZDLA 4R0IA 1CBWB 3MO6A 3SZNA 1GL1A 3SJ8A 2XOKD 2W7UA 3A7XA 1UTKA 2ZGHA 3M3VA 1SGFG 2XC5A 2J4IA 1PYTD 2BLOA 4RT0A 1FMGA 3F0PA 5EG4A 4TT3D 2ZFQH 5EPYA 1O3NA 2BOHB 2P93A 1GHBG 8LPRA 3PMAB 3ZVCA 4AZ2B 1ZPZA 3UR9A 3MU8A 3GY7A 1XXDA 4NG9H 1Y3UA 1O5GH 1XUGA 3VGCC 1CE5A 4Y8YA 5C2ZA 1QJ1B 1BIOA 1SGFA 2FESH 1QB6A 3BTTE 3KNXA 3KYFA 2D2DA 3MNCA 4B6FA 1DUAA 5DP5A 5GJ4B 1PPEE 4FUJA 1Y8TA 1UCYK 2EY4C 1QRZA 4ZHLU 1DY8A 1WAYB 1W3CA 1C1PA 1VJAU 5HXFA 2VIOA 5F8XA 1Z1JA 2F4LA 3U28C 4F55A 1MTNC 3U1JB 2LELA 3MOCA 1B7XB 2JETB 2OUAA 1QHRB 2ZTZA 2QYIA 2J38A 3SU0A 2RDEA 1SHHB 1HJ8A 3AK5A 3ZZ9A 2A4QA 2FODA 4KP0A 4HFPB 1ID5H 1P3CA 4R8TB 2R3UA 1YPKH 4UONA 4K8YA 3V12A 2FOHA 2AMQA 1RTKA 5FHTA 4CHAB 1LCYA 3H7TA 1BMNH 3W95A 8GCHG 1C5SA 1O5EH 5LPEA 3JZ2B 1PQ5A 2A31A 2KM0A 2NU0E 2ZHWH 1LVYA 1DXPA 2ZHFH 3SN8A 1K1OA 1LQEA 3QGNB 3ATLA 3ENSB 3PMHB 4X2XA 4YLUA 1GJ7B 4MTBA 3JZ1B 5EGMA 4MG3A 1O3EA 1CU1A 1A46H 1IQMA 2P8OC 1P2JA 3DUXH 1H8ED 1BTHH 1Y59T 3EQ0H 2ZU5A 3FP6E 1JOUB 3F1SB 1WOFA 1ZMLA 4NZLA 3RXSA 1C4V2 1K1JA 1F0UA 1YPHC 1P0SH 1C1UH 1EX3A 2UWPA 3Q3KA 5JPMH 4ACBA 3E8LA 4CH2B 1O36A 1D3PB 4X6OA 2GT8A 4NZQA 1GHZA 3DT0H 1LHCH 4K8BA 3CNRA 2DE8A 4HGCA 1OP8A 3RXVA 4BXWA 1NO9H 1XUIA 3F68H 4YO9A 1C2EA 3W1EA 2ILNA 1BBRE 1RTLA 3K9XB 4JZDH 3F9FA 2A45B 3NRLA 4ZUHA 2BD7A 4X1QU 2FOCA 3QZQA 4ASHA 1A5IA 1O2YA 2EI6A 2ZI2H 4AGJA 1ZPBA 1UTMA 3VXFH 2FOMB 5DK1A 2JJ1D 4XOJA 3MI4A 1E38B 1MQ6A 2P95A 1QBOA 5DGJA 1QRXA 1ZR0A 1FLEE 1W12U 3HPTB 3FVFB 2AGGX 3MU0A 3S7HB 4B2CA 1MKWK 2XBVA 1DS2E 4TPYA 2NU3E 1NS3A 1UTQA 4TYDA 1SC8U 1GVZA 3CENA 1RGQA 2VVUA 1O0DH 4FUHA 5TCCA 3PV4A 1AUJA 2VGCB 3VGCB 1KLTA 3AW1A 1OX1A 3ZVGA 1VZQH 1UVTH 5C1UA 3RP2A 2ULLA 3TK9A 1WXRA 3KQEA 1O38A 1TLDA 1GHXH 3PLPA 2V35A 2KZ4A 1COWD 1SPJA 2VWLA 1TA2A 2A0QB 2VIPA 4CRCA 1Y5UT 1UTNA 1GMDG 4A6LA 1GBEA 4ISOA 4BAQB 2IOTA 3M3TA 1Z71A 3GCHC 1O3AA 3TVJB 1EJMA 4B2AA 5HM9A 1GMHG 1WQVH 4AORA 1BTZA 1DUEA 1O3MA 1S0QA 3GCTF 3KCGH 4FU7A 4BANB 1O33A 1ESBA 5LH8A 4THNH 3PYHA 2YMSC 4X2WA 2H2ZA 1XM1A 2UUKB 1O30A 1VITH 1G3CA 2PUQH 3SU3A 4Q4LA 1O34A 5DJ7A 3V0XA 1GPZA 3PLBA 1AO5A 1C2DA 3U9AH 3RXPA 5C1YA 1OSSA 5GCHF 1EZXC 4CRDA 4X6PA 2ZWLH 1HGTH 1SSXA 2Z3CA 4FUCA 1FIWA 2BVXH 5IDKA 1XVOA 1W0KD 3S0NA 2P8OB 3MFJA 1AN1E 3LGTA 3A87A 1RRKA 3GY3A 1A61H 1GGDC 1O3BA 2IPHA 3HK3B 3BTQE 4KTSA 1D3DB 5DSFA 2FP7B 3RXAA 2PTCE 4DY7B 4ZKOU 2QF3A 2CMYA 4RT1A 4JMYA 1O2VA 2PFEA 2YMSD 4UD9H 4CRAA 4ABEA 1GJ9B 1ELVA 5DP7A 3M7UA 3RU4T 4KELA 1UVUH 1C4U2 5E2OA 1C5UA 1O2RA 3A8CA 3TH4H 1XUFA 1A2CH 1T8OA 4FUEA 3SV2H 1C1RA 1G37A 2KCPA 2O8WA 2QXIA 2VBCA 1THRH 4ABJA 1FNIA 1O2ZA 2WZQA 3HKIB 3S9BA 4SGAE 2ZZUH 2ZGJA 4XBBA 4NIYA 4MNVA 4B6EA 1SBWA 4X6MA 1KYNA 2OP9A 3RXTA 3QZRA 5JBBS 3NWUA 1MMJN 1TPAE 4E7RG 1S6HA 5EXLA 3F6UH 1C5WB 1LVBA 4FUFA 2W7SA 1XMNB 1LPKB 1F5RA 4I8GA 3UREA 2FI5E 1GMCF 2DUCA 1TWXB 1UTJA 3R3GB 2RFKC 5LPFA 1C1SA 3RXRA 3FN8A 3TNSA 1T4UH 3UIRA 1D3TB 1INCA 1XVMA 2FO9A 4AG2A 2GJGA 2VIVA 1NROH 1TGCA 2PR3A 3S69A 3FZDA 1H1BA 2HNTE 1Q31A 2AMDA 1KTSB 1ZSKA 1AB9C 3T25A 3TITA 1YY3A 3SW2B 3I78A 5F6MA 2AERH 4F49A 5FAHA 2A7JA 2TRMA 2BD4A 1H4WA 4OGYA 3BF6H 1JRTA 1TPOA 2A7HA 2R0LA 4MNXA 5DP6A 1NTPA 1KSNA 1ZJKA 5TCAA 1EOLA 3PV5A 3GCHB 1QBNA 1F5LA 3ZYEA 1HAOH 1V2QT 2KAIA 4Q7XA 1EPTB 1NT1A 2CHAB 4NA7A 1ZOMA 4MNYA 2GMTC 3M36A 1DWDH 2YMSB 1CT0E 1W14U 1O2XA 4ISIH 1BB0B 1LKBA 4INLA 1K9OE 2BXTH 1IHSH 5F03A 4DG4A 2WPHS 1NRNH 1W0ZU 1Y5BT 3M35A 3N7DA 2FIRH 5GIBA 3B23B 3PLKA 5ESBA 1ZJDA 1GJ8B 1MH0A 1RXPA 1TNJA 1P12E 1TBZH 1TYNA 2FS9A 1S5SA 3MH4A 1HCGA 7GCHG 4IGDA 5J4QA 1FY3A 4B2BA 1GGDB 2QC2A 1MUEB 2OBQA 2K1QA 3FOAA 4A1XA 5F8ZA 2GZ8A 1O3KA 1RJXB 2ZTYA 2AH4X 2CJIA 3SQHE 2ZKSA 3GY4A 3TH3H 2THFB 1TRNA 4OGXA 4FOUC 4GPGA 1AFQC 2J5UA 2B8OH 3ESTA 3F9HA 3I29A 4H4FA 1HDTH 5CDFE 4X0WU 2XNIA 2OC7A 3VB4A 1MD8A 3BTKE 1AU8A 2J95A 2FI3E 4JYTA 3MWIU 1N1LA 4NIVA 3I77A 5FCRA 3RC4A 1TB6H 1YGCH 2ZDMA 2ZHEH 1KDQA 4WWYA 3NKKA 2TGAA 1ZTLA 1EZUC 1P10A 4ESTE 1AVXA 1WTHD 3PO1C 3W94A 1NFUA 3P6ZB 1UMAH 1Y3WA 1IQIA 1O5CB 1DFPA 2A1DB 3P95A 1NRQH 1ELTA 3L6PA 3QDZB 3PB1E 2RG3A 1JBUH 1KIGH 4WXVA 1TNHA 1AWFH 1O2IA 2SGAA 1OWJA 3SUFA 2Z9IA 3TU7H 3SNDA 1FY4A 1O3PB 4Y8XA 1VGCB 3Q00A 4Y79A 4I8LA 5L2YH 2SGQE 1MABB 5EQSA 3ZVEA 3UNRA 1F2SE 4JK6A 1Q3XA 2J98A 1C1TA 4NIXA 3ZZ4A 1AB9B 4IMQA 1YF4A 2GVFA 2GX4A 1N6YA 3AW0A 1FY8E 1H9LB 3T27A 1QL7A 4CRBA 1ELFA 3BTGE 4YXWD 3GCNA 4UFGH 1VKYA 3UNQA 2C8XB 2ZQ1A 1TX6A 4K5ZA 3OX7U 1SLXB 1PQ7A 1G2LA 2XC0A 1HAIH 3Q3YA 4ZHAA 3UR6A 4ZXXH 3OEHD 1SQRA 4OS7A 4OS6A 2A4OA 4FU8A 1SGRE 4BNRA 2A32A 2PTNA 2HOBA 2W3IA 5DKMA 1YPHE 3VXEH 2QF0A 2K0QA 1GJ5H 4INKA 1C5ZB 1QZ8A 1O31A 2Y80A 1IQEA 1ELAA 1LHDH 3BTEE 4K2YA 3TJNA 1QR3E 2ZHQH 3T28A 1YLCA 2ZECA 1GVLA 4GVUA 3M5MA 5ETXA 2ZEBA 1CHOF 4Y8ZA 2UWOA 4MPVA 3MH7A 1DWCH 1CGJE 3SUEA 2F43B 3M37A 1L4ZA 1A5GH 4P02A 1HAYB 3RUOA 1TRMA 1W10U 4INHA 3ZVDA 3M61U 5EJZA 1DE7H 1SLWB 8GCHF 4BAMB 2PP6A 3FKSD 3GDUA 1QL8A 1KMHB 5L2ZH 1WDIA 3RXLA 5EOKA 2HNTC 2PHBA 2ANYA 4WY3A 2V6NA 1VITF 5JB8S 1UTOA 3KIDU 5JBCS 3BEFB 1D3QB 1UHBA 3GY6A 1ZHRA 1GBHA 1P11E 1FI8A 2FM2A 1TQ7B 1HAHH 1C5YB 3TJOA 4YM9A 2ODQA 5JB9S 1BMAA 1C5PA 5HIZA 4Q2KA 1C1MA 4GHQA 2AFQB 4IMZA 2BY6X 2ZFPH 1XUKA 5DO4H 1MCVA 2GZ7A 3UPEA 1YKTA 2BM2A 1AFEH 3A86A 2G8TA 4D8NA 2Q1JA 2UWLA 1YP9A 1FIZA 4ZMAH 2G81E 1BBRH 3NUMA 1WYKA 3OY5U 4Y7AA 2A5IA 1FV9A 5EJLA 1LVOA 1O2LA 2Q6FA 3ATIA 1VR1H 4AFQA 5LPRA 1ETRH 3BTFE 3K2UA 3O8BA 2Z3EA 4B73A 3A80A 4BTTB 5A8XA 3EA7A 1W0YH 4ZROA 3DSGA 4NFEA 4ZAEA 1BTXA 1D6RA 1AUTC 3MMGA 2AEIH 1GBIA 3GY8A 4ABHA 1NRPH 4JZ1A 1C1QA 4DIHH 4K1TA 5C3NA 2QAAA 1TBRH 3RLWH 3ZVAA 1YC0A 3EAJA 4AYVB 3LC5A 2VJ1A 1NRRH 1THSH 4ZH8A 4Y71A 3BEUA 2ZFRH 1O5DH 3ODDA 1JXPA 1W7XH 2FS8A 4WH8A 1AMHA 4GLYA 4A92A 4RN6A 1SKYE 2G5VA 1GG6B 4Y76A 3NK8A 1O2UA 1QNJA 3SGAE 4D7FA 1GBJA 1ZMJA 2VWNA 3OFND 4XD7D 4ZKRU 1C1NA 3ZZ3A 3BSQA 1C2LA 1UVOA 5C5OA 4IS5A 1GMDF 1ZGVA 2QCYA 2PSYA 1GI8B 1SR5C 1F0TA 4ISLA 5B6LA 1O32A 1EAUA 1BOQA 2IJOB 1P02A 2ASUB 5A8YA 2VWMA 2IN2A 1KXCA 3CS7A 4K1SA 4SGBE 1NN6A 5A0BA 1GWAA 1S85A 4FUDA 4ABIA 2RA0A 1C1VH 1OYTH 2TIOA 2FDAA 1K1PA 1Z7KA 2XBYA 2Z9JA 1O2PA 1GI2A 2GGVB 1GHAG 4MPUA 4X8VH 3TH2H 3ZZDA 2ZTXA 1PQAA 2LP6A 3E91A 1P2IA 1MBQA 2LPRA 3DHKH 3SORA 3FO8D 1C2HA 1UVPA 3MU5A 1B0EA 1TA6A 3SJOA 3SHAH 4UFFH 1E1RD 3B8JA 4TY6A 5AFYH 2F9NA 4DT7B 2QXJA 3P17H 1HNEE 2FTLE 2NU2E 3WWBA 4WXIA 5KECA 3K6YA 2WHXA 2BDCA 2NU1E 1VCWA 5HYOA 4X8UH 2BD9A 2HRVA 1O3DA 4B76A 1TNLA 5HMAA 2OCVB 1CO7E 4A5TS
chains in the Genus database with same CATH topology
5L6NH 1TGSZ 1YPEH 2B5TB 1W2KH 3SJIA 1KXFA 3O8DA 1O2TA 2VH0A 1F0SA 1SVPA 3LT3A 3GYLB 1T32A 1EXFA 1IQJA 1LPGB 4X1NU 1P2OA 4B75A 1DWEH 5E0GA 1MQ5A 4U32A 3SU4A 1HUTH 1G3EA 2WPJS 5JYIA 3E0NB 4NSVA 2ZHDA 1GL0E 2VWOA 1O3IA 3H09A 5JBTA 1NZQH 2STBE 5C0UA 1TX7A 1V2MT 4ISNA 1RTFB 3SU5A 1NPMA 2PKAA 3PV2A 2AHME 1N6XA 4RI0A 3VB6A 2ZP0H 4KKDA 1HFDA 2SGFE 3CS0A 3OTPA 3D23A 4K60A 1HIAA 3QUMP 5TJXA 1TABE 1OKXA 1FN8A 5DG6A 1EFRD 3MU4A 4OS1A 4UEHH 3KEEA 4DW2U 4O3TA 1T8LA 3K65B 3BIUH 2XCFA 1NM6A 2FX6A 5AHGH 3OYPA 3LGYA 2PUXB 4NA9H 1O2OA 1PQ8A 1O2HA 1TONA 3E16B 3VFEA 1H8DH 1GDUA 3SOSA 2GDEH 1WTGH 3NPSA 3MHWU 1JIMA 2BDIA 3LH1A 2A7CA 4CR9A 2SNWA 4AFZA 3EGKH 1BT7A 2F9VA 3FFGA 2JDID 2FEQH 4AYYB 1SGCA 1SMFE 3F3BA 1ZMNA 2YNBA 3RXCA 3F2HA 4JZEH 2BQWB 2ZCLP 3BTME 1DDJA 1JWTA 1Y3YA 2BVSH 2VB0A 6CHAC 1EASA 4Q7ZA 4Q63A 3U1IB 8KME2 3V13A 2D26C 1MTNB 2O8MA 2O8UA 2XWBI 1A5HA 2BY7X 3PTBA 3KHVA 3MTYA 1FAKH 5A0CA 4MVNA 1KLIH 3MNSA 2ZU3A 1ESAA 1MTWA 2F9OA 2QY0B 1NBMD 5DP4A 1AGJA 3LJJA 4FUIA 2R3YA 4HZHA 2Y5FA 3KQCA 3TJVA 4LOYH 3UQOA 1BTWA 1AVGH 4MPWA 1G9IE 2ZFFH 3DFLA 5FBEA 4ZXYH 3OU0A 7GCHF 4UFEH 3KGPA 1QA7A 1IOEA 1LHFH 2AYWA 2BMGB 4O3UA 4Y0YE 7KMEH 2G4TA 3TGIE 1TNKA 1P9UA 3HGPA 2V3OH 1SGNE 1GJCB 1OWIA 1ANBA 1BA8B 3BEIB 2H5CA 4FETA 2FXRA 1GI1A 2ZIQH 1MKXK 1VCQA 3WWFA 2F9UA 4AGKA 5ABWA 1O3HA 1TE0A 3MYWA 2BQ6B 2STAE 1GBBA 1BMLA 3P92A 3MU1A 1L2EA 1MTVA 2W3KA 4J1YA 4TPIZ 5EODA 3TK6A 4NWKA 1Z1IA 1S6LA 3ATWA 3EDXB 3A8AA 1KLJH 1KXEA 1ZRBA 1V2ST 2CV3A 4D7GA 3C1KA 2GT7A 2Z9GA 2Z3DA 1MZAA 1ZLRA 2F9PA 4BAOB 2PKSC 5HM2A 3VB3A 1HYLA 3RMNH 1CVWH 1GJBB 5FX6A 1AKSA 1P2QA 2PSXA 3RM0H 4E06H 1BCUH 1C5OH 1CHGA 1NFWA 2ALPA 4FUBA 1DSTA 2J34A 2LNCA 2G51A 1A0HB 4X2VA 2VVCA 2J94A 1C2KA 1SGIB 1TGNA 5C0TA 1FY1A 3VG8A 4U01A 2PLXA 1Y3XA 1E1QD 2H6MA 1P2NA 4U30A 1EZQA 1QB1A 1FAXA 4F4OC 2A2QH 2A5KA 2ZDNA 1YPLH 2HGTH 1BBRK 1SQTA 4AB9A 1F92A 4TWWA 1P2MA 5FCKA 1ESTA 5C1XA 5CHAC 1ABIH 3OAAD 1W7GH 3RXGA 2QF4A 4VGCC 4DIIH 1AWHB 1H9HE 1YCPH 3M7QA 3M5LA 2F9BH 1TALA 1XUJA 2JH6D 1O39A 2BLWA 1GHWH 3A82A 1BRAA 2FX4A 3UY9A 1HAZB 2G00A 1SOZA 4BTUB 3MH6A 3SV9A 2BQ7B 3SU1A 1N8OC 1ETTH 3LPRA 1UTLM 1SQOA 3N7OA 5EU8A 2FLBH 1GI5A 3P70B 1A3BH 1L0ZA 1CGIE 1LPZB 2ALVA 1T7CA 1ELEE 2R9PA 2JH5D 1AY6H 2KAIB 1PJPA 3NCLA 2Z9LA 2H9EH 1GCTC 1OWEA 5CE1A 1GBCA 2F3CE 3Q3XA 5GXPA 2GCHG 1S81A 3A83A 2TBSA 1BHXB 1GCDA 4ABDA 1ELDE 3SI4H 1K22H 5T6FA 1C5MD 3A7ZA 1GHVH 2BVRH 2B7DH 5F53A 3GCTG 3ZZ5A 1O35A 1O2NA 3ELAH 1WCZA 1HAVA 1P01A 1E79D 4AOQA 3RXHA 4UDWH 1TBQH 2D8WA 4AFUA 1EB1H 1TMBH 1O3OA 1G32B 1FJSA 5G4BA 1GBFA 2WV5A 1PPFE 1PPZA 3A85A 1QCPA 4TSFD 1D6WA 3RXOA 2WPKS 1E36B 3MNBA 1K1MA 1OPHB 2WPDD 3T2NA 2ZNKH 3GDSA 2OC8A 1HAGE 1EUFA 1C2FA 2RA3A 4DT4A 1HV7A 5A8ZA 1ZGIA 1ZTKA 2NWNA 1T8NA 5FPSA 2FI4E 2C90B 2TPIZ 1ANDA 1C1WH 1O3LA 3OSYA 5JBAS 1AQ7A 3P8GA 4AX9H 3R0FA 2OD3B 2AGIX 1GBDA 4M7GA 4NGAH 3SI3H 3SJKA 1MAYA 1H9IE 1L1JA 1PPCE 1ELGA 1ETSH 3RXDA 4K1EA 4GHTA 1NU7B 5E0HA 1KDQB 1HLTH 1DOJA 1V2NT 2BY8X 1PPHE 2ZU4A 1GDNA 1C4Y2 1HJAC 1K1NA 4Y11E 3UNSA 2BLQA 1V2OT 1C5XB 1KXBA 1C5NH 2BOKA 4JCNA 4E7NA 2UUJB 4XDEA 3SZEA 4X2YA 4VGCB 1TX8A 3E90B 2HPQH 1C5TA 4XBDA 2ZQ2A 2ZDKA 4X8TH 4Y6DA 1FX0B 1DT2A 1NRSH 3TLOA 5EXMA 4BTIB 4E05H 1K21H 1DWBH 1V2VT 1GHBF 1A1RA 3PWBA 2QF5A 3UOPA 1MTSA 3E0PB 2VINA 2Y6TA 3TJUA 2WPLS 2A4RA 1SL3A 2HNTF 1OWKA 4X1SU 4JYUH 5ESTE 1YM0A 1V2UT 1WSSH 5FXLA 4ABFA 1N8OB 1UK3A 1C5VA 1BRCE 1CGHA 5GDSH 1UCYE 2GMTB 1BTYA 2ZO3H 1J9CH 1K1IA 4DCDA 3PRBA 5A2MH 4CBNA 3BN9A 1EP6A 6ESTA 4OS5A 3SNCA 3URCA 3RU4D 2I6SA 2VIWA 4X1PU 1Z8RA 2XWAA 3LGIA 2BDYA 5F8TA 4YOGA 2VNTA 5CHBA 4LK4A 3VPKA 4I8HA 1CA8B 1O37A 2AMPA 1C5LH 1TRYA 3U8TH 4YT7H 1GJ6A 2OBOA 3KN2A 3STJA 3A81A 4GCHG 1O2WA 2VIQA 3KQBA 2R2WU 3BG4C 2R2MB 3FANA 4A1TA 4DURA 1EAWA 3RXBA 1AHTH 1GJ4H 1P03A 3PM3A 5CMXH 3WY8A 1P04A 3PWCA 5AVDA 4GAWA 3B9FH 3ZZCA 1P3EA 2ZPSA 2BDGA 1IQKA 3S9AA 3UFAA 2JETC 1G2MA 3H5CB 1AFQB 1UVSH 4AFSA 4FXGH 1DXWA 3UUZA 2SGDE 2BDHA 1O2KA 3H7OA 1GHYH 2AS9A 1SGYE 5HGGA 4D76A 1NBME 2SGPE 9ESTA 4M9FA 1UHBB 4CHAC 3TNTA 4IC5A 3AAUA 2ZGXH 2Z94A 3FP8E 1SOTA 3NXPA 1BTUA 3ATMA 3PO1B 2JIZD 1O2QA 3SV6A 1LTOA 2P59A 1ELBA 1GI3A 3P8NA 2H1UA 3RDZA 3LDXH 1DPOA 1J15A 1C2MA 1C2IA 4Y10E 2I6QA 4MQAA 1O5BB 2QGRA 5LGOA 3QWCH 1FZZA 1FDPA 1ELCA 1HPGA 1QA0A 2G55A 4Q80A 2IJD1 1A3EH 1TOMH 1CQQA 2W26A 1O3GA 1ZSJA 3A7VA 1HAXB 5AFZH 4LXBH 2KCOA 1P05A 2XNDD 5L30H 1QIXB 5I46H 1SG8B 2UUFB 2BLVA 2J92A 3GOVB 1C2GA 4WMFA 3GYMA 3PMBB 3L3TA 5FX5A 4FVDA 2PGBB 1QBVH 1G30B 3RMMH 3DSPA 1X7AC 2OC1A 1IAUA 3PROA 2WUBA 1KY9A 3MO9A 2BX3A 2UUYA 3RLYH 5C5NA 4A7IB 4I32A 1ZSLA 1TGTA 1S84A 1SLVB 2GCTC 3ZVBA 3WW7A 1BZXE 3M3SA 2ZFSA 3U8RH 3RXUA 3U8OH 1TQ0B 3A89A 3P8FA 3N7EA 4LZ4B 1GMHF 2NU4E 1V2KT 2ODPA 2OINA 2WYGA 1V2LT 2A4GA 4DJZB 3GS9A 2VGCC 2JH0D 1P2KA 3UWJH 2AIQA 1HAPH 1HXFH 3BG4B 1EQ9A 1O2MA 1A0LA 1EP5A 1A4WH 1YCPK 4BOHA 3VEQB 1G3BA 3S9CA 2F83A 4FU9A 1EKBB 1LO6A 1BRBE 1EOJA 3LC3A 3T26A 3SYJA 1RFNA 4ZCNA 3L33A 4JYVH 4NFFA 1Z8IB 5EQRA 5C67A 1FPCH 1QB9A 2BDAA 2Q6GA 1CHOG 2ZDVH 2PW8H 1Z8JB 4BAHB 1E0FD 5BRRE 2Z9KA 5EW1H 2GP9B 1YBWA 1OP2A 1IQGA 1P06A 4YLQH 5T6GA 2GV7A 2AIPA 5EXNA 3K6ZA 3TPIZ 3D65E 3O8CA 4FVBA 1LMWB 1Q2WA 2C8ZB 5GWZA 1DITH 4TWYA 1T31A 4OM9A 1H8HD 1GBLA 2WYJA 1F7ZA 1SGPE 1C9PA 1VITG 2CN0H 1OYQA 1YCPM 2BYAX 2BZAA 2ZF0H 2XBXA 3GY2A 1HJ9A 1ORFA 2Z6BD 4WF8A 1EAXA 1TNGA 2Y82A 2GDDA 2GZ9A 2H9TH 4MLFB 4CREA 5PTPA 1GI4A 2OK5A 1K28D 5FBIA 5J4SA 4Y7BA 3FAOA 3A84A 1GBTA 1QTFA 3QGJA 1S6FA 2BY5X 2H9HA 2KCAA 2TGDA 2P94A 1MAXA 3MO3A 1SGTA 3A8DA 6GCHG 1C9TA 3SNBA 1ZTJA 2Z7FE 1JMOH 4Q7YA 1S82A 1QJ6B 4A1VA 2JKHA 5K0HA 1JIRA 3BTWE 1EAIA 2ZA5A 3EE0B 1SGEE 2G52A 2PKAB 2R0KA 1TNIA 1ACBE 1XKAC 2FOGA 1V2PT 4NA8A 1E34B 1XUHA 1TMUH 3OTJE 4ZKNU 3E3TA 2EA3A 2QXGA 3ZV8A 2BD2A 2ZGBH 5EPNA 1HIAB 3TGJE 2GKVE 3DFJA 5C17A 3LGVA 5T6DA 3SV8A 2BD5A 4BAKB 1TFXA 2AGEX 4GSOA 4B74A 3VB5A 3SUGA 1T8MA 2FTMA 1BHXF 2GCTB 4XFQA 3DSOA 2ZCKP 3LGWA 5E8EH 3V7TA 2XW9A 2OC0A 3GDVA 3PTNA 1EJAA 4DVAU 1H8IH 4Z0KA 2Y7ZA 3STIA 2BB4A 1WBGB 2BD3A 3EA9A 2TGTA 4K3JA 1MCTA 2SNVA 3A7YA 3SU6A 5B6OA 3ITIA 1GJDB 1BRUP 2XYAA 2FPZA 1NFXA 1FQ3A 4JZIA 2FLRH 4XE4A 1EB2A 3BIVH 1XX9A 8ESTE 1E37B 1LHEH 2GCHF 1W11U 4MDSA 1WU1A 2FYQA 2KCYA 2XBWA 3RXIA 4J2YB 2FOBA 2GV6A 1MD7A 1QY6A 1ZHPA 2P16A 2QA9E 1EPTC 1QQUA 2CHAC 3T29A 5T1VA 5FL7D 5A09A 1QRWA 2BDBA 3RXJA 2P3TB 2ZC9H 1MTUA 4YT6H 3S7KB 7LPRA 3F2GA 1HXEH 2VH6A 2OLGA 1DLKB 1SHYA 3ZZ7A 2B0FA 3DCLA 1RIWC 3RU4E 1BUIA 3LGUA 1FN6A 3BTDE 1GI7B 3D62A 4ZKSU 4KGAA 2XCNA 4XSKU 2PV9B 1MBMA 3HKJB 1DVAH 5IK2D 1YLDA 4B71A 1FONA 1SGQE 1L1GA 1SB1H 2WPIS 1OS8A 2V7QD 1EATA 1GBAA 5E2PA 1BDAA 3EA8A 3QO6A 4TY7A 4X1RU 1THPB 2Q6DA 1MZDA 2HPPH 3IITA 4I8JA 2ANMH 3PRDA 3CP7A 3ZZ6A 2HALA 4ABGA 2BHGA 4NSYA 5GPIB 1O5AB 1B0FA 1TGBA 1P09A 1W8BH 1SFIA 3LIWA 1GJAB 1DX5M 1BMFD 1M9UA 2XXLA 3BV9B 1B5GH 1J8AA 1NFYA 1QURH 1RD3B 1C2JA 1W13U 1OP0A 1K1LA 2FOFA 4HI3A 1CSOE 2C8YB 2WUCA 2A5AA 5HKKD 1V2RT 2FOAA 1AKSB 1YPMH 3GCOA 1FPHH 2RCEA 1O5FH 3OY6U 3BG8A 2DE9A 4PROA 1AE5A 3N99A 1S0RA 2VIDA 1YPJH 1GDQA 1PPBH 2SFAA 3SU2A 1GI6A 1G36A 3ODFA 1TPSA 2M5TA 1IQFA 1KXAA 5H4IB 3AAVA 1SFQB 1UCYH 4HTCH 1LVMA 1NESE 4UE7H 2ANWA 1D4PB 1SLUB 1T4VH 3A7TA 3AASA 4IW4E 4XBCA 2SGEE 3C27B 2Y5HA 6CHAB 3NZIA 2WV9A 1V6DA 3RMOH 5K7RA 1AZ8A 3O8RA 1VGCC 3A7WA 2Y81A 1RS0A 1V3XA 4ZHMU 3V3MA 4ABAA 4GUXA 1KTTB 1EJNA 3RXKA 1CA0C 3GY5A 5T3HA 1FXYA 1C1OA 3QK1A 2ZGCA 1EPTA 1KXDA 3UWIA 4MPXA 4DOQA 1IQHA 4X6NA 1NC6A 4AN7A 2VVVA 5DP9A 1LKAA 1OWDA 1S83A 2W6ID 1TAWA 3KL6A 3OE7D 1IQNA 1VCPA 1G3DA 2O9QA 1WQSA 3UTUH 4GCHF 3HGNA 3ZYDA 2ESTE 3P8OA 2G4UA 3TGKE 3U98H 1BQYA 1ZYOA 4AB8A 4D9RA 2QIQA 2YNAA 2C3SA 4B1TA 4RSPA 3ZV9A 4I31A 4KTCA 1QQ4A 2G5NA 3HATH 3QTVH 5GNDA 4KTUA 5I25A 1YPGH 3RMLH 1RIWB 1OOKB