4TYNA

Dead-box helicase mss116 bound to ssdna and adp-bef
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
509
structure length
509
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/dna
molecule keywords DNA (5'-D(P*AP*AP*AP*AP*AP*AP*A)-3')
total genus 179
structure length 509
sequence length 509
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tynA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tynA02
1TMKA 2ZRFA 4EFMA 2NPIA 1D6JA 1G19A 1AS0A 3QG1A 4PPNA 5CJPA 3B1WA 4Q7LA 4E03A 1XTKA 2IA5A 2Q3HA 3SHFA 4MRVA 4TL8A 1ZCBA 4XSHA 5HPYB 1KK1A 2D7CA 5CIWA 2P6UA 3TW4A 2ERXA 2JGNA 5LDDC 3X1YA 4G0NA 5KU1A 5AUQA 2F55A 1U9IC 1G20E 1XMVA 3K0FA 3ADCA 1KSJA 2IBMA 1JALA 4NBSA 4TSFD 2VLIA 3IUYA 3W5IA 1I4LD 4NCJA 1UFQA 1EFRD 4TQUS 3UXMA 3T35A 3FVQA 4LGMA 4CEIA 4LHVA 4QGAA 1X8JA 2KBFA 4JL5A 1X8KA 3IIMA 1WBDA 1ZP6A 1AZSC 1Q1ZA 5BN3A 3IBYA 4OL0A 3CF6R 1E94E 1G7RA 5EE5B 4B71A 3GLIA 3RNLA 3E1SA 1J70A 3KX2A 1JEEA 2CLDX 1XZQA 2KWIA 2WKRA 5F2EA 4EAQA 2ATXA 4O2LA 1U81A 4DHEA 1E3MA 3W3ZB 2Z6VA 2QPOA 3T34A 1M34E 2RGAA 4PANA 5DYIA 5IDVA 421PA 3Q85A 4OHXA 4NCNA 1T8UA 1KO7A 4GOKA 4NONA 3FMFA 4MKFA 4H1UA 4LYFA 5CDFE 5G3YA 4ZKEA 1OT3A 3K0AA 3ZVNA 2RGCA 2C99A 1JAHA 5L3VA 1JPNA 1W0KD 4FCWA 8OHMA 1X3SA 4HAXA 1ZM3A 4YONB 3KQHA 4N0EA 4PC3A 3R20A 1J90A 3U3OA 5JJLA 1E1RD 4WZBE 1TUEA 1R5NA 3ZDQA 4UNRA 1N3BA 4US0R 1Z5ZA 4B6FA 1TUIA 2FF7A 4DCVA 2REXB 1SHKA 4D4KA 1XF9A 4NYMQ 5CK4A 1SZPA 2ZJAA 4A4DA 1AGRA 3DKVA 2ZR7A 4PAQA 3UMRA 3KDSE 4JLOA 1OXUA 2LKCA 4TMZA 3W8RA 3VR5A 1N6NA 3TAUA 2J0UB 5FOTA 1HT1E 5EP2A 1AIPA 3O8BA 1S3SA 4OHYA 3RWMB 4U00A 4C0LA 1IN4A 1PUJA 3BAFA 4IDOA 2BV3A 3ZQ6A 3SJBA 3TIFA 3GLGE 4A8JC 4TYWA 2IYVA 1UBFA 4Q1FA 3HU3A 4Q4JB 3B78A 3U3MA 3KL4A 1NKSA 3QVVA 4TL9A 5KDOA 2RGEA 2VRWA 1E98A 2ECKA 1MH1A 4D4MA 5J4VA 5TV2A 3LW8A 3X2SA 4BASA 3HYTA 3RRMA 3WYGA 1NBMA 5EXTA 1QG4A 2QAGC 2VP9A 1GAJA 1JR3E 3KJGA 3U44B 2XZLA 1SVWA 4YDHB 1BKDR 2HJVA 3TE6A 4FD2A 1Z0IA 4KFTA 2JDIA 3AF1A 3IQWA 1AN0A 3TSOA 4HZUA 4TZ0A 2IT1A 2WVJA 3CR8A 2HXYA 2QMEA 2GXUA 3BGWA 4V0MA 1MO6A 3H86A 3TH5A 2NTYC 3R8FA 3AM1A 1VYUA 5BN4A 1QHHA 1YR9A 3VX4A 1A2BA 3SBDA 2CE2X 4QKQA 2XTMA 3U60B 1WQ1R 3ZIAA 2O8BA 3IEVA 2JEOA 2FG5A 1AZTA 1U2RA 1N0UA 1Z0DA 4F91B 2WIAA 4URYR 1GSIA 4JSYA 1L4UA 3MLEA 4C9BA 3FPAA 2VP6A 1OHHD 3K9HA 2OLJA 3B8HA 5F3WB 4LJ7A 1KSHA 3EZFA 3CF2A 1CS4C 3DHWC 3G5UA 3HJNA 1G4UR 1P3JA 4LOAA 4BFTA 2EYQA 4AKHA 4X8MA 5FOSA 1T3SA 2BC9A 3Q7QA 3VX3A 1K8RA 1ESMA 4F92B 3ZLJA 5KYKA 4LK2A 2OFXA 4I1SA 1X6VA 1E2EA 4RCYA 3UWKA 4QHSA 1E2JA 3UK6A 5HZKA 3NBZC 1FP6A 3MD0A 4NYIQ 1OIXA 2W00A 3P4XA 2B8TA 1GRQA 2V8OA 3MCAA 4PTLA 4TLDA 3RYTC 1CJVC 2J41A 3D7MA 2RH5A 2QROA 5KDDA 3NVAA 1IAQA 4HEJA 1DE0A 4URXR 1BS1A 1VCIA 4B32A 3KKNA 4B48A 3ZZTA 4MDFA 2GHIA 4BGDA 3HWSA 3ASZA 3WRYC 1HT2E 1XRJA 1D2MA 2Y8EA 1PZNA 4FI3C 1JECA 3CRQA 3A1VA 4JT2A 1M7HA 4JBWA 5FTLA 1DVRA 2GZDA 4UNNA 5JLJA 1W36B 2OFWA 4NTZA 1RYFA 2VSXA 5C46F 2EU8A 5G40A 5GVRA 1NBME 2PZFA 4MYTA 5CJ2A 3T1TA 3QF4B 4JKIA 4NH0A 1EFTA 1GKYA 4M1SA 3U3JA 3QENA 4RD2A 1XJ0A 3AF0A 1SXJC 5TB5A 1SKYE 3AVVA 4DLTA 2W0MA 1L7VC 2C04A 4LBWA 2EFCB 1KI4A 4DCNA 4KSBA 3V4FA 1DEKA 2JDID 2C9CA 2AXPA 1FMJA 3VNVA 3WYFA 1AJEA 4RSGA 3LO5A 3I3SR 3FHTA 2FSHA 3L82B 2VP5A 4GNKA 2B92A 5K8IA 4E5UA 4AK9A 4DLZA 4QBHA 2HV8A 4QOSA 4FWIB 4DB2A 3K0AB 1EWRA 3VKWA 3K9GA 2PEYA 1DELA 2V54A 2C96A 4RY2A 1JR6A 2NO1A 2ZR0A 4HZUB 2GAOA 2WICA 4Q1AA 5JBQA 2F1RA 5HKKA 5JJKA 4Q18A 1NG1A 4PAMA 4DSNA 4HSEA 1Z2AA 2HT6A 5AK0A 4PC2A 4D81A 1E2FA 2W2XA 4MYCA 2WOJA 4HAWA 1E79A 4B6EA 2FZLA 1JQJC 4NMMA 1GUAA 1YQTA 1G7TA 2FSIA 2L0XA 3LW7A 4HLCA 1NVUQ 5FH9A 2GXQA 2Q6TA 4BFZA 3EC2A 4M22A 1T5LA 3ECCA 1XDBA 5SZIA 4XJXA 4TLAA 1R0XA 2Z4RA 3RAPR 1VHTA 2ZRLA 3FWYA 4KJZA 1GL6A 2QQEA 4ZI2A 1F48A 1CTQA 2QA5A 4P31A 2I1QA 4NYMR 4LDJA 1FP7A 2ZRJA 3ZQJA 4NCIA 3GJ0A 1DAKA 4HUQA 3N2EA 2XEXA 1VPLA 2YWHA 4NYJQ 2HT1A 2R6FA 4Q7JB 2HLDD 2ATVA 4BEBA 3O8RA 5FPKA 1HURA 2QT1A 2OESA 5CM9C 4Q1DA 1NY5A 4QBGB 2H8KA 1BMFA 5EZ5A 2AXNA 3AF2A 3BFXA 4ZDWA 1XEWX 4FIDA 1FX0A 1LF0A 4M53A 3MWYW 1OE0A 1P73A 2A5DA 2DR3A 2O52A 3BB4A 4URWR 4JSTA 1W44A 5SZHB 5JEEA 2DFTA 3QE0A 1I4TD 5M04A 4A36A 1AS3A 2GF0A 5CYPA 5L8VA 3UWOA 2V1XA 4ON9A 4AYTA 2J0QA 3EZ2A 1PJRA 2YVUA 3PUYA 4MA4A 1CU1A 4K81B 2C95A 3ASYA 2AK3A 1SXJB 2VTKA 2ZR9A 3I73A 3W6NA 2F1IA 2QN6A 2V4ZA 3THYB 4DWJA 5DYGA 1MO4A 3L0SA 5TMPA 1FPMA 1EFCA 1S9DA 4GMDA 2YWGA 1Q0UA 2BMFA 4LYHA 4KITB 3B7GA 4IOLA 4A0GA 1R8QA 4QBFA 2GBLC 5LD2C 4HAZA 3DDCA 4IVQA 3WXMA 2RAPA 2BBTA 5HTKA 2ZITA 3F5FA 5FI1B 1ZJ6A 2X2EA 5EJEA 4BE7B 3CPHA 4TMTA 2G77B 4LBYA 4BWYA 4OQXA 1X8LA 2J59A 521PA 4DKXA 2HUPA 2AWOA 2VHUA 3I72A 4LUCA 4ARZB 4DDVA 4AKEA 3GLFE 3D31A 1FX0B 2YYZA 1E9BA 2YINC 2IS4A 3K70C 1RJ9A 5ELXA 1R10A 3CRRA 2OM2A 2BBWA 1AK2A 4D0LB 1O3YA 4ESHA 3T1VA 4BLOA 1D9XA 2P6RA 4IDPA 3C41J 1CIPA 3LFUA 4PO8A 4PXAA 5IRCD 3UMFA 2NMVA 1IY0A 1E2QA 5AWFC 1AA9A 3C8UA 1T0JB 2VPPA 2ZXUA 3Q5EA 2SHKA 4I1VA 3TR5A 3EZ6A 4BZQA 1SVMA 2GILA 4ZCLA 1AM4D 1ZIPA 4IEEA 3N70A 1XZPA 3ZH9B 2GA8A 2R6AA 2BM0A 2WWXA 3L8YA 4JLBA 3BERA 5EQTA 3LDAA 1KKLA 3FTQA 3G82C 5KSPA 2PBRA 4QM7A 5AR1A 5FBWB 1KJZA 1UKZA 3MSXA 4CDGA 4I81A 2FGKA 1ZD1A 1P6XA 3VAAA 4MITA 1CR1A 1ZC3A 4MQBA 5FTKA 1S8FA 1LB1B 1T91A 2WPDA 2LWIA 3TMKA 4DT1A 1K5DA 5EP1A 4ABYA 1WA5A 2JATA 2JLZA 4RZ2A 2KSQA 1G17A 3BORA 1TPZA 2ODBA 3P4YA 2Q9AA 1N25A 3MMPA 4TLBA 1OJLA 1LNZA 3A58B 2GJAA 1QHIA 2A5YB 2OEPA 1X1SA 1Y63A 4D80A 4NDZA 1MO5A 1S2MA 3QI2A 1PV4A 2ZI5A 4JLNA 2WMOB 3E2IA 3L8ZA 4B43A 3L0OA 2GVDC 3DMNA 4YMVA 3EWSA 3DVLA 4TYNA 1KI9A 4UJ3A 4HAVA 4ZPXA 4BEJA 4Q47A 1Z47A 3QXSA 3A37A 4CYMA 2IS1A 2CJWA 1DAIA 2JJ2A 5FBVB 3BH6A 4E07A 1H8ED 4KXFB 5DISB 1XU4A 1ELOA 1VG1A 4KVGA 2HYDA 2IXFA 2GAAA 2K5UA 3TBKA 2MSEB 2XNDD 4HDQB 4Q4AB 3U6KA 3WNCA 4LWZA 4EFLA 4K8OA 4W9MC 3VFDA 3EZ9A 4DCSA 1KMHA 5JEDA 3P20A 4W7SA 1MOZA 2OHFA 5AUPB 1GILA 4OJKA 1EXMA 1CJUC 1R7RA 3SQXA 4JLJA 1GP2A 1EFUA 4WZ6A 4ITRC 1CBUA 5GJVC 4DT1B 3VKGA 4QC2A 1W2GA 4D0NA 2C77A 4GP6A 3GLGA 4WOPA 1XTIA 1E96A 4TMXA 1NLYA 4A2PA 2Q3MA 5IHPA 2O8FB 1WMSA 4Q1EA 2NO9A 3B85A 2ZRBA 2CMKA 1N6PA 3FKSA 1D2NA 4CZ2A 1SVLA 2BCGY 1ZUNB 4EUNA 4TZ6A 4JKYA 1W0JA 5B2ZA 1ZMXA 4QM6A 2GCOA 5K8LA 2IYLD 4GPTA 4HAUA 3VNUA 2VP4A 2J7KA 3OFNA 1G8FA 1TQDA 1KI8A 5FR2A 2CCJA 2F1JA 4JBXA 1IBRA 1XTSA 1U0LA 1XEFA 3CZPA 4EJSC 3GJ4A 2VF7A 1KMQA 3OIUA 3VR2A 4DEXA 2IYZA 1XTQA 2OLKA 2ANCA 221PA 5DO9A 3DKPA 2A9KA 5K8TA 1TAGA 2HDNB 3GPLA 2GXAA 1PLKA 4GP7A 1KHTA 3BJIC 1F6BA 1Z6YA 3PUWA 1CEEA 3BFVA 3KQUA 4QL3A 4L4UA 3CIOA 4RD0A 5DN6D 3ZYCA 2G6BA 3CX6A 3KQNA 2O8CB 1Z0KA 3R9IA 2ZRHA 2R44A 4TT3D 3D8BA 3GEHA 2ZI9A 4ZKDA 1Z07A 5KNCA 2XXAB 4LI0A 5FL7A 3A8TA 1P7CA 2W83A 1J8YF 2W6IA 1UEJA 2BHRA 3MUFA 1Z3IX 1ZVQA 2QE7A 3EPKA 3B13B 4F4JA 3N2IA 1Z08A 3TVDA 1GL7A 1Z0JA 5CLQA 3NDBB 3AV0B 1ZW6A 3CNNA 4AY2A 4PHTA 3TAHA 1RC8A 4YXWA 3QKUA 1KJYA 2EWWA 4LZZA 2JA1A 1J8MF 3U4QA 3GJ8A 5DI9A 5G41A 2Z0MA 5E3HA 4DLXA 5F9FA 1OV4A 3BXZA 1SXJE 2DFLA 1OXTA 5SZKB 3T61A 1Q3HA 1KGDA 4EFNA 1XTRA 3LAWA 3VTKA 4MGYR 4Q9LA 4JLMA 6Q21A 3QF7A 4FN5A 3WP0A 2FPLA 4LPSA 2R6CA 4RFSA 1JQLB 5CITA 4LV5B 2GCNA 1OB5A 1COWA 1NY6A 1QHGA 5EXXA 3F8TA 2HLDA 3QPVA 2WTUA 2GNOA 2P2LA 3TJZA 2QBYA 3RWOA 4A15A 3EPJA 5TDHA 2P0EA 2LKDA 3VHXA 2D62A 3TSWA 4L9WA 1RVDA 2Q0HA 1NVVR 2VHCA 2X2FA 2V6JA 4HUQB 2BOVA 2HCBA 1XPRA 2ZSAA 1QHYA 4DSOA 3QOFA 1N6HA 4EIWA 2XX3A 3M0EA 3AVYA 1OF1A 4GOXA 2V55B 1G7SA 3UKDA 3ZVLA 1QHNA 4FXPA 4U7DA 3HR7A 3OIVA 4KFSA 2XAUA 1IN6A 1QF9A 2PLFA 3RS5A 2XJ4A 721PA 3SYKA 2W6ID 1ZYUA 1KYIA 1KK3A 1W4CA 1DO2A 3BRWD 5BW8A 4B34A 4A2QA 4R98A 4CEIB 1JAIA 4RZUA 4FWTA 2VIIA 5FTNA 4WIAA 4RD4A 1JXOA 1IHUA 1K6MA 2OCPA 3MFYA 4OI1A 5HKKD 2WAXA 2ZRKA 3KUDA 3QEOA 3ZJYA 3NG1A 1Y3AA 3EWAA 3LXRA 2CL6X 2ONKA 1NP6A 4LJYA 4MRRA 3ZVMA 4YQFA 1N0WA 2WM9B 3JZMA 5HR5A 3PQCA 4M8NE 4ACAA 1JNYA 4KFUA 4Z8YA 2V6IA 5UKDA 1UM8A 2N46A 4I1UA 1P75A 1I4DD 3RC8A 1IQPA 2AD1A 1XWIA 4FMDF 3LBHA 4GFDA 4AURA 1KJWA 2ZJZA 4FMCF 1M6NA 3MWKA 3HDTA 2PZEA 2IX3A 1G3IA 3VR6A 1LW7A 4TMWA 4BZPA 1OXVA 3J81k 4EJSA 2WMNB 1P61B 5JHGB 3P26A 4GT1A 1VCNA 4RFSB 1G5RA 1M1YE 3KFVA 1P5ZB 4QXAA 4V03A 2JJ8A 2RKOA 4D26A 4B3BA 4KI0A 4MRNA 4LHXA 5E7JA 1ZUHA 1U0HC 1KNXA 1O87A 5GJCA 5FOWA 4ACBA 3EX7C 4WXPA 1S3GA 1E0AA 4PC1A 2GESA 4HZIA 3AVXA 1W4AA 1NSFA 2UZ3A 2XOKD 4OQFA 4AG6A 5FFMA 4H9GA 2ZE7A 1YHNA 2J5XA 1KNQA 3QPWA 1KIMA 2X8AA 2ZI6A 3P27A 3CRVA 3EA5A 3A1WA 3HYRA 3KXIA 1SXJD 5J4YA 3BFKA 5AJXA 1TU4A 2ORWA 3CUEF 4LJAA 5EE9A 1KTVA 1HQYE 3SI7A 1GITA 4KLZA 4M1YA 3TUIC 3OESA 5FOVA 4CF7A 4B2PA 1VG9B 4CEJB 2BIFA 2H16A 4TSFA 2ZQ5A 4C0HA 5DIFA 2AL7A 3QY0A 4AWXA 1T3LA 2VHJA 2RMKA 3B2EA 3MRSA 3M4YA 4YLGA 2VBCA 4Q9IA 1P62B 4X8LA 5J4HA 1JEDA 1AKYA 2A2ZA 4W5JA 3NBXX 2G83A 121PA 4TTRA 2GCPA 1KO1A 2QTHA 2ZEJA 4DLVA 5A4JA 3LX8A 4PPQA 1ZM9A 4WXRA 3GP8A 2FNAA 3GEIA 1FOEB 1G4AE 2G0NA 1DAHA 4XTCS 1G8HA 3BIFA 4Q01A 2Q9CA 1G41A 1AS2A 1XJCA 4O2RA 2GF9A 1L2TA 3CNLA 4QNRA 3AKDA 5FPHA 2YC4C 3AVOA 3K09A 4PC7A 2J0SA 1T9HA 4EPXA 4NP6A 1ANKA 1E2NA 1E9AA 1GG2A 3OZXA 3DM5A 5DI3B 4Q4LA 4US1R 5JCZA 5EE1A 1D8TA 2BBOA 3U2QA 3O47A 5TARA 2PT5A 3A36A 4TT3A 1M7GA 4ZIRA 1CJKC 3B82A 2OCAA 4L15A 4W5HA 5CLLA 5EZ6B 1LS1A 2UKDA 1S4QA 3GLHA 3R9XA 1M8PA 5DN6A 3B60A 4P0TA 3EIQA 2QBYB 3NH9A 2P67A 2QMHA 1B0UA 4F93B 1N6LA 4OHVA 1N5LA 2OCYC 2ZRGA 4OI4A 2WPDD 4IVPA 5J5CA 3RANA 4MUAA 3GLGB 1OFUX 1OLOA 4QRHA 4OI0A 2ZU0C 4PAOA 3CB4A 4QJ5A 4PO9A 4Q4HA 1X86B 1FQKA 5FPTA 3KKQA 1A5TA 1E9DA 4POAA 2WV9A 1NN1A 4MH0R 4Q4JA 4CEHB 1YZTA 2IYYA 2GWHA 3MJRA 4UKDA 2QQ0A 2EFGA 1BH2A 4EDHA 3NHBA 3U4QB 3PXGA 5IF9A 4AD8A 1XMSA 1NBMD 2VH5R 4QGFA 4EQ6B 1HE1C 2VYFA 4C2UA 1OSNA 3Q7PA 1P2SA 3W5JA 1XCMA 1UADA 3H4MA 1KK2A 3NDPA 2WAYA 3R7WA 3HPRA 2QRZA 2J0UA 5KSOA 1YZLA 4TYQA 3U3RA 1ZIOA 2WSSA 4LJ4A 4PQYA 3QPUA 1GKUB 1IONA 1R0ZA 4D25A 3BH0A 4X8HA 1TF5A 3SHWA 1CJMA 4V0OA 3SBEA 4HB0A 2JLQA 5L3QA 1NRJB 3SYNA 4A0RA 1OYYA 2YOFA 1YRBA 5EXPA 5DH9A 2CCKA 2XZOA 2VP0A 4MRPA 1P72A 4QG7A 2FMXA 4Q9HA 4PQFA 3TUJC 4HUTA 3CW2A 5JS7A 3PUXA 2FV8A 4JJKA 5KO2A 1HUQA 4WAUA 3OE7D 5H1YA 1RRPA 1QVAA 3A1UA 5KNDA 1NN5A 2REOA 1E6CA 1PUIA 3IO5A 4IJMA 2KJQA 1YRAA 5A5GA 5JSZA 3E5HA 3K70B 2ZRAA 2GKSA 3O8DA 2Q21A 4XVQA 3T1QA 3BB1A 3OHMA 3THWB 3GLHE 4JBYA 4V0ME 3MWLA 3EIEA 2JJ2D 2QZ4A 1SULA 1IOZA 1ZC4A 4NCHA 3I32A 4ZDKA 4P33A 4U02A 1NVVQ 2C03A 2QRNA 1XNJA 1W2HA 1RFLA 4Z1MA 2KI5A 1H65A 2HJGA 2ZUDA 1W4BA 2A7QA 3AF4A 3L43A 1Q3TA 1OH5A 3TNFA 3GLIE 1ZNXA 1E69A 2PEZA 3BC1A 1XJQA 4AG5A 4QHYA 1RRFA 3K0FB 1Z0AA 4B2LA 3M6AA 3ONWA 2EFEB 3EZ7A 2F1HA 3PR1A 1KI6A 5BWMA 1P2UA 2GDJA 5JS8A 2OZEA 2RCNA 2WKPA 3S1AB 2BVNA 3X1XA 1C9KA 3ZD7A 5EUQB 1EFRA 4URZR 3H0KA 5FOXA 2QEQA 4M9SA 3IBGA 4IW3B 2IYSA 1TTTA 1II8A 1VDZA 1NJGA 1Z6AA 1DOAA 5KNBA 5TVKA 2P5SA 2LCFA 1RJ9B 2EQBA 2ZYTX 2R65A 3EARA 4P4UA 2ZJ2A 3X1WA 2G1JA 3VQTA 3AVQA 3CX7A 2JJ1A 4V0NA 4DZZA 4HDOB 3K9NA 4S35A 2GEDA 2O0KA 5KPDA 2ZVQX 4OHZA 3LRPA 2Q3FA 4G3XA 4OQNA 4IDHA 1US8B 3AP3A 4PQRA 3CPJB 3AVWA 1G3UA 3FFBA 1FNMA 4L5BA 5L3QB 5J4KA 1T0HB 2PX0A 4RZXA 4QJ3A 4CVNA 3K0CC 3AP1A 1Z6XA 2MMCA 2C9OA 5B58C 4BLPA 2YV5A 3KTAB 3CLVA 3KB1A 1W49A 1CKEA 1JB1A 2GJ9A 2NZ8A 2V7QA 2ZI7A 1E32A 3CBQA 1QRAA 4JLDA 3RS2A 1SVSA 4ZCIA 4JL6A 4JYBA 3K0EA 4KAXA 4C0SA 2A5GA 3F0TA 4BFWA 4JVMA 2IHBA 3FDIA 1I2DA 1TL7C 2GZAA 1Z8FA 1ZRHA 3OFND 2Z83A 1A82A 2O8DB 2FFBA 4TYPA 2ZROA 3ADBA 3T15A 3OEEA 3EASA 1GWNA 1W5SA 3RRZA 2OBNA 4XTRA 2ZRPA 3OEED 4XD7A 4Z54A 2ZSEA 2J46A 4IEIA 3QKRA 5SZJA 1DARA 1HE8B 3AGPA 3DO6A 3Q9LA 2ANBA 4PPGA 1YR7A 3TR0A 2PH1A 3B5JA 3NHAA 4OHWA 2JJ1D 2VHTA 2QAGB 2OV2A 2D06A 5F98A 2HF9A 1E1QD 2VSFA 5IK2A 1E0KA 4Z8XA 2YWFA 3A4NA 1DS6A 2BCJQ 1OW3B 3PUVA 1PLJA 1WP9A 1FL9A 3K70D 1NKTA 2DWOA 2OCBA 5KUTA 5CK5A 1M74A 1ODFA 1T8TA 1UDWA 1XX6A 2HCJB 2YNMA 3QBTA 5FUWA 4AKGA 1M2OB 2JAQA 4LC1A 1ZNYA 4TN1A 5JI3E 3WYAA 4RKEA 2P65A 4B76A 3I61A 2QORA 1WB9A 2IF0A 4I4LA 1XXHA 3AKEA 3LBIA 3R8CA 2XNDA 1EESA 4ZCMA 1R4AA 4C0JA 2VL7A 2GEUA 5BN5A 3IDQA 3BBPA 5KPJA 4LV8B 4P3YA 2B7CA 4ILEA 5FOUA 5B64A 2QSZA 4Q7MB 4B44A 4HB4A 1U8ZA 2R2AA 1BYUA 3L2OB 1E2MA 4IDQA 4V0KA 2CVFA 4L16A 3V4RA 3K0CA 3ND9A 1IM2A 4GMXA 3FE2A 4HLUA 3WMGA 3PEWA 1SVOA 2DCUA 2R62A 4XIGS 3LQRA 1YU9A 4FCTA 2CHVA 3FMOB 1KOFA 1CLUA 2EFDB 3RS7A 1XPUA 1F2TB 1OHHA 4A6XA 1DAMA 1G64A 2FU5C 3HU2A 1ZM4A 5C4MA 1ZM2A 2ZVPX 5GJWC 2O8DA 2CK3A 1YZNA 2J9RA 1S1CA 2XNSA 2ZREA 3HP1A 2PL3A 3H1TA 3NTUA 1BMFD 1VCMA 3MAAC 4BFYA 5EXSA 3BOSA 1AGPA 3KKMA 2ZS7A 2ZJ5A 4MKHA 1WCV1 1UKVY 3AVUA 2IC5A 2FEMA 2WKQA 3OF5A 1G3QA 3I4LA 2FDCA 3D3QA 1SXJA 2ERYA 1UKYA 2WWGA 3B9QA 2FJUA 1E2DA 3SFZA 3M1IA 4G5RA 1DBSA 1Q20A 1XTJA 2H7VA 2UZIR 4HDCA 1Q1EA 2GVZC 4UNSA 1ZCAA 3I62A 1MABB 3QVUA 3QF4A 2QGZA 4YMSA 1E0SA 1N6IA 3AQ4A 3WHKA 1MT0A 1Q21A 2C8VA 2F43A 4II7A 3ZS9A 4IFEA 3QXJA 4M0LA 1T5IA 4GBMA 2X77A 3UIEA 1Z6GA 4G5SA 2VF8A 3RS4A 3DM9B 1F60A 3NC1C 4KVAA 2W2TA 4PFSA 4EPRA 2I4IA 4B2IA 2QT0A 3HR8A 2VO1A 2FFHA 3QQ5A 4CW7A 2J1LA 3GQBA 1NJFA 4MGIR 4DLRA 1DTSA 2GJKA 1OXSC 5CM8B 3KJHA 5AJYA 2B7BA 4Q5IA 4QJ4A 4M1WA 2F9LA 4NYIR 1R8SA 3WMFA 2FOLA 2OILA 4P4SA 1W4RA 5DHFA 5DSZA 1E9EA 2AX4A 3NXSA 2O8EA 3IIKA 3KQLA 3Q5DA 3ICEA 4ZDIA 1G291 2CCGA 1R0WA 4M9XA 1YR6A 4JIMA 4XWAA 3TVTA 5EE3A 3DZDA 3JVVA 3KJEA 1RRCA 1KI3A 4Q1BA 4IOKA 3SR0A 3IKJA 1EGAA 4TL7A 2QL6A 2GBLA 5BQ5A 1R5OA 5AUOB 4HLQB 2V1UA 2ZJBA 1YZQA 2H18A 4LYJA 1G8YA 2VP2A 4JVNA 1GL9B 2VHQA 2YOGA 4FCVA 4Q19A 5DLQC 3TSZA 1DG1G 3JVUA 4BFXA 2A78A 2WBLC 3EA0A 2DWQA 3BE4A 3B9PA 1CRQA 3X1DA 3GD7A 2BDTA 1Q1BA 3OEHD 2F6RA 4A0HA 3I8SA 1UBGA 2O0JA 2RB4A 3B1XA 3NBYC 2IXGA 1QHHB 4P32A 3THWA 4BLQA 1R2QA 2OSBA 2DFNA 4X8OA 3ICQB 2JIZD 4HB2A 4M9QA 5KTYA 1W36D 3UATA 3VR4A 4JYCA 4CRWB 1BIFA 2UVQA 2WJHA 4KU4A 4B35A 4GRAA 4U5XA 1EFHA 2N42A 1F2UB 1NL3A 4C2TA 2J0VA 3QKSB 4MKIA 4TQ9A 4C0KA 2ORIA 4PHGA 2D2FA 4S2EA 4UNQA 3SZRA 1ONBA 1XEWY 2I3BA 4DB4A 2G3YA 3BWDD 2Z5FA 3ETLA 1G8PA 2AFHE 4BLSA 4YXWD 1RPZA 2IF2A 4BFVA 3ZVRA 1T6NA 3UG7A 3RLFA 2PJRA 3SN6A 1GIAA 2HXSA 2CE7A 3OIYA 2CNWA 3BS4A 1YJ5A 2EYUA 4JZKA 1ZM7A 4OQLA 5FBRB 621PA 3TKLA 2FEOA 3DEFA 2PT7A 3VR1A 4F38A 3EPLA 1IN8A 2RGNA 5FUVA 2PMDA 1FNNA 1ZUIA 4FINA 2QP3A 2WJYA 5JHHB 2ZANA 3HPQA 5DE3A 2V9PA 3P32A 2B21A 3AKCA 4I99A 2FH5B 3IILA 4TWZA 2WIBA 4RCZA 3SS8A 1XD8A 4A92A 4M1TA 2BKEA 3QUSA 4R7ZA 5C4GB 2JIZA 2ZRMA 2IWHA 3UG6A 3PEUA 4DLUA 1NNEA 5AUNB 4UNPA 4PHHA 1P4SA 1T3HA 1ZNZA 3FHCB 1GKIA 3NEJA 2RHMA 4Q4HB 5CDFA 4ZDJA 2XXAA 4LRWA 2BWJA 3OEHA 1KI7A 3OAAA 1E1QA 4PO1A 1Q57A 2BBSA 2W58A 2DWPA 1G8GA 3CRW1 1VG0B 4QFMA 5FL7D 2RGDA 1SVIA 3N5CA 3IHWA 1PLLA 2FE4A 2BKUA 4M1OA 1G7CA 2XOKA 3LX5A 3CNOA 4C4PA 2GETA 4LC0A 4XD7D 1LS6A 1NVXQ 1NI3A 3OIWA 4H1VA 2QM8A 4PC6A 5BYJA 1NMZA 4B75A 4ERNA 1KO8A 3ZIAD 2ONJA 4KYIB 3RS0A 1N6OA 5D3QA 1NMXA 4OK6A 2D3WA 2F9MA 2NG1A 1E4VA 3MWJA 3ZS8A 5FPSA 1XBTA 2ZYUX 4LJ6A 3R9WA 3SDZA 1VMAA 2EVWX 1Q12A 5G3ZA 5LB4A 4HLUC 4OQMA 1VIAA 2J45A 2AKAB 3KXKA 1F2TA 4M1KA 1IJEA 3RRYA 2BM1A 3AVTA 5KOYA 2O8FA 1OYWA 2IWRA 2NO0A 1LVGA 5IT5A 1E2GA 1U8AA 4A82A 1A4RA 1EG7A 3KJIA 4BQSA 4DDWA 4GL2A 4Q03A 4PZYA 2P3SA 1DO0A 4LSGA 4P4SB 5GADl 4N0DA 1UBCA 3GFPA 2CDNA 4EPVA 1KZ7B 1P2TA 2CK3D 1Z2CA 1VCOA 4O3MA 2V3CC 1F3OA 2ZYVX 3SFVA 1II9A 4YC7A 1RW4A 2IYUA 3LLMA 1P2VA 2QTFA 2CHQA 4IDNA 4JL8A 1I2MA 4HI0E 4UXIA 2IUUA 1W36C 2W2VA 4MUBA 3X1ZA 3AUYA 3QKTA 1COWD 2IUSA 2OAQ1 2P6NA 2VA8A 4BFUA 4JVLA 4DC9A 5HCIA 3C4JA 4KCGA 3LD9A 3I5XA 2Q9BA 2FWRA 3NEYA 4GI7A 4QHTA 3B1ZA 2DPXA 3NWJA 3T5DA 2XB4A 5BYKA 4C0QC 2W0SA 3TRFA 3W9YA 2JCSA 2E1RA 2QAGA 3A4LA 3WRXC 1G5PA 1NN3A 2DYKA 3ND8A 1IN5A 1TF2A 1NIJA 3REFA 1F5NA 4Z1MD 1J2JA 4MYHA 4ZO4A 1TQ6A 3TUZC 4YDSA 4BUJA 5D3MA 2CL7X 1WRBA 3SQWA 4ZI3A 4A9AA 5C18A 3WNBA 2R6GA 3SEAA 4A8JA 2QP4A 4UXHA 4XVRA 4B3FX 2PZGA 1XMJA 3RABA 3VR3A 4OYHA 2XZPA 4R2HA 1MO3A 1CJTC 4Q02A 5D3MB 5FUYA 4KFRA 1P60A 1E9RA 2J7PD 5E95A 3GLIB 4W5WA 2EW1A 3TQCA 3U3KA 2JLYA 1OIVA 1NIPA 2ZE6A 2QMUA 5L3SA 1G16A 4JLVA 1G6OA 4PZZA 3T1OA 1Q44A 1SHZA 5FR1A 4IOMA 1IY2A 1U94A 2BJVA 2ZU6A 4EPWA 3MJHA 4PR0A 3CF0A 2CEAA 4DUGD 3K8YA 2Z4SA 1MRSA 3CZQA 3WMEA 1OFTA 1NSTA 1EK0A 2ZRNA 2FFAA 2YWEA 4QGGA 1D9ZA 4HB3A 1KSGA 4JT4A 2A3RA 1OKKA 3HU1A 4BFSA 1E99A 2TMKA 4D0GA 1E9SA 2OG2A 4AYWA 1OB2A 1X1RA 5FBLB 1II8B 2QU8A 3CONA 2ZE5A 1U90A 4LBZA 4PHFA 3PITA 1XCGB 2PMKA 5LB2A 1KDTA 4XH9B 3BH7A 3H2YA 2J7PA 4C7OB 3QNUA 2VSOA 1PVOA 5LPNA 4NZYA 1DADA 3AUXA 1XD2A 3A1SA 1N0VC 1LY1A 4OKSA 4Q9KA 1MKYA 1KO5A 3QXHA 3U7EB 1RKBA 2EWVA 1KDPA 1N5IA 4AYXA 2YHSA 4FMBB 2A5JA 2OT3B 1W0KA 2NOAA 5GJBA 3SJCA 2WWFA 3MGCA 1VKJA 2IL1A 2D2EA 3DZ8A 4LJ8A 4P4TA 4Y0AA 4B33A 5FTJA 1E2IA 3Q8XB 5TXGA 4LJ5A 3TQFA 2ORVA 1K5GA 3CX8A 3I8XA 1N6KA 2BEJA 1FZQA 5HCNA 4D4JA 4XSGA 2XTZA 1DAGA 3U7FB 4M9ZA 2ODWA 2OUKA 3THYA 3GFTA 3VU9A 3W90A 4BLTA 5KSYA 3KTAA 1GVNB 4MRSA 3TGPA 1HYQA 3CRMA 1E9FA 2KE5A 3CH4B 2CBZA 1US8A 2O8CA 1ZU4A 1KI2A 1QZXA 5H70A 2NQ2C 2BJWA 4UJ5A 1QVRA 1FTNA 1IXSB 3V00A 3K0SA 1ZD8A 3T5GA 5JMTA 2QPTA 2VEDA 4EKDA 4IRUB 2FN4A 5E4FA 5JRJA 2ZUBA 2GZHA 4LHWA 2WJJA 1XFAA 3TW8B 5CB6A 2JLWA 2JLSA 3CWZA 1H8EA 2ZSBA 1NLFA 1N2CE 1E4YA 4TYYA 4R9UC 1YKSA 4M2LA 3VU9B 1Z06A 5J4LA 4DLYA 3S1AA 5B30A 3T12A 1XXHE 2B8WA 5GVSA 1KI6B 4QBIA 1N5KA 4TMVA 1WBBA 1YZUA 2QNRA 2RGXA 1WXQA 2GCOB 4B3XA 1HA3A 1CR0A 1J99A 2GEVA 1S9HA 2GK6A 2ZRCA 3FKQA 1IN7A 5IK2D 2IW3A 4R2IA 4TLCA 2A5FA 3LQQA 3QIAA 1VIYA 2N1BA 2ODNA 3B1VA 1P9NA 5A0FA 2ZM5A 2CVHA 5CYOA 3AVPA 2WWWA 1A2KC 3C16C 4KBGA 2BMEA 3QG5A 4M1MA 4D4LA 2DB3A 4LX0A 1XD2B 2GTPA 2IYQA 5JCPA 4NL4H 3GJ7A 2ZI4A 1P9WA 4MGKR 2WJVA 3TLXA 2QM7A 3QKSA 4DSTA 1HQCA 1U9IA 3UMSA 1F2UA 4C7OA 4BECA 4Q7KA 2BMJA 2OO7A 1FFHA 4GZLA 1C1YA 3LLUA 1BOFA 1QBKC 3AKYA 2FA9A 1J7KA 5JSZB 3GLHB 1KMHB 4LY6A 4AI6A 3IHLA 4K46A 5TY0A 3O8CA 3K53A 4KHZA 5J40A 3E70C 1W48A 5EE0A 1FW6A 2QGNA 2V7QD 1OH6A 4AC9A 2IS2A 1KAOA 1H8HD 1U8YA 1ESNA 2XSZD 4DRZA 4DIDA 1YZGA 2JLUA 5KHOC 2A30A 1IXRC 3IIJA 4L9SA 3KXLA 2OFOA 4TL6A 4DDUA 4V02A 4EPYA 1B23P 2WOOA 1VG8A 2QAJA 1W5TA 2R6DA 4FMCB 4Q1CA 4C0AC 5L3SB 4RZ3A 4C30A 1BO6A 1YZKA 4G5QA 4RJLA 1VECA 2ZS9A 3VMFA 2QUZA 1OIWA 4DJTA 2AK2A 3A4MA 3QEJA 3R7WB 4DIEA 1XEXA 4JLKA 5JI2E 2O8EB 4B3GA 2NGRA 2F7SA 1E2PA 1TU3A 5AJVB 2VQSA 1TQ2A 4EQ6A 5H8WA 2GJSA 3PFIA 3IEUA 3A1TA 1TNDA 2YJTD 3FMIA 3PIRA 2GK7A 3LA6A 4WBSA 2E87A 5C2JB 4A8JB 4UQOA 4WZAE 3T06B 4IXMA 2AD5A 5AJWA 4B3CA 4O25A 4XWKA 5CB8A 4IHQA 5AJZA 1CR2A 3CH5A 4BRWA 2WZQA 4B73A 1TX4B 4PSAA 3LH5A 2G88A 2C2HA 2HYIC 1OH8A 2QI9C 1Z0FA 3REGA 1E9CA 3I1FA 1RYHA 1G1MA 1SVKA 4TMKA 4BRUA 1HY3A 2QSYA 3VHLB 2C78A 4MKGA 4A2WA 1RRGA 2J3EA 4DBLC 4LJ9A 1FQJA 4B3DA 2ZPTX 5J47A 3IPXA 1SKYB 3BD9A 1XB2A 2FSGA 2MMGA 2GRJA 1G6HA 3B6EA 4DSUA 2QPAA 5HE9A 1UPTA 3SE0A 1FMLA 1U0JA 4HATA 4RD3A 2JASA 1N6RA 5FL3A 1U98A 2IYRA 1QDEA 5DI3A 3W34A 2AHOA 1Z63A 3RDPA 5LD2B 3KUCA 3KKPA 3WNDA 3WY9A 4HAYA 2WHXA 3GJXC 1NN0A 1YR8A 3OE7A 2IS6A 1ZINA 3QSYA 1JJVA 2BMDA 2ZI3A 1CRPA 5FI0B 2ZRIA 1RZ3A 3H84A 4URVR 2NO6A 2QE7D 2FFQA 3U61B 1G18A 1Z83A 3GLFA 2RGBA 1AQYA 2HF8A 3MG9A 1NF3A 1R6BX 2PX3A 3K09C 3IGFA 1GNRA 3ADKA 3U44A 4EPTA 5FUXA 1ZBDA 1QG2A 821PA 4IXNA 5ANRB 4WA7A 2ZS8A 3SJAA 1MRNA 3SOPA 1II0A 1VTKA 3PEVA 4TTPA 1D5CA 1YE8A 3P1JA 2F3RA 3C14C 1MV5A 4NE2A 2WWYA 4KLNA 2ZIAA 1N5JA 3G0HA 1XCPA 4B74A 4DCUA 1Z29A 2NZJA 1D2EA 4FMDB 1XXHB 1A7JA 5KSZA 4Q66C 3Q72A 2OBLA 4NPHA 4E09A 4G1UC 1E79D 1UF9A 4OI2A 5FBQB 1Z22A 3RSLA 3EG5A 4KO8A 4C0BA 2YZ2A 2IK8A 3EPHA 1EX6A 2H17A 4AIIA 4IOJA 3CKLA 5JWOA 2J87A 1AQUA 3OAAD 2R9VA 4YMUA 1L4YA 1A1VA 2PLRA 3LV8A 2FPMA 1DPFA 2ZJYA 1XD9A 4Q21A 1SKQA 1AKEA 3SNHA 1UAAA 5K8UA 4DVGA 2QMOA 3RRNA 3PV0A 4PPFA 3KFXA 3CO5A 2MSDB 4LV6A 1Q1QA 4UXJA 3SC3A 2H5EA 4URUR 3LXXA 1T4GA 1E2LA 4HLDA 3C15C 4A0FA 2CXXA 1G3MA 1SGWA 5JECA 3U7GA 3AP2A 2JLVA 3VKHA 3D6TB 3LBNA 4F7WA 3A6PC 2NPFA 3QBVA 3ZZUA 3AH8A 2FGJA 1JI0A 4CT5A 3PJRA 3ZGXA 4YMTA 3PCRB 4N3NA 1KK0A 1XEXB 1S0UA 3NKVA 4Q00A 5BXQC 2GXSA 4A1FA 4E22A 1HEIA 4NKRA 2WJIA 3CR7A 4OBEA 4RD6A 5EUMA 4V0LA 1VYTA 2ZYWX 2AN9A 1OFIA 4AKIA 2WJGA 5CIQA 1NVWQ 1OPXA 4Y0VA 1GRRA 1HTWA 3C5HA 4GOJA 1FUUA 5JRZA 2CLCX 3QXXA 4TTQA 2P5TB 4M4SA 5LBIA 3ZZ0A 3UPUA 3RSOA 3GJ5A 2CNWD 3C7KA 1R0YA 1KDRA 1DAFA 4MDEA 1EX7A 3U7HB 4KSCA 2MSCB 3TK1A 4F4IA 5E7IA 3GLFB 3PUZA 3CWQA 1C4OA 4LPKA 1OFHA 1IY1A 5FTMA 1ZU5A 4O0MA 1KDOA 1GZSA 1DAEA 1FUKA 2RGNC 1V43A 3JZAA 3RC3A 5JWRA 1EWQA 3DMDA 4DDTA 4MYUA 5E7MA 3L0IB 1RIFA 2R8RA 1XP8A 4IFBA 5EP3A 4F4CA 1ZD9A 2DBYA 5JJIA 4GSYA 1HH4A 2E9SA 4WVFA 1VYVA 2D74A 5G53C 4L8GA 4PX9A 1H8HA 3QJYA 5DNYB 4YMWA 2PCJA 1QHSA 2XJ9A 1JR3D 1E2HA 2WSMA 3RVBA 1KY3A 3DOEA 1G3RA 4IVRA 3NBFA 2NIPA 2B6HA 2IEZA 3EXAA 1GDDA 1GRNA 4DLWA 3THXA 2ZSDA 4I1OA 1W0JD 2Z43A 4OJQA 3F3YA 2D4HA 3L0PA 4Q48A 4DLSA 1ZNWA 3FMPB 1R5BA 3KKOA 4XWOA 5JFGA 2DHRA 2IEYA 1P9RA 1BYIA 4B47A 4RD1A 4RKFA 3FYHA 4D2IA 5FPYA 2WWIA 1MR3F 3IPYA 3UANA 1GOTA 2OBMA 4LBVA 4RVCA 1E1RA 1V5WA 2XTNA 2QENA 4LCBA 2YOHA 1NG9A 1YVDA 2F43B 2IXEA 2PCLA 4NYJR 5DGXA 3W8NA 1UDXA 1LFDB 2ZAOA 5L3RA 3EW9A 1G5TA 1MABA 3NH6A 1TEXA 4KYUA 4QNMA 5JZVA 3AGQA 2W6JD 1QHXA 1OXXK 1TADA 2QP9X 2ZRDA 3KB2A 3NIBA 3I5YA 1KAGA 2C9YA 2F3TA 2G1KA 1TEVA 2RHDA 3FGNA 3SJZA 1W7AA 3GJ6A 4LHYA 4R71A 1KY2A 4MGZR 1UEIA 2HEIA 3GJ3A 4Z51A 4GZMA 4LHZA 1NMYA 3ADDA 3DOFA 1KSFX 2O8BB 3U5ZB 2BEKA 4DXAA 3THOA 4NU0A 3PVSA 3WBKA 4JJZA 3PG5A 3WHLA 2DFKB 4CT4B 1S1MA 2AR7A 4QGHA 4A6PA 1OH7A 2QTVB 2YC2C 4C3ZA 2IYXA 1GNQA 1GNPA 1S96A 4CEHA 2AFIE 1LTQA 4JS0A 2WWHA 3AEZA 4TLEA 1GM5A 3IO3A 2O0HA 3W6PA 3U6BA 1IXZA 4PZLA 3ZD6A 2ZUCA 4NCKA 2ZJOA 4IKEA 4G5GA 2CHGA 3IQXA 4WW0A 4ZV4A 1KKMA 2REBA 3GCGA 2CLSA 4PSVA 3SYLA 1XPOA 1U99A 1W1WA 1TF7A 4D6PA 1W47A 3V9PA 3LY5A 3C5CA 1KZGB 3GEEA 4NHOA 5P21A 5EP4A 5JWHA 1Q22A 2AKYA 1WE2A 2NO7A 1RE0A 3BK7A 3AB3A 4Q9JA 1LF5A 3NC0C 4ESVA 1UKEA 4D82A 4KODA 2FX3A 2D7DA 2IYWA 1FTSA 2ZTSA 3RS3A 3QXCA 1Z28A 4CIDA 5B57C 2QG6A 4LYAA 4N1AA 4J0QA 1KI1A 2DY1A 2OXCA 4ZIRB 2ZJ8A 4US2R 3AF3A 4Q4AA 5DHAA 2KB0A 2FPKA 1XMIA 3LVQE 3Q3JB 1WF3A 2XB2A 1E2KA 3DL0A 2JLRA 2JLXA 2I1VB 2CL0X 1CR4A 1ZAKA 4DCTA 3W6OA 2ODEA 1G9XA 2IHYA 2H57A 3WBJA 5F9HA 1JJ7A 3FFAA 1JBKA 3LNCA 2CJWB 2IYTA 2RGGA 3W3AA 4BPBA 4XOIA 1CULC 3FHOA 1JXMA 3CM0A 4ASUD 2OXRA 1LV7A 3B1YA 4OK3A 1DG3A 2ASEA 4ARZA 4DEYA 5HZHA 3I92A 3KQKA 2O5VA 1GTVA 2W6JA 3DPUA 2XGJA 1W46A 1JPJA 3FB4A 2IUTA 3K1JA 3QKRB 2XSZA 1KO4A 1CF4A 1L8QA 4BLRA 2PJZA 4FW9A 4G01B 5KDLA 4CEJA 2OAP1 2YKGA 1ETUA 2WSSD 2H92A 5HE8A 2ZAMA 2GJ8A 1JR3A 4DUGA 2X19A 3THXB 4JMPA 1G21E 4TQAA 3WP1B 4OK5A 4M21A 4G5OA 3PENA 1E0JA 2C5LA 2ZETA 3FKSD 5C1BA 4JLAA 3K9LA 3EC1A 1OKKD 4XVUA 4CGZA 2KBEA 1UJ2A 2XITA 4HYYA 4JVSB 3FOZA 1IJFA 1TQ4A 2H1LA 3EAQA 3PEYA 1WDTA 5H68A 1VHLA 2C98A 2FZ4A 1Z6TA 4RFVA 2X1VA 2G0TA 3RHFA 3EIHA 3KZ1E 1SQ5A 3BB3A 4GDFA 3LWNA 4PSKA 1NLZA 3CPEA 4JLPA 3SU8A 4BZXA 2QY9A 1M7BA 2AWNA 2EFHB 2ZE8A 2G9NA 1GFIA 3GMTA 1CXZA 3LVRE 4EJSB 1CP2A 2OE2A 2FSFA 3GFOA 1HV8A 2ZSFA 4ASUA 4KV9A 4KBFA 1UBEA
chains in the Genus database with same CATH superfamily
5CB4A 3BRSA 5IDWA 2N0SA 1Z5NA 2ZYAA 3DAFA 2Z09A 1AS0A 1R0SA 3H9QA 3B1WA 4Q7LA 3T7SA 2DPYA 1LDYA 5HPYB 1U6JA 4XM0A 1KK1A 3MGGA 4E5DA 2OHGA 1M0TA 1USIA 2JGNA 4HNAB 4R8RA 3X1YA 5KU1A 1A71A 3L8GA 2F55A 1RWQA 3WOVA 1WAMA 3HFGA 1U7XA 1JEYB 1UXKA 3ADCA 3GIWA 2AEMA 1LBTA 3MIIA 1FNSA 5BO5A 4ENRA 4TSFD 1JALA 4NBSA 3HFSA 4WKNA 1H4TA 2P9QA 3EFBA 3TOSA 2C2MA 3UBTA 1E7SA 1PDOA 3AJAA 3PTAA 1Q7TA 2GKGA 3OI7A 5TF4A 1QYDA 2JL1A 1IWPB 1EFRD 2GEJA 1UEXC 3AR4A 3KEFA 4J1SA 4QA9A 4TQUS 3B1JA 2O7QA 2VDWA 1BZYA 3HN7A 4CQJA 2OY0A 2UZAA 5G02A 3D6AA 1LBQA 2YJZA 4QGAA 4RVUA 4JL5A 1WBDA 4B0OA 2WFMA 1Q1ZA 2AEEA 3O8OB 5EKDA 4J0JA 4BDTA 5BN3A 1ST3A 1YA6A 1ADFA 2WU8A 4IUDS 1Z56C 3JZFA 3KX2A 1JEEA 1TCCA 1ORVA 1B8OA 4O2LA 4Z99A 3SYMA 3L7CA 3D1LA 5KVQA 2WSYB 4BN5A 2RGAA 3K6KA 5DYIA 1WW2A 5IDVA 1PT6A 2QRPA 3MRTA 3W9SA 4KR9A 4DW8A 3T3MB 2OV8A 3DZJA 4MKFA 5AW6A 1OT3A 3K0AA 4YA6A 1UXIA 1YB4A 2C9MA 2RGCA 4N5LA 4OP1A 1XRRA 3TQTA 2I7TA 3ESQA 4O59O 5L3VA 5BOSA 1W0KD 2BFBA 4AJKA 4C6RA 4HAXA 1XCJA 3DZGA 2CMGA 1M6HA 2NLOA 4WASA 1U2GA 4O6VA 1QIIA 1YBMA 1OGYA 4MRAA 1M8KA 1WY7A 2DBZA 4FJ2A 1JG4A 3QWAA 1I0LA 2QX7A 3QY9A 3FX2A 4I4IA 4NBKA 3ZDQA 1RACA 2FWNA 5KNDD 4JBGA 3W78A 3BMOA 4B6FA 2WTMA 4YP1A 2UAGA 3MW8A 4CKZA 3X43A 1EP2B 1NQOA 2ONCA 3L7DA 5KYXA 4MB0A 4PAQA 4JLOA 4CLOB 2LKCA 4TMZA 3NHZA 3STTA 2CB0A 2FHPA 5FOTA 3S1SA 2HJ9A 1TKCA 2HWWA 1AIPA 4HWSA 5EP2A 3O8BA 3VKUA 5ADWA 5JIBA 4HH3C 3TM4A 5DTJA 2O5RA 4EB8A 3EGXA 2VHYA 2DQYA 3HKBA 3ZQ6A 4E3WA 2MSKA 5IEBA 3GLGE 3VBCA 1ECPA 3O7MA 3HKDB 1J6UA 2IZ1A 3QYPA 1M10A 1BN6A 3GG9A 6YASA 2HAEA 1RYDA 4U3JB 5KQLA 1RZUA 4K1LA 1DAOA 5KDOA 1GGMA 1TFUA 2CNKA 1YRYE 5TMEA 4WEOA 2ECQA 2GUWA 3DVAB 2JCXA 3INYA 3BD8A 2MINB 3WYGA 1Y4ZA 5IYZF 4EYKA 2UUAB 2QAGC 1DRVA 1YVEI 3KJGA 4J16C 5TX7A 2GLUA 4BWGA 2XZLA 2BGUA 3BE6A 3DE2X 3G7UA 4PSUA 3WYBA 4CMJA 2HJVA 5H5JA 4PBTA 4FD2A 2BR4A 2FYTA 5EMJA 1AN0A 1QO9A 4D5EA 2MIIA 4ZQFA 3UJ7A 3ECSA 4TZ0A 2IT1A 1L5MA 2G06A 3BKWA 1KBOA 4CG2A 1QH8B 1UBKS 1WF6A 2I29A 3AM1A 1V11A 4OGWA 1CK4A 1YR9A 1A2BA 5F76A 2FN7A 1HLDA 3JQ7A 2XMGA 4B4WA 4CDRA 1HZJA 3NV9A 4QKQA 3QUTA 1KARA 1FS5A 2E5FA 3ZIAA 2AOUB 2YNMC 4IIHA 3FUUA 3RKSA 3IEVA 5CPFA 2EKBA 1UJCA 3FYUC 3IPCA 2OTCA 2HK9A 1GUZA 1A5BB 1AQLA 2AR9A 1X74A 3CIFA 4JSYA 1EIWA 1I3OA 2GM5A 4FC7A 1V8OA 2C7PA 1L4GA 1OHHD 2VP6A 4M37A 4R5HA 4O4LB 3H04A 4GI2A 3P19A 2YVKA 4LJ7A 2QUHA 1WD7A 3HVHA 4GBED 3CF2A 1CS4C 3DHWC 3HXMA 2ZDGA 5ITZB 5EIOA 2VAWA 1R0CA 5HFNA 1E3DA 3W06A 2EYQA 5KQRA 1LV8A 3E7DA 5FOSA 4M6WA 4FGUA 1YS7A 4AJ2A 1C81A 1Z34A 2AIRA 2GBFA 3ZBUA 4F92B 3ZLJA 4IDAA 1P39A 3T7CA 2CXUA 2RI1A 3QKWA 1RWKA 2HIGA 4A5SA 1FP6A 2PRKA 3MD0A 1OIXA 2FOXA 3O1IC 3VTAA 3LDUA 4F7DA 3P4XA 2B8TA 3KZMA 3MCAA 2H1OA 3K0KA 2D5IA 3OPXA 4PF1A 2J41A 4A0SA 3JQEA 3OQPA 1GTMA 3C7CB 3ZWOA 1IAQA 2VSQA 1PBNA 4NBVA 5ECWA 2AN4A 4B32A 2BONA 4HL6A 3SC6A 3L6BA 3HO6A 5H81A 4U2EA 1CX9B 3HWSA 3AR8A 5PGMA 4WLOA 5A1TA 2VZ9A 4KK4A 4JMLA 1EDBA 1W0CA 2JLCA 3IV7A 2Y8EA 4PTYA 4FI3C 1JECA 4CV3A 1QYIA 3CRQA 2XHZA 4UNIA 1M7HA 4MSUA 1U0BB 2GZDA 3NRJA 4BUCA 3V80A 3COJA 5JLJA 4ZK2A 1RYFA 1JJFA 1O8CA 1FXWA 5G40A 1AF4A 1D2CA 3JZDA 4R8MA 2V97A 3OQIA 3QF4B 4M6WB 4NOJA 4JZYA 2XT6A 1R9GA 1HTBA 4LOIA 1MCZA 5FQOA 3PTZA 1XJ0A 2N1MA 1SXJC 4CQLA 4DCGA 2ZBGA 4N5DA 3T9DA 5TB5A 4BNZA 3LWBA 4GX5A 1NUQA 1L7VC 2A0KA 1J5PA 1I1QB 3WK5A 4N01A 3AR2A 4D56A 2PUBA 1LDMA 2C9CA 5B1SA 1RIIA 3VNVA 4DDHA 4CMEA 4RSGA 1TGVA 5H82A 4L5IA 4F2DA 1Z4JA 2OC4A 5K8IA 2IPMA 1ES9A 1G66A 2GPYA 1IPHA 3NBMA 4AK9A 2Y9PB 3RUDA 2PPVA 4XB6B 5EZYB 4TSKA 1PNQA 1JEAA 3K0AB 1MO2A 1SUFA 4IHJB 5AW7A 3CUVA 2R6JA 2KLBA 4RY2A 2GTIA 1UKBA 4BB9A 2ZR0A 3UK2A 4HP8A 4YCCA 1SY7A 2PRZA 1BCSB 3G1UA 4UVEA 4KQGA 2QTMA 2OP0A 3GLIA 1NG1A 1RZVA 1FRVA 3DKKA 3HDVA 3LCMA 3VPDA 4DSNA 1DIGA 2HT6A 3O73A 5AK0A 1E2FA 1PK7A 4ZHQA 4KPEC 4HAWA 4DPMA 3GAZA 1E79A 1DOZA 2I3GA 1MOPA 4RHFA 2FZLA 3PWZA 4ZCQA 3TOVA 4B6EA 1VLLA 3NXKA 1GUAA 2FSIA 3R74A 4BRZA 2P1RA 3WB9A 3K8ZA 2P30A 1NUPA 4BFZA 3EC2A 4IDBA 5ALIA 4YP7A 3GR6A 1L4LA 3UUGA 5J5VA 3IQHX 2WUFA 3F6PA 2CLMB 2NPOA 3QLUA 2BFDA 4IIJF 4RZSA 2OB1A 2Z4RA 1A7AA 4H4DA 1PCXA 4LRQA 2AG0A 3IMKA 3VNAA 1BW9A 4ZI2A 1F48A 3EMVA 1QFJA 1AQ6A 2C92A 4GS5A 2VA9A 2QA5A 5REQA 3ZZ1A 1KMNA 2I1QA 4P31A 4LDJA 5COQA 2FVYA 1R4MB 2WTEA 1XLWA 3ZQJA 3BF7A 1F8FA 2JFUA 1W59A 4ND6A 1YAHA 1U4NA 1WCWA 4QWWA 1KEPA 1JIJA 2QRVB 2SKEA 3OTHA 4L50A 2R6FA 4Q7JB 4RTLA 2J32A 1ZK0A 2CXOA 1A88A 4Q4DA 1GFWA 5E8JA 3UJ9A 1GCAA 4AS1A 1QK3A 3IKLA 4CE6A 3DAGA 3T3EA 3HADA 2IV2X 2GUGA 3WB2A 3HFJA 3NETA 1H0HA 3QUCA 4GR5A 4YP6A 2AXNA 3AF2A 3BFXA 4ZDWA 4FIDA 2FZKA 2YIDA 2EL9A 2V74B 1OE0A 1P73A 3Q6MA 4HD8A 4JSTA 1RXUA 3LK7A 2DFTA 3QE0A 3T7RA 5M04A 5C1OA 4W7HA 2XQGA 3A6GA 1PNVA 5CYPA 5L8VA 1C29B 3FD8A 3I4CA 4ON9A 2X8BA 2WQ7A 1JYEA 2XMZA 4B46A 1SEVA 1SXHA 2A9PA 4ZWNA 1KERA 4NI5A 3AUSA 1I9GA 5AKEA 1T6XA 5KYUA 4G23A 2C95A 3DEAA 4I66A 1ZGJA 3SC2A 5E9WA 4PW0A 5JATA 1AV6A 1SXJB 2X6TA 1IWOA 3I73A 1VLHA 5LVAA 2V4ZA 1HRDA 4EP1A 1MV8A 5I7FA 1SU6A 3A14A 4BFLA 1FPMA 2C42A 4I8IA 4RH1A 1NBOA 1WEHA 1HEUA 2PH5A 2VNSA 3TSCA 3VV3A 3IEXA 1HSZA 1I33A 3PWKA 4A0GA 1V4VA 4HQKA 3QI7A 4YUAA 3GUYA 5LD2C 4IQ0A 1RXCA 5KVSA 3K72B 4IVQA 4TRRA 1LVHA 3P96A 5B37A 1I2CA 4MCAA 5I7VA 5FULA 3JATA 5YASA 4BVEA 1SELA 2VNIA 2XXAB 2Q3CA 2WT8A 2F67A 3HGTA 2H00A 4CIXA 4BE7B 4EK9A 2Q0SA 5HF5A 5CBPA 1UOQA 1HZZC 2O54A 2PBFA 1OU0A 1X8LA 4O1HA 1TVCA 3DD1A 2HUPA 2GJ4A 3MXTA 3OFKA 4JA2A 4R2KA 1TMYA 2FSVC 2ZXEA 4ARZB 4WCFC 3NIWA 4JXXA 1E9BA 3TW6A 1JKFA 2QVZX 3WWPA 3PHIA 1GQ2A 3DV2A 4X61A 5ICMA 3GWGA 3CRRA 3MS7A 1AK2A 1O3YA 2J3KA 4RQBA 3DMFA 3LM8A 4I9GA 3T1VA 5AW4A 1D9XA 2PKCA 1U80A 3EEBA 1XMOB 3P52A 3H0CA 3UJ8A 1QIFA 1IU9A 4UU0A 1AN9A 4GZ3A 3ZCRA 3HJFA 1S2OA 5LA6A 2NMVA 1RI2A 1E2QA 3BHIA 4XGRA 3GFQA 3E7PA 1H2XA 3SOZA 2GHQA 1T0JB 5JV5A 2FPIA 1QFSA 2JJMA 4COKA 2IIBA 4BZQA 1SVMA 5CDTA 4LFAB 1AM4D 3QTTA 3KKEA 3WRVA 5KTNA 3SVLA 1DKMA 1R27A 3KJQA 4FGLA 1SUAA 2DX7A 3ZH9B 3G0IA 3M4ZA 3PHLA 5A7FA 1DJOA 3EQ9A 4JLBA 4UAGA 3H9GA 2HOQA 1KE1A 2J4CA 4ARCA 1PL0A 1RJDA 5FYDA 3DE5X 2OXFA 2X58A 2QN9A 1JA9A 3FI0A 3FTQA 3IAS1 3LQYA 3C70A 4ZAFA 5LBUA 4ZHSA 1D8AA 4ES6A 5KSPA 1J1IA 1MJGM 3UB3A 5AR1A 1PI3A 3WR5A 3MSXA 4HVCA 4Y1GA 3GBPA 1VJ1A 4RBNA 3ZE6A 2FGKA 2AE1A 4CDGA 1EDDA 4I0WB 3D7RA 1P6XA 3DV9A 4RGBA 1F9EA 5J2TF 4B6RA 4Y98A 1I80A 2OGWA 1CR1A 4MITA 2D59A 3O2JA 2H2WA 4KAFA 5E6UB 4DUPA 1SQ6A 1J07A 2BGMA 2LWIA 3ONVA 4X6LA 4YQZA 1K5DA 3CEJA 5ALGA 5F9HA 1ADCA 1XTTA 3ML1A 4ALNA 1WA5A 2V0NA 1PJ2A 4M88A 5K3EA 4YR9A 4MR9A 3SZMA 2JLZA 3UM9A 4GEGA 2LBPA 1DJLA 1G17A 5KOJA 3L3BA 1NXWA 2Z5GA 1TE2A 4K86A 5DCUA 4TLBA 5HNKA 5EUCA 1VSTA 2OEPA 3LDFA 5CXSA 3MCVA 4EF6A 4D80A 3N2GA 4Q6BA 3R7DA 3QI2A 4P7JA 1IZ7A 3LJKA 3M34A 2WMOB 3FZQA 4J4TA 5P8WA 3VH4A 1A2QA 3AERA 1ECGA 4NENB 4YMVA 3R5KA 4TYNA 3DGFC 1KI9A 5AVYA 1T8WA 4MO2A 4ZYTA 1IUOA 2ZSKA 2DCMA 3KOUA 4BEJA 3KR9A 3DE6X 1NFFA 1XAJA 3OLWA 4PE5B 2NUPB 4KLRA 4KIFA 3SD7A 1CUIA 3K9QO 3R1IA 2O7VA 5KVVA 1H8ED 2J6BA 4KH0A 4QUAA 4IO1A 2FWIA 2IGBA 2QX6A 4KVGA 1T9KA 3BGIA 3U56A 1YL5A 3RYHB 4E1VA 3DEKA 3KVNA 3UHFA 4WBNB 1YDWA 1YS6A 3FUWA 3GJQA 5B3LA 4HDQB 3SHVA 4REQA 1JDBB 2MSWA 2VNHA 3GIDA 1OMOA 1DG9A 1OTXA 1T5HX 1QF7A 4R1UA 5JQGA 4N41A 3IJPA 1WZNA 4O4IB 4EFLA 1DWUA 1U2QA 2VJLA 3NAQA 4HKTA 1HWYA 2O06A 2C5SA 3LF2A 1LLDA 4W7SA 1JBQA 3S2GA 1M6WA 2QUAA 2VHVA 4F9GA 4OJKA 5AUPB 2HLHA 5JNWA 1CJUC 3FOCA 3HB0A 1CZLA 3M6IA 3OT4A 2QTNA 1Q7BA 4Q15A 1C4XA 4WZ6A 3OPNA 1CBUA 3VKGA 2HZBA 4BLUA 4MUYA 7AT1A 3M3HA 2XNHA 4P81A 4D0NA 2C77A 1LSOA 4GP6A 1QSGA 1YVPA 4G9EA 2Q3MA 5IHPA 4AMVA 4PLYA 4IJVA 3TZHA 4JXKA 4BVFA 1QCDA 2CMKA 3FKSA 4RYLA 1XDWA 3FNQA 5JTTA 1DO8A 2BCGY 4MNTA 1ZJYA 3C3JA 3MRXA 3OP1A 4JKYA 4BIIA 1W0JA 4QT0A 4P2GA 4Y6OA 5IT9A 2PKWA 5IMSA 4LRXA 4UTNA 2GCOA 4WOBA 3FPHA 1JEOA 4HAUA 4K9NA 5KJFA 3VNUA 3AINA 3IP3A 1TQDA 1KI8A 2MYNA 3I23A 1DQYA 2CCJA 3QYFA 4EI7A 5MN4A 1YA4A 4IXWA 3HXLA 1IBRA 1EINA 1XTSA 2PWZA 1YS9A 2EKLA 3JQRA 4E5VA 4WK6A 1N1DA 1H1TA 3DC2A 3D9QX 4G1FA 3REOA 1VHQA 2BE9A 3PJGA 3GJ4A 1KMQA 3OIUA 4HSGA 4DR3B 1Z35A 3PRJA 1J2RA 4ARBA 2OLKA 4PAGA 2IPXA 3MUEA 3WL5A 4UU1A 221PA 1FSPA 1SG9A 2E82A 2RK6A 4G4IA 1BDJA 3ANLA 2XUPA 4GOLD 1PLKA 1YC5A 2GPJA 2Q2WA 4R8VA 4GP7A 4NULA 5ILQA 3BJIC 1ZI8A 3FJ1A 4FUTA 4KO3S 3MJTA 4L4UA 4WY8A 3MVEA 3FRJA 2JGLA 2A9QA 2FQQA 5IAJA 2I2CA 4N3CA 3CX6A 2VBFA 3ZYCA 4DSZA 3KQNA 1CUCA 1NXVA 1USWA 4G86A 4ZI7A 2ZRHA 2R44A 4TT3D 3D8BA 1U4OA 4N5IX 2C3UA 3A8TA 5FL7A 2F48A 1ADYA 1KEEB 2R8ZA 2W83A 1P1JA 5JALA 3LT0A 1QRDA 2J9FA 2XAAA 2GN8A 2QY6A 5BRJA 3R75A 1GRVA 3ENZA 4MS1B 4IZOA 5KJ1A 3EPKA 1W8IA 2AG8A 1Z08A 3N2IA 2Q9UA 1MIHA 1L5RA 3QVXA 4X9XA 1ZSYA 3IUNA 2B4RO 2GD1O 1LUAA 4EW1A 1CZUA 4L5CA 4RW0A 3NDBB 1RLUA 2W6MA 3SLGA 1I51A 4AY2A 4D8TA 4U7GA 4JI6B 4EZIA 3NTOA 4OQEA 4X20A 1A97A 3QKUA 5EJIA 3K2EA 3N0XA 4KBYA 2EWWA 5I8WA 1A9XA 1NPYA 4PRZA 2PIAA 1PV2A 3GJ8A 4JJ8A 5FWXB 1JLLA 2WWVD 3JD4A 1E4EA 4CM9A 1SIBE 3PIDA 2HMYB 3FSJX 1OXTA 3T61A 2FEXA 1N0HA 1RMYA 4R9SA 2IYAA 4MW1A 4FE7A 1KGDA 1U7HA 5C8YF 1XZEA 4QO7A 3C3AA 1L8OA 4JLMA 3R3JA 4GL4A 1LKZA 1UWVA 2FR0A 2K2QB 3LYLA 4GYKA 4O63O 5FPQA 2GCNA 4C43A 3KSDO 4E4YA 1NY6A 1A8UA 1AF7A 2Q3DA 2XQFA 4I3GA 2GSWA 4RIEA 1QHGA 5GWXA 4PYJA 1UIRA 2H3HA 4BNTA 4KXMA 5E7QA 1CQIB 3WLIA 5HIKA 2B8NA 4F12A 3E27A 3RYIA 3SKYA 3BD6A 3FMVA 3VSEA 4JJFA 5K03A 1MB4A 2YVLA 1PKEA 4M36A 3LUBA 2AW5A 2NUBA 3A7DA 4BX8A 2YXPX 1YDGA 1JHDA 1Z8NA 3HV2A 3LUAA 4HR7A 4FM9A 2C5FA 2QTRA 1V3VA 2X2FA 3STWA 4WVLA 4L0CA 4MWGA 4FEAA 1EVEA 3RSQA 3KG2A 4EI9A 3L1JA 4GOXA 3WQQA 4HNHA 3ZVLA 5MGBA 5EJFA 5COAA 2P9ZA 2XAUA 3OLXA 4NS1A 2B69A 2PLFA 3RS5A 2WJ3A 3ZBQA 4E5KA 2YMMA 1ZYUA 1KYIA 3RF7A 1DO2A 5BW8A 1I3CA 3I3OA 1P5HA 5D00A 2HQRA 5FB3A 2WF7A 2LGJA 2OXEA 5FTNA 2C9ZA 4Y2TA 3DTTA 3LO8A 1K6MA 5CDHA 3D0QA 4QELA 3TXYA 2WAXA 3VR4H 4EMUA 2P7IA 1Y3AA 3EWAA 4I6JA 4JJ6A 2OXTA 3N1UA 3VUFA 5LKAA 3OM9A 3P9CA 4TYMA 4OA5A 4WZBB 1I7NA 4LJYA 1CUWA 2P4SA 1WUHS 2WM9B 1TTPB 4V2IA 3OWOA 4Z86A 5JT1A 4Z8YA 2IY9A 2AXEA 4K6KA 4RLSA 5UKDA 5LNK6 3A4IA 3RJ9A 2W2NA 1ONSA 3H13A 4ND7A 1KJWA 1KC3A 5AESA 3MWKA 2PZEA 3IDSA 4RVDA 2HU5A 4YRBA 2CNLA 2X7JA 1V1JA 2OUIA 1LW7A 5EA2A 3DLCA 3J81k 1I8TA 1EFVA 5EMKA 1P61B 3F8WA 2UXDB 3ZW9A 4RE5A 2LD4A 4RFSB 1M1YE 2W9XA 1P5ZB 1RRVA 1T36A 4V03A 5ENVA 4PYQA 4ZAXA 1B3RA 1C7JA 4H7HA 4IL5A 3S44A 1ZUHA 2Z8XA 1C7ZA 1W4ZA 1FNCA 1O87A 2P4UA 1J4AA 3C2QA 3MLBA 1QYRA 2WVGA 1E0AA 4V38A 2QSJA 4PC1A 3WRWA 1F8UA 2Q6OA 4YRTA 3QNMA 5ALPA 5TPZA 3ZG6A 3AVXA 4PFQA 3WKCA 1IDN1 3BIJA 5FFMA 5JOQA 2R11A 3L6OO 2OFFA 1GV1A 2X8AA 2ZI6A 3JD3A 3JVIA 3LKZA 1YAJA 2OCDA 1XQ1A 2O05A 3EA5A 5B5SA 4BNKA 1PWHA 5KX5F 3TGWA 4PLVA 3BFKA 1MJHA 1SZCA 2HQBA 1EFLA 5EE9A 2IU6A 1RE1A 1T4BA 1KTVA 1HQYE 4KDEA 5TQJA 2BFNA 2QE6A 4ZT7A 2XCLA 1CLEA 3ZQ4A 2UUBB 1T0BA 4DA9A 3Q9SA 2PTGA 5G0TA 1QZUA 1LDEA 2H16A 1NNI1 2XB9A 2ZQ5A 3ZUGA 3BZBA 2ZIXB 4NH4A 3MTEA 2VHJA 3JTEA 4KVFA 3Q88A 4ZI7B 2DUUA 2R4TA 4TWJA 1QORA 3OUTA 2GHRA 3KQWA 1LNQA 2X7XA 4TTTS 1YUMA 2A2ZA 4XPIA 2P5YA 4MWEA 3HEAA 1SB8A 1YQEA 4QARA 3IJ5A 3AM4A 3C8DA 4DLVA 5TT0A 5F7XA 3OPYB 3LS2A 4PPQA 5ECGC 3OG9A 2FNAA 1QK5A 1K6JA 3A4VA 3JAKB 1BE6A 1G4AE 1BQ4A 2G0NA 1GG9A 4PZ0A 1G8HA 3ULKA 2C7RA 3BIFA 4WK2B 1J8QA 2WWRA 3PUJA 5JYBA 5CUQA 4K6FA 5EMHA 3Q3GE 5DBOA 1S2NA 3LYUA 4YAWA 5DYTA 5FLEX 4C4TA 3D3NA 5AVTA 1PR6A 4QNRA 2DF8A 5TLSA 3AKDA 4ROTA 4EEZA 1N7IA 4JJEA 4YFVA 3KWMA 3OZXA 1DV1A 5DV9A 4TWAA 3ZW7A 5JCZA 4F6LA 1T10A 2RH9B 4LF6B 2EIHA 2BBOA 1JDVA 3O47A 5HFAA 2PT5A 3TG2A 2P9HA 1M7GA 2VDUE 2CB9A 1KEZA 4NJEB 4HNTA 3A27A 3IDAA 3IT3A 4GLBA 1N1EA 1TW2A 5EZ6B 1S4QA 4NBUA 3UCEA 1JQKA 3E2MA 4X66B 3G2NA 1KU0A 3B60A 2DR0A 5DN6A 4AG3A 3R9XA 1NMQA 4X1KB 2QBYB 1Z3CA 2WJPA 4DMKA 1CQIA 3QLUC 1X1AA 2Q1UA 3QFCA 4F0JA 1Q7EA 5LR6A 4G0MA 2OCYC 2G4VA 2PS3A 4M8LA 3KYDA 3QJGA 2C00A 3V6MA 2E4UA 3GFGA 3RSHA 3GLGB 3SMQA 1OFUX 5ALSA 1E3WB 3A9VA 4JSRA 1E7YA 2OAEA 4FEEA 1YI0A 4L6AA 3NAMA 4OI0A 5ALYA 1U2SA 1U5BA 2Z2JA 1GCGA 4PO9A 4JAVC 4OQYA 3TFWA 5BUQA 2ZBPA 1GUFA 3KKQA 1E9DA 2Y6UA 3T3OA 1O57A 4F9EA 1B26A 4CEHB 1YZTA 2QRQA 1T3GA 5KCZA 1IBMB 3FY4A 5IJ0A 5JJBA 5KQPA 4UKDA 4XFJA 3FYUA 4QTZA 1KS9A 2VDNB 5A9RA 1BH2A 2C54A 2OV1A 4XJVA 3TQSA 4AD8A 1E6UA 4M7RA 4EQ6B 2VYFA 1ISMA 3TLZA 1OBOA 1AV7A 1HRKA 2BKVA 2HRBA 3PQ3A 3Q7PA 2ISSD 4F04A 1KK2A 2IBSA 1G8KA 1Y5IA 1WXEA 5FX2A 2X40A 1JHAA 3HPRA 2QRZA 3UJAA 1PN3A 3B36A 3U0VA 1QQBA 3PT5A 1O96B 1YZLA 3U3RA 3I37X 3QPUA 1SCQA 3JWPA 1JZQA 1WSAA 3C87A 2BEWA 3J7TA 3TXAA 2JFYA 1XZAA 3BH0A 1X80A 1GPWB 3GVXA 4X8HA 3S2SA 5C7IO 1BDMA 2UUPA 4UM8B 4AO6A 1OJ7A 5IKXA 1OYYA 5EXPA 5DH9A 1YH3A 2JCYA 2VYND 5HJ2A 4NX2A 4BO3A 5CCEA 3W5AA 3QFTA 1E8NA 1P72A 2QYTA 2I67A 2A5LA 4KN9S 1E8MA 1FUEA 1K9SA 2H5IA 3FB1A 4UU7A 5JS7A 5BOSB 2YJNA 5KO2A 1HUQA 3QMWA 4MQ4A 2HSGA 4BJ6A 1VLJA 4H1HA 1QVAA 1L5GB 1NN5A 3RW9A 3A9TA 3C3CA 5FFFA 1PUIA 2PVSA 3GWZA 2KJQA 3IO5A 2QUBA 2AMYA 1VL6A 3KU4A 4HO1X 1Y7HA 2GKSA 1M2HA 2QGFA 4XOUA 3T1QA 5JXIA 1E5TA 4MR9B 4QDOA 3MTIA 1T1JA 4GYWA 2OPBA 4AS3A 5LWHA 2RGRA 4BGUA 4J4BA 1HI9A 5J2TA 1MQAA 1JFVA 3EJ6A 3G7SA 1W73A 3MWLA 2QZ4A 2FMFA 2AZDA 1CPYA 1VJ5A 3VAZA 1BG6A 1ZC4A 5EE5B 1NWCA 4IF6A 4OF4A 1NVVQ 4U02A 3HY6A 3I45A 2QRNA 3O75A 4HADA 1XNJA 3I2YX 3KTOA 1JMVA 1RRMA 1S01A 1O9GA 1SPXA 4M0UA 4Y6RA 1D7OA 5D3ZA 1H65A 1L3BA 2H1IA 4B31A 3V7YA 1PW5A 4EUEA 1UK7A 2VH2A 3AF4A 3L43A 4EKIA 3KTDA 3EVAA 3GLIE 3KKZA 4KMRA 1ZNXA 1E69A 1OUMA 1I3KA 2PEZA 3BC1A 3SWWA 5KYNA 3VO9A 2WJZB 1RRFA 2PR2A 4ENWA 4F06A 4FBLA 2I3AA 1A8QA 3ONWA 4ND8A 1PD0A 3UXYA 4WMLA 1H69A 3EZ7A 2CJXA 3PR1A 3ZCXA 5JW6A 5JS8A 1AB5A 2WKPA 3WK8A 3S1AB 4BO8A 2HI0A 3V46A 4CMBA 3DF9A 4XGKA 2QEQA 4TWRA 3UJHA 3IBGA 2YYAA 1Z5PA 3L8EA 4EGQA 3PL1A 4JUDX 2DKNA 1WCIA 3OKFA 4K40A 5KNBA 5JNUA 1DIHA 2UUOA 1N8TA 1X1EA 5FCDA 2ZYTX 4GKKB 3EARA 1WDLA 1KJIA 3EDCA 1U7ZA 1ISHA 3UGJA 4V0NA 3UN1A 3DR5A 1T3TA 3CVYA 4I9HA 3C6YA 4F46A 4KPYA 1CG6A 2ZVQX 5BMVB 1R6DA 4MVWA 3C6KA 2E89A 3EG9A 1C7RA 3BXPA 2QV7A 4PQRA 1CJBA 5DGCA 5EOVA 4ID9A 5JFOA 5BQFA 1YONA 4UDYX 3FFBA 1FNMA 5J4KA 4NY1A 3WGMA 5E6SA 1Z18A 2C4WA 3JATB 4MW2A 3WKDA 4NV1A 3AP1A 1Z6XA 2MMCA 2C9OA 2D5CA 3FCCA 4AY3A 1KORA 4HX2A 1O6ZA 1ONOA 1XHFA 4UHDA 3X44A 2E4VA 3PFNA 3ZE7A 2ZI7A 1YI1A 1E32A 2YH2A 3QLJA 4G37A 4JB2A 3UH0A 4JLDA 1IOVA 3RS2A 3IERA 1WOYA 4ZV4A 4JYBA 5T3YA 1D3AA 4Z3OA 2CD7A 3GP5A 1IPFA 4H0FA 3ZBTA 1A50B 2QNBA 3LLVA 3FDIA 3UMBA 4X84A 3L79A 5FWYB 1A82A 1RPTA 4Q4CA 4OLBA 3HVIA 4TYPA 3HCFA 5I9BA 3T15A 3CXRA 3OEEA 2D2VA 2EAUA 5TGDA 2ZUVA 1PK8A 5H4GA 1KFCB 2EX1A 4UARA 2ZRPA 4XD7A 1X38A 1YHZA 3QKRA 1H0KA 1X87A 3K31A 4XPIB 3TRHA 3HCEA 3OC0A 2RBEA 2VJNA 2QL9A 4J6EA 3TEMA 3TOXA 3NRCA 3SE7A 1ABEA 3LBAA 1MN6A 1QLWA 3WGJA 4I8DA 3JQBC 3M7IA 3NATA 1H5UA 1VM6A 4DV6B 5IVKA 1EFDN 2Q28A 3GFRA 3KYDB 3MPUA 2QAGB 3OPYI 3S29A 4KGZA 4ARIA 1V8BA 2HF9A 3CZ9A 1J06A 5IK2A 3EMBA 3WLHA 1XLTA 2YWFA 4Z8XA 3UCFA 3UJPA 2BCJQ 1XZJA 4Z3KA 3A1EA 5K3DA 4N7RA 4P35A 1UBRS 1FL9A 2DHQA 3ZDDA 1R4NA 1JX6A 5U1PA 2DWOA 3M4JA 1KJQA 3BE8A 3HKCA 1M74A 1C8BA 2XE6A 2ZYSA 2HSDA 1ZVJA 2HCJB 3BGSA 3CURA 1EFPA 1VE3A 4FSHA 4GLLA 4ZC8A 3UMYA 5JPIA 1EIZA 1UPUA 3HCCA 3HWRA 3ZH2A 4HN4B 4JNKA 4BNGA 4BB0A 2IF0A 3DA8A 3TR6A 1WDKA 4E14A 3GJZA 1W1UA 1U9ZA 5ARDA 2NACA 4ZCMA 1R4AA 2FSVA 2VL7A 3NOVA 3CGGA 3R40A 4C0JA 5BN5A 1MJFA 2QPLA 2GBPA 3OJEA 3UAXA 1NKVA 4A91A 5FOUA 4JV5B 2D54A 3KQTA 4HB4A 4C06A 2NU6A 5KJEA 2V9CA 5FWDA 1CUJA 3IIEA 4EHJA 4RY0A 3L4EA 1T6BY 3F7MA 4CDNA 3ISTA 2QSUA 4N40A 1FU8A 2B5VA 1BHSA 3CEAA 2Y1GA 4K6CA 3IA7A 1QO0A 4R2WA 4F71A 2BRUA 4N7BA 4XIGS 4IDFA 2PJDA 4O08A 3AV3A 2CHVA 1KP3A 3FMOB 4QAJA 3TNLA 1Z7WA 2CNBA 1NQXA 2WM8A 3BWYA 2QQ5A 1Y6QA 2B8EA 3OJ0A 4I4NA 2EFDB 4M49A 1QFYA 1XPUA 3GV0A 3KLBA 3A6LA 3LZ6A 2XYQA 3QP9A 4LF4B 1OHHA 1ODKA 1DAMA 1G64A 2ID7A 4QQFA 1ZM4A 5KWVA 5EPOA 3VPFA 3FPBA 2O8DA 4JGGA 3ZX5A 2AMJA 2XNSA 3ZW8A 1Y42X 3FOFC 3HMQA 3VXKA 2IYPA 2YFHA 2A57A 3H1TA 3NTUA 2X3FA 4J7UA 4BFYA 1SKMA 1N4AA 1THZA 1EUCA 1EX1A 3ILVA 4X54A 3EIWA 4KB5A 3WIUA 1Y8AA 1CY1A 2WKQA 1G3QA 4J7CA 4W8HA 1MFPA 4YYZA 2C4MA 4F21A 2MYTA 4KGVA 4Q16A 5ICEA 1G9SA 1ZGHA 5DM2A 1P0QA 2EBWA 2MYPA 1QH1B 3FETA 3LDHA 3B9QA 1E2DA 2B36A 2H1CA 4H3KB 3BXGA 5FO0A 4EECA 4YB8A 1XTJA 1U3FA 1AKVA 4N6NA 4C78A 2PUVA 1ZVMA 4FYWA 2RIRA 1SIOA 1XWFA 1ZCAA 4OGFA 1D6SA 3NQ41 1YWGO 4CM3A 3WHKA 4V0SA 4YT4A 3PRKE 4CQNA 1BD4A 4IFEA 4C4SA 5ER6A 2AFHB 2PLNA 1Z6GA 4LVUA 4PLCA 3SIRA 3M5WA 1CDZA 4G0OA 4RVNA 3AHHA 5ETJA 4EPRA 4I50A 1XRLA 2I4IA 4ALJA 4B2IA 1ZH6A 3ITKA 2O57A 1K8QA 1PR0A 1Z4MA 3ROZA 3FR8A 3HLTA 3ITEA 2XRFA 5T4BA 2QR5A 3L01A 1P4GA 4EY8A 3HJTA 1G6KA 3V1LA 4DLRA 3MHTA 3IUMA 2GJKA 4ER7A 4ZVQA 1UBOS 1S3IA 2Z2YA 5I7WA 5CM8B 5CVUA 2ODTX 4L5YA 1R8SA 3LGAA 2WF5A 5DHFA 2XUKA 4EEKA 4EGAA 2PZMA 1CZOA 1JUDA 2EQAA 1B2LA 1TW3A 3Q5DA 3KQLA 4KL8S 1VLQA 4NESA 1OI2A 3PPWA 3DZKA 3C3DA 3UYKA 3DBRA 1R0WA 4EVQA 5C5DA 5KMGB 3HNRA 4JIMA 3V9AA 1R0KA 1KJ9A 5EZSA 4FFBA 5EE3A 3J7AC 2W6PA 3JVVA 5JLAA 4ZYZA 3ILHA 3OC6A 4Q1BA 1QCZA 2O7SA 4DWWA 3IKJA 5ITZA 5BQ5A 4F9FA 1UMDA 1UM9A 2V1UA 9MHTA 3OCJA 5TGZA 3OJWA 2H18A 2G04A 2ZIEA 3QVKA 4INJA 4HDMA 4LYJA 1QB8A 1G8YA 2VP2A 4JVNA 4N6GA 4OM7A 4XQ9A 1MDBA 4I4TF 3TSZA 1SK8A 2NVBA 3JVUA 3LUFA 2A78A 2WBLC 3EA0A 1ZCJA 3G2JA 1KJJA 3TCXB 3BE4A 4WECA 1J0DA 2BDTA 1Q1BA 4B4DA 1V6AA 4NHEA 1FYVA 1UBGA 4CV2A 3BSYA 2A1TS 4BLQA 3WE7A 2OSBA 4L0MA 2FOIA 2VXOA 1KQPA 4WY2A 2JIZD 2PT9A 4HB2A 4M9QA 5KTTA 2WP0A 5EIBD 3VR4A 4JYCA 4PINA 2WJHA 2F9FA 3KETA 1TYDE 2VHZA 3RUEA 3VC7A 3KXPA 1TKAA 1U8CB 2CUZA 4QTTB 3VU1A 1GZ6A 4MKIA 3UAZA 3E7WA 4I5EA 3TSYA 1XAIA 3KK0A 5K0CA 1WIWA 2DUMA 4S2EA 2I3BA 2NTEA 3TECE 1E2BA 3MAJA 4J43A 3OSUA 1A2OA 1NQUA 4OYLA 4BLSA 1V16B 3NOOA 3KZCA 1TA4A 1O94D 5AHKA 3PP8A 1N9GB 1UAYA 4R5MA 1HDXA 3RLFA 4YJHA 3SN6A 2H31A 3JV7A 1SQFA 2DTXA 4HWOA 3L92A 3AF6A 3RSSA 1BHO1 3VPHA 1DJPA 4IICA 3BILA 4ZOLB 5IXYA 2EJUA 2Q4TA 3IPLA 1YJ5A 5DHUA 3HKBB 1O77A 2YZKA 3O82A 2FEOA 3ACBA 3LCRA 4X20B 3DEFA 3NGMA 1OCEA 2PT7A 1CQJB