4TYPA

Crystal structure of an adenylate kinase mutant--akm1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
208
Chain Sequence
MNIVLMGLPGAGKGTQAEKIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSRGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIDVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMKPLLAFYDSKEVLRNVNGEQDMEKVFKDLRELLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
source organism Bacillus subtilis 168
molecule tags Transferase
total genus 66
structure length 208
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4typA00
5SZIA 1XTIA 4UQOA 1R0WA 4ZCLA 2GK7A 3MSXA 2Z6VA 2C03A 2ORWA 1ZIPA 4OHVA 1R10A 2LCFA 5D3QA 3U7HB 5JBQA 3A36A 1ZC3A 1DAHA 1N6RA 3NEYA 4AI6A 2ZRJA 1TQ2A 5KSZA 3CX6A 5HKKA 2OCAA 1GILA 3BXZA 3LRPA 3EZ2A 3PR1A 2D74A 4U00A 5J40A 3I8XA 1AIPA 3PUYA 5BN4A 5HKKD 3C5CA 1TEXA 2IWRA 5L3VA 4HYYA 1W36C 3PVSA 1U99A 5EZ6B 2VLIA 3X1ZA 2EWWA 2GJ9A 3KJHA 3EPJA 1TF5A 1NLFA 1R7RA 2QORA 3VU9A 4P4UA 2QAGC 3B78A 1E9SA 1XB2A 3EC2A 3VTKA 1TU3A 1OJLA 1YHNA 4LDJA 3UIEA 1P2VA 2A5JA 2VP9A 4GI7A 3FMPB 1NSTA 3A4MA 4DLUA 1N5JA 4DCSA 4NCIA 1P73A 3A1VA 3GQBA 3NKVA 1E0SA 1R2QA 1OF1A 2ODNA 4LV8B 1Z6TA 2C2HA 2Z4RA 4M0LA 3VNVA 2WJYA 5C18A 2C04A 3EZFA 2QAGA 2FA9A 2QI9C 4JLAA 2DY1A 3N2IA 1KO4A 4LV5B 2IL1A 4OQNA 4YMVA 2NGRA 1N5IA 5FPHA 4JLVA 4NU0A 2V3CC 2IBMA 2GETA 4RD0A 4AD8A 1YE8A 1R8QA 2ZI4A 2D3WA 2FF7A 5UKDA 3U2QA 5FOWA 4Q66C 1ESMA 3GJ4A 4BEJA 2FFHA 1OIVA 4FMDF 4DB2A 2F1IA 3DVLA 2JJ8A 1WF3A 1VG9B 3QF7A 2O8CA 4EPXA 1Y3AA 1M7HA 3EAQA 3ZYCA 3RDPA 1DO2A 3PQCA 2IEZA 3TBKA 1TF2A 2WSSA 1OW3B 5TMPA 1TAGA 3K70C 3QF4B 4ABYA 4MUAA 3RC8A 5HTKA 2XZOA 4B73A 2WSSD 1G3QA 4OK3A 1XXHE 5AR1A 1F2UB 1HY3A 2CNWA 3QKRB 3FKSA 3TNFA 1KK0A 1EGAA 1GNQA 1ZUHA 5EUQB 4A82A 1NJGA 3ZS8A 3FKSD 4V03A 1G7TA 4PQYA 3K9GA 4HDQB 4DLYA 1M7BA 3I5XA 1KAOA 3B9PA 3LW8A 2I1VB 3ETLA 4C0KA 3RNLA 2PLFA 4XVUA 4XTRA 4D4JA 4PZLA 4QHYA 3ZVNA 4OK5A 3GLFE 1VKJA 4TTQA 1W48A 4IW3B 4W5WA 4US2R 2BBTA 1AZSC 4Q18A 4QGAA 2PJZA 2VH5R 4DJTA 3K70D 3E70C 4C2UA 1LF5A 2IT1A 2DPXA 4HAZA 3RS4A 1K5GA 3RLFA 1KK3A 2ZE5A 2GJAA 1UFQA 4TLEA 5DN6A 1OV4A 4LHVA 4M1MA 4GOKA 2HT1A 2UVQA 1WXQA 2QG6A 1WMSA 4AIIA 4NONA 5KPJA 4C0AC 3B6EA 3AF0A 5DN6D 1G1MA 1E9AA 1G3MA 2VA8A 2B8WA 1CTQA 2NO0A 1RVDA 2PX0A 2QM7A 2IXGA 3HPRA 3PITA 5DYGA 4TT3A 2PT5A 1A2KC 2WM9B 5JS7A 2H8KA 3IHWA 1TF7A 3QBTA 2CE2X 2QT0A 1NF3A 1ZM4A 2NPIA 2UZ3A 4RY2A 3AKDA 3QXXA 4B2IA 2JLVA 5HE8A 2EFDB 2WWWA 1DS6A 3SFZA 2FPKA 4TYWA 4IXMA 4URYR 3LX5A 2GTPA 3GEEA 3M6AA 4JVNA 4DLTA 1NN1A 5A5GA 2XX3A 4UXJA 5A0FA 3UKDA 2IS4A 2F3TA 2FG5A 1M1YE 1U8ZA 1KAGA 2CDNA 2GNOA 2WKPA 5FR2A 1UDXA 2DB3A 1JXMA 1G8GA 2IYUA 3C4JA 3OEHD 2JEOA 1HYQA 1ZUNB 3EPHA 3BFVA 3FPAA 5TVKA 4XWOA 2GCOA 1KIMA 3U44B 1LF0A 1XZQA 1BIFA 2N1BA 1PLLA 3GJ8A 1W36B 5EP1A 1WCV1 1Z06A 1Z2CA 1XXHA 2GVDC 3L2OB 4KFSA 2A5YB 4X8MA 5J4VA 3I62A 1GITA 1HT1E 1T5LA 5JS8A 2R6CA 4HLUC 3GFTA 2OILA 4FD2A 1W44A 1J7KA 1VYTA 2CVHA 3MD0A 3MRSA 1I2MA 2ZS8A 3W6OA 2W00A 5G3ZA 5HZKA 5JHHB 3NDBB 2WSMA 3REFA 2O8BB 1W46A 3LX8A 5CLQA 5IT5A 4CEHB 4B32A 4K81B 4OQFA 1SKYB 4JYBA 1MKYA 3GLFA 3AKEA 4P4TA 2JLSA 1QVAA 3C7KA 2O8CB 4BUJA 2NG1A 3LLMA 2XAUA 4A6PA 1KK1A 1QBKC 1QHXA 2O0KA 4LYAA 3TW4A 2P6RA 3P26A 4EQ6A 4M4SA 2ZRMA 4ZCMA 5KDDA 4HLUA 3TVDA 5FH9A 4PHHA 2ZAOA 4KAXA 4WBSA 2RGGA 5DGXA 3HYTA 5HZHA 3PENA 3WBKA 1FP7A 2XTNA 1D9XA 2QTHA 3KKQA 5FTKA 3P20A 2QROA 1QF9A 2F9LA 2XTMA 1YZLA 3DEFA 1ESNA 5C1BA 1KK2A 3BK7A 2BJVA 1CR4A 3TIFA 5BWMA 2YC4C 4ZI3A 1HQYE 3WBJA 4NYJR 3DPUA 2A30A 1Z0DA 2VIIA 4PHGA 3WNBA 4JLOA 1AS3A 2GXQA 2WWGA 2HXYA 1OH6A 1SVMA 3CNOA 5KOYA 1OIWA 4B76A 1GDDA 5F3WB 4HATA 4WOPA 4ZIRA 1E2FA 1VCMA 1AA9A 2AWOA 2XSZA 4I81A 2WJGA 1E9BA 4EPYA 3RSOA 2P6NA 2Q3MA 2VSFA 2WWFA 4M8NE 5KYKA 3L0IB 4DDUA 1Q1EA 3GD7A 2YV5A 1KI2A 2XSZD 5DHFA 4EFLA 1KMHB 4N1AA 2WIBA 2IF0A 3AUXA 2NMVA 2ANBA 5C4GB 4NBSA 4ITRC 1NRJB 1S3GA 5KNCA 4I1SA 3TSOA 3ZD7A 3O8RA 4LJ9A 1G8HA 1UBCA 1OPXA 3QPUA 4CGZA 2FZLA 2NZ8A 1FTSA 1KGDA 1CR1A 1XBTA 2FSIA 3MFYA 2FFQA 2VHTA 3GJ7A 3GLIE 5DYIA 2AD1A 2RAPA 1CS4C 3ZDQA 2KE5A 4M2LA 2RGNC 4NYIR 3KB2A 4WW0A 1GKUB 3X1WA 3WNDA 3WHLA 4M22A 4JL6A 2JLWA 1XU4A 3EZ9A 4R7ZA 4KXFB 1G5TA 1OXUA 1E2GA 3AGPA 3BRWD 2F6RA 4HUQB 4JBWA 1EG7A 1GNPA 2ZRFA 4LHXA 2IYSA 4RZUA 2X77A 2HLDA 1Z0FA 4D4KA 4KCGA 3DM9B 2ZJ8A 1KI7A 1Q21A 4O2RA 4BGDA 1XMJA 3R9IA 3DKVA 4R71A 1XDBA 2GCOB 3P27A 4U7DA 521PA 2ZREA 2J5XA 1YZTA 2HLDD 4AG5A 3GLHE 2WAXA 1X8LA 1KDRA 3U5ZB 2AN9A 4OJQA 3U61B 2RGNA 4LC1A 4LJYA 4R98A 1L7VC 2ERYA 2FFBA 2ZU6A 4QBFA 1EX6A 3CBQA 1YR8A 8OHMA 4RZ2A 1FP6A 2QPTA 1XZPA 4RFSA 2YC2C 1ETUA 1CLUA 2B7CA 3H84A 1KI6A 4TL9A 2ZYWX 1YZUA 2GZHA 2JLRA 2YOFA 2XOKA 3NWJA 5D3MB 2KB0A 3VKGA 1CJVC 1VG1A 2VP0A 1EXMA 1UKVY 5FOVA 4L9WA 1JJ7A 3SJCA 2WWIA 3GPLA 2C99A 4TL6A 3QJYA 4MRVA 4NMMA 5B58C 4NDZA 2F43A 4Q7JB 2HJGA 3BBPA 5EE0A 2W58A 1G7CA 2OT3B 1NVXQ 1GKYA 1K6MA 4EQ6B 1I4LD 1SVLA 3QOFA 4M53A 5JRZA 2GVZC 3KX2A 1E9FA 4QKQA 5AUNB 4OHXA 2FFAA 2V6IA 1QZXA 1B23P 2FGKA 4TMXA 4D6PA 5EP2A 2Z43A 4PZYA 1TMKA 3GLIA 4H1UA 1CULC 2WOJA 4DEYA 2OCBA 4L4UA 3U7EB 1M8PA 1X6VA 5FOXA 2QTVB 1L4UA 2BKEA 1HV8A 3K9NA 3EA5A 4FIDA 3U3JA 2CEAA 3DKPA 3OZXA 4DIEA 3IIJA 2ZJBA 3AVPA 1RE0A 3WRXC 2OESA 5AWFC 1X1SA 5KSPA 4X8HA 3TRFA 2DR3A 3CRW1 3V4FA 2FNAA 2ZM5A 4PAOA 4I1VA 2GCNA 2QL6A 2BBOA 1DARA 1T91A 4MYTA 5DI3A 3W5IA 2W2XA 4LY6A 4OQLA 1E2IA 3B1ZA 3GLHA 1G20E 1DE0A 1RRPA 4LJ4A 4HB3A 1KI3A 1FQKA 3AP3A 3OIUA 3AVUA 4FCVA 2VQSA 2PZGA 3ONWA 1W2HA 1Z0KA 2RKOA 4K8OA 4P3YA 2RH5A 3LAWA 2FZ4A 3FHCB 4GMDA 5EQTA 1EFRA 4JJZA 5CLLA 2H1LA 2O8EA 2X1VA 4TMKA 1E2JA 4S2EA 4CDGA 1K5DA 1S9DA 1RRCA 2O8FB 3O8BA 5TXGA 2ZRBA 3D7MA 4C0LA 1DAMA 4TL7A 1EFRD 3EIHA 4MQBA 3W9YA 1UKEA 1ZD9A 1KTVA 1QHHA 4QG7A 3SI7A 2J0UB 3ASYA 4F92B 4RZ3A 2UKDA 2GEDA 4Q00A 3GEHA 2O8DA 3VHLB 4FMCF 5LD2C 1SVIA 2IXEA 2H16A 2YOGA 1IY2A 2J41A 2ZEJA 3IIMA 1HEIA 2CLSA 2HT6A 3KKPA 4MITA 5CB6A 4TSFA 1WE2A 3LH5A 5BW8A 1K8RA 2BBSA 2IW3A 2EFHB 2MSDB 3K1JA 2NPFA 4PHTA 2OUKA 4IOKA 1XJCA 2QQ0A 5KUTA 4J0QA 4Q1AA 1P4SA 2ZITA 1D8TA 2GZAA 3E1SA 4B6FA 3FGNA 1FUUA 5DNYB 3A4NA 1JR3E 2HYDA 2J7KA 1PLJA 5CK4A 4B34A 5JCPA 1XPUA 3AVOA 2HF9A 1II8A 3I4LA 1W0JA 5DE3A 2J0VA 5E7IA 4Q4LA 4RFSB 4N3NA 2NQ2C 1ANKA 1ZAKA 3P1JA 4CF7A 1WA5A 2F1JA 5ELXA 2GXAA 5FUYA 3M1IA 1EFUA 3QPVA 2C98A 1KO1A 2FGJA 2WWHA 4Q7LA 4Q4AA 3T1TA 3EG5A 3B60A 3V4RA 1D2MA 4GMXA 2QRNA 3NVAA 1E0JA 1UADA 2HEIA 1NMZA 3NTUA 4BRWA 2BBWA 3U7FB 4B47A 2ODWA 2ZYUX 1NSFA 4TYYA 1F6BA 1T6NA 4B2PA 4P31A 2Z83A 4N0EA 3QXHA 1WRBA 1AS2A 1UBGA 4XD7A 3A6PC 1N2CE 2OCPA 2QSYA 2OBLA 5FI1B 3NBFA 5CIWA 1XEXA 1SXJE 2Q6TA 3R20A 3QKSA 3Q85A 1G8FA 2VP5A 4CYMA 4Q9HA 5FR1A 2HJVA 5FOSA 4FCTA 2X2FA 1FNNA 4XWAA 4Q4HB 5BYKA 4C0HA 4DC9A 1UEIA 2VP4A 3V9PA 2ZUDA 2JLZA 2QBYA 1Z83A 3HJNA 5AK0A 1Z6YA 4RCYA 4A8JC 1KJYA 2CK3A 3CF0A 1AM4D 2V8OA 2IYRA 3SBDA 5GADl 4URVR 1XTQA 4GFDA 1VG8A 4Q1DA 3TW8B 2EWVA 1R4AA 1COWA 2CK3D 4OYHA 4LC0A 4TLDA 1ZP6A 3B1VA 3AVTA 3K0SA 1KKLA 3RSLA 4QBGB 1TNDA 5JEDA 1PLKA 3DMDA 3CZQA 3PEYA 1COWD 3FKQA 4LCBA 1ZRHA 4QC2A 2RGCA 4US0R 5TB5A 3U4QA 3THWB 2CL6X 2XEXA 5AJVB 1RC8A 4GZMA 5EE1A 4W9MC 4AKIA 2ZXUA 4TYPA 1KO5A 1MABA 1U81A 2L0XA 4TWZA 4TN1A 2JCSA 2IA5A 4A8JA 2XNSA 2QMEA 3AUYA 1V43A 4JLNA 4I4LA 2HCJB 5G41A 4B43A 1HE1C 5BXQC 5KSOA 4QJ3A 1JI0A 1OKKD 2CL7X 2DYKA 1GWNA 3TMKA 5E7JA 3Q5DA 1LS6A 1YZKA 3UMSA 1D5CA 3CW2A 4DDWA 1L4YA 1D6JA 2BMJA 4YC7A 2NO7A 1KJWA 1SXJC 4OJKA 3LWNA 4FWIB 2FN4A 2Z4SA 1ZC4A 1LNZA 2VSXA 1Y63A 4L15A 3VMFA 1GFIA 1T8TA 2DFTA 2ODBA 2WPDD 2ZSAA 4LV6A 4URUR 3SJAA 3K0AA 2O8DB 1H8HA 2BEJA 1P72A 5LBIA 3SNHA 3OIWA 3FMOB 3TAUA 2H57A 2D4HA 2KI5A 1JBKA 3KZ1E 3VR5A 4D82A 5BN3A 4KHZA 4Q01A 1NVUQ 2HCBA 1XTJA 4PANA 3GMTA 2R6GA 2FEOA 3SS8A 3BH0A 4PO1A 621PA 4YMWA 1XMIA 2F7SA 3VFDA 4TLBA 4ZDIA 3GJ6A 2QA5A 2QQEA 4G01B 1DEKA 1E79A 3LW7A 1KDOA 3LVRE 1SXJA 2FPMA 2GKSA 3CR7A 2C78A 3QKUA 1NMYA 5G40A 2Q21A 4DT1B 1OE0A 3AVYA 3IHLA 1S9HA 4DEXA 1E79D 3W34A 1SXJD 1BKDR 1JAHA 2CXXA 1G19A 4H9GA 1BO6A 4M1TA 1CJMA 4TMTA 3NEJA 3UXMA 4GBMA 2VL7A 3ZH9B 1T5IA 1XPRA 4WA7A 2V7QA 3NBXX 3IBGA 4IDNA 2G0NA 4ZCIA 4FW9A 1JPJA 4PSVA 2LKDA 4DCNA 2G1JA 3R9WA 1VG0B 2V7QD 2JDIA 3BD9A 1OXSC 1CJTC 4MRSA 1ZU5A 4G5OA 4B35A 2VYFA 2ZR7A 5DLQC 2CLDX 1F3OA 2JDID 4M21A 5GJBA 5E7MA 3AF3A 2BWJA 3QXSA 3IBYA 4NTZA 1RW4A 4B44A 5LB4A 5JECA 1OH7A 2V1XA 1N5KA 2CHGA 3K0CC 3KJEA 1MO4A 2OAQ1 4Q03A 5BN5A 1XEFA 3AVVA 3R7WA 3RRYA 3FFBA 4YONB 4EJSC 3JVUA 4C2TA 3TAHA 3QEJA 1YRAA 2BCJQ 3PV0A 4RD2A 4PZZA 1AGPA 1JAIA 2BVNA 4Q47A 3TKLA 2R6FA 3ZQ6A 1OXTA 3PG5A 2A78A 5J4KA 4CEJA 5DSZA 1S3SA 2X8AA 3EWAA 4K46A 3O8DA 3G5UA 3UK6A 3SFVA 1FMJA 3L8YA 3MJHA 4QFMA 4D0LB 4DSUA 4MGKR 3MWKA 3B13B 3CIOA 3LY5A 1NL3A 3T35A 2E1RA 4UNRA 1IHUA 2RGEA 3SQWA 1UDWA 4ZV4A 2J9RA 1IN5A 3LQRA 1M6NA 3CRQA 4Q9JA 4C9BA 5CM8B 3K0CA 4MGYR 4HUTA 3MMPA 1NN5A 1US8B 821PA 1S1CA 2LKCA 4EJSA 3I61A 3ADBA 5E4FA 4MGIR 1MV5A 1T4GA 2VP2A 4B3XA 3TUIC 6Q21A 3QXJA 1GUAA 4V0OA 1GL9B 2GDJA 5EJEA 1AGRA 1VHTA 3DMNA 4IDPA 5DIFA 4JJKA 3DZ8A 2AR7A 2QENA 4AYWA 4BFXA 4MKIA 1O87A 2R6AA 4AKHA 1Q22A 3TSWA 2UZIR 1ZUIA 1RIFA 1GVNB 1Z08A 1E2LA 3QI2A 2GILA 1S4QA 2ZJAA 3UG6A 3TR5A 4MKGA 3EC1A 4Q19A 2HF8A 1WB9A 2CVFA 3IDQA 4BFWA 2G88A 3HWSA 4WZ6A 2FMXA 2XXAB 2WJJA 1E96A 2CCJA 1Z22A 2XTZA 3CKLA 3D31A 5EZ5A 3D8BA 5FTNA 3SJZA 3GFPA 1IJFA 2ZI6A 4ILEA 1ZM7A 2ZSDA 1NP6A 2J46A 3IO5A 2DFLA 3OEED 3HP1A 4ZKEA 1OFUX 1V5WA 4QRHA 5EXXA 2GEUA 3RANA 1E2KA 5FBQB 3K8YA 4M1SA 5EE3A 1HA3A 1ZNZA 4BECA 3FYHA 3C15C 1J90A 3NC0C 4PC3A 1UBEA 5TDHA 3L0OA 3MWYW 3UMFA 1OT3A 1RRFA 2WICA 3RS5A 3X1DA 1IN7A 3SYLA 2QAJA 5AJZA 2P65A 4PPFA 2Q9BA 4JLKA 3AGQA 4ZDJA 1E9DA 1P9NA 3QG1A 4NCHA 2OBNA 1YR7A 3RYTC 3SHFA 3W8RA 4B3CA 4TYNA 3K53A 3RABA 1E4VA 1P61B 4AKEA 4KO8A 4JKYA 1NIPA 4F4JA 4JLDA 4LX0A 1XCPA 2ZUBA 2PLRA 1GG2A 4AC9A 3DOEA 4KLNA 3W90A 3Q5EA 1W4BA 4JL5A 2W0MA 1N3BA 3Q7PA 4MA4A 1KI1A 4BFSA 2GXUA 4RVCA 4DHEA 2BEKA 1SQ5A 3SZRA 3ZQJA 4B3GA 2BMDA 1WP9A 2AFHE 3Q8XB 1X8KA 4Z8XA 4NP6A 2H18A 3CUEF 4Q9LA 1KO7A 3ADKA 2AK2A 2REBA 2QPOA 1Q44A 3VU9B 5CK5A 2IYQA 3CONA 1G41A 1CR0A 1Z6AA 3OEHA 1WBBA 1XX6A 4Q1FA 3KXKA 2XNDD 4HB2A 1ZBDA 1B0UA 1NG1A 3KQUA 4MUBA 2Q0HA 4KFUA 3T15A 2P5TB 2FX3A 3IGFA 2ZUCA 1U8AA 2B21A 2NO1A 3X1YA 2G6BA 4Q1CA 3WYFA 4PPGA 4CT4B 4JLPA 1S8FA 2VBCA 4JT4A 1JPNA 1RPZA 3LA6A 3CF6R 2WJIA 2FJUA 5HR5A 4BLTA 2YWGA 3U60B 3OE7A 2P5SA 4G5QA 2NO6A 3N5CA 4B71A 4KYUA 4CT5A 1S2MA 5AUPB 4JLBA 3WP0A 2HYIC 2QAGB 2PMKA 4MKFA 2C9CA 2QN6A 1RJ9A 2ZE7A 2IF2A 3OE7D 4MRPA 3J81k 4WIAA 4V02A 3C41J 1L2TA 2YKGA 3BJIC 1MH1A 3M0EA 2DFKB 4TMWA 2MSCB 2H5EA 3RAPR 1N6PA 4RKFA 4X8OA 5FBLB 2BIFA 1OIXA 1ZW6A 2RMKA 5P21A 4DLWA 2IYLD 4HLQB 3OAAA 2IWHA 2PCJA 2AKYA 4KODA 1HTWA 5CDFE 1KOFA 1N6LA 2BCGY 4Q5IA 3TUZC 2F3RA 3OAAD 1OFHA 1T3LA 1WQ1R 1BS1A 2PX3A 3BB4A 4A15A 3ECCA 1XD8A 4HB0A 1MRSA 4JLJA 4RZXA 3I32A 3VR6A 2JLQA 3SC3A 4QXAA 3HDTA 1DAKA 3AQ4A 2EQBA 2EFEB 2QP4A 2OO7A 2E9SA 4C0BA 4F91B 2RGXA 4TTRA 3WYAA 4D4LA 3EWSA 3K0FA 3QENA 4LBVA 3CWZA 4LJ6A 5TARA 3T61A 4B3BA 3ND8A 2ZRPA 4ZI2A 1G4AE 5J47A 2YOHA 1UKZA 4QBHA 3QPWA 1KSGA 4M9SA 5EP3A 3WHKA 2OEPA 3MG9A 1W0KA 4DCTA 2YZ2A 3AKYA 3KKMA 2IUUA 4PPQA 1KY2A 4MRNA 4ARZA 2MMGA 4L9SA 1LW7A 1W0KD 2PZEA 4BFTA 3K70B 3DDCA 1E69A 3ICQB 1NG9A 2NIPA 1I4DD 2DHRA 3KJGA 1XJQA 1IN8A 2JATA 3H1TA 2C5LA 1AS0A 2XB2A 2JLXA 3F8TA 2Q3FA 1GM5A 3IILA 3GJ3A 2ZAMA 2GK6A 3H86A 2IXFA 5E95A 4OL0A 3LO5A 3LXRA 4JYCA 4DZZA 1CBUA 1ONBA 1HT2E 1BYUA 3IPXA 1O3YA 1GTVA 4MYHA 3U3MA 3AF2A 3I1FA 1OHHD 2FH5B 3A37A 5J4LA 3PJRA 1KDPA 2BM1A 1P62B 5B30A 3QUSA 3CPJB 4E22A 4A1FA 3QVVA 1YZGA 3B1WA 1XCMA 3RRNA 3LXXA 2ERXA 5JWHA 3ZZUA 3O8CA 5FPTA 4NZYA 1XD2A 2ZVQX 4NCKA 1NVVR 2G0TA 3QEOA 1TX4B 3U6KA 4HAWA 3GJXC 2V9PA 4LBZA 3HU3A 4OQMA 2ZRNA 4POAA 2QT1A 5C46F 2ASEA 1E2QA 4EAQA 3WMEA 3ASZA 1S1MA 5CDFA 4BQSA 4WZBE 2P2LA 3FMFA 3H2YA 1SKQA 1MO3A 2ZR0A 3L8ZA 3MUFA 4U5XA 5GJCA 4GL2A 1SGWA 4G5GA 1L8QA 4BEBA 5E3HA 1Z0AA 3ZZ0A 2ONJA 2IHBA 2ZI3A 1N0UA 4U02A 2PT7A 1XXHB 3MJRA 4JVMA 4B3DA 1LVGA 3EW9A 2CHQA 2OFOA 2FE4A 2OSBA 3W5JA 4BRUA 2HDNB 4XSHA 1G6HA 4AY2A 5TY0A 3SR0A 1VCNA 2VP6A 3NDPA 2ZS7A 2ANCA 3SJBA 1XCGB 2VTKA 4NYJQ 1EWQA 1GRNA 5ANRB 1II0A 1X3SA 4IDQA 1LS1A 5EP4A 2JIZA 4DSTA 1X1RA 4D25A 4Q7MB 2ONKA 4IVRA 1AKEA 4P33A 1LY1A 2XJ4A 4D80A 5L3SA 2QP9X 4G3XA 2AWNA 1NN3A 4WAUA 3RRMA 5CJ2A 4A92A 3GLFB 2PCLA 4LYHA 2ZS9A 5L3QA 3R9XA 2JIZD 1NVWQ 2HXSA 4IFEA 3SYNA 1GRRA 2NTYC 4P32A 1E9EA 1XF9A 1ZNYA 3VX4A 4BFZA 1G9XA 4B74A 3LBIA 1U0JA 3WYGA 2A5DA 2GAOA 4B2LA 1ZM9A 1N6OA 4KBFA 4TZ0A 3T5GA 5FPKA 1N25A 1GAJA 2ZI7A 4C7OA 1Q3HA 1YQTA 3AP1A 4DWJA 2D7CA 2YINC 2HV8A 5JWRA 1TEVA 3BOSA 1MRNA 2WV9A 3AF1A 1JQLB 3K09C 3K9LA 4IHQA 1OFIA 1G5PA 4LPKA 3B9QA 3A1WA 3Q7QA 4IFBA 1JNYA 1KDTA 2GHIA 2JASA 4ZDKA 1SVWA 1UPTA 2J87A 2ZJ2A 5G53C 1P60A 2CE7A 2PEYA 1GZSA 2H7VA 2W0SA 2ZANA 4ARZB 1IM2A 2XITA 4IXNA 1F2TA 4ZIRB 3MLEA 4LJAA 5JEEA 2FSHA 1JECA 3QNUA 1BH2A 2VSOA 1CRQA 3WP1B 2PZFA 3U7GA 1KZGB 3ICEA 1E9RA 1Z0IA 3HPQA 3F0TA 4DCVA 3W3AA 1ZYUA 3BAFA 4BZQA 2J45A 4IVPA 2REXB 2VF7A 2C9YA 1VCOA 3K09A 1C9KA 2VRWA 1E2PA 4QGHA 1S0UA 5IHPA 3NBZC 2QM8A 1KSJA 4HZUA 4GDFA 1JJVA 4JLMA 4HAXA 3I3SR 3UG7A 1CP2A 2W2TA 1E1RD 1E99A 4Q9IA 2GAAA 2KSQA 1KJZA 2ATVA 2EVWX 1YZNA 5DO9A 3PUVA 2RHMA 4DRZA 4DBLC 1FPMA 1KO8A 5JSZA 2XGJA 1QG4A 3ZZTA 1VYUA 1U0LA 4LHZA 2BHRA 2ZYVX 4BFUA 4DVGA 1Q20A 1CJUC 1Q3TA 1XD2B 2VHQA 2C8VA 1VYVA 1UKYA 4UNSA 2CJWA 3SHWA 3G82C 2ZRGA 1R0YA 2V55B 4Y0VA 2FEMA 2WTUA 1OXXK 3ZVLA 1G64A 1G4UR 4F38A 3KXIA 3S1AA 4QM6A 4YMTA 3KXLA 3TGPA 1DAGA 2GF0A 2XZPA 3ND9A 4YQFA 2W6ID 2OG2A 1YRBA 4DDTA 4AKGA 3KKNA 1D2EA 2PL3A 4PR0A 3THYA 1LB1B 1LFDB 2CBZA 2XB4A 3AF4A 4CEIA 4DLXA 2R9VA 2FWRA 1GRQA 2O0HA 3QG5A 2O0JA 1GIAA 3THXA 4F4IA 4D0GA 4CW7A 4G5SA 1DOAA 3IIKA 5SZJA 1KKMA 2FSGA 4DCUA 5LPNA 1H8EA 3KQHA 4W7SA 4EFNA 2FOLA 2Q9CA 2ZETA 4NYMR 4BLSA 4OI0A 3EXAA 5SZHB 2BOVA 4P4SA 4RD3A 4XVRA 5AUOB 1H8ED 2ZYTX 2P3SA 2PH1A 5EXTA 4A0GA 5CITA 4RD4A 3VR3A 1KI6B 1F60A 3P4XA 2QMUA 2YVUA 3EIQA 5JJIA 1A82A 2RGAA 721PA 3CX7A 5H8WA 1GP2A 1YU9A 1I4TD 3T12A 1G8YA 4YDHB 5L3QB 3EPLA 3ADDA 2F43B 1TPZA 1DADA 3EARA 5KHOC 1IN6A 1AK2A 5JWOA 4PAMA 1A5TA 1CU1A 4PHFA 2A5FA 1NLYA 3VAAA 1KY3A 1E0AA 2ZJYA 1QRAA 1Z07A 3OESA 4OHYA 4KSCA 3NH6A 5JJKA 3LQQA 2EYUA 1U0HC 2CCGA 4KVGA 3AV0B 4C7OB 1UJ2A 4Q48A 3OHMA 2G9NA 1IOZA 1KSHA 5IRCD 2ZJOA 2FPLA 4UNPA 5BQ5A 1TUIA 1KNQA 4DLVA 4N0DA 1NBME 3X2SA 3QE0A 3VQTA 2QE7D 4TL8A 2EYQA 5DI9A 3GLIB 2MMCA 3OIYA 5FPSA 2HUPA 1GOTA 2KBEA 2VO1A 5FFMA 4A0FA 4ACAA 2ZRDA 4A4DA 3E2IA 4V0ME 2OE2A 1IY0A 2DFNA 2ZVPX 4M1YA 2NZJA 2ZQ5A 1ZCAA 4G0NA 1JXOA 1G16A 1XP8A 5DH9A 2I3BA 3T34A 3V00A 4NE2A 5JJLA 4NPHA 4LRWA 2W6JD 1RFLA 1SZPA 3CM0A 5DI3B 4HB4A 4B3FX 1XTRA 5K8TA 1IXRC 4NHOA 2GEVA 1SVOA 1ZIOA 4DB4A 1NJFA 1TUEA 3DM5A 3KQLA 1W5SA 3P4YA 3GLHB 4MGZR 1OFTA 3ZGXA 1TADA 1EFHA 2R2AA 5HPYB 3JVVA 1XTKA 1OKKA 4V0KA 2AXPA 3DL0A 1GL7A 1BOFA 3B1YA 1KI8A 2QUZA 3UPUA 1T0JB 2C9OA 2RGDA 2WJHA 1QVRA 2XJ9A 3TSZA 5B2ZA 2J7PA 2O8EB 4V0LA 1M74A 5FTMA 1Q57A 2WZQA 2ZPTX 2ZR9A 1FX0A 4URWR 1Z63A 2Z5FA 5EE5B 2WPDA 121PA 4Q7KA 4Q02A 2GBLC 2J7PD 1TTTA 1Z3IX 3KL4A 1FUKA 1C4OA 2B6HA 2GJSA 3UANA 1QHHB 2IYWA 1KYIA 1SVSA 4JVLA 1AZTA 4LJ7A 1T8UA 5LDDC 2P67A 4BFVA 2IK8A 1SULA 5FL7A 2IYXA 2Z0MA 4G5RA 2XZLA 5IK2A 1TQ6A 1F5NA 2O5VA 3EA0A 4OBEA 2QMHA 1Z6GA 5FL7D 3THYB 3ZD6A 1P2UA 3A1TA 1ZCBA 2OXRA 2PBRA 4OK6A 4Z1MA 4LPSA 3W3ZB 5IK2D 2F1HA 2BV3A 1R8SA 4Z54A 3QF4A 3NC1C 2GBLA 4ACBA 3UMRA 5M04A 4Q1EA 4XVQA 4Z1MD 1VTKA 4ESVA 5J5CA 1FFHA 1F2UA 1II8B 1XFAA 1NBMA 2JJ1A 3QKRA 2FV8A 5LB2A 4XJXA 4NL4H 3FHOA 1AJEA 4P0TA 5LD2B 2GJ8A 4JIMA 3ZS9A 5BYJA 1WDTA 2JJ1D 1NBMD 4LYFA 4PSKA 4V0MA 1N6IA 4BE7B 2D2FA 4Q4AB 3RS3A 1TU4A 5AUQA 5F9FA 1P9WA 2R65A 3W8NA 5H70A 1Z29A 4JBYA 4QNRA 2OXCA 1NY6A 2D06A 3Q72A 4O25A 3F5FA 4C0QC 2VHUA 4PAQA 2RHDA 4KI0A 4QBIA 3NIBA 1YKSA 4ON9A 3CZPA 3SU8A 2I1QA 3HR8A 4HZIA 2ZRCA 5KDOA 2A7QA 5DISB 1ZNXA 4URXR 4WZAE 4JL8A 2D62A 1IONA 3PEVA 1XEXB 3GLGE 3QXCA 2BJWA 3QKSB 1NKSA 2YWEA 1Z6XA 4LUCA 1JEDA 4L8GA 2QSZA 3L0SA 1OH8A 2VF8A 3I8SA 3A4LA 3HU1A 1Z28A 4RSGA 2QBYB 3PUZA 4LYJA 4PSAA 1KI9A 2EFGA 1XMVA 1W4CA 1AQYA 1J8YF 1UBFA 4AWXA 2G3YA 3WXMA 2V54A 5SZKB 5FL3A 3RC3A 1E9CA 3QKTA 3SOPA 2GRJA 3B85A 2IYZA 4ZO4A 5FOUA 1T3SA 3B5JA 2ODEA 1HH4A 4PQRA 5FI0B 1P9RA 1T0HB 3U4QB 1OSNA 4IDHA 3IQWA 2BDTA 5GJWC 1CJKC 4PO8A 5HE9A 4EFMA 2CMKA 1MABB 5CYPA 1R0ZA 2H17A 2RB4A 2ZSBA 3UATA 3KFVA 4F93B 4QJ4A 4A8JB 4KITB 3U44A 1KSFX 4KSBA 3CRRA 2BC9A 5DHAA 5JCZA 1MOZA 4WXPA 4RFVA 1QHGA 1SHKA 2ZRIA 1LV7A 4GOJA 2QMOA 1ZM2A 1MO6A 2DWQA 1FL9A 3I92A 3KDSE 2GXSA 4TZ6A 2Y8EA 1W36D 2QNRA 3BS4A 4TQUS 1IXZA 2B7BA 2ORIA 4CRWB 1FX0B 3Q3JB 4BZPA 2Q3HA 5AJYA 1I2DA 2E87A 3KUCA 4QNMA 2G83A 3TLXA 4URZR 2DWPA 1UEJA 2O8BA 3LLUA 2WKQA 3A58B 4HAYA 4M9XA 4DUGA 4CEHA 1QHIA 1Z5ZA 2JAQA 3RVBA 3LV8A 3GP8A 4MDFA 1XEWY 3K0AB 4Q1BA 2C77A 3BH6A 4DUGD 1W7AA 3B2EA 2YYZA 4A0RA 4R2HA 3OEEA 4R9UC 2EU8A 3WMGA 1P75A 4HLDA 4QJ5A 1FNMA 4M9ZA 2IYYA 2AKAB 1KI4A 4DDVA 3BORA 1SVKA 1XRJA 3F3YA 4MRRA 2J3EA 4W5HA 1SXJB 3GLGA 4DXAA 3PXGA 3PIRA 3U3KA 1N0VC 4OQXA 2F55A 1PJRA 4IOLA 3AB3A 1U8YA 5K8UA 3CRMA 1A2BA 1UM8A 2CNWD 3SDZA 1CF4A 1NLZA 2WBLC 1ZINA 2ZSEA 1DPFA 3NG1A 4DLZA 1XTSA 2OFXA 4GOXA 3IEVA 4MYUA 1ZU4A 1OYWA 1JR6A 3BB1A 3K0EA 4KJZA 3I73A 3AVWA 2WJVA 2WMOB 1QHNA 4MKHA 2OFWA 2IYVA 5KNBA 1T9HA 1KMHA 4PC7A 1QG2A 4Q4JA 4ZKDA 5F2EA 1TL7C 2XNDA 3ZIAA 4FMDB 4FXPA 4BLQA 1G3UA 2W2VA 2ZRHA 3NHBA 4HEJA 3TH5A 4TTPA 3TJZA 5EUMA 5JFGA 2OM2A 3PCRB 3SEAA 2BM0A 2N42A 2IHYA 3ZJYA 4KBGA 2RGBA 4TLAA 3ZIAD 1DAFA 1JQJC 1E6CA 3GFOA 4FMBB 5JLJA 3R7WB 3G0HA 1ZD1A 2JLYA 1VHLA 4PC2A 2N46A 5EXPA 4YMUA 3OIVA 1R5BA 4NKRA 3TK1A 1CIPA 4KFRA 3GCGA 1VIAA 3U3OA 2EW1A 1CRPA 1Q12A 2R8RA 3JZMA 4FCWA 3T1VA 4D2IA 2ZJZA 3TUJC 4CEJB 2J59A 3NH9A 2IX3A 1RRGA 1DAEA 4TT3D 3LNCA 3RS2A 1YJ5A 4KLZA 1GSIA 4TYQA 2KJQA 2IC5A 3HU2A 3UWKA 2ZJ5A 1OXVA 4EPVA 3CWQA 1KMQA 1VDZA 4R2IA 4HUQA 2IS1A 2NOAA 1VECA 1Z0JA 2WVJA 1NY5A 4I1OA 1G3RA 4C0SA 4II7A 2GA8A 2WHXA 3B7GA 1FQJA 4C3ZA 4H1VA 1M34E 5L8VA 3SYKA 3VR1A 4DSOA 4EJSB 1NMXA 3KTAA 3PUWA 3KQKA 1W4AA 3GEIA 4UJ5A 3W6NA 2ECKA 4M9QA 4KFTA 4GNKA 2EFCB 2W83A 3H0KA 4HAUA 5B57C 4LOAA 5JI3E 3QSYA 4JS0A 3O47A 2ZIAA 4PTLA 1EESA 3N2EA 1G5RA 3IKJA 1ZMXA 2JA1A 3RS0A 1E3MA 4BZXA 421PA 2DBYA 4ZPXA 4HLCA 2H92A 4OI2A 1XD9A 3LDAA 2KWIA 2D2EA 5D3MA 4BLRA 1R0XA 3L0PA 2KBFA 3D3QA 2IS6A 5FOTA 2IEYA 2I4IA 4I1UA 4EDHA 4HDCA 1E2MA 3JZAA 1XNJA 1R5OA 1OB2A 5EXSA 2DWOA 4IDOA 4E07A 5CIQA 4HAVA 2IS2A 3R8FA 3A1UA 3GLGB 4C0JA 4IVQA 1AKYA 4XSGA 3KB1A 4AURA 1G291 1DVRA 3QY0A 4HI0E 4M1KA 1DELA 1XWIA 3EASA 4IOJA 2K5UA 4CIDA 1E98A 2F1RA 4PO9A 1IXSB 3D6TB 4KVAA 4LGMA 1AN0A 1XJ0A 2FSFA 3K9HA 1U9IC 2OLJA 2RCNA 4JT2A 1P6XA 2AD5A 2VHCA 1Q1ZA 1KNXA 2YJTD 4OI4A 2ZI5A 1OHHA 5KDLA 1G21E 1J2JA 2AK3A 4FI3C 4PC6A 3RS7A 4HSEA 1QHYA 3T1OA 5HCNA 4RD1A 5KTYA 2PMDA 3I72A 3MCAA 3RWOA 3PFIA 3EIEA 4RKEA 4PXAA 1CKEA 2CLCX 2X19A 1DAIA 4CVNA 3TR0A 2QGZA 4EKDA 1Q0UA 1MR3F 1N0WA 1UF9A 2AXNA 4MH0R 2ZI9A 4UNQA 1RYFA 3N70A 1YR9A 3OF5A 1G7RA 1C1YA 3VX3A 1PUJA 3FE2A 4UNNA 2AX4A 1OB5A 4Q4JB 3KUDA 3CR8A 4QGGA 5KSYA 4BLPA 1U9IA 3I5YA 2IYTA 3FWYA 2YHSA 3LFUA 5KU1A 4PX9A 1FZQA 1PVOA 3C14C 2MSEB 3LBHA 4ESHA 1CXZA 1ZJ6A 2A2ZA 5AJWA 3A8TA 5CB8A 4IOMA 4D81A 1RYHA 4JVSB 1TQDA 4NCNA 2O8FA 4A0HA 3BC1A 3OFNA 3EX7C 3PEWA 3THOA 3FTQA 3E5HA 3FHTA 1S96A 4JKIA 1W4RA 1NKTA 1PV4A 2J0UA 1KZ7B 4F7WA 2REOA 3OFND 5C4MA 1BMFA 3DZDA 3T1QA 3AVXA 4UJ3A 3FOZA 4UXHA 3DHWC 5JMTA 1H65A 2YNMA 4FINA 1RJ9B 2C95A 2QP3A 5G3YA 1MO5A 1BMFD 1ZM3A 3QQ5A 3CPHA 3B8HA 4FWTA 3CNNA 3NXSA 3RRZA 2D7DA 2OHFA 3FB4A 4US1R 5HCIA 1GKIA 1W49A 3EZ6A 3ZVMA 4QHSA 2JGNA 2F9MA 3KTAB 3T5DA 2ZE6A 3ZLJA 1J70A 1HUQA 4L16A 1NI3A 3HYRA 5JI2E 1IAQA 3LVQE 1P2SA 2QEQA 5AJXA 3HR7A 5B64A 2DCUA 2B92A 1YR6A 1EK0A 5CYOA 4QHTA 5F98A 4LBWA 3CH5A 1U2RA 3CLVA 3NBYC 4IEIA 1G6OA 3SQXA 4GP6A 3LD9A 2YWFA 1EFCA 2P6UA 3BFKA 1A1VA 5FUWA 2CL0X 3H4MA 3KQNA 1P5ZB 2AHOA 5EE9A 1G8PA 4ASUA 5CJPA 5J4YA 4BWYA 4A36A 4AYTA 2XOKD 3K0FB 3KJIA 4ASUD 5C2JB 1DTSA 1T3HA 3DO6A 3IEUA 1N6KA 4GSYA 1YZQA 4JBXA 4BASA 1RZ3A 4S35A 3CNLA 1NVVQ 3FVQA 4NYIQ 4A9AA 4RCZA 2X2EA 3NHAA 2OLKA 3TVTA 4MDEA 5FTJA 4B6EA 1FW6A 2WWXA 1E2DA 3MWLA 4ERNA 5GVSA 1W1WA 1P7CA 1IQPA 1D9ZA 1JB1A 1HE8B 1PZNA 1VMAA 2Q9AA 3QBVA 2PJRA 4Q4HA 2P0EA 4LWZA 4YXWA 1KHTA 4KV9A 5GJVC 1U94A 1E1RA 4LHYA 221PA 3ZVRA 3BERA 4XOIA 5JHGB 3CRVA 4BFYA 1N5LA 1TQ4A 3Q9LA 4QL3A 4OHZA 3RHFA 3SE0A 4YXWD 4MYCA 4EUNA 4FN5A 4AYXA 3IQXA 3EZ7A 5KO2A 4C30A 4XTCS 2R62A 1IN4A 2ZRAA 5KPDA 3VR4A 1Q1BA 4QOSA 4XIGS 3THWA 2VHJA 3BE4A 3IUYA 2QY9A 1ELOA 4LK2A 2ZE8A 4JSTA 1G3IA 5K8LA 3PEUA 3M4YA 3VKHA 1MT0A 4TQAA 3QIAA 2W6IA 3QVUA 4YLGA 5FUXA 1W2GA 2B8TA 2R6DA 4KU4A 4TLCA 1RKBA 3GJ0A 2ZSFA 3R8CA 3AKCA 3VKWA 4DLRA 3IPYA 2V6JA 4DSNA 4OI1A 2WOOA 1N6NA 4W5JA 1CEEA 1E2HA 4UKDA 4IEEA 5L3RA 1U90A 1E2NA 3AEZA 3UWOA 2IUTA 5H1YA 2VEDA 1PUIA 4Z8YA 5A4JA 2OAP1 1A4RA 4GT1A 2R44A 4DKXA 5FUVA 1DG3A 4O2LA 5H68A 1IJEA 1E1QA 4GRAA 5FBVB 3CH4B 1BYIA 4EPWA 3C16C 4LBYA 2ZTSA 5CM9C 3MAAC 5J4HA 4QM7A 4LHWA 1G7SA 1E1QD 1Z47A 4TSFD 2J0SA 5L3SB 4D26A 3KKOA 1DO0A 3CPEA 4LZZA 4AG6A 3IO3A 4DT1A 2SHKA 1II9A 3B1XA 3SN6A 1E2EA 2V1UA 4NH0A 4IRUB 3B82A 4YDSA 2G77B 1LTQA 4B33A 2G1KA 2OZEA 1M7GA 4RJLA 2PEZA 2GF9A 4XH9B 1FOEB 2WKRA 3L43A 1Z8FA 1W0JD 2ZU0C 1N6HA 4DIDA 3A1SA 4GPTA 1NN0A 3REGA 3VHXA 1G18A 4TMZA 3AH8A 1JALA 2QE7A 1FTNA 4DLSA 1DG1G 3C5HA 1NNEA 1ZVQA 1E32A 3AP2A 4Q9KA 4X8LA 3BGWA 1XPOA 3TE6A 1VPLA 4Q21A 4YMSA 2FDCA 2WIAA 2QGNA 1AQUA 2QTFA 4GP7A 4XWKA 2AL7A 4UXIA 1HQCA 1EX7A 1X86B 1X8JA 3U3RA 3X1XA 4JZKA 4A6XA 2JLUA 4FMCB 3BIFA 4IKEA 3AM1A 4A2WA 1ZNWA 1F2TB 3LBNA 2ATXA 4C4PA 4LJ5A 3EPKA 5F9HA 2W6JA 2BKUA 5FBWB 2ZRKA 3L82B 5FBRB 1HURA 4XD7D 5TV2A 5KNDA 1UAAA 1E0KA 2ZRLA 1DBSA 4L5BA 3CF2A 3TQCA 2QU8A 2TMKA 1F48A 4I99A 4PPNA 3WNCA 1QHSA 2YWHA 2LWIA 3DOFA 3FFAA 4KYIB 3FDIA 1P2TA 2AFIE 4HZUB 2IUSA 4RD6A 3BB3A 4JSYA 1OYYA 3VNUA 2JJ2A 3CX8A 1EFTA 2VPPA 4E5UA 2FU5C 4IJMA 4PQFA 4LI0A 1CR2A 1R5NA 2OV2A 4NYMQ 4A2PA 2JJ2D 2QRZA 5JSZB 4PFSA 4A2QA 1XMSA 4TMVA 1NIJA 1R6BX 1VIYA 1VCIA 2A3RA 1OLOA 4BLOA 2BMEA 3KFXA 5GVRA 4D4MA 3W6PA 1YVDA 3CO5A 4WVFA 1ODFA 1US8A 2WWYA 1WBDA 3WMFA 2CJWB 4EPRA 2GCPA 4PC1A 4E09A 2C96A 3FMIA 4AK9A 1EWRA 1XEWX 3BH7A 3TQFA 2WMNB 3WY9A 1JR3A 3T06B 3WRYC 5JZVA 1J99A 3S1AB 1G17A 2CCKA 4Z51A 2O52A 1IBRA 3VR2A 3CB4A 4LJ8A 1E4YA 4G1UC 1D2NA 4E03A 3C8UA 1E94E 2WAYA 2OBMA 2ORVA 3RWMB 1JR3D 4TQ9A 4EPTA 1IY1A 2QPAA 4BPBA 3PUXA 4CEIB 1OH5A 4EIWA 4OHWA 1GL6A 2BMFA 1ZD8A 2A5GA 3THXB 5K8IA 4JMPA 1Q1QA 3SBEA 1A7JA 3P32A 4LSGA 3ADCA 2GZDA 1J8MF 5IF9A 5JRJA 4NCJA 2XXAA 3U6BA 4ZDWA 1W5TA 1U98A 4V0NA 4O3MA 4P4SB 4OKSA 4F4CA 1P3JA 2J1LA 1W47A 1QDEA 2GWHA 2J0QA 1JEEA 2GESA 1H8HD 4M1WA 1FMLA 2ZROA 2NO9A 4Y0AA 4O0MA 3MGCA 4GZLA 3AVQA 4B48A 2V4ZA 4CZ2A 1Z2AA 4B75A 2GJKA 3BWDD 4HDOB 2QZ4A 4QGFA 2CHVA 1M2OB 1SKYE 3GJ5A 3MWJA 5FPYA 4WXRA 5IDVA 2OCYC 3BFXA 1GNRA 2A9KA 4D0NA 5FTLA 1SHZA 4M1OA
chains in the Genus database with same CATH superfamily
4C03A 4F9GA 1KEWA 3ELUA 4EYOA 4TKUB 3QWBA 1FFDA 2QRLA 2Z6VA 3MSXA 5F7ZA 1DMSA 4EKNB 2AFIA 1R10A 2WTXA 3U7HB 5JBQA 2Q6VA 3EQ2A 1FBNA 1SZJG 4EG6A 5L7TA 1L7EA 3IP7A 4MB6A 5HEKA 1RCFA 3UO8B 5T64A 5CPFA 3TIXB 3KOXA 1Y8QA 2AYZA 4J1QA 4QTTB 4LZOA 5E9QA 1JEAA 4L57A 3TQIA 1GILA 3BXZA 2QXUA 3LRPA 3JQDA 4U00A 1Q0ZA 1MC1A 2QTAA 4H7KA 4OGGA 2F8SA 1AH2A 5AI4A 4D45A 5CH8A 1KYZA 1L7PA 5DWQA 2JIPA 2MSWA 3C5CA 1GKKA 3UVEA 1EVJA 4OM8A 1TEXA 2IWRA 1I1HA 1XK6A 4RK7A 4GRIA 1OXMA 3ZY2A 2YJ6A 2ZYRA 3X1ZA 2EWWA 4Q0MA 2WF9A 4BVBA 4BO3A 1NLFA 1R7RA 2H5IA 4RKRA 1GDHA 3TLJA 3QWHA 3P0FA 2PUWA 3GZJA 5TVGA 3RSQA 4F6RB 4ZVUA 1ECFA 1KFCB 2EBWA 5CMLA 1TU3A 1H2RS 1OJLA 1YE3A 1YHNA 1S2OA 2VDPB 1UMDB 3DH0A 4K9DA 1Y9EA 1XNRB 3UYLA 4DLBA 3GGSA 4CKWB 3Q0EA 3HBJA 4OL9A 4TZKA 4EB3A 1FFBA 4TV9B 3ZWWA 4DCSA 1P73A 5M5BA 3P19A 1OBFO 2Q6OA 2I4NA 5LN1A 1E0SA 2CB0A 3IUJA 1OF1A 3I23A 1L5GB 2ORYA 1UCFA 1ZHFA 2NU8B 3SE7A 2CUNA 2B35A 2ZBDA 3AR6A 4CMGA 1MBZA 3OZWA 4M0LA 2V03A 3ESXA 3OA2A 5E0OA 5CXUA 1YAJA 1MAWA 3R6TA 4JZYA 3FHJA 3LF1A 5IDWA 1PJLA 4DREA 2C04A 3EZFA 3GAMA 2IBTA 5ITWA 4WLEA 4HH0A 3K2IA 1T5BA 3GL9A 2APJA 2QI9C 3JATB 1VIDA 1CRWG 1KO4A 3C6XA 2FEXA 2VTEA 3AIOA 4JLSA 2DBQA 4YMVA 4ZZ3A 3BX1A 2EBFX 3PD1A 1QE5A 2BE9A 2R8OA 2G4CA 3HA7A 3N2GB 3V4OA 3M5DA 1T9KA 1R8QA 4QTUB 2OOSA 4NV1A 4G0YA 4Q3AA 1ESMA 2XE6A 3EAGA 3OJOA 4BEJA 3JQGA 4KNVA 1OIVA 4DB2A 3DVLA 3LFHA 4GXNA 2JJ8A 3EUAA 1MAVA 3SDSA 3JQAA 3GV0A 1WD7A 4KIUA 1FYXA 1YKGA 4JA2A 4HDAA 1M7HA 4OM7A 4UE2A 3NAQA 3FNRA 4M8SA 1CY4A 4IJQA 1YGPA 4PYKA 4QYMA 3ZR4B 2FEAA 1YBFA 2WU4A 5IAJA 1LRLA 3UWSA 3ZCVA 3QF4B 1V5FA 3E7WA 5HTKA 3R7DA 1YTLA 4BBJA 5ECDA 1TVEA 2CLOB 2XNJA 1USIA 3UMYA 4B73A 2WSSD 4U8HA 1QHFA 2CXSA 3NWBA 1WDMA 4KXQA 1C1XA 3DBRA 1F2UB 1HY3A 3GDHA 3HA3A 3K72B 3TNFA 1GEEA 2NYAA 4FVTA 5AVQA 1W85A 3FZNA 3BWXA 2JL1A 2I2BA 3D6AA 5EUQB 4A82A 1VKNA 4MW6A 1QQTA 3EGDA 4ZOCA 4HDQB 1VYHA 3SBXA 3GDWA 2HXGA 2I1VB 2QV7A 1GEGA 4RFLA 1JIKA 1JILA 2PLFA 3L07A 1ATZA 5DBGA 3RVLA 4BGUA 4XVUA 3W4KA 5CW1A 3R0JA 3GVCA 1XZFA 2XRFA 4HD8A 3FZGA 5I7HA 3UMBA 3GLFE 1VBNA 4HP8A 3Q3GE 3I39X 3R7AA 4D0SA 4Y1FA 2PJZA 2VH5R 3K70D 3E70C 1EGQA 1LF5A 2I34A 3H2SA 3KVYA 4UD2A 1K5GA 3F71A 3PTLA 1ID8A 3HMKA 2GJAA 2AEEA 3FWKA 5F77A 3N8GA 4JI6B 2XQFA 4TLEA 4I55B 3N7AA 1YL7A 3FJOA 3KK0A 1L5MA 3OMXA 4HX9A 4M1MA 3KPWA 2HT1A 2UVQA 1WXQA 3AFMA 2UVDA 4XW2A 3ONEA 3N2LA 3R23A 2X1HA 1G1MA 1E9AA 1G3MA 2VA8A 2ZCVA 2OSVA 3L7MA 5EFOA 4QOEA 5H3HA 4BV9A 1CTQA 1XVIA 3QELB 2BUBA 3V4LA 3GFSA 1O9BA 4HQLA 4O0LA 1REQB 1U9YA 2ZUVA 3PYMA 8AT1A 3QPCA 2I2CA 4N54A 1TF7A 2QT0A 1QS0A 2NPIA 2UZ3A 2GYYA 1DIAA 3R24A 1TGYA 2PT9A 4IXMA 3JQ7B 2FPOA 3M6AA 1T1IA 1NE7A 3QW2A 1M2VB 5BVHA 5A5GA 1ZJYA 5EWLB 1TKCA 2EGGA 3DNFA 3H4IA 3V8PA 4JP1A 4RK0A 4UUBA 3E82A 3WJAA 1E3SA 3JVDA 5I9NA 3ZDXB 1VPEA 2OGWA 4DJAA 4LMRA 1JXMA 3OEHD 2XVMA 1NW9B 2A86A 3AM4A 2RFLA 4DUZB 1ZUNB 3I83A 3BFVA 5A05A 3I5AA 1Q0TA 4MLPA 1P0PA 1T2NA 4ZWNA 1FK8A 2OORA 4UOZA 2HR1A 5K9ZA 1XSEA 4YRIA 1FFXB 2YXNA 4G1FA 3WB1A 1AO0A 3A1NA 1KJ8A 1M8KA 1YC5A 1W36B 1PKXA 5EP1A 1WCV1 1Z06A 4JI2B 1Z2CA 4EG4A 1Q0LA 1Y1RA 1UAYA 3L7JA 3SHTA 4J90A 1UMCB 3VOBA 3I62A 1T5LA 3HZRA 4DA0A 2OB2A 1OU4A 1U0FA 3L8FA 2CUTA 4C88A 3IDOA 3NEAA 4FD2A 2CVHA 3L93A 1EAMA 1PBTA 2ZS8A 1M2JA 2I2XB 3GPBA 3I9OA 3NBAA 2PMEA 3NDBB 1ULZA 5TS2A 3V1TC 2PQ0A 3LX8A 5AM2A 1JSLA 3N7TA 2H4FA 1ZOSA 5JZSA 4CEHB 1AZWA 2AW3A 5KTPA 1P80A 3A1DA 4DV6B 2FY8A 2JGLA 2R8EA 2ZJFA 3INNA 3GLFA 2HA6A 3EISA 3HXMA 1QVAA 3DQQA 3TS1A 1UOPA 1Z62A 1V7QA 2IE0A 1HDIA 2X2OA 4RGVA 1ZGBA 2XAUA 1KK1A 4A1OA 1WJGA 2O0KA 2ZW9A 5EJ6A 1G1AA 3G49A 1ETHA 4EQ6A 4M4SA 2ZRMA 5IP5A 1ZIYA 4ZCMA 1PFQA 5EPUA 5FH9A 1MNAA 4PHHA 1Y5RA 3UJCA 1EFPA 5IYZB 4WBSA 2ZCJA 1T4DA 1FYWA 5HZHA 2V97A 3P9RA 2EARA 3FD8A 4AAYA 5K45A 4UBKA 1L8LA 1LPPA 1OV6A 1XALA 2F9LA 2RGWA 2UYOA 4ODIA 5EC8A 1YZLA 3RSFA 2ZUEA 3KHUA 1KK2A 2HIAA 1GTG1 3E5RA 1X7GA 1CR4A 1UXHA 3AZPA 3RUAA 5K0JA 4I1PA 2H2AA 5HIAA 4RL6A 1J0AA 3OLXA 6LDHA 2YC4C 2NUAB 4KSYA 1HQYE 1ECLA 4HQRA 1Z26A 2LUOA 1LBIA 4J2HA 4NYJR 3F5MA 4DJEC 2VIIA 5I9LA 4R4JA 3HEMA 2XZDA 5HZGA 3GP5A 1TVKA 3CMMA 4RTQA 5BNIA 4BNDB 3CNOA 3I58A 4C05A 2Q4TA 5F3WB 4FHDA 1DLIA 4HATA 4IIJB 3KU1A 1VCMA 1DC5A 2XSZA 4LTMA 4I81A 4P80A 2P6MA 1VHDA 5TS3A 3ETDA 1E9BA 4D8WA 4EPYA 2Q3MA 3BXOA 1YZHA 1UMKA 1NWCA 4G86A 1V8OA 1R37A 4KNYA 4BNYA 3ZD9A 4JGGA 3GD7A 4DDUA 3SC2B 3CEPB 4KLCA 4XARA 1QCZA 1N57A 2ATCA 1J5PA 1I4OA 3EVDA 4N1AA 1SBCA 4NBSA 1SIBE 1GZDA 3TLZA 3NHUA 3KLPX 1BMTA 3CGGA 4QO8A 4BLVA 1F7UA 3J7TA 3T4XA 1UBCA 1CZUA 1VBKA 4J9UE 4ZOLF 4EMSA 2FUEA 2M6RA 5IM4A 5KNCD 3UMVA 3BQNB 2I80A 5JNUA 2CNKA 4MVJD 2Y4NA 5AI8A 10MHA 4XWYA 4EHJA 4CKEB 2GEJA 1XBTA 2B0JA 2HMYB 2CVQA 2PLNA 3MFYA 1NDQA 3OY2A 4ENTA 2RAPA 3ZDQA 1SXQA 3KSAC 3QMVA 3T3GA 2C3PA 2RGNC 1DLJA 4NYIR 4DLAA 1UIRA 2CF6A 4Y2XA 3WHLA 3E18A 4LRTB 1RQRA 2BZ0A 2YHIB 1S8OA 3K6SB 3EZ9A 4KXFB 2H65A 1G5TA 1WV0A 4IIXA 1CYDA 4MUXA 3FYUB 4R16A 3ZDFA 2ZRFA 2HSWA 3KHSA 1JU3A 2FUKA 3MTEA 3AB7A 4FLMA 3B3GA 5EIHA 1UMBA 2XMRA 1JA0A 2HLDA 1Z0FA 1XAHA 2WUVA 2X77A 2VJOA 2X6QA 2X9GA 3T3OA 1KI7A 9LDBA 2PY6A 1XMJA 1S7CA 3DKVA 5MHTA 1Q2UA 4ABTA 2GCOB 3U31A 3P27A 4CTJA 2WSYB 2ZREA 3OPNA 5J9FA 3V7NA 2OKGA 1M0SA 1VSQA 2PDAA 3DTYA 3G8DA 3GLHE 1Q16A 5G4KA 2VXBA 5T57A 1KDRA 2XI4A 4GIBA 2WNHA 4GMFA 1H0KA 4JB2A 4OJQA 3U61B 2RGNA 2M1ZA 4BLWA 4Q3DA 1O97D 1L7VC 2QR5A 4QBFA 2NU7B 1L4EA 1EX6A 3CBQA 1L1EA 1WXDA 4YRFA 1EWKA 1O2DA 4G0UA 3CLRD 2WABA 4FB4A 3E7PA 3G85A 1PJCA 4RFSA 3TR6A 1MOSA 5B7GA 3FUVA 4WN9A 3I05A 3ITDA 1L5RA 2JLRA 2GZHA 4ONEA 1YVPA 3A6FA 4Z0TA 1M6VA 2AA3A 2XOKA 2KB0A 5D3MB 1YFJA 3VKGA 1HBJA 1CJVC 1VG1A 2VP0A 4M37A 4WX2B 3R7BA 1T0UA 4PIPA 5T8KC 3V6MA 3D4BA 3G6KA 2J9FB 1E7WA 1ZESA 2C99A 1W52X 1B26A 1HSZA 1R8JA 1XZGA 2H0AA 3D2AA 3PS9A 3QJYA 4FIZA 4MRVA 4NMMA 4C04A 1QIEA 1KXZA 2HJGA 1B8VA 3BBPA 2AEJA 2G07A 1R8YA 5EE0A 2IGBA 5AW7A 2ETVA 1DBRA 1N9ZA 3LE8A 5J2TB 1R16A 3KX2A 3HMQA 4DE5A 1PBNA 4QKQA 2P9QA 4OHXA 4IQ4A 3DF7A 2P9TA 3FPGA 5JVDB 1RJDA 3U9TA 1B93A 1E8DA 4QUGA 3ONNA 3DP7A 2OUIA 2C07A 5EMHA 3TL2A 1H2AS 3Q1KA 4I6EA 2NVOA 5T8KA 5CM2Z 2XODA 3H0CA 4MUNA 3TMYA 4F3CA 4ND7A 4P8RA 1EE2A 4H1UA 3IHTA 1L5YA 5ETJA 4DLNA 4RLHA 3W5HA 4KUHA 3KYDB 2FP4A 4Q16A 5JO9A 4MLDA 1YXMA 4AO7A 4KKVA 2P11A 2FPUA 3K9NA 4L8VA 2OHIA 1E1KA 3WG9A 2J3QA 1RWMA 3RK0A 1Q6YA 3IPLA 4GX1A 1M1YB 2VAPA 3IIJA 4DIEA 1NQ5A 2PVCA 1RE0A 1HFKA 3GARA 2OESA 3UJNA 4L4SA 2EX4A 5ERXA 5IJXA 3FYSA 3A0RB 5EHIA 3CRW1 4I36A 2FNAA 3V4FA 4PAOA 2QL6A 3R4CA 1TZ2A 1T91A 3E22B 2XWSA 2J6IA 3NDIA 5DI3A 4CKBA 3DXZA 4P35A 4YUZA 4XI9A 1T9DA 4ZA2A 3LBAA 1E8NA 1B6TA 3HCOA 1BXRA 1ZH8A 4LY6A 3PFBA 5HUQA 3G0GA 3HKEA 3GLHA 4RH3A 3PRYA 5KYXA 3W3AD 4I8IA 4HB3A 1LCIA 1JDTA 1AKQA 1E6MA 3AP3A 3OIUA 4X6YA 4FCVA 3EEBA 2VQSA 3DTNA 4P3YA 5AVUA 2RKOA 2UUOA 2GBIA 2AUNA 2X0NA 3C3JA 2FZ4A 2HRCA 4OBBA 2XBUA 4R3UC 5GIOE 4GMDA 4WLFA 2O8EA 1AHPA 3O8OA 4CDGA 1K5DA 2X4GA 3AESB 5ECYA 2O8FB 1JEQB 3E3AA 3B5EA 1NW4A 1KA9H 4ETMA 3COJA 2GFQA 1X0VA 2VHYA 3DOCA 1TVCA 4U2FA 4TL7A 1PS9A 4G5YA 2VNJA 4MQBA 3ZW7A 5AW4A 1UKEA 3WQSB 4B84A 1A9SA 5A4KA 2BTQB 4QG7A 3W2EA 1JLLA 3K9WA 5AW9A 4M55A 4F92B 4RZ3A 4MEJA 4D6YA 1IEXA 1NR5A 1T8YA 1C8KA 4W63A 2GEDA 4Q00A 3DBHA 4LOJA 3T3PB 4FMCF 1SA0B 2IODA 3EGEA 5LD2C 1XL1A 4XLTA 3B20A 2B6NA 2R1VB 3FDZA 1ISSA 1IY2A 3FSEA 4Q24A 1ODTC 1SC3A 4QQRA 2W6PA 5CB6A 1ONOA 3NBQA 2RI1A 2EJVA 1PU2A 2FW7A 5GZ1A 3VJLA 3LH5A 2Z2KA 2OBXA 4ND6A 2RHRA 5EMKA 2BBSA 3MIIA 4ALLA 1F8FA 1VCHA 1N1GA 2Y93A 5LZ7A 4Y9SA 4QOGA 3TBFA 1P4SA 2L82A 2ZITA 1ULUA 3LZ6A 4DPKA 3L02A 3E1SA 4WSOA 3EEQA 1KWGA 2DGDA 4D3XA 1GLVA 1JR3E 2J7KA 1UBNA 5T6BA 4X91A 2PMCA 3A6DA 3OO0A 4B34A 3PFKA 5F5NA 3ZGOA 3LC7O 5F76A 3D4PA 2J0VA 2WD8A 3OUUA 4KACA 5K8JB 1K66A 4N7JA 4P86A 4Q4LA 5AKHA 1R6XA 4LEIA 5BV1A 3CURA 2G76A 3P1JA 3S99A 4Q39A 5K3DA 4RDXA 1EFUA 3AY6A 4BAZA 2QDKA 5HQJA 5I8WA 2PUHA 2RBGA 2FLKA 1X94A 3EG5A 1D2MA 4GMXA 1P8JA 2GLTA 2QRNA 3O1HB 4K7JA 2XKBA 4KV7A 1XZBA 3E9QA 3FNBA 1NMZA 3GFQA 3NNDA 3NTUA 5IXYA 3U7FB 3WKDA 4B47A 2ODWA 2LBPA 3V1KA 4X0EA 3R40A 3IAS1 1H1TA 2V6GA 4M8IA 1LPAB 3WV5A 1IC6A 4TSKA 2WM2A 5BRAA 1K75A 3FCAA 4OD0A 1PI3A 2G09A 2RI6A 3L8MA 3QXHA 4J7AA 4NG5A 2NAFA 1F0PA 4BMNA 1CCWA 4FFNA 2OCPA 5FI1B 3DONA 3SD7A 1KH3A 4YV7A 1T1JA 1JQEA 2OL4A 2AV6A 4TS3A 1XEXA 1SXJE 1GGNA 2ZIXB 5CIWA 3ZDZB 1AKVA 1V7CA 1G8FA 2VP5A 3IUEA 3Q85A 5CH5A 3ETCA 3DHVA 4PX2A 3M1AA 2JGEA 4LFBB 3SX2A 1FNNA 3ZUPA 3IX7A 5BYKA 1B4DA 2V8BA 4DC9A 1NMQA 3NAGA 2VP4A 3QITA 4Y2SA 1UDBA 1Z83A 1FJGB 1YJCA 1Z6YA 4U7GA 1KJYA 1J8FA 2V8OA 2E37A 2YDXA 3SBDA 5GADl 4BJ6A 1FLNA 5EZYF 3DFUA 4IF6A 4IXDA 3LP6A 3E7FA 4CHGA 2H9AA 4ZAWA 1MAAA 2P2SA 3F1KA 3KKZA 3VU3A 4PZ9A 4J0GA 4ZQCB 3PIIA 2E49A 4N7BA 4TLDA 5AKEA 5B7NA 3K0SA 3F3SA 5D2CA 5AIAA 4CG2A 5AM1A 4WL0A 2PJDA 4R8KA 5IJ9B 5JEDA 2DQKA 4QSMA 2FMKA 3WLSA 2DUMA 3THWB 5TB5A 4QC2A 4L75A 1WCWA 2NP7A 3WJ2A 3SAJA 1DPGA 1QP7A 2CL6X 2O4CA 5AJVB 4JGBA 1DBQA 1YRHA 1J0BA 3KCNA 2ZXUA 1U81A 5DMHA 1Z4LA 4INJA 1F9EA 4TWZA 4L3VA 1SUAA 2JCSA 2B4RO 4G1BA 2IA5A 3RM3A 3NTVA 2QMEA 2IKSA 3PDWA 2C84A 2CVOA 3BAZA 1E4EA 5AKZA 2EG5A 3M33A 1BEEA 1FU8A 4B43A 2QRVA 5CBPB 2OCIA 2FSPA 5KWEA 5AVJA 4YT4A 1SXPA 2JIRA 3HCCA 4O4LB 2ACVA 4KQXA 2F48A 1LS6A 1D5CA 2B9VA 2ZIFA 1Y33E 4ROSA 3W9BA 2H4ZA 3CJRA 3SF8A 3H2GA 5MN4A 2BMJA 2NO7A 1SXJC 1HDOA 1DCFA 1W9HA 2FN4A 3D6MA 3LWNA 4MINA 2Z4SA 4Q1VA 2VSXA 5I4IA 1N1DA 1OILA 2KLBA 2ZKLA 3V8QA 4W5NA 2YVAA 3AUSA 3TQRA 1GFIA 2MOKA 2ODBA 1XLUA 4LV6A 1U2TA 2RH9B 3GZTB 4URUR 2BD0A 1SHLA 2XMZA 2ILVA 3F9RA 1YS2X 3K0AA 1U8FO 4S1VA 3ANYB 2WWRA 2BEJA 1N7IA 4G09A 1E7QA 1P72A 3QVMA 4HVTA 5LBIA 4BV3A 3OIWA 5EHQA 1AG9A 3E5MA 4MA5A 5EMMA 3KZ1E 2RHWA 4CLRA 3VR5A 4E11A 1FFEA 2I7CA 4KHZA 4L07A 3IALA 3DNPA 3ISVA 3AI2A 2A1TR 3I28A 1NVUQ 4QTYA 1XTJA 4FJ0A 3CEHA 3GMTA 2R6GA 1L1RA 3HKDA 1P0CA 1BU5A 2IU6A 4PO1A 1RTTA 1XMIA 2F7SA 3CEMA 1JA9A 3N0WA 4TLBA 1GGFA 2BMVA 2WFLB 2QQEA 2YY7A 1DEKA 3LVRE 1SXJA 4HWSA 1U0NA 3CR7A 3G2JA 3INYA 3IMFA 4DCMA 2WTBA 3U3DA 5BQPA 1OE0A 1H4TA 3SJUA 1S9HA 3VSAA 3WYBA 3EUFA 4FFDA 1E79D 1E6WA 5K4HA 3OZIA 1BKDR 1JAHA 2CXXA 4M1TA 3U81A 1BO6A 5JNWA 1CJMA 5F64A 2CV2A 3NEJA 4V1CA 2ZIVB 2FWJA 5FBKA 4NBNA 4FYPA 3GWZA 2DUWA 3G2LA 5K3BA 5GGXA 3SIXA 4C08A 1X14A 4JEHA 1H3NA 4LJKA 1XPRA 1W35A 3HBMA 4OSOA 3VHXB 2B69A 1GDTA 3QX7A 2XUFA 2GN8A 4MV3A 3KOZA 2G0NA 2F3UA 2ZJ1A 4FW9A 4GW3A 4KQWA 1JPJA 5G0UA 3ZTYA 5JJCA 2EL7A 2WT8A 4PSVA 4R2XA 3CZRA 3R9WA 3PGXA 3SR3A 2X5NA 4YALA 4NBKA 4DAEA 3ZVKA 4RACA 3M2TA 3X3HA 5IXSA 1YUMA 1CJTC 2FPGA 1IZYA 1XAGA 2P1DA 4NVRA 3P9IA 2VTBA 1ZU5A 1SU7A 3NP7A 4HNHA 4LXTA 2VYFA 5DLQC 3SVZA 1SIOA 4A9AA 5IH7A 1OAAA 1E6KA 3OC6A 2C0PA 1OGJA 5EMJA 2RHHA 4QASA 4NTZA 1V7PC 2EV9A 2YXPX 4MB2A 4GE0A 5JECA 4F3NA 1DWPA 3L0ZA 3UICA 4Q03A 2OAQ1 2WEKA 2A88A 3NVMB 4OBWA 1L5NA 4C3OB 5BN5A 5C7IO 5ALEA 4Z4GA 2AMFA 4YONB 2NVUA 1EG2A 3JVUA 2BCJQ 3RTGA 3PV0A 5JFOA 1F0NA 2IVFA 4JXKA 1FSZA 3W0LB 4LXGA 5DOZA 5C5EA 4C2AA 1JAIA 2BVNA 3AUJB 1T10A 4MW5A 2R6FA 4O2AB 2C5HA 4EBBA 4S1OA 1NBOA 3EWAA 1AGNA 2Q46A 1NQWA 2VJKA 1HLPA 1Y3IA 3G5UA 3OOJA 1FMJA 4D0LB 5DN9A 4TVSA 4LTNA 4MGKR 2VDMB 4UNRA 3Q0TA 1DKNA 1KVQA 1NL3A 2E1RA 3DT8A 3O2QB 5JCPA 1IHUA 2RGEA 1QXSA 4WCVA 3UB3A 5CA1B 3SQWA 2GTIA 4JBHA 2VOJA 2EIXA 3H8VA 2QTNA 4Q9JA 4DEVA 4UM9B 5CM8B 4BMOB 1Q17A 4GOMD 4GAEA 4D5EA 3UAZA 2R5WA 4FFRA 2WW8A 1UPBA 821PA 1Y4AE 2EATA 3BSYA 5BR7A 1SK9A 3V2HA 2CVZA 4EJFA 2GZ1A 5E4FA 3EMVA 4B5LA 3ADBA 1DQYA 2VP2A 3TUIC 5TJHA 2UVPB 5KOHB 1UK9A 2KM1A 3ESCA 4V0OA 4EUSA 1C9YA 1MB2A 1PJZA 4LWPA 1PGOA 3T6KA 2GEBA 2FG7C 4B1FA 3M6WA 3J80A 2XTJA 4UHJA 1KPHA 1VHTA 3PC3A 9ATCA 4LY0A 3AJEA 4IDPA 4JJKA 5NULA 2AR7A 2BHNA 2P62A 2C1XA 1O87A 5ALQA 2HMAA 5CLJA 3E3MA 4GYWA 4BU0A 4XRGA 1I7DA 1GVNB 1Z08A 3O75A 3MTIA 2I1LA 2YVLA 3P94A 3GVIA 4ZCPA 4CG3A 2W6CX 6NULA 3EA4A 3TIVA 1S4QA 4L0QA 1TCAA 1U8EA 1TYEB 1KBZA 1C7EA 4XR4A 2OHJA 2B8EA 2HF8A 2XYHA 1IXYA 1K6EA 1QFZA 2AIRA 3TOSA 3RSHA 5CDUA 5ICMA 4P3OA 4ARIA 2G88A 2VZLA 4LG1A 4IIVA 4NAVA 4YFYA 3TRDA 4WBNF 4EY6A 4OMFG 2F59A 3EMKA 4JUFA 1JWLA 1SHUX 3TZCA 4PF1A 1VRVA 1VSVA 3CKLA 4YRNA 3SJZA 5IUJC 5JU6A 5JRDS 1EIWA 5HIJA 2ZI6A 3D5EA 2IYEA 4ILEA 5D7NA 3IUQA 3DE1X 3EFOB 1FRFS 1Y4UA 2BFEA 2ZBPA 4B0PA 1E4OA 3HP1A 3LDGA 4ZKEA 3UK1A 4NCAA 1RLIA 2Q8NA 3KJFA 1N1EA 3QV2A 5EXXA 3S3TA 4BQFA 1A5ZA 1PN3A 5FBQB 1RWVA 4M1SA 4YP6A 3SVTA 1ZJWA 1GPKA 4LOLA 5EE3A 5IVPA 1T8PA 4BLUA 3OPMA 2VWHA 1H94A 4W99A 1QJCA 2NV6A 4PC3A 2JH3A 3L0OA 1OT3A 4BLSA 3OLCX 3H1BA 2QTRA 1EGVB 2NXNA 2WICA 4GNRA 3ZLBA 1E6LA 2XCOA 1OWPA 3SCZA 2R6HA 5B3LA 3BZUA 1YT5A 4LZWA 8LDHA 1BD3A 3OZFA 4PPFA 1RBQA 4JLKA 1NT2A 1E9DA 3I2GA 1XQ6A 4NCHA 3RYTC 1UWVA 3IHKA 3JSXA 4BKRA 3K53A 3IEMA 2DSTA 2OR3A 1NIPA 3KHTA 4JLDA 4LKOA 5FJJA 4F4JA 3WSTA 1EXVA 5LQJA 3DPIA 3EFHA 3VUFA 3ZUGA 3HVKA 5CG1A 2RK4A 3A1CA 2Q3BA 4KLNA 1GCUA 1IHDA 2R86A 2WJ6A 2FUNB 3KHKA 4MA4A 4RADA 4BO4A 5HXAA 3RIGA 1SHJA 4CKXA 1L4FA 3E9CA 3WWZA 4CQJA 4WGGA 4PIVA 4O59O 3DUFA 1KO7A 3QVKA 4XUEA 1Z38A 1Q44A 5CK5A 1VGQA 2RONA 3ESYA 5THKA 3WISA 3EQ6A 1FU4A 3OEHA 4JT9A 5HBRA 1XX6A 2HWYA 1WR8A 2VHZA 5ALGA 3D7NA 1MX5A 4P93A 2XNDD 3A6HA 3IAEA 1NG1A 5DK4A 5K20A 1BVHA 1TGVA 3IGFA 2FX3A 3S8EA 2HPZA 3ZWNA 1DKOA 1WXHA 2UYQA 1U8AA 2B21A 3NYIA 1NZJA 3PT9A 1U3CA 4BQOA 3PXXA 1VOTA 4EVRA 4PPGA 5F1YA 1T6BY 3LBYA 4JLPA 4OHMA 4LOHA 4J4BA 4B3IA 3NAZA 4JT4A 1K2VN 5BOSA 2WJIA 3CF4G 1SG0A 4H0FA 4Y2QA 3SR4A 5HR5A 1ZGHA 1KQGA 5E1BA 1ZN7A 2V6MA 3BQ9A 1FF9A 4MVJE 5A3VA 6GPBA 2G6TA 3ADPA 5HYVA 1OMOA 1Z39A 3WAJA 1VL8A 4BO5A 1OX4A 2QN6A 4U9IS 3OE7D 1IWOA 1QNLA 3J81k 2YKGA 1FY2A 4BNZA 2RBKA 1SOMA 4S2UA 4AKTA 1A7KA 3BMQA 3RAPR 3DCIA 1ESDA 1UKAA 2H5EA 3NIFB 4RXMA 1N6PA 4RKFA 5DM2A 1MJHA 4X92A 3VHRA 4F5YA 5F7XA 2A9FA 4ZVRA 3EY9A 4I6JA 1KJQA 1NC1A 3DAHA 3KWMA 2RMKA 5P21A 4IHAA 5AVTA 2IYLD 3JQGB 4F04A 1U2PA 2B2CA 2I62A 4QEDA 4JENA 4KODA 4XQ9A 5JW6A 5A0VA 1PWYE 4DR6B 1WLYA 1HTWA 1OREA 2HQBA 4LW8A 5WRFA 3DDUA 4LCEA 4LS3A 1T3LA 1WQ1R 2QJRA 4G07A 4KJXA 4OG2A 4A15A 3ICWA 1M0WA 3NWEA 1ZCZA 2BEUB 3GRYA 4JLJA 2VUUA 5BSGA 2O3UA 3VR6A 2GTHA 4ZOLA 3RYCB 4KAFA 4B6PA 3G02A 2EQBA 5ESXA 3MNFA 1FCJA 1C1XB 3DBRB 3QIVA 2E9SA 4C0BA 1FDVA 1WF6A 2RGXA 1AKTA 4TTRA 3RBXA 4D4LA 4F86A 5D6OA 4RF3A 3DP9A 5JAPA 1ZA2A 5CFZA 1TECE 4LBVA 4NFYA 3T61A 3V42A 4B3BA 3ND8A 4BVAA 4HXYA 4FR0A 3BTUA 3TEFA 1RQNA 1XOIA 2QW8A 3UOWA 1R0CA 1EVQA 2F8LA 3QPWA 4MHSA 1M33A 2H1IA 1YSCA 3EGDB 3JSAA 2LR0A 3D7RA 1W0KA 4M9SA 4NATA 4MQ4A 1KQNA 4FILA 3KKMA 5ALYA 4LKRA 2OHHA 4J2OA 4NDAA 4TL6A 4ER5A 1WVIA 5J23A 4MP3A 3ZV7A 3HY4A 2CT8A 3WGQA 2PZEA 4IPTA 5LMNB 3DDCA 1E69A 3DW1X 1FX1A 3F90A 2AFVA 4H7EA 3D3WA 5LR6A 2DHRA 2DVMA 1WCIA 1XJQA 2IHKA 3VDNB 3ZY5A 1DKPA 1P5FA 2V7PA 4HFRA 1ZR4A 2JLXA 4R8VA 1GM5A 3IILA 3H86A 4XPZA 2GK6A 4R3NA 2ZYHA 2AI3A 2IXFA 1BE1A 5E95A 3R5FA 3RIEA 1C81A 1U2SA 2FKNA 3N39C 2QRPA 1KYYA 1B2RA 1ONBA 4TXNA 3MT8A 4KQ1A 4J8PA 3PXBA 3VC1A 3E7XA 3VSCA 4EGSA 2PS3A 2PX2A 3AF2A 4RKWA 3L3BA 2FH5B 5LWQA 1F6DA 2QAIA 2HK8A 2W37A 5IARA 4J0KA 1LJLA 2CXTA 3HE3A 4NNJA 5AHRA 3QUSA 1L6RA 1YZGA 1GJRA 2OB1A 1Z2PX 1VFPA 1OZFA 3ETNA 3O9VA 2QF7A 3RLIA 2V5AA 2ERXA 1B3RA 4L8YA 1D3AA 4H16A 3ZZUA 2QX4A 3O8CA 1XD2A 3BL6A 3KZVA 1QS0B 2O2HA 2ZVQX 4NCKA 2G0TA 1RMYA 1TX4B 1X70A 2R5NA 2ZJ3A 3WLAA 5AQ1A 5K99A 4TS4A 5BVHB 1BHJA 1TVMA 2V9PA 3KXDA 3V4PB 3HU3A 2AKEA 4OQMA 1KZ4A 1TK2A 2CW5A 3QRWA 3NTLA 2FQQA 2ASEA 4PN3A 5C46F 1Z7YA 1ES9A 4YBRA 4B45A 1U4OA 2P2LA 3IMCA 4KWHA 4U2BA 2TS1A 1D04A 1CIVA 4U5XA 2EWMA 4I2NA 1N2BA 1ZOOA 4EP1A 5KTMA 2OM6A 3JAWA 3MM4A 1SB8A 3GDOA 2AC4A 3AEQA 2ONJA 3OZTA 4XUDA 3OU2A 4W9NC 5HCUA 1X38A 2AYXA 3JRWA 3NBMA 4M7RA 3UAXA 4BP1A 1IBKB 1APBA 2K7FA 4J49A 3ER9A 1XPJA 1COZA 2FE4A 3IURA 4EY5A 3BHIA 3C7CB 2HDNB 1LQUA 4UFNA 1G6HA 1RLMA 1V47A 1EFAA 1DAPA 2VYVD 5TY0A 5IS2A 4L74A 5JSKA 2Z9BA 2OWEA 1B7GO 2VK8A 2HIHA 4NDNE 5CVJA 4C20A 3G2NA 2C20A 4EFDA 5CXSA 3IPRA 3ML1A 3K35A 5ANRB 1YCHA 4KUEA 2YNMD 1X2BA 3L8DA 2OTCA 3JPWA 1DWOA 4L22A 3T7RA 5EP4A 3CVOA 1AY0A 3ZQUA 2O20A 4Q7MB 4B6OA 4DSTA 5KMGA 3F6PA 4C4OA 1LY1A 2XJ4A 2DCMA 4FEEA 5IG2A 2AWNA 4A92A 4XGRA 3GLFB 4W9NA 1JW9B 1EFKA 4LYHA 3NAMA 5L3QA 3R9XA 4HRVA 1QJ4A 1A69A 3AO0B 3H3FA 4IFEA 2QRJA 4JJAA 5A4MS 4EARA 4C4ZA 4P32A 4JOCA 1O7JA 1G9XA 1DBVO 4FBMA 4N8EA 1EFPB 2HO5A 4KKXB 4EKIA 4WI1A 1MRZA 5KVQA 2GAOA 4B2LA 5EJ4A 3QUTA 1A98A 2PKEA 1N25A 1X87A 3T5GA 2WT9A 4OCZA 5EWJA 3WICA 4MW0A 1YQTA 1E1NA 3ENZA 5FYDA 3WGGA 2HV8A 5AICA 3KUKA 2Z95A 3STTA 3GJRA 3ZHZA 1TEVA 3BDIA 5LZ9A 1MRNA 2OYRA 1GNVA 2BI7A 3T1YB 4LPKA 4U2GA 3B9QA 4FEYA 3T9EA 3VOAA 4BX9A 4IFBA 1K0FA 1XTBA 1J9GA 1K6IA 3LYAA 2YJ5A 1EQUA 5G53C 2YXEA 4OH1A 5A03A 1GZSA 1NPDA 1Y1SA 2HU7A 1NWHA 4R83A 1IM2A 4ARZB 5B3KA 2XITA 1Y37A 1F2TA 1QG6A 4MCAA 5DXAA 1Y7HA 1W5EA 4ZIRB 5HOQA 3IAXA 1JECA 1RWNA 3TAXA 2NSJA 4I66A 1KAMA 4EY7A 3V6LA 1N3IA 4CV2A 2PZFA 4BIIA 3DE3X 1K6XA 1PJBA 1U7TA 3JWHA 1Z0IA 3HPQA 3CRNA 3HSKA 4ND3A 3W3AA 4RLQA 5K2OA 1EMDA 1Q74A 2J45A 2CUZA 1WUTA 4ERXA 1YBVA 1XVUA 2B4TO 2Y2UA 5G02A 4B5KA 2VRWA 1CHNA 2IEAA 4QGHA 1R6UA 2VJLA 4Q93A 3RUPA 3V80A 5AVYA 5LQAA 2QM8A 1KSJA 3AERB 3HUFA 1B14A 4HZUA 1JJVA 1I2ZA 3WKAA 3LUGA 1F17A 3LXUX 4C7KA 5KJCA 4XJTA 4QRIA 4B4KA 3BDAA 3UG7A 4LCJA 1CP2A 2I6QA 2OENG 4JSRA 3GFFA 4ZJPA 2IHUA 4UUQA 4M3NA 3QKWA 1YZNA 1GZVA 2RHMA 4GSLA 1FPMA 5F21A 3FOZA 1ZXLA 5JXHA 4NBWA 1Q91A 4A27A 2XGJA 3ZZTA 1U0LA 4BCDA 4ZMRA 1H0HA 2CNOA 4JNCA 1YCDA 4LHZA 2BHRA 5ADVA 1QAMA 1Q3TA 2VHQA 4KGVA 1AUVA 4BN0A 1I7SB 4FC7A 1A5AB 2CJWA 2QUBA 3BL5A 4ZYUA 2PH5A 2OXEA 1BDJA 4CTMA 1OXXK 3ZVLA 1GZHB 1L4GA 1SN7A 5D87A 1G4UR 2W8ZA 3MXTA 4O08A 4AMBA 3DD1A 5FI3A 5SYMA 3HACA 1UMBB 2JK1A 4NAUA 1K7EB 4YMTA 3ZH2A 3PVCA 3X43A 1YRBA 4PG6A 4DDTA 2RK3A 1USGA 3A2MA 1GXSA 3KKNA 3SMVA 1E3QA 1LFDB 3M6FA 4GLFA 4CEIA 2FWRA 1TO1E 1UBMS 3OTGA 3BQMB 5G4KB 1OWNA 5K3OA 4NENB 2V5UA 3THXA 3UT0A 4CW7A 3CLSC 1L7NA 1ZK1A 3GNTA 3IIKA