4TYPA

Crystal structure of an adenylate kinase mutant--akm1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
208
Chain Sequence
b'MNIVLMGLPGAGKGTQAEKIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSRGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIDVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMKPLLAFYDSKEVLRNVNGEQDMEKVFKDLRELLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
molecule tags Transferase
source organism Bacillus subtilis 168
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
total genus 66
structure length 208
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4typA00
4GRAA 2KSQA 4LK2A 3I62A 3GLFA 3EAQA 2C77A 4NP6A 1FUUA 2HXYA 5FBLB 3HU2A 1A1VA 3KXIA 1Z22A 2Z4SA 2FFAA 2ZJ5A 4E22A 4OYHA 2A78A 3UANA 2CMKA 4I1OA 1SKYE 2BDTA 3SBEA 3TKLA 2CE7A 2VSXA 4JVSB 1LVGA 4NKRA 5DGXA 3UG7A 4DJTA 4AC9A 2XSZA 4ASUA 3B1WA 4RD1A 2RGDA 1RYFA 3AF3A 1I2MA 4JLKA 2QTFA 1G8HA 5FTMA 2XX3A 1CP2A 1AZSC 1U0LA 2GBLC 1G21E 4Q18A 4HAXA 2QPOA 2WWGA 4A0RA 4F4JA 4O2LA 2BCGY 2D74A 1M74A 2PLFA 4JIMA 3ZGXA 4TL8A 3MUFA 4TYQA 1RRGA 4YMSA 3FYHA 4UNQA 2BM0A 1DPFA 5DNYB 1Y3AA 2P5SA 3KQKA 1CR2A 1SGWA 4IDOA 3VKGA 4U02A 4URUR 2WKRA 2PEZA 1DG3A 2KBEA 3GQBA 1TEXA 1ZNXA 3MD0A 1ZD1A 2ATXA 4PAOA 2QZ4A 4GPTA 5CYPA 4B33A 3KTAB 4LY6A 1F60A 4BLPA 5L8VA 4ESHA 2J9RA 1JR3A 3GLGB 3TSZA 1E2EA 5B2ZA 1YZQA 2FJUA 1TU4A 1E1QD 2IYRA 2P67A 2ZUDA 4BRWA 1XP8A 3N2IA 3H4MA 4MKIA 2IS6A 1P73A 2W2VA 1U8AA 3ETLA 3KFXA 3WRYC 1Z6AA 2OXRA 3SDZA 3UXMA 3GMTA 1T5LA 2FE4A 3GLHB 1DAHA 2VLIA 2DWOA 2ZUCA 2QUZA 3W8NA 1XTKA 3LVQE 4R71A 2BKEA 3ZZUA 5BN4A 4F93B 1EFUA 2OBNA 4MDEA 221PA 4LI0A 5F9FA 1Q0UA 1E2GA 521PA 3CNOA 1D2MA 3TGPA 3ASYA 4PAMA 5JRJA 2QAJA 1NVXQ 2VIIA 2XNDA 1SULA 1G20E 1YR9A 3NBXX 1Q57A 4M1SA 1NN1A 1OHHD 4L8GA 1LV7A 5JJIA 2HEIA 4PSKA 2ERXA 1DARA 3KKPA 1KSJA 3VR1A 2ZQ5A 5EP1A 2FFHA 1YU9A 2ZREA 2R6FA 5E7IA 1Z63A 3RABA 4MGYR 4A0GA 3WMEA 2ZSDA 1R5BA 1P61B 4US1R 2ZETA 3OEEA 2WJVA 2JLRA 3W6PA 4EPYA 1MT0A 1XEXA 4HLUC 3NC0C 4TMVA 3UMSA 3MGCA 1DEKA 3SJAA 2CLSA 3KKNA 1SVSA 2KWIA 1P3JA 5BN3A 1KK2A 1XMVA 2XTNA 1D9ZA 3BERA 2HJGA 5JWHA 2FPMA 4DIDA 4Q4JB 4TLEA 1NLZA 4IVQA 3N2EA 2WJYA 4Q00A 1VHTA 3DM5A 2ZRDA 3UMRA 3NTUA 4EPWA 3P4YA 1KO5A 5CM8B 3ONWA 3LAWA 3CNNA 3AUXA 4Z51A 1I2DA 2NPIA 1XMIA 4RD2A 1XTQA 4N0DA 4F4IA 4FCWA 2Q3FA 2BBSA 2PH1A 1ZW6A 2ZE6A 2MMCA 2BJVA 3B9PA 1TPZA 1OSNA 2GJSA 4LBYA 2V55B 1NLYA 3EZ6A 4EJSB 5LB2A 2O8BB 3EPHA 4Z1MD 3DZDA 1UPTA 3BOSA 1Z2CA 4B75A 1NMZA 4B2IA 4ZDJA 3SS8A 1KGDA 1KI7A 1W4AA 1A2KC 1R0XA 1Q1QA 3FFBA 4DLVA 4PPQA 3L0OA 1ZIOA 4B3CA 1ZM2A 3ND9A 1EFRA 2AL7A 2GJ8A 1GILA 4A6XA 4B76A 1P2SA 3K53A 4L9WA 2P6RA 3R9IA 5E3HA 1W36D 4NYMR 5FPSA 4AI6A 2BM1A 3U3KA 4Q7JB 5E7JA 4V0MA 3U60B 1II8A 2AX4A 3CRMA 5D3MA 5L3QA 3SU8A 1FPMA 5FOUA 1HH4A 2BIFA 1QRAA 2HF9A 4D81A 4TMZA 3OESA 4JLBA 3I73A 4JLAA 3LX8A 2GVDC 1KSHA 3EZ7A 4JKYA 5KDDA 2EWVA 4TLBA 2UZIR 2KE5A 3RRNA 3ZH9B 1KKMA 2JLWA 4NCHA 2HT1A 1RVDA 3QEJA 2CBZA 1XJ0A 1W1WA 1MRNA 1XX6A 4RFSB 1Z2AA 2WIAA 1N6HA 3RRMA 4GOJA 4POAA 1M8PA 4GOKA 3BJIC 3KJGA 1XU4A 4WVFA 421PA 3BXZA 1HUQA 4IRUB 1W36C 3P27A 2B7BA 5JWRA 2JAQA 5CK5A 2J1LA 1L2TA 2AFHE 3VR4A 5L3SB 1U94A 4LYFA 2ODWA 1COWA 4HSEA 3REFA 3IEVA 3SQWA 4JBWA 1RYHA 1Q3HA 2XJ9A 4IFEA 4PC1A 4F92B 5G41A 3D7MA 1G7RA 3U44A 3FDIA 2WHXA 3LBNA 2QMEA 1A4RA 1R0YA 2IYLD 2AK2A 4EQ6B 2NOAA 4FCTA 3OFNA 3I92A 621PA 3J81k 5FUWA 2H16A 5SZHB 1TEVA 1I4LD 2ZRMA 1NBME 1SKQA 2IS2A 3U3OA 3TSWA 3GJ6A 4KAXA 1NSFA 3W8RA 3ZVMA 2N42A 4C9BA 3RRYA 2QM7A 1M1YE 1JPJA 1Y63A 2EW1A 2HLDD 1XD9A 4D82A 5EP4A 1JJ7A 4C0AC 3QXXA 3CF6R 1NVVR 5JBQA 2QGNA 3T15A 1IXZA 3B1ZA 2WMOB 3MWYW 1XTRA 5CITA 4BPBA 4XTRA 3ADDA 1OIWA 3IPXA 1NJGA 1U98A 1G7TA 3TK1A 2IEYA 3O8DA 2MSEB 3CIOA 4R7ZA 2YKGA 3X1WA 5EE9A 4QFMA 3FOZA 4OL0A 3PJRA 1R5NA 2VP6A 4TLCA 2VHUA 2J7KA 2R6CA 2IW3A 3A1WA 1S2MA 4NPHA 3HU3A 2QORA 3X1ZA 1JR6A 5JMTA 1OJLA 2V1XA 3LWNA 4Q01A 3UWOA 3KB2A 4RKEA 4DDTA 1WBBA 4B43A 1KI6A 1IM2A 1JXMA 2I1VB 2VHCA 1NY6A 4PHGA 1X3SA 1JAHA 3AVUA 1NRJB 4MRSA 4QGAA 1CRQA 1IAQA 4B48A 3ZZ0A 2MSDB 5CK4A 3K70D 1OLOA 1OW3B 4OJKA 2QAGC 2CHGA 1JQLB 3GJ7A 2XAUA 3D8BA 1OPXA 3NBYC 5HCNA 4KFTA 3FB4A 2RAPA 5CM9C 2Q6TA 1FMJA 2XTZA 4OQNA 2QBYA 4WZ6A 1KI8A 1KZGB 4LSGA 4UQOA 1CU1A 1YZGA 1ZNWA 3OF5A 3ZVLA 5JRZA 4MYTA 4F91B 3CX6A 2ORIA 1MO6A 3GP8A 2YC2C 2QMOA 2V7QD 4ZCMA 3EPKA 3SFZA 2ZR0A 4PZYA 2CJWA 3CZPA 4AD8A 5L3VA 2H5EA 4MKGA 2BMEA 4N1AA 5JHGB 4M9QA 3O8RA 2B8TA 1GSIA 1BO6A 3OHMA 4B35A 2IHBA 1IXSB 2A5YB 1S8FA 2FG5A 5AWFC 1GOTA 4LUCA 1UBEA 2IUUA 4W5JA 2UZ3A 2REBA 1OKKA 5HR5A 1KNQA 1X8LA 3IILA 3KKQA 3B1XA 2AR7A 4M1YA 3OEHA 1F2TA 2WVJA 1UFQA 1E9AA 2QAGA 4QHYA 1E2NA 3EIQA 4EJSC 5GVRA 2GNOA 4L16A 4O2RA 5CJ2A 1G3MA 5TDHA 4M1MA 5B30A 2P6UA 5JI3E 3VU9B 4TLAA 1KK0A 2JLVA 1S3GA 2EFHB 3K0SA 2XNDD 1ZBDA 3B78A 5JECA 1GRRA 3I3SR 4B74A 1AZTA 1QHXA 4X8MA 3RS2A 3VNVA 4YMWA 2WSSA 3LW7A 1XXHE 4URXR 1CF4A 2NG1A 2VP9A 4QBIA 3WBJA 1ZINA 5DI9A 3X1YA 4XWAA 3WP1B 4GSYA 1KO8A 4JYBA 5DYIA 1D9XA 2C78A 4MRNA 3DVLA 4HLCA 4JLJA 4BFYA 3TUIC 3IHLA 3NHAA 5FOXA 4LOAA 2CVHA 3CR8A 4TL6A 1KOFA 5EXXA 5KTYA 2AKAB 4Q47A 1LB1B 1QZXA 3NDBB 2PLRA 2CK3A 4GFDA 1S1CA 4C4PA 1KI3A 5IT5A 4WW0A 3ZVNA 4PHHA 1NVVQ 4KV9A 3CRQA 3THXA 3CW2A 3VNUA 2X19A 4JT2A 3QPUA 5HCIA 1DAKA 4TQAA 3K0AB 1JECA 4FMBB 4MRRA 2IEZA 2BMDA 4UNPA 1DTSA 3I8SA 1W2HA 4EKDA 1XCPA 5D3MB 2GCNA 1LTQA 1YR7A 4KSBA 3HU1A 3OZXA 1W4CA 5FBQB 3EPLA 3KXLA 1VG1A 1WA5A 4M21A 1PJRA 2BJWA 5LB4A 4BFVA 4UNRA 1RW4A 3AP1A 1DADA 1N6OA 4OHWA 5JS8A 1KMQA 1R6BX 1ZD8A 2DYKA 1XTJA 2RH5A 5GJVC 4QGGA 5FL7A 3EX7C 1E2DA 1HE8B 1YHNA 3U3JA 3SEAA 3DOFA 3U5ZB 5DE3A 5AUPB 5K8IA 4CEJA 1KJYA 1EFRD 3I4LA 4LHVA 4PO8A 3QPWA 4ERNA 3THOA 3R20A 1WRBA 2JJ1A 2ZJ8A 4A6PA 3CRRA 1C4OA 1ZMXA 3HR8A 3PENA 4E5UA 2WWIA 4Q7LA 5CLLA 1XB2A 1R8SA 2DHRA 1PLKA 3K0CC 4ZCLA 4EUNA 4JMPA 1KAOA 3N5CA 3IKJA 4NONA 5FTKA 5EE3A 2IL1A 1CTQA 2EYQA 1G7SA 2GJ9A 4LBWA 3DL0A 1UDXA 1DAFA 4IDHA 4S2EA 2IYVA 1R10A 1SXJA 1VDZA 1XD8A 2ODBA 3IIMA 4LJYA 3EA5A 3FMOB 4KJZA 2H57A 4HB2A 4C0QC 3H86A 1ESNA 4B2PA 1VG8A 4Z1MA 2YOFA 3KTAA 1HYQA 3MWJA 3WMGA 4EQ6A 4RD0A 3MJHA 2ZJ2A 1G5TA 1E9DA 1RRFA 4ZKEA 2IYTA 1T5IA 1OXTA 3SFVA 4ACBA 4A2PA 1AKEA 4CEHB 1JBKA 4Q03A 1GVNB 5DI3B 4FD2A 2Y8EA 2JLQA 2FEOA 3CNLA 4IOMA 1VECA 1MO3A 2ODNA 1X1RA 4HI0E 3BAFA 3WMFA 4Q9IA 2NMVA 2NPFA 4HUQA 1IONA 4AKIA 1DBSA 4URZR 1WMSA 3TLXA 4QXAA 5J4YA 5JSZA 1UJ2A 1DO2A 4QC2A 4FMDB 3IQXA 4GI7A 2F1IA 2IWRA 1W36B 1IXRC 3O47A 3T06B 3U7FB 2PJZA 4M9SA 4D25A 4DLYA 4MDFA 4ZIRA 2R65A 1QHGA 1WDTA 2DFTA 2QTHA 3IGFA 2ZRJA 4R98A 1Z0IA 1G16A 4XWOA 4YXWD 1XMSA 2ZJOA 3LBIA 4ZDKA 4B3BA 3GLIE 4DB4A 3DEFA 4OHZA 1FP6A 1U90A 1E0SA 4Q9HA 2G3YA 1N6PA 3V4RA 3PUWA 2V7QA 4D0NA 4HAZA 2KJQA 2YZ2A 1XEXB 4OHYA 3QE0A 1SKYB 3C41J 3OAAD 5G53C 5LDDC 4TMKA 1T8UA 4HAWA 3ZS9A 3FE2A 3QNUA 4IHQA 3GLFE 2IT1A 4WIAA 2QA5A 1RRPA 3SNHA 3HDTA 1Q22A 3P26A 1TF2A 1OH8A 2OEPA 2WOJA 1SVLA 4FMCF 4QG7A 5AJZA 3W6NA 3BIFA 1FOEB 5JEDA 2HF8A 2V54A 4I1SA 4KYUA 3EPJA 2AWOA 3TVDA 2PX3A 2WWWA 4DEYA 4KVAA 3TRFA 1XBTA 2YOHA 2XGJA 4Q9KA 3TUZC 2W0MA 5G40A 3JVVA 1TQ4A 4A0FA 2IYUA 1NF3A 1O3YA 1FP7A 3GJ0A 2QU8A 3IO5A 2HLDA 2A5GA 3KFVA 3RAPR 4G5GA 2IA5A 4KU4A 4P4SB 4XD7A 1MO5A 4TTPA 2HJVA 2DR3A 3C5HA 3B60A 4HDCA 3TUJC 1J2JA 4S35A 1R5OA 1VCMA 2GCOA 4E07A 1GKIA 1OIXA 2W6JA 3GJ4A 4PC6A 721PA 4HAYA 1E4VA 3AVVA 1IJFA 3EWSA 4R9UC 2YJTD 3FMIA 3SYNA 3A1VA 2QAGB 2C2HA 1N6KA 3PUYA 2YNMA 5H68A 2PZFA 1MOZA 3MWLA 4FXPA 4X8OA 1HE1C 1OH5A 2GJKA 4CEHA 2GESA 4Q1EA 3T5GA 1Z0JA 2C9YA 3CRVA 2ZU0C 1P9NA 4PZLA 2ZVPX 3T34A 2PMDA 2Z6VA 2C03A 1UBCA 3AGQA 3R7WA 3SHWA 1JQJC 4A8JC 1SXJE 1CJUC 1Z6TA 3HWSA 4LJ4A 1JAIA 2ZSEA 5KDOA 4W5HA 2IF2A 1Q3TA 4O0MA 5AJXA 5DIFA 5DHFA 5GJCA 3BS4A 2R8RA 1T4GA 4WZAE 1C1YA 1Z0DA 5FI1B 4ZI2A 5JSZB 1Z0AA 1ZC3A 2ZRAA 5EE0A 2XZPA 2ZANA 1W44A 4HB4A 1FX0A 3K0FA 3PXGA 1R8QA 1QBKC 2NO0A 5IF9A 1YVDA 4RSGA 3U7GA 2C8VA 3ADKA 2QBYB 2AD5A 2WWFA 4RZXA 1SQ5A 3REGA 2R6GA 1RJ9B 2P3SA 3BD9A 4D4JA 4D80A 5JWOA 5KSYA 4RD4A 3QKRB 4UXJA 3DZ8A 3F0TA 5AUQA 2OM2A 1RPZA 5EP3A 1A2BA 4LDJA 4C0HA 2GEVA 2QP4A 4A15A 4M53A 3PQCA 1FL9A 2GCOB 4RVCA 1WB9A 1F2UB 2QT0A 1E2FA 2F1RA 2GILA 2NTYC 3MRSA 3NBFA 2WM9B 3PITA 1X1SA 2HXSA 2PL3A 4KFSA 3W5JA 1CR0A 2ZE5A 4YMVA 1P9WA 1Q21A 4OQMA 3QF7A 4XJXA 3WYAA 5BW8A 3FVQA 2UKDA 1SXJD 2FF7A 1Z5ZA 1T3LA 3LLUA 1G3UA 5J4VA 3EIEA 4TZ6A 5KNDA 1OB2A 1KK3A 1G4AE 2F6RA 1PZNA 4C30A 2PEYA 2IUSA 1GZSA 1S0UA 2O0JA 2PT5A 2B21A 3NH6A 4Q4HB 1Q1ZA 4TL9A 4BEBA 1F48A 3BFVA 2JJ8A 3ADCA 3RWMB 5EZ6B 5J47A 1N6IA 1NNEA 4IDQA 3VTKA 3F5FA 1TAGA 4Q1DA 4JLDA 2IYWA 2VF7A 1FX0B 2F3RA 1KO4A 1W5TA 4TYPA 4EPXA 3IQWA 4B3XA 1OFIA 3DDCA 2QT1A 2GXAA 4V03A 1ZCAA 1E1QA 2ZM5A 1D8TA 3AF0A 3KUDA 3E5HA 3V9PA 3CRW1 2ZITA 5KU1A 1JB1A 1FNNA 4IDNA 4LZZA 4QNMA 1W47A 1W0KA 4AKGA 3RS4A 4F38A 2OV2A 1E2MA 3QUSA 3GJ3A 1ETUA 4M0LA 3IBYA 4HDOB 2CDNA 3MCAA 3RSLA 5KNCA 3T1QA 2RMKA 4MYCA 4RCZA 3KUCA 4DSOA 3ZD6A 3R8FA 2GXQA 3QXJA 4DT1A 1GNPA 3UWKA 3QF4B 5C2JB 3KJEA 3THXB 1E94E 1XJQA 4PSAA 5HE9A 1ZRHA 4WA7A 3LVRE 4CF7A 4BZQA 2WWXA 2ZYVX 3ICQB 1IY0A 4HATA 3VQTA 1KJZA 2AHOA 3T5DA 3GLIA 2XOKD 3BORA 4OI4A 3CF0A 5AJVB 3E2IA 4A9AA 3T12A 1IJEA 4DIEA 3KQUA 3LDAA 3QBTA 1E9BA 1E2JA 2ZS8A 1AJEA 2BMJA 2QY9A 1G19A 5EXPA 4GBMA 2ECKA 5TMPA 2ZI6A 3K1JA 3CX8A 4BLRA 4CZ2A 2IBMA 2OT3B 2OAQ1 4JKIA 2IC5A 2EFEB 1ZP6A 1ELOA 2WAXA 1U8ZA 2JASA 4DKXA 2RGNA 4FN5A 5HZHA 3EZ9A 3K0FB 3ZDQA 4QBGB 3H0KA 4JL5A 2XSZD 1D2NA 3K0CA 5UKDA 2QRNA 2ZRGA 3B1YA 1VCOA 1A82A 1P2TA 2FWRA 4EFNA 3Q3JB 4NCIA 2CLCX 1XPOA 3K0EA 3QVUA 1ZD9A 2WWHA 3PUXA 2GXUA 2PBRA 4AIIA 2XTMA 2NO1A 3OIUA 4D6PA 1XNJA 3SI7A 4C3ZA 4PHTA 5FOVA 2JLXA 2V1UA 1M7GA 5DSZA 1KMHB 2HYDA 4JVMA 4Q21A 4A82A 2CCKA 3AVOA 4PPNA 5C18A 3K09A 1OIVA 3LO5A 4HZUB 5HPYB 4BFUA 2JA1A 4BWYA 3KKMA 2QENA 1YQTA 4HZIA 4CRWB 2VEDA 1CJMA 3GLIB 2MMGA 3K9LA 4TL7A 4ZPXA 2W6JD 4B3GA 3F8TA 2G83A 3QBVA 1E0JA 4JT4A 5FTLA 2GZDA 3QXSA 3DM9B 4AY2A 4QGHA 1HA3A 1O87A 3HP1A 1B0UA 2ZSAA 3GFTA 3M6AA 4PHFA 4C2TA 3TAUA 4PC3A 3BH7A 1Q44A 1J7KA 2C98A 5AJWA 4US2R 3W34A 2WPDD 1V5WA 4ZDIA 2ZSBA 2A7QA 1J8MF 3W90A 4DRZA 4Z8XA 4BFSA 1GP2A 1GL6A 3AVTA 2GHIA 4RFSA 4GOXA 2J0UB 2YOGA 4MUBA 4JVLA 1HURA 3TJZA 2G9NA 1XZQA 1JPNA 1NY5A 1EK0A 2D2EA 2W83A 1E2QA 3Q72A 3KZ1E 1ZM3A 1IN5A 3AQ4A 1ODFA 4NYIR 2CLDX 4EIWA 4KLZA 3AF4A 1CJVC 1JR3D 5D3QA 3FTQA 2ZRPA 1XCMA 2I4IA 2IYYA 4JYCA 3L0PA 1SVMA 1II0A 3PEWA 3BK7A 3FKQA 3R7WB 4IEEA 1MO4A 1SVIA 1OB5A 4TLDA 1N6LA 2CL7X 2ZE8A 3A8TA 4M1KA 2WWYA 4UJ3A 4AYWA 4IDPA 4NCNA 1UDWA 2WTUA 2QEQA 2OFOA 4KCGA 5JZVA 3TH5A 1G7CA 2FZLA 2FZ4A 3QXCA 4M9XA 2O0KA 3EWAA 1MABB 1YKSA 2B6HA 5EUQB 4FWTA 4B2LA 2AD1A 1XEFA 1DELA 1EGAA 4OK6A 3B9QA 4NCJA 3DPUA 5AUNB 1KJWA 2ZAOA 1DS6A 1Z28A 5EXSA 2JLZA 2VHQA 4URWR 3Q7PA 3VR2A 2FA9A 2J45A 3QKRA 2IYZA 4GNKA 3PUVA 4A0HA 3LRPA 2EYUA 4IOLA 3HPQA 1T91A 1LF5A 3ZZTA 4H9GA 3VHXA 2ZJZA 1FQJA 3KL4A 1E2LA 1XTIA 1E9SA 2XOKA 3NXSA 5EXTA 2DFKB 2ZRIA 3A1UA 3L8YA 5ANRB 4ZDWA 1F2UA 2HUPA 1OXVA 3BE4A 3ADBA 4KITB 3VMFA 2E87A 4XSHA 2FV8A 2XXAA 3R8CA 4BECA 3D6TB 4TQUS 2W58A 4NDZA 2ZI4A 3W5IA 1UKYA 2BBTA 821PA 3S1AB 1AKYA 2GAAA 4G5RA 4HZUA 4JSYA 4DSTA 4XVUA 1XFAA 2OESA 3BB4A 3C5CA 1QDEA 1RFLA 2HCBA 4DCVA 3WYGA 2ZE7A 3CX7A 5HTKA 2JEOA 4DLZA 5AR1A 3R9XA 1GWNA 1P60A 4DBLC 2FX3A 4DCNA 4TYNA 3D31A 4KLNA 1II9A 2YV5A 3A58B 5ELXA 4AURA 4PANA 3THWA 3A4LA 2A5JA 4L5BA 4OBEA 1FUKA 3TBKA 1W49A 3AEZA 3TVTA 4TMTA 3OIWA 2P0EA 1G5RA 1W5SA 1S4QA 2YYZA 2F55A 1XPUA 1B23P 3U61B 3U7HB 3RC8A 4LBVA 4GZLA 2ZYWX 4JLMA 4ZCIA 5DYGA 2RGNC 2F9LA 2BEKA 1XPRA 1DAEA 4Q7KA 1KO1A 3Q7QA 4KVGA 3JZAA 3QXHA 4QJ5A 4LHWA 5FPYA 3RSOA 2F1JA 3I61A 4A2WA 3THYA 1M2OB 1TF7A 4YDSA 1L4YA 5TVKA 5JFGA 4CGZA 3ZIAD 1N0VC 2OAP1 2O8DA 1G3RA 1N5IA 4IXMA 5FOSA 4LYHA 4R2IA 3U4QA 5EP2A 1BMFA 3GLFB 1G6OA 1F2TB 1Z47A 4XOIA 4Y0AA 3AKDA 2ZXUA 3CBQA 2XZLA 4AKEA 1JI0A 5DISB 3WNCA 4XH9B 1W0KD 2GF0A 4OHVA 5IK2A 4IXNA 1R4AA 1YZTA 4C0BA 3EXAA 1DVRA 2ATVA 2NO6A 2QROA 2W2TA 2WJGA 2ZRBA 3EZ2A 4V0NA 5J5CA 5SZIA 2DCUA 1S1MA 1W7AA 1A5TA 4KBFA 5F98A 4HDQB 1S9HA 4YQFA 2O8CA 1W46A 4LBZA 4DLWA 1U81A 1UBGA 3CZQA 2FEMA 4Q4HA 2QRZA 3IUYA 5DLQC 1NIPA 3U44B 3AKEA 5C4MA 2GK6A 3CPHA 4RFVA 1KDRA 2H92A 5AK0A 4MGZR 5FL3A 1E79A 1G64A 2ZS9A 4U5XA 1ZYUA 1UADA 4A92A 1E1RA 4XWKA 4M1TA 1Z6GA 2X1VA 1M6NA 3PUZA 1NBMA 1NJFA 4CW7A 2CVFA 5GADl 1T3HA 1XRJA 3R9WA 1G3IA 2WSSD 3TSOA 1K5GA 3GLHA 4JBXA 4F7WA 2ANBA 3LH5A 1J8YF 3CPEA 5K8TA 4G1UC 1FZQA 2YWGA 3K9NA 1BYIA 2ZIAA 2JGNA 2D2FA 4HLUA 3FPAA 4B32A 2A5FA 4RZ2A 5KPJA 1LY1A 1S9DA 2OXCA 3LX5A 4BFZA 5K8LA 1OKKD 4ITRC 3ZJYA 2IF0A 3B13B 2QN6A 1NL3A 1E32A 2I1QA 3UKDA 4QOSA 3UK6A 4IKEA 4NYIQ 1S96A 4G01B 4II7A 1NMYA 2D06A 3AF2A 1IHUA 2V6JA 2QGZA 1T8TA 3SQXA 4GDFA 3K70B 1SHKA 4G5SA 5FPTA 1PLJA 2AKYA 3FHTA 3MLEA 3PEYA 1VYUA 1KI1A 2WSMA 1H8HD 4OHXA 4BQSA 4KFRA 3BH6A 4AYXA 2Q3HA 3LQQA 4N3NA 4DB2A 2ZYUX 4FMDF 1GIAA 2WJIA 3TQFA 4DSUA 5J4KA 1KSGA 5CDFA 1Z3IX 5HKKD 3RNLA 2RGCA 1EWRA 3LW8A 4LJ5A 2DFNA 3TIFA 3A1SA 2XEXA 5KSZA 3SOPA 4MGIR 2ZPTX 4C0SA 1SXJB 4HLDA 2J0QA 3B2EA 3KKOA 2IS1A 2VP5A 1NI3A 4BEJA 3E70C 2V6IA 4UXHA 2J0UA 1M34E 1NG9A 2I3BA 4JBYA 4RCYA 2NGRA 1R2QA 5EE5B 1YZKA 2G0TA 4TT3A 4LJ9A 1E9EA 4IEIA 4HB0A 3NKVA 2OCYC 1JALA 2ZRLA 2AK3A 2KBFA 4MUAA 5AUOB 4DZZA 5C1BA 1EFTA 5C46F 3QY0A 2JDIA 1LNZA 3FKSA 2CJWB 2EWWA 1HTWA 5FOTA 4BLOA 1FMLA 3TMKA 3NEJA 3PR1A 3AVPA 2FFQA 2N1BA 4Q4AA 4IFBA 2AN9A 1D6JA 4FW9A 2BC9A 1NVWQ 4TYWA 1ZUNB 3EARA 2IHYA 1VYVA 3BC1A 2G6BA 3MMPA 4FMCB 1MV5A 2CL0X 1MR3F 4G0NA 4NBSA 4I1VA 1US8B 2VF8A 1P62B 1EX7A 1W4RA 5E4FA 3SR0A 4RZ3A 2CNWA 3AB3A 4JJKA 4JZKA 4B6FA 4EPRA 1KAGA 4DEXA 3FGNA 1UEJA 3SHFA 4YONB 2ZS7A 3QVVA 1ZC4A 1P5ZB 2RGXA 3GJXC 3ECCA 4LC1A 1XZPA 5BYJA 3LA6A 3LXRA 5B58C 1AS3A 1EFCA 1KDOA 4ASUD 2REOA 3CM0A 1UEIA 5DN6D 2FSHA 1LFDB 3QF4A 1UAAA 2ZUBA 4QJ4A 2R6DA 4EPTA 2Z5FA 3CKLA 4LPSA 1KY2A 3GCGA 2HYIC 3I1FA 1Z83A 1U9IC 1Z0FA 2J46A 1N0WA 3Q5DA 4PQRA 5FTJA 4B6EA 3VR6A 4XSGA 4NL4H 4LJ6A 5GJWC 1G5PA 1AIPA 4X8LA 2EFGA 1VKJA 2X2EA 2YVUA 5TY0A 4M4SA 5JCZA 4AKHA 1FFHA 5SZJA 4PPGA 4NE2A 2LWIA 3K70C 3DHWC 3JVUA 1GG2A 4K46A 2ZRCA 3U7EB 3CB4A 1ONBA 1EXMA 4A4DA 1AS2A 4NZYA 1N25A 4MRVA 4C0JA 2GVZC 6Q21A 3P1JA 4BLTA 1AK2A 1E79D 2H18A 5L3SA 2GKSA 3VAAA 1Q12A 1H8ED 1VHLA 1Q20A 3G5UA 4CT4B 2VA8A 1YRBA 3CH5A 1KTVA 2O5VA 2A30A 3EZFA 3LXXA 4V0KA 4DDWA 4BFTA 3BRWD 4UJ5A 3KQHA 1UKZA 1OE0A 2OSBA 3P4XA 3A1TA 3A4MA 4URYR 5BXQC 2WJHA 5JLJA 4QL3A 4GT1A 3SYLA 3KQLA 1XTSA 2D62A 1QHIA 3QJYA 5FPKA 1I4DD 4P4SA 4RJLA 2JLUA 5LD2C 1XWIA 3P32A 5TV2A 1E4YA 4ZIRB 3NH9A 1TQ6A 5CLQA 1PLLA 2C9CA 5A4JA 3FHCB 4IVRA 4RY2A 3TW8B 4A2QA 1P2UA 3WBKA 1E9CA 4HAUA 4JLVA 5KSPA 3KQNA 2CCGA 2VYFA 1PV4A 1MH1A 5JCPA 1TF5A 3K0AA 3UPUA 2OCPA 1KMHA 5JS7A 4P32A 1AN0A 2ORVA 1GL7A 2G88A 4I1UA 1K5DA 3WNBA 4HLQB 4B73A 1ZU4A 2JATA 2C5LA 4BLQA 1HQCA 2BV3A 3U6BA 1U99A 2ZRNA 3C8UA 2WJJA 1Z8FA 1OXSC 3QKTA 2QMUA 3C14C 3IPYA 4EPVA 1QHSA 2VP2A 2N46A 1F3OA 3MFYA 4YMUA 1QG2A 5JI2E 3K8YA 3HPRA 2J3EA 2ODEA 2CHVA 4YMTA 2IYSA 2DWQA 3EASA 4BUJA 3VKHA 3VHLB 5FUYA 5FTNA 4A8JA 3GD7A 1KI6B 5FFMA 4Q7MB 4CEJB 5LBIA 1N3BA 4KODA 2ZI5A 3QIAA 3TW4A 4IW3B 2JJ1D 3W9YA 5F9HA 2ONKA 4DUGD 1H65A 3IBGA 4LWZA 2LCFA 1AQYA 4OI1A 4D0GA 1HT2E 4EAQA 3TNFA 1X8KA 2BWJA 2BVNA 3BFKA 3SJBA 1HT1E 1DOAA 4GMXA 3CONA 4WXRA 1KK1A 5FOWA 4Q1CA 5EE1A 2VP0A 4Q9JA 3SN6A 4ZKDA 3A6PC 3VFDA 3AVWA 2V9PA 5HE8A 4EFLA 1W0JA 1ZJ6A 4L4UA 3MAAC 2R62A 1GM5A 2GRJA 1KDPA 2GWHA 1U0JA 3HJNA 3HYTA 1GUAA 2Q0HA 3NEYA 3K9HA 2EU8A 3G82C 4PZZA 2PMKA 4B3FX 5HKKA 5BWMA 4XTCS 3UIEA 1BIFA 1R7RA 1E98A 3IIJA 3IO3A 2O8BA 4G3XA 2A3RA 1XF9A 1Z07A 4LC0A 1GTVA 3RWOA 3AP3A 2GCPA 2LKCA 2V8OA 5G3YA 3NIBA 4BRUA 4DWJA 1F5NA 1KKLA 4ABYA 5DI3A 2OHFA 3QG1A 1OH6A 3TE6A 1KSFX 5E7MA 1OYYA 4ZI3A 3RS3A 1UBFA 4LHYA 2Q9AA 4TT3D 1Q1EA 4OK3A 3LLMA 4HAVA 3AGPA 3LY5A 3V4FA 1GNQA 2RKOA 3U6KA 1IN7A 4Q66C 1DG1G 1OT3A 4TYYA 2G0NA 2GA8A 2PJRA 1BKDR 4A36A 4CVNA 3DMNA 4E09A 2IK8A 2ZVQX 1WBDA 2PZEA 2QP3A 3ZVRA 4LRWA 4OJQA 3QEOA 4TSFD 2IXEA 5H8WA 2D3WA 4J0QA 3WRXC 4M8NE 2C96A 1RE0A 5JHHB 5KPDA 2VH5R 3F3YA 2VP4A 4Q4LA 5CB6A 5GJBA 1L8QA 2PCJA 1LS1A 1WQ1R 4X8HA 1YJ5A 2HDNB 4TTRA 1VCIA 2C99A 2B8WA 1EG7A 1VIAA 4LJ8A 4CT5A 1NN5A 2W0SA 4MRPA 4H1VA 3WXMA 5IDVA 3IEUA 4W5WA 4JSTA 5CIQA 4BZPA 3AVYA 3SE0A 3BH0A 4NHOA 4P0TA 1E1RD 3QPVA 4PPFA 1N5KA 1R0WA 3IDQA 1OFTA 1M7HA 2FFBA 4CYMA 4PQFA 5B57C 3I5YA 4C2UA 1Z08A 4E03A 4PC2A 1VCNA 3HYRA 3PCRB 4TMXA 3BWDD 2RGBA 3ZD7A 4QBFA 3PV0A 4KI0A 1QVRA 4JLOA 4W7SA 4F4CA 3FMFA 1T9HA 2QM8A 1K8RA 1E3MA 1NKSA 3BGWA 2PZGA 4G5OA 3CWQA 4O25A 1N5LA 1DO0A 2QMHA 1IBRA 2VHJA 2WKQA 4LHXA 4BLSA 1T6NA 2TMKA 3FMPB 3THWB 1ZCBA 2O0HA 3G0HA 1G1MA 2QSYA 1XD2B 2FGJA 1W48A 1N6RA 1EFHA 2FGKA 1P2VA 1KYIA 3AVXA 2JDID 3KB1A 4V0LA 5L3RA 2PT7A 4NU0A 1WE2A 1X6VA 2C9OA 5EJEA 3MSXA 1H8HA 3LV8A 2GK7A 1U0HC 4DXAA 4G5QA 1J70A 2OLKA 2XB2A 1OH7A 4JS0A 3U3RA 5J4LA 4A8JB 4M9ZA 4D4KA 1ESMA 4P31A 1G8FA 2OO7A 1AA9A 1CULC 3DO6A 3QKUA 2WBLC 2LKDA 1MRSA 3E1SA 2J7PA 1KNXA 1NSTA 3U4QB 4OQLA 4LGMA 3THYB 2G77B 4DVGA 2K5UA 4IJMA 4JL8A 3AF1A 3DKPA 3PIRA 2X2FA 2XZOA 3WNDA 5A0FA 1N0UA 3MG9A 2RHMA 4QBHA 2Q21A 3PG5A 5KO2A 4FCVA 1HQYE 1CXZA 4IVPA 2YHSA 4MITA 1ZAKA 4PSVA 1Z29A 3TAHA 3RDPA 3WHLA 2GDJA 1DE0A 2OFWA 4GL2A 1ZVQA 2D7CA 4ZV4A 2YWFA 3O8CA 3KX2A 1GAJA 3OFND 1TTTA 4W9MC 2D7DA 3WP0A 5BN5A 2FDCA 2H8KA 4U00A 2Q9CA 2OLJA 2FSGA 1L7VC 2WIBA 4AYTA 2CCJA 2WKPA 4GP7A 2O52A 1QG4A 3I5XA 1E0AA 4OK5A 1RRCA 3B1VA 1XJCA 3LD9A 3NDPA 5DH9A 3K9GA 2BOVA 3AV0B 1Z6XA 1CS4C 2GZHA 4BASA 4Q4JA 3W3ZB 4MQBA 3ZYCA 1T0HB 3D3QA 4ZO4A 4A1FA 1GDDA 3SBDA 2VQSA 2VO1A 1KY3A 1FW6A 2CNWD 4Q02A 2FH5B 5KUTA 1NVUQ 1Z0KA 2ZYTX 4MH0R 1NLFA 1H8EA 5TARA 3GEHA 1QHHB 2O8EA 2Z0MA 4URVR 2IUTA 2HV8A 4JL6A 2F1HA 5E95A 4L15A 1YR6A 3QQ5A 2YWEA 5J40A 2ZAMA 1JEEA 1TADA 4OKSA 4H1UA 3EA0A 3EC1A 2EFDB 3QSYA 2GEUA 4KXFB 2AFIE 1YZLA 3L2OB 3A4NA 2O8DB 5CB8A 3ZQ6A 3FHOA 1DAIA 3BB3A 4ACAA 4DSNA 4M22A 2GTPA 3PEUA 4LHZA 3RLFA 2GETA 4MGKR 1P6XA 5A5GA 3OIVA 2YC4C 1KHTA 4HEJA 4JJZA 4PC7A 4QKQA 2NQ2C 4KSCA 4HUTA 1TX4B 1YR8A 4K81B 4C0KA 2X8AA 1KIMA 4CEIA 4C7OB 3SC3A 2BKUA 3BB1A 1JXOA 4UNNA 5JJLA 4RD6A 4AG6A 3IIKA 4N0EA 1MKYA 4NMMA 4PXAA 4IOKA 5AJYA 2OCAA 4QM6A 1J99A 4LPKA 3WY9A 2V4ZA 2SHKA 3CO5A 1II8B 2GEDA 4IOJA 1CEEA 2WICA 2WMNB 4BFWA 3JZMA 5H70A 4TWZA 4XVRA 5GVSA 1ZIPA 3M1IA 1TUEA 2ZI9A 1GNRA 5KOYA 1COWD 1WCV1 3I32A 1P9RA 5FUXA 1KZ7B 3GJ5A 2Q3MA 1ZM4A 1TU3A 2QE7A 4D26A 1QF9A 3L82B 4QHSA 2DB3A 2O8EB 4V0ME 2VTKA 3RRZA 1P7CA 2JJ2D 2GAOA 4B44A 2RGGA 4I99A 2ZRHA 1SVOA 4V02A 2IYQA 4RKFA 4Q1AA 3GLGE 3M4YA 2NIPA 3L0IB 2WV9A 1NN0A 2P5TB 2XXAB 2BHRA 1E96A 1BH2A 4QNRA 1PUJA 2RHDA 4PQYA 2BCJQ 1SHZA 3SJCA 5CDFE 4MKHA 3SJZA 1E9RA 1HEIA 2QQEA 5KSOA 1ZM7A 1NP6A 2X77A 4CEIB 2DWPA 1KI9A 5FUVA 2ZSFA 1G8GA 1TNDA 4P4UA 4DCSA 2ASEA 2FMXA 5DHAA 4HB3A 2OUKA 3X1XA 3LNCA 2Z4RA 4C7OA 2J7PD 3CWZA 4JLNA 2FPLA 2ZR7A 1UKEA 3ZQJA 4LV6A 2ZRKA 1C9KA 5LPNA 1Q1BA 2EQBA 3AKYA 4CDGA 1NN3A 1GRQA 1N2CE 4DUGA 1QVAA 4M2LA 3MWKA 4Q9LA 2XJ4A 1KDTA 2QPAA 2F43B 4Q1FA 3KXKA 1N5JA 1VYTA 4EFMA 5K8UA 4PTLA 2DBYA 2NZ8A 1XEWY 4P33A 1EX6A 1P4SA 2FPKA 1LW7A 3GLHE 2QG6A 4NH0A 4PR0A 1ZNYA 2V3CC 2H7VA 1OXUA 2E9SA 3CR7A 4ARZB 3AH8A 4MYHA 4NCKA 4PO1A 3OEHD 5BYKA 3M0EA 1PVOA 2CE2X 2CHQA 2ZJBA 1YZNA 2PCLA 2EVWX 4DCUA 3ND8A 1JJVA 4DLRA 1BYUA 5JEEA 1E6CA 5CYOA 4RZUA 2KB0A 4QM7A 1OYWA 1VMAA 1X86B 4TZ0A 1E69A 1QHYA 4DCTA 3AP2A 1RKBA 1CR4A 2P2LA 5F2EA 1ZUIA 2A5DA 4FI3C 4GP6A 4KHZA 4QJ3A 4O3MA 3LFUA 5C4GB 1XXHA 1XD2A 5FH9A 4DLTA 2F3TA 3OE7A 2A9KA 5EUMA 2IXGA 3B5JA 4NYJQ 1E2IA 1ZU5A 4PFSA 2ZTSA 1AGPA 4ILEA 4D4MA 1CLUA 1US8A 2O8CB 1U8YA 2VPPA 2WPDA 4Q1BA 3RS7A 1HV8A 4TSFA 4RD3A 2XITA 1AGRA 2RB4A 2L0XA 2HCJB 4CIDA 3L43A 1N6NA 1BS1A 5HZKA 2QL6A 2OCBA 1FQKA 2HT6A 2P65A 1IY2A 1DAGA 1XMJA 1M7BA 1TL7C 5FBVB 3T1TA 3SZRA 2UVQA 3B8HA 2NO9A 4XVQA 1XDBA 3RVBA 1E2KA 4I81A 4B34A 2MSCB 2JIZD 1VG9B 4LYJA 4TMWA 1G8PA 1R0ZA 5KNBA 1L4UA 1LS6A 2RGEA 4YC7A 2Q9BA 4YXWA 5IHPA 4BE7B 1FTNA 4OQXA 2QI9C 3KJHA 4C0LA 5CIWA 1G6HA 2RGAA 4D0LB 3EG5A 3GLGA 1BMFD 4AK9A 2F7SA 1V43A 3LBHA 4DHEA 1FNMA 1OF1A 3BFXA 3MJRA 1G9XA 4GZMA 1YE8A 3TQCA 4DT1B 4FWIB 5FL7D 4BZXA 2C95A 2YWHA 4OQFA 1NIJA 1NG1A 3I8XA 1JNYA 2QE7D 5IK2D 2J5XA 3GEIA 5TB5A 2CK3D 2ZRFA 3S1AA 5M04A 1GRNA 1DAMA 3Q85A 1PUIA 2WZQA 2FSIA 1U2RA 1TUIA 1AS0A 2BMFA 2GBLA 5P21A 5TXGA 4LV8B 1WP9A 4LYAA 4Z8YA 1G17A 2QP9X 2ORWA 4PX9A 4R2HA 1CKEA 2GXSA 3U2QA 2A2ZA 1VG0B 4DC9A 2AWNA 3B85A 3H2YA 3GFOA 1YRAA 4AWXA 1GKUB 2R6AA 4EDHA 1ZNZA 1U9IA 3ZLJA 5J4HA 3I72A 2Z43A 3C4JA 2ZEJA 5BQ5A 1NBMD 4WAUA 1XCGB 1XEWX 1CJTC 2BBWA 4XIGS 1SZPA 3EIHA 3FWYA 4OI2A 4YDHB 2YINC 2J59A 3WHKA 1EWQA 1RIFA 4I4LA 2OG2A 4LV5B 1CRPA 3L8ZA 2ZI7A 1IOZA 1T0JB 1Z06A 3ZIAA 4TN1A 1ANKA 1E2PA 3NHBA 2R2AA 4Y0VA 1OXXK 1VTKA 3B82A 2VSOA 2EFCB 2DPXA 4JVNA 3RYTC 5KYKA 2DFLA 5EZ5A 1KO7A 2IS4A 5DO9A 5FI0B 3DKVA 2IWHA 1W4BA 1XXHB 5IRCD 5F3WB 4Q19A 3X2SA 1A7JA 121PA 1AQUA 4M1OA 3NVAA 4D2IA 4M1WA 1OV4A 2AXNA 3DOEA 4UXIA 1F6BA 3T61A 2PX0A 2CL6X 4QRHA 1J90A 2ZI3A 2ZU6A 2DY1A 2O8FA 2NO7A 2W6IA 1OHHA 1CBUA 1E99A 2ANCA 1T3SA 1G4UR 2OE2A 3BBPA 2FNAA 1UKVY 1AM4D 1TQDA 3H84A 3QKSB 3VX4A 4FINA 5EQTA 3T1OA 5SZKB 4EJSA 2J41A 1K6MA 2GF9A 3CF2A 1NMXA 3GEEA 3QOFA 4PAQA 1P72A 5FR2A 1KI2A 3ZS8A 1X8JA 1P75A 2XNSA 2WOOA 1IN8A 3FFAA 3C15C 1LF0A 4US0R 2C04A 4P3YA 1E2HA 2B7CA 3Q9LA 3KJIA 1IN4A 5FBRB 2OBMA 4QHTA 1RZ3A 1G41A 3SYKA 2QTVB 2NZJA 3GPLA 4WBSA 4Q4AB 3V00A 2JLYA 3PVSA 4FIDA 3UG6A 3B7GA 1TQ2A 2JLSA 2IXFA 4KFUA 2XB4A 2VL7A 4D4LA 4LJAA 1YZUA 3VU9A 4K8OA 4B47A 3VR5A 2VBCA 3W6OA 2JJ2A 4DLXA 5KHOC 2ERYA 3KDSE 3VX3A 1IY1A 3CH4B 1CIPA 2VHTA 4QGFA 2FOLA 2H17A 3K09C 2IYXA 3NWJA 3UMFA 1CR1A 2Z83A 3AVQA 3QI2A 4DDVA 2G1KA 3AUYA 4DLSA 4BFXA 3U3MA 4ON9A 2J0SA 2O8FB 2AXPA 3A37A 4HUQB 1RJ9A 1QHNA 3TR5A 4L9SA 3W3AA 3T1VA 1OFUX 2OFXA 3ASZA 4LJ7A 2G1JA 4KO8A 3L0SA 4B71A 1GL9B 2CEAA 2KI5A 3CLVA 1UM8A 1SVWA 3RC3A 8OHMA 3EC2A 2OBLA 4HYYA 1GITA 3GJ8A 3OIYA 3P20A 3T35A 3B6EA 3NG1A 3Q8XB 4ARZA 2VSFA 3PEVA 1JR3E 2FU5C 1VIYA 1HY3A 1S3SA 2GJAA 3OAAA 4Q5IA 2W2XA 3OEED 3A36A 1SXJC 4GMDA 1VPLA 1EESA 4KBGA 3GFPA 1W2GA 2REXB 4TQ9A 2ZJAA 2BBOA 2OILA 1D2EA 1G3QA 2ZROA 4OI0A 1G291 1KI4A 2B92A 4JLPA 3AKCA 1WF3A 2D4HA 4YLGA 2R44A 4MKFA 3H1TA 2JIZA 2QQ0A 4NTZA 3NBZC 1G18A 1OFHA 3QG5A 4Q48A 4TTQA 3EW9A 4WZBE 5JJKA 1ZUHA 3PFIA 5G3ZA 2OZEA 3TR0A 1MABA 2QPTA 4KYIB 3RANA 5LD2B 4U7DA 4P4TA 5FBWB 3C7KA 3VR3A 4AG5A 3IHWA 4LCBA 1GKYA 3CUEF 4XD7D 4Z54A 3HR7A 3VKWA 3O8BA 4BGDA 1GFIA 4V0OA 4ESVA 5L3QB 1QHHA 1Z6YA 3RS0A 1NKTA 3N70A 2F9MA 1SVKA 2J0VA 3DMDA 1UF9A 1CJKC 3C16C 2ZJYA 3ICEA 3WYFA 1I4TD 1IQPA 1E0KA 3OE7D 4MA4A 4DLUA 4PO9A 2H1LA 1RC8A 4UNSA 2R9VA 1BOFA 2F43A 4WXPA 2E1RA 5B64A 3QKSA 2BEJA 4DDUA 2ONJA 3AM1A 3Q5EA 3RS5A 4B3DA 5DN6A 3FKSD 2P6NA 4NYJR 1E9FA 4MYUA 2VRWA 5KDLA 3NC1C 2IX3A 2RCNA 2QSZA 2JCSA 2QNRA 1ZM9A 5CJPA 1JEDA 2ZR9A 1FTSA 2CXXA 2FN4A 5H1YA 5FR1A 2GZAA 3CPJB 1TMKA 4LX0A 3LQRA 5FPHA 2WAYA 4NYMQ 4WOPA 1D5CA 4UKDA 3RHFA 2W00A 1WXQA 1W0JD 1IN6A 2FSFA 1G8YA 3QENA 2W6ID 3UATA 3X1DA 2J87A
chains in the Genus database with same CATH superfamily
4GRAA 2ICAA 1OREA 1V7QA 4G1VA 3S55A 4H18A 3V5NA 4A0QA 3EAQA 4TV8A 1JLLB 1IZ7A 1QB8A 2BAGA 2OV4A 2Y0DA 3I2YX 4H0FA 3HU2A 3GLQA 1Z22A 2IZOA 4MWOA 2PZMA 4C20A 5BR1A 2ZJ5A 1P8JA 4N6GA 1XNQB 5K0TA 1WUIS 2C3OA 2CMKA 2R751 7ABPA 1DKRA 1PK7A 3GCZA 3F5SA 3DR3A 4C0XA 2F17A 3AHJA 4FDAA 4QUGA 3SBEA 2VSXA 4HV4A 4NKRA 1ISJA 3UG7A 1ODJA 1GKLA 3F2VA 1Y3BE 4AC9A 3UCXA 3RG2A 1DPGA 3BBLA 3F8WA 4WUVA 4DM4A 4ASUA 4RKWA 4RD1A 1RYFA 5KQMA 3AF3A 4H7DA 4O4JB 1WVGA 1G8HA 4HJXA 1U0LA 5DNWA 4EHNA 1HE3A 4F4DA 1CX9B 2N75A 3U1TA 1JYSA 5K0JA 2UYOA 1QQTA 3R5XA 4QYIB 3H5NA 1YMUA 1R6AA 4A0RA 4HSGA 3ZGXA 3IB3A 4HVLA 3PKZA 4R9VA 2ZKIA 5IX8A 1CFZA 1ZQ1A 1RRGA 2NXCA 3DBOB 4IQFA 4TYQA 2BM0A 1DPFA 5JYCA 2R6JA 2BYTA 1Q74A 3N8IA 1B93A 2HHJA 2XKKA 4I4TA 3EUAA 3KQKA 1SGWA 2CXUA 3HP4A 5CB4B 3CF4G 3IVAA 1OAOC 3F3SA 2QD2A 1EHYA 1H6BA 5MHTA 1NGSA 3L7OA 5ITZA 3AFGA 1PL6A 4DW8A 1DG3A 3T3HA 1FFCA 1TEXA 3ZOKA 1UC4B 2ATXA 1C8KA 2QZ4A 4F71A 4M76B 1NW5A 2YHIA 2J9RA 5I7RA 5L8VA 3HZRA 2IH2A 4LGCA 4HNHA 1GGMA 2VHVA 4Y2QA 3DE4X 4J0KA 3FDZB 1U3GA 3FTCA 3PL5A 4FFOA 5CB0A 1YZQA 2FJUA 2FPPB 3SC4A 3FOEC 4Z4IA 3IMEA 1E1QD 2P67A 4WLUA 4BRWA 1BCSB 2PL9A 1BVUA 3EDQA 2PK3A 4UOZA 1P73A 4XPIA 3ETLA 3ODPA 2PGNA 3KFXA 3PI6A 3WRYC 3ZY6A 4IWXA 1ZRNA 5AHRA 3DLPX 1NMSA 1C3LA 4EB0A 4I36A 5IM4F 3GMTA 1C30B 2FE4A 3H97A 1MAWA 3ANYB 4O4HA 2ZUCA 2IBTA 1NF2A 3G7SA 5HKBA 3W8NA 1CRWG 1XTKA 3WTCA 2BKEA 5FYQA 5TPZD 4O2BF 4XGNA 1PQYA 1FTQA 2JFNA 4LI0A 4ZWNA 5CAEA 1Q0UA 521PA 5F9FA 1Z6PA 1QS0A 2PKWA 3OA2A 5GOTA 4EEKA 3ES9A 3TGPA 1BU8A 1ZVMA 3UWPA 4DRYA 2VIIA 1K6EA 1ZN8A 1R4NA 2HA5A 3DGEC 4M0MA 2DFPA 5EQDA 2PSSA 1Q57A 4I7EA 3MMNA 3HBFA 4L8GA 4QUEA 4G4IA 4EARA 1XNRB 5K3FB 4E4YA 1D2AA 2ATCA 2YZGA 3VOBA 3ILVA 3WBBA 1PGPA 1RI5A 4XX0B 5CTJA 1S2LA 1YQQA 2A35A 4R6XA 2B4RO 2WA2A 3DVQX 5KKNB 1QUEA 5I8WA 2WHPA 2ZREA 2ZCVA 1A72A 2R6FA 1IEWA 4MGYR 5GP1A 3SK0A 1CUEA 1QIIA 1RFGE 1XC7A 1KQGA 1R5BA 1P61B 3V97A 1W0CA 1WDWB 2ZETA 1EK6A 3QVLA 4US1R 5EYPA 3W6PA 4EPYA 4PW0A 1O2DA 2G28A 3WIEA 3KEQA 2JFPA 3NHRA 4O2BB 1L5RA 1MEOA 4YLYA 2GNPA 1KVSA 3INYA 4S05A 3NVDA 1UWKA 1XMVA 2OXIA 3X1JA 1N2IA 2XTNA 4TKLA 2OXEA 1HL7A 2E2WA 4Q4JB 1H5QA 1UFKA 3AHHA 4RWZA 3DAYA 2WJYA 5C8YA 1BEEA 1JQBA 1U0TA 3DM5A 4PQGA 8ABPA 4UM9B 5HSGA 1JFFB 3JPYA 4YFYA 3UTCA 3P4YA 4FKBA 5CM8B 1PWXA 3TTSA 5KYWB 3JD4A 1ORVA 3LAWA 5F7JA 1JKJB 2JGIA 3OJXA 1L5FA 1I2DA 1RMYA 1XMIA 1X80B 4MUXA 4RD2A 3WJAA 3VDNB 4X63A 4FCWA 1C7RA 1QZUA 2BBSA 2Q3FA 3H2ZA 2ZE6A 3N8KA 3DFUA 4HQLA 4L8LA 3WYDA 3R0VA 4HGRA 4EM6A 4W5OA 3SF8B 2YJZA 4YPVA 2GJSA 3NHKA 1FBTA 2SKCA 2KLBA 2VT6A 2W9XA 4TV9A 5LB2A 4QYTA 2OB2A 1B41A 1UPTA 1RM3A 1NHWA 4RS3A 4RY0A 2HXGA 1AH2A 1Z62A 1KGDA 3IIIA 3U7RA 1AQNA 3MQFA 1BDMA 1ZWKA 2ISSD 2OR3A 4FOOA 4GVLA 1LC0A 4U0JA 5A7HA 4ZTUB 3RH0A 2GUWA 4GSLA 4L28A 4WBNF 1MGPA 1UPUA 1I9GA 4E2YA 2OG1A 1UZAA 4KQMA 5C1IA 3FUCA 3U7QA 1VYHA 2TS1A 4OXRA 1ZM2A 2YIMA 1IDOA 4RL6A 4UM5A 4ZO6A 5LDGA 3ZWBA 4AZ3A 5ICEA 5K8CA 1SO8A 3BUSA 2YHIB 3GJSA 5H59A 1W581 3R9IA 4NFYA 4NU5A 5J58A 5FPSA 4YUWA 3DO5A 1IQ0A 1XU7A 3U3KA 1JDJA 5E7JA 1BXRB 5J23A 4V0MA 3T9AA 2YDYA 3E82A 1II8A 1C29B 1M34A 2AX4A 3CRMA 1ZOLA 2WZDA 1VOTA 3E3NA 3JD2A 2FPIA 3JQ7B 1HH4A 3QU9A 4X90A 5FOUA 3WLRA 3MJEA 4AP9A 4P0QB 4TMZA 1IRXA 3I73A 2HTFA 3AUTA 2OWDA 3QOWA 4HCJA 3PE4A 4PG6A 3FVTA 4WGGA 2WFLB 4DA8A 821PA 3UMJA 5KVAA 3Q8KA 4N7MA 2PNFA 2HSEA 1FDIA 1QRTA 1ZRMA 4MWSA 5EFZA 2HJWA 4F11A 4KE6A 4YCAA 4IHJB 4UATA 5IXSA 4KRFA 1KKMA 3PTAA 4X3OA 2FW6A 4KDCA 3TFOA 3PDWA 1TKAA 3SXUB 3UMMA 4MQLA 3V4SA 1U7ZA 1XX6A 3A4YA 1AF4A 1FBNA 3V2UA 4RY9A 3OZCA 1C30A 4GOJA 1IZYA 2X3FA 1M8PA 4GR4A 4POAA 4LTDA 1E3TA 3BJIC 5FLKA 3T41A 3ZKAA 5JUWA 4LA4A 4ND8B 4XGIA 1WXFA 4YWJA 3BXZA 4G56A 2RD2A 1A5ZA 1AX9A 1V95A 4MLPA 4Q9DA 5JWRA 1XQWA 5CK5A 4ZAYA 5I7EA 4NBNA 1ZMRA 4R8KA 2Q46A 3R5TA 1HG0A 2Q62A 3EY4A 4G0MA 5FDFA 2C97A 2I4LA 3OCJA 1EDOA 4JBWA 2P27A 2C9BA 1Q3HA 2I6TA 2XJ9A 4CLEA 1KGSA 1Q11A 2JAHA 2VSNA 3JATB 2V0CA 2FZCA 5TNXA 3D7MA 3O38A 4LQCA 1Q14A 2E82A 4LYDA 3HJAA 1BE0A 2IIBA 1A8IA 3NORA 2GPTA 2IYLD 3BAZA 3KOXA 1IQRA 1ULHA 2AK2A 3AEKB 4E1AA 3B3AA 3QV1A 2B9VA 1JLMA 3EJ6A 5CFQA 1ZI9A 3B20A 1TEVA 2QZSA 2R86A 3DDUA 3P2KA 3T7RA 1U6JA 4EYQA 1ENZA 2AOVA 4IUYA 1HXHA 1QWOA 1OI3A 4QPPA 1LU9A 2XBLA 4ZI7B 3L18A 4CLDA 3A31A 4D82A 1JPJA 2HLDD 1YC5A 2RE8A 4G09A 1YB5A 3KT8A 4HDAA 1X9IA 5EP4A 4C0AC 3J81A 1C1DB 1NVVR 2I6UA 4KKXB 4G4JA 1NW9B 3T15A 2JI6A 5LP6F 1JHUA 3DTVB 1SBQA 3D2BA 4XWTA 3CNEA 1W19A 1M0SA 4BPBA 3ADDA 4UBNA 3MAJA 3IPXA 1BQ3A 1NJGA 1U98A 2H1WA 5BT9A 2IEYA 4B4KA 2AG6A 1BSVA 1P6UA 2J3MA 3L4EA 4RHUA 2QUBA 3FOZA 1Q1GA 4QXQA 5CT9A 3PJRA 3O83A 2VHUA 4GM1A 4MUEA 3U4AA 4FCCA 2WU0A 2IW3A 4IMIB 1S2MA 4XCVA 3H6GA 1G5HA 1CQWA 2RBEA 3EGVA 3TCNA 3Q88A 5JMTA 4L2IA 1OJLA 5LNK6 1RZRA 4RKEA 4JP2A 5DGTA 1WBBA 5KKCA 3K5PA 4BGVA 2H06A 4AJNA 3HXOA 1OOEA 4NZZA 2VHCA 1NY6A 3ENZA 4OHOA 4PHGA 4DWOA 1JAHA 3AVUA 1NRJB 2J5RA 4W63A 4QGAA 1V35A 3TZHA 3VAYA 2CL5A 3LWDA 1Q7BA 4C6RA 3QK7A 5JZBA 1EBFA 3U4HA 2MSDB 1ISMA 4CQLA 1OLOA 1PR4A 3K70D 4JJGA 1H0SA 3G0DA 1PT6A 1OW3B 2FCRA 4OJKA 2JLCA 1LWOA 2I78A 4CMCA 1GADO 2CHGA 5EN4A 3GCXA 5BSWA 1FY2A 1ZUNA 3GJ7A 4BMPB 2CB9A 3D8BA 2ZUTA 5JH7A 1OPXA 4OLAA 3NBYC 2AI3A 1AGNA 5HCNA 1Y7TA 2Q28A 4KFTA 2Q7OE 2FWNA 2Y4NA 1ZS9A 2W8BB 3AETA 1KYTA 4YGYA 3VC3A 4QKQA 3JAMA 2IIVA 3C1TA 5CM9C 2Q6TA 2QBYA 4YJGB 1NXOA 1KZGB 4UQOA 1CU1A 4GPEA 1Q5PA 1R0SA 3ZVLA 4MRAA 5JSQA 5JRZA 1GFWA 3CX6A 3QEMB 1A98A 4ND5A 3QLJA 1XYVA 4RJKA 3BRSA 4DVJA 4JYMA 2O2YA 4AD8A 3CINA 5L3VA 1XYYA 1ACJA 3GT7A 4N1AA 3GGJA 4JV5B 1RKQA 2VOEA 1GSIA 3OHMA 3ZZNA 4Y2SA 5IMSA 2IHBA 3TJRA 2A5YB 1OWLA 5HW0A 1K92A 4LUCA 5JY1A 1L5NA 3HGMA 1N3YA 2NZUG 4Y6SA 1OKKA 9MHTA 5G4KB 3TLEA 2MIIA 2QSJA 1FF9A 3IILA 1E18A 3NIFB 4MICA 2F2TA 3BHMA 2AB0A 4RORA 4M1YA 1ZK3A 5CVCA 3OEHA 1C5KA 2OBXA 4NIMA 3GH3A 1UFQA 4PIVA 4UM7A 2G40A 3EIQA 1EWKA 5CVDA 3VSCA 2FUEA 5CCXA 2WU3A 5DGCA 5TQJA 2NU6A 3L9WA 4E6EA 2P6UA 2DAPA 2XYRA 3RUEA 1PTJA 1S3GA 3BWMA 2EFHB 5AICA 1ECJA 1ZBDA 1ZVKA 2ZJ3A 3R76A 3I3SR 1O95A 4B74A 1HLPA 5A62A 3VNVA 2PD3A 3ROFA 5KJEA 2VPQA 2C42A 2P8JA 4C6HA 3QUQA 2YL2A 2YXDA 2VP9A 2PYDA 3AW8A 4QBIA 3SVZA 2XUJA 3FW1A 4GSYA 1CCWA 1YDEA 5ECYA 3VH4A 1I3CA 1LPBB 1UPFA 2VTEA 3QVJA 4G86A 1D9XA 3B52X 4PEVA 2CC2A 4I1RA 5EHIA 4CMEA 4LE0A 2CSXA 1Z18A 4BFYA 4YAUA 4JB3A 4K9DA 5JXIA 3TUIC 3NHAA 3OCWA 3R24A 2BM9A 2IPMA 1J97A 1UMBB 4S2UA 5ICSA 4TL6A 2E21A 3AIKA 3DYVA 1TC1A 1Z5OA 4KO4S 3QEKA 1IDN1 2AKAB 2FPOA 3ME5A 1N7JA 3LXMA 4WLFA 1QTNA 3VZPA 3WRVA 4GFDA 2HSDA 2ROQA 4JUIA 1KI3A 1TB4A 2C5BA 4EUKA 1LUAA 4D9KA 1VJRA 2FPXA 4IQ8A 4PHHA 4L08A 4UFOA 4KV9A 1EEXB 3LPLA 3G79A 3CRQA 3PQ2A 3THXA 3K2QA 3GDHA 3K1YA 3QPUA 1DAKA 1UJBA 3M6LA 3NNDA 4JT2A 4Q9NA 4TQAA 5HCIA 3TW6A 4CM7A 2GD0A 4MRRA 3E3AA 1QYXA 4X6LA 2PY6A 4O1IA 4X24A 1QR6A 3LYHA 4LI3X 1VMEA 3FZEA 5IC5A 3UFBA 3ZDAA 3I8SA 2YJNA 1W2HA 4NZPA 3CPSA 3FGOA 4G0ZA 4M37A 4YUAA 1XCPA 1XPJA 5D3MB 1YR7A 4KSBA 1U0RA 4MWDA 2C0CA 1JG6A 2W5UA 3MAGA 3Q9NA 4A27A 4CQNA 4N39A 4ICIA 2WAOA 3AJ8A 4M21A 2BJWA 4BFVA 2OP1A 1GZ5A 1PKEA 3AP1A 3GG9A 5H82A 2YWXA 3PPIA 1GTL1 3BL5A 1ISRA 2DZDA 2RAVA 3ZU5A 1J20A 1BC5A 3KP1A 4MZDA 3GGPA 3DXXA 2NSHA 2R5FA 2HJSA 4HVAA 3FCOA 1K2WA 3OTWA 5KJFA 5DE3A 3IKVA 3INGA 1INLA 4EGSA 2CXTA 3I4LA 1E1CB 1K7XB 1MB4A 3MUNA 4MQUA 5D01A 1SBCA 1KARA 1Z45A 2WWIA 5K7SA 1XB2A 1DWUA 1YVEI 3BVPA 4PYQA 4XWYA 4TSRA 3ZDZB 1LBQA 1WD5A 5L95A 3IRVA 3NTVA 2QTRA 4URFA 2ZTVA 2HU7A 4LBWA 4KNVA 3DL0A 1ORTA 3UY4A 5I4IA 2QTTA 4QOEA 1K0UA 2VNAA 1SXJA 1VDZA 2ODBA 1NBWB 4IKOA 4M89A 1U2QA 4ZREA 3EA5A 5D86A 3X1DA 1Z4IA 2WIJA 1X0VA 3WNZA 1X1CA 4Q4CA 4CIVA 3RIHA 2N3ZA 5IF3A 3G2QA 1TC2A 5LJIA 3LFHA 1L1QA 2AQ8A 2VBFA 3BMOA 1Z5UA 1VHJA 4LRTB 4M7OA 4EQ6A 1I32A 2VYVD 3IJ5A 1BJTA 2IYTA 1P0IA 1T5IA 1EUDB 4ML3A 2ZZNA 3FBTA 3FDFA 4Q03A 2QUAA 2PR7A 1GVNB 4MP8A 1AUPA 3P2MA 3CNLA 3FCCA 4OM8A 2AMFA 5I7VA 1CC1S 1M2KA 1VECA 2QRMA 1MO3A 3EIWA 4IOMA 4S0ZA 3ZHQA 4LGYA 1GPLA 2KM1A 3FN4A 4MQMA 3VPSA 2FEKA 3UQYS 4Q9IA 4DNQA 4RMNA 3UF0A 1V5IA 3HNPA 3OFKA 3GZ4A 4B40A 3K05A 3DMTA 1WSAA 1J2RA 2QLJA 1BEUB 3R9XB 1PJQA 1R16A 3DEYX 2A1TR 3TZKA 3HHEA 4MPRA 5CW1A 4F7DA 3I58A 1UJ2A 1DO2A 2JVJA 3HYNA 3O2SB 4U2DA 4RQUA 1ONNA 1OTXA 4Y6LA 3ZBTA 1W36B 2GFIA 1X7YB 1PCXA 2Q7XA 1UMCA 4JHLA 3RRBA 4FB5A 1Q6ZA 3O47A 4X93A 4AS1A 1QTRA 1ZJ4A 2G80A 2EZUA 4TS4A 2MYPA 3ZXUB 1P7ZA 2HB6A 2NYVA 1I5EA 4DLYA 4DV3B 5U4XA 3U4DA 3E0XA 4J4BA 1E1NA 5AM1A 2DMRA 3E27A 3VJKA 1I10A 4JOCA 4UU7A 3IGFA 2ZRJA 1ZQ9A 2KMLA 3EYAA 4UMVA 2IPLA 2ZJOA 4JK3A 5JLAA 1Q0RA 1LC3A 1V45E 4IGFA 2P7HA 3BXOA 3OT4A 5F12A 4DB4A 5CNIA 5A3JA 2X8JA 3E35A 1O95D 1NZDA 2A67A 4Q9HA 2HU5A 1W35A 5LA6B 1N6PA 2JFHA 3PUWA 2GTHA 2BI8A 1WEHA 4RTOA 2WPNA 4HEHA 1RKXA 4W6ZA 1KE2A 4WKNA 5I4KA 4GPZA 4RC9A 1EQUA 1PZMA 4IEFB 2GAJA 2X14A 1NPDA 3HJBA 3C41J 1DQZA 2EKPA 4Q3BA 2UZ1B 4S1OA 1DQNA 5AKKA 3VPAA 2JHCA 1L4LA 4IHQA 1URPA 4J1NA 1XALA 4NXNB 2IT1A 3COYA 1O94A 3FNRA 4FQ7A 4YK7A 3UJ6A 3TIIA 3LYAA 2ZB7A 5CCEA 5B7PA 1Q0HA 5KC8A 3WWYA 1GFSA 3I01M 4R31A 1XLTC 3HWX1 9LDBA 4BB0A 3RIMA 3C4VA 3ZU6A 1I24A 4OJMX 1DL5A 4F8YA 4QG7A 1E2BA 1DLIA 2HF8A 3RU9A 4BAGA 3ZY3A 3EPJA 2OKCA 1V3QE 3TVDA 5JU6A 2PX3A 4DEYA 1E66A 1RAGA 5K01A 4O59O 2PVCA 3TRFA 4Q9KA 3N53A 1DBPA 5CXUA 2H4XA 3Q98A 2XE8A 5ITWA 3U49A 1TQ4A 1KU0A 2IYUA 5SY6A 1O8BA 1E7MA 1XTVA 3IV6A 4YI3A 3M89A 6REQA 2JIMA 3IO5A 5E1OA 3T3OA 2ZJ0A 4G8BA 3JYHA 4JBLA 1DKUA 1A7KA 1VCHA 1GXSA 3EMDA 1MO5A 3KDPA 2JKVA 1SOAA 2DR3A 1DQSA 4D9IA 1R9JA 1A97A 1GAEO 1YA6A 4RYDA 1K3TA 1JHXA 5L7TA 4YCMA 1H1LA 4PC6A 4DA6A 1IJFA 5F64A 3COPA 3SYNA 5A05A 4B6JA 1P9LA 2FN8A 3TCKA 2YNMA 2XRYA 1TUGA 3AM4A 1XQ1A 2FKNA 2YXBA 5TLSA 2GJKA 1OH5A 3PJFA 2CLOB 4WRRA 2BRUA 3EMBA 1H3FA 1NONA 1QLHA 2O3RA 3CT4A 4EMUA 1E5QA 3D0QA 4REMA 1ZW1A 2ZU0C 3FOBA 3ER9A 2Q4TA 4NU8X 3D4LA 1NBOA 3HXKA 5EMNA 2C03A 2O2GA 4PYNA 3R7WA 1CQIB 3SHWA 4NENB 4D9EA 1JQJC 4DEVA 4ES6A 1CJUC 3U4GA 4J16A 1GU0A 4LJ4A 1YQUA 1Y6RA 1SB8A 2ZSEA 1NQWA 4W5HA 4X1YB 1Q3TA 5AJXA 5DHFA 3FZNA 4IG4A 3BS4A 1IH8A 1Q95A 4WZAE 3WKBA 1SD1A 3VVCA 4ZI2A 4X3CA 2QVGA 1Z0AA 3BXFA 3EXHA 3MB8A 4GKJB 2XZPA 2VKQA 1KS9A 1BHSA 1IHDA 2HO4A 4QTZA 1EB9A 5JSHA 1T1RA 1JHMA 2C8VA 4H1HA 1TM1E 1TIPA 3CSUA 4D02A 2AD5A 5I4BA 1Y34E 1WW8A 2WWFA 3REGA 1OGJA 1UZNA 4D4JA 4DUYB 1EVQA 3PDCA 4UXJA 3SCZA 3ORYA 5AUQA 3DOOA 5DBFA 1RPZA 4M8KA 4MW6A 4BLPA 3UHOA 1KEUA 4FJ0A 2VHYA 4TKUB 2QP4A 1L5HA 1P7VA 2J9GA 2X0EA 4A15A 3HJUA 3ZDCA 1FL9A 3DE7X 1BVYF 5MGBA 2OOSA 4JUBA 2JARA 3CMMA 1WB9A 2RHWA 4YV7A 1E2FA 2F1RA 2GILA 2NTYC 2XDWA 3LO8A 3ZXIA 2K7FA 2WM9B 3GVXA 4PVDA 1ZA1A 3ESYA 3IQEA 4KFSA 4P9NA 4YJHB 3OOJA 2ZE5A 2FUCA 3QJ5A 3QF7A 3ZDDA 2IU4A 4XJXA 5IT4A 1FP2A 3QOXA 4TV8B 3FVQA 4HNAB 2FF7A 1O5OA 5ALHA 1KJQA 4TM8A 1UC8A 4XEHA 4D99A 5KNBH 1DFGA 5FO1A 3DXZA 3MBIA 1E77A 1KK3A 2C3YA 1GZSA 4Q4HB 3T94A 4JENA 1Q1ZA 2FPUA 2XKJE 4XUCA 1J5EB 1NJ5A 1YB4A 2JJ8A 4MVJF 1P0PA 4OLFA 1ZCZA 3L1IA 3RWMB 1ILEA 4LXHA 1MX1A 1N6IA 1I3KA 2G06A 4IDQA 3MJVA 1NNEA 4ND2A 3O73A 3V1LA 3OQMA 2IYWA 1F0NA 1FX0B 1F51E 4TYPA 1G0OA 3OJFA 4EPXA 3T4EA 2QGFA 3GJQA 1RZUA 2EBWA 2O0LA 4QDUA 1CQZA 5M34A 2ZM5A 5LBTA 1U2SA 1TK9A 3AF0A 3FPKA 3KUDA 3I1IA 1XCOA 3CRW1 2QRGA 5KU1A 3MPOA 2HCRA 3D81A 3STXA 4QNMA 3IDAA 1WB5A 1W0KA 1Y3DE 4KPEC 1E6MA 4Q9AA 2NP7A 3URKA 4S24A 2JIOA 2IYNA 4BMSA 3M8KA 4O4IA 2QQFA 2JVIA 4DR5B 1ETUA 4M0LA 1P17A 4HDOB 2CDNA 3DUFB 3HZOA 3MCAA 1N75A 2BFDB 5H0IA 3KUCA 1X9HA 1T8WA 4D9MA 3P0FA 1OLUA 3A9WA 2UYHA 2Q50A 4BYGA 3SMQA 4DT1A 3UWKA 5IVPA 2GM4A 1E94E 1QYIA 2Y1XA 3RUHA 1DIRA 4KWHA 3HO1A 4EAAA 1GQOA 1T24A 5DGHA 1VB5A 5T57A 1R64A 2OHIA 3H5IA 3ICQB 1IY0A 2Y9PB 5E3JA 1EJ0A 1SHLA 4OI4A 5DNDA 3WNQA 5AJVB 4C76A 4YR7A 3T12A 3KQUA 4KEAA 1BMQA 1IPHA 3W2FA 2UZ4A 4EK9A 2BZ0A 1E2JA 2ZVDA 3KBBA 4R2XA 4DADA 4RF5A 2PKQP 1AMUA 1KJIA 5KTOA 2ZWVA 5JSKA 4MTCA 5EXPA 5T4EA 2V03A 4RLQA 5TMPA 1JRLA 1RSZA 4GZ6A 5DBOA 2BELA 4F0JA 3IP3A 5AYVA 4YV0A 1ZP6A 2C5GA 2Z9BA 2R97A 3P4UA 3ZY4A 4F3CA 1JKIA 4FN5A 4YCCA 3Q9UA 5JV5A 5C8ZA 1JYFA 5DTIA 1MORA 3V4OA 4QBGB 3ESXA 4UCWA 3ESRA 4R5MA 1D1SA 2JD0A 3DQPA 4JL5A 1V8PA 1PL0A 4DDMA 4ZGBA 4ZYTA 1CUDA 3LUCA 1NT4A 4F4UA 3WSTA 1U1FA 3OIDA 2C00A 4EFNA 1P2TA 2AOUB 3E9YA 2CLCX 3UW1A 2VUUA 3E5MA 3BXPA 3K0EA 4AZ3B 4I2VA 1X7WB 1EH5A 3OC6A 4L9AA 4NV1A 4AIIA 3BX1A 4RVUA 2LNDA 2PIAA 2JLXA 2VYNA 2H4FA 3SFTA 3NIGB 5DSZA 1E5VA 1ZGZA 2BUBA 1KMHB 2HYDA 4QTXA 3R8XA 4UTRA 1XKXA 2OHJA 2WE8A 4QZVA 3ZE1B 1Z25A 4XQ9A 4MJXA 3L07A 3LT2A 2GBGA 4AULA 1O9BA 4HZUB 2OGSA 4MOWA 1Z2OX 1GPH1 3A9CA 2I2WA 4LXUA 3A9UA 4HZIA 5EMKA 1OBHA 4HNAA 4CPDA 1USUA 1CJMA 3HDJA 3GLIB 1FSGA 5DLYA 3TLCA 1WM1A 3JZFA 4LOLA 3GLVA 2WABA 2IEIA 4TL7A 2WHRA 1JX6A 2G83A 3GY0A 3QBVA 4TWIA 5F1OA 1V7ZA 1WP4A 3DOHA 1NUHA 3LRXA 3NYRA 4ZXPA 1KDZA 3PPXA 2GRUA 4BNWA 5AVRA 1IUPA 3ZE8A 1M6VA 1FDWA 1O87A 3N8DA 4PSUA 3STYA 4BNHA 5HUJA 1T9GS 2CB0A 2G9QA 4I6EA 2OTCA 3RJ5A 1UKCA 1YSCA 3CUUA 3TAUA 3KQPA 3E84A 1WUHS 1Q44A 1J7KA 1NV8A 1SC3A 5AQEA 4MR7B 5EJAA 2J6CA 3TZEA 4DIFA 1PR0A 4YJDA 3LZDA 1WXDA 3IH5A 2D2VA 2ZSBA 2A7QA 3IXLA 4G0WA 4HFJA 1GP2A 3G0CA 3UAVA 3WGNA 1N8NA 3EVZA 4RFSA 2B1RA 5E8RA 2JZOA 4GOXA 1KJJA 1AHPA 6NULA 1FNSA 1YONA 1BA2A 4NJMB 1QIHA 2J0UB 1E62A 3OTHA 2VRCA 3PNPA 3KEFA 3WV5A 3GVPA 4M36A 3MLAA 1XZQA 4ZARA 2ENUA 2LZ0A 5B6JA 5FOQA 5ENZA 4MJ3A 4WK6A 3PQEA 1UPXA 2K6GA 1PR5A 3KZ1E 1QKJA 3LBAA 3Q72A 5E38A 3VH3A 1I7LA 4NYIR 2OYCA 4EIWA 4ESOA 4KLZA 4QUAA 1FTGA 1YFJA 4PONA 4MW1A 3K2EA 2H4HA 4OHRA 2IV3A 1XCMA 2OK7A 4NBUA 5KWVA 5TR9A 4JYCA 1U3TA 3CUTA 1PAUA 2G04A 2UYQA 4W6QA 1II0A 3R3JA 3BK7A 3K1AA 3TOCA 1MW9X 3KAKA 3EDCA 3D5EA 4IEEA 1Y6GA 1OB5A 4YX9A 2IZ0A 3L93A 4CG2A 3A8TA 3VYWA 3ITDA 4O4JF 4M1KA 3DDNA 1K6JA 2Q2QA 2WLSA 4H77A 4CDRA 1IBLB 1UDWA 2WTUA 4Z9XA 1WHTB 4DLKA 4KCGA 3I23A 1FTWA 4M9XA 3WGMA 3EWAA 5MF6A 2B6HA 5EUQB 1GDHA 1X3LA 1R18A 5IMBA 5A5FA 1DELA 3Q9SA 5C51B 3ZD9A 4CMGA 2SBTA 3AERA 2KYRA 3N2LA 5TGTA 4I3HA 3UFXA 5CFPA 2WF5A 2XMBA 3FOCA 2W93A 2Y1KA 2VHQA 5KNDD 4L4XA 1SKAA 5K8JB 4URWR 2FA9A 4EX6A 3QKRA 1YF3A 2IYZA 2Q5QA 3PUVA 3G1WA 3L4BC 2G5TA 3GARA 1LSOA 1RXEA 1T6XA 1I4OA 2IEDA 2X5XA 1I6KA 4O02B 4WX2B 4LQDA 1KAMA 2QXUA 3DV9A 3KL4A 4EG6A 1E9SA 2DFKB 3PGJA 8GPBA 1XVVA 1W2WB 3FIUA 3H6KA 3SZUA 1ULSA 4CGYA 1JDUA 4I08A 4KUEA 4PPYA 1OXVA 3RFCA 4KITB 1ZESA 3CNBA 3VMFA 3OKPA 3IURA 3GJZA 2R25B 3ND5A 1YQGA 5I7HA 3P2YA 2BTEA 2XXAA 3G8YA 3CW9A 2CBGA 4Y6GB 3D3WA 4IMJB 4J49A 4NDZA 3BHJA 3UJ3X 4ZZ0A 4K9PA 3S1AB 1AKYA 4G5RA 2NSYA 4HZUA 4JSYA 4PYIA 1YB6A 4AJEA 3BB4A 4BVKA 4K6FA 4NBLA 1A5SB 3DC2A 2NZVG 4YTEA 1QDEA 2HCBA 1C8BA 4JQYA 4DARA 2IYPA 3WYGA 1V8OA 2JEOA 3UOGA 4DLZA 2VRBA 4S0XA 3R9XA 1P60A 3GDFA 4DBLC 4DCNA 2H0QA 4KLNA 2ZW9A 4RNDB 4ZD6A 1B00A 1RHJA 1IZ8A 4AURA 4PANA 3A4LA 4J2OA 3ELDA 4L5BA 1NLUA 4RSMA 2P3OA 1W49A 5BMVA 1NZJA 3W5DA 1W5SA 2F55A 1B23P 5EVCA 3CZCA 3GMSA 1EPUA 1YL6A 3I6IA 4Y6QA 3VMMA 4PLZA 4UTPA 3D7SA 4V0SA 1WU8A 2F9LA 2RGNC 1E7SA 5DFAA 1XPRA 3GRKA 5E6UB 5HKAA 3VVMA 4G5XA 4TQGA 2GOYA 1KO1A 5HM6A 1JYEA 2NTVA 3Q7QA 4KVGA 1TCUA 1F1JA 3QXHA 1JNXX 1HOXA 4QJ5A 3C3AA 4LHWA 5FPYA 4KXMA 2F1JA 3EDRA 3RSOA 3AKZA 3I61A 1F9AA 4GI1A 1DKNA 1M2OB 4BKOA 1TF7A 3H4VA 1CW2B 4G41A 5TVKA 3FFTA 4V2IA 1TD1A 3AOEC 5REQA 1U7DA 1JAZA 2CZCA 4HMQA 2VDOB 3GAAA 5JAQA 2HV9A 5ARDA 3TSCA 4PGAA 4RA9B 1DWQA 4LYHA 3LHIA 4R2IA 3U4QA 4OJNA 5EP2A 2IHVA 4Q3EA 4RH0A 1BZYA 2JRLA 3B2QA 3O9VA 4CETA 1NULA 2B25A 4X1KB 1RHMA 4LRSB 1L1EA 1MEJA 4FWBA 4Y0AA 4I5DA 3QGMA 1NX6A 1KZYC 5CEJA 2ZXUA 3QHQA 1O7JA 5DCLA 1WXWA 3VYUB 4RPHA 4PZDA 2QG4A 1ZK1A 4V24A 4O8CA 2GF0A 6LDHA 3FTEA 5IK2A 2CWWA 1KJNA 2VPXA 1JR2A 2I76A 2WJGA 4P93A 3SLGA 5SZIA 2FG6C 2LIPA 4RPKA 4P58A 1GPNA 5GV7A 4OREX 3SEZA 1W7AA 5A4FS 2X4LA 3ACBA 2C5AA 2OCIA 3HMKA 4JJ7A 2DE0X 3VTFA 4B6RA 1S9HA 1QFYA 1GNVA 2O8CA 5ALGA 4LBZA 4DY4A 1DIAA 4YV2A 4F1WA 5DLQC 5KS2A 2FEMA 4YJGA 5F3DA 4XFKA 5JYEA 3II6X 5IKOA 1GV1A 1R3DA 4TT8A 4RFVA 1FLVA 2H92A 4F96A 4HNUA 1E60A 2D5CA 3NQ41 1JDPA 4BVAA 1K4YA 4Z1OA 1NQTA 1RPAA 4U5XA 3TD2A 4G1MB 3ZDXB 3IJPA 1X87A 3CX3A 3M6MD 4MHOA 5F73A 2X1VA 5IZ4A 4J91A 5EZSA 1NBMA 2DFDA 3H3JA 4PSCA 1XRJA 4E7OA 5CB4A 1G3IA 2ZM6B 3R9WA 3P2JA 3E03A 3GLHA 4P53A 2ANBA 5ALZA 1ENYA 4LDZA 1YK1A 2HQOA 3COZA 4AZVA 1SRRA 5CGQB 5M3BA 1YS6A 2HREA 5K51A 4EL5A 1Z5NA 4CKWB 4INZA 3T5PA 5CH8A 3RGGA 3O8LA 4G1BA 2I2AA 5EAIA 3FCSB 3WGVA 3UXHA 4R2KA 3PUHA 2A5FA 4ZQEA 1H2ZA 1VL6A 4ZVSA 1GQRA 4PWZA 3WLIA 2UVDA 3MN1A 2OXCA 1O03A 4OGFA 4RWEA 1OKKD 3UM9A 5JH7F 5K8LA 3K92A 2CN1A 2XVXA 3OHSX 3EEYA 4MLZA 4R2LA 3UAZA 4EYGA 1X1AA 4J7UA 1SHTX 2CDBA 1DRWA 2BW0A 1V2GA 3FLBA 3WMXA 3O8QB 3HR4A 1OYOA 2V6JA 3GRRA 1L7MA 4N5MA 1CVIA 4F2GA 5IVKA 1JUDA 1E9VA 2QN8A 3SQXA 4GDFA 3HFGA 3QBDA 8ATCA 5TGDA 1SHKA 4Y30A 3SE7A 3FYUB 5FPTA 5DM2A 1PLJA 2AKYA 2FEAA 4WDRA 3F1LA 4GQAA 3FR8A 4OHXA 1S2DA 3BRQA 4TPKA 3S2YA 4AYXA 3LQQA 3R6LA 4CM4B 4F56A 1Q50A 2EIXA 2ZYUX 4FMDF 1UT8A 2YJ4A 3F47A 3EAFA 4KL8S 1VI6A 2R48A 5F9MA 4DSUA 5J4KA 1U7WA 3LBFA 2OCDA 1CUWA 1D04A 2PT6A 3NCHA 4TZKA 3H2BA 4UUAA 3A1SA 4QFCA 1GZDA 1SWVA 4G4GA 3G3EA 2ZPTX 4MGIR 4BUZA 1SXJB 4BO7A 5HJEA 2PH7A 3E22A 1FUEA 1Q77A 3L06A 4I5FA 1TLLA 4UXHA 3DMPA 1O94C 4OXIA 1Q0TA 3CUYA 1NVEA 2I3BA 2NGRA 1R2QA 5G0UA 3ZG6A 2WU1A 3DAFA 4YMHA 4G67A 1WV1A 1WXIA 3RPEA 1TIKA 3AG6A 1OZFA 4L22A 4ZAZA 5G1OA 4HB0A 3VH1A 2CXSA 4QG3A 7MHTA 3DYBA 2WZCA 1Q1AA 3DWFA 3PEFA 1QV6A 3GEGA 4JELA 2R6R1 3UT5B 2ZRLA 2D2XA 1V39A 2YUIA 3W4JA 5C1BA 3COSA 3C6KA 2VDWA 1CRLA 3A0UA 3EEQA 5C46F 1D8AA 1X1TA 3QY0A 1QE0A 5EMLA 2C8KA 1YTLA 5FOTA 5F7XA 5I51A 1FMLA 1K98A 1F8XA 3H18A 3TMKA 1EGVB 3NEJA 3PR1A 4CNBA 1DEAA 1OWNA 2FFQA 4IFBA 5D5QA 1SPXA 2IPOA 1L7EA 1BG6A 2L17A 4ISBA 5I7WA 3OPYB 2ZJ7A 3ZHBA 4M9RA 2I71A 5IABA 3NOXA 2A4MA 2BC9A 1FS4A 4K9OA 1JBQA 3KAPA 2X7XA 2XGOA 3RTCA 3TO5A 2ES4A 2VJQA 3B8EA 4WNYA 2OSVA 2Y1EA 3RB8A 5CNJA 1Q7TA 3VO2A 2NNWB 2RAFA 1X7ZB 2CL0X 3H9GA 3PL1A 4G0NA 4I1VA 4KQ9A