4TYPA

Crystal structure of an adenylate kinase mutant--akm1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
208
Chain Sequence
MNIVLMGLPGAGKGTQAEKIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSRGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIDVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMKPLLAFYDSKEVLRNVNGEQDMEKVFKDLRELLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
source organism Bacillus subtilis 168
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 66
structure length 208
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4typA00
1YR8A 2OG2A 3U3KA 1KO4A 1KIMA 1YVDA 3BJIC 5C4MA 1IN8A 2ZAMA 2UZIR 3CRW1 1L7VC 1P4SA 2Z4RA 2Z6VA 3IIJA 5CIWA 3PUZA 121PA 2ZPTX 1TF2A 4JSYA 4B34A 1F3OA 3IILA 1MKYA 2GJAA 4HLCA 4IOJA 4OK5A 4Q7MB 8OHMA 3AF0A 4Q9JA 2XX3A 4MYCA 1YRBA 1IONA 2XTZA 2XJ4A 3B2EA 2WAYA 2YC2C 3B7GA 3KDSE 4QBGB 3RWMB 3SHWA 3PQCA 2HF8A 1DTSA 5GADl 4JLKA 4CT4B 3KB2A 2YZ2A 4GI7A 4UKDA 2IXEA 2JIZD 3AF1A 1OJLA 1N6HA 3DL0A 3GJ6A 2F7SA 2QE7A 2R6GA 2CLSA 4QGFA 1W4CA 4MKGA 3B8HA 5A0FA 1EESA 4JVLA 4TTRA 4FMDF 2REBA 4TN1A 5E7JA 2B92A 3VR3A 1GSIA 3B1WA 2XTNA 3KQUA 3VKHA 3TRFA 1SXJE 1AM4D 1JBKA 1S2MA 1A1VA 5L3VA 3ZIAA 5EXSA 2YWFA 2NIPA 4O2RA 4FW9A 4ON9A 4DB4A 2QQ0A 2X19A 5FOSA 4QJ4A 4AY2A 3D7MA 3THWA 2AKAB 4AI6A 4LHVA 3WHLA 4IEEA 1NP6A 3DPUA 1BOFA 1II8A 1E0JA 3KB1A 1LB1B 2YVUA 2FGJA 2JLZA 4NZYA 4M9QA 4RFSA 2ZI3A 4Q9LA 2RGAA 4B6EA 1UKVY 3VFDA 5HPYB 2QMUA 5AJXA 2GZAA 3PR1A 1ANKA 1RYHA 3W8NA 4BLPA 4D4KA 1T0JB 1AKYA 5KNDA 3VNVA 4UNSA 3QKTA 3ZZUA 2V6JA 4YC7A 2X2FA 4POAA 2W0SA 3OEEA 1F2UB 4FMCB 2GXAA 3RS5A 4RKFA 3CZPA 4C7OB 3KKMA 3KXLA 1T3LA 2WV9A 3VAAA 4YQFA 4ZI3A 3I4LA 2E1RA 5KTYA 4L16A 2F1JA 3EIHA 4I99A 1WBDA 2IC5A 2OFOA 3AGQA 1XTRA 1A5TA 1RRPA 3AP3A 4KSCA 5KYKA 3T1TA 1IQPA 1D2MA 4ZKEA 2PMKA 4B2PA 5JI2E 2FZLA 1J8YF 1E9AA 1TX4B 1VKJA 4JT4A 4TLCA 4TQ9A 1SKQA 2R62A 1S0UA 1IN5A 1YR6A 2C77A 1KJWA 2HLDD 5IK2A 1E96A 4N0EA 5EE0A 1CR2A 3FMIA 2GBLA 3R9IA 1XU4A 4D4MA 1ODFA 3IEUA 4D82A 1VHTA 4KAXA 2C03A 1ZNWA 2AK2A 4GBMA 4P4UA 1L2TA 1DS6A 3ADKA 1VG8A 5TDHA 2QTHA 4TMTA 4TMWA 5FBRB 4QG7A 5KDLA 3UANA 1W49A 2AKYA 3W6PA 5A4JA 5KNCA 2GA8A 5FL7D 1ZD8A 1E3MA 4RZXA 2WJIA 3CW2A 3I92A 4BUJA 5KUTA 2IS6A 4PO8A 1E69A 4RCYA 4V03A 1MABB 1NVVR 1Z2CA 3CM0A 2GBLC 3PUVA 1G3IA 1KI7A 3KXIA 1QG2A 1DPFA 1I4LD 1NN0A 3AVTA 3QG1A 5TMPA 2QEQA 1XZPA 3LO5A 2CCKA 2YWEA 3KKPA 4B3BA 3C5CA 1GNPA 1RFLA 3THWB 1N6RA 2FGKA 2GJKA 3P27A 4B71A 4Q9IA 2WPDA 4B3XA 1NIPA 2ODEA 3KFVA 3MD0A 3W6NA 2JDIA 3GFPA 2HUPA 2XNDD 4US2R 3SE0A 5A5GA 3QPWA 1M7HA 2WWHA 5JHHB 3BC1A 4LV8B 2XJ9A 3TVTA 1ZNXA 2QSZA 4KXFB 3ZVRA 4YXWD 4XD7A 4C0KA 4TZ0A 3L43A 4TTQA 3FKSD 2JLQA 1YZNA 1KHTA 1JR3E 1FMLA 5CIQA 4OHZA 3CONA 2WWYA 1D6JA 4US1R 4XWOA 2C9YA 2K5UA 3P26A 4JVMA 2HLDA 5IK2D 3A36A 2PX3A 4HI0E 5LBIA 3AVUA 1GRRA 1ESMA 2XSZD 1NJFA 3GJXC 3VU9B 1US8A 3GP8A 2GVDC 4OL0A 5CJPA 4YMWA 1G5TA 3AF3A 1ZM9A 2Q3FA 4NTZA 1E0KA 3N70A 1N6IA 2Q9AA 4TT3D 3B9QA 3LDAA 4IFEA 1T3HA 1GIAA 2ZR0A 1MOZA 1Z22A 2BM1A 4MKHA 2ZRAA 1N25A 4QBIA 1NN5A 3B6EA 4KCGA 1MT0A 4JKIA 4JBXA 4A15A 2ZRJA 4YMSA 2QAGC 5DE3A 1ZNYA 2CL6X 3R8CA 3WXMA 3ZVNA 3AF2A 1HY3A 1Z3IX 1KAOA 1UBCA 4AG6A 1ZP6A 1TF5A 3T1QA 1OH8A 4URXR 1NJGA 3B1XA 3SDZA 3CRRA 2VQSA 3K0FB 3K9GA 4PSVA 5KOYA 2ORIA 3EW9A 1X86B 3LBNA 3WP0A 1E9RA 1CS4C 1X8KA 1XP8A 4W7SA 3W34A 4BFSA 3H1TA 4MYUA 1Q21A 2JIZA 1OFIA 1K6MA 2F3TA 2JDID 2SHKA 2WKPA 4TT3A 4YLGA 3AB3A 4QJ3A 5L3QA 3CRMA 2D4HA 3MJHA 4A6PA 4JJZA 5FOUA 2AWNA 4V0NA 3GLHA 1CTQA 1WXQA 2XXAA 5GJBA 2A30A 2OCPA 4YXWA 4CIDA 2FEMA 1XD8A 4NL4H 3FWYA 3AVVA 2R65A 3CB4A 5FPTA 3GLGE 2PEZA 5IT5A 3GLFE 2GNOA 4AYTA 4B3DA 2ZYVX 4F4IA 3QEJA 5HKKA 2J0QA 1SVLA 5DLQC 2A7QA 3BWDD 2PH1A 3OEHD 1MR3F 1G20E 4QM7A 1DAEA 2QNRA 2WJYA 2WWWA 1G6HA 1CR1A 1MRSA 4ZIRB 5DN6D 1GKYA 2RKOA 3MFYA 2D7DA 1KDPA 1W5SA 3K1JA 4Q66C 1BYIA 1TMKA 1KI9A 2W2XA 1E2GA 5E7IA 5EQTA 5FOWA 2P2LA 4DT1A 1KO5A 3SBDA 4II7A 2VP0A 4TMKA 4C7OA 3QY0A 3VR5A 4JLPA 5EXPA 4EPXA 1JB1A 3Q5DA 2R6CA 2ZI4A 4WA7A 4ZCIA 1R2QA 2IS2A 1HTWA 1GFIA 1JR3D 1E9EA 3MWKA 5TV2A 4C3ZA 1E99A 4TWZA 5CB8A 4DLTA 2C78A 3OFNA 4ZIRA 4Q01A 5GVRA 2R6AA 4LHWA 3DDCA 2VP9A 2ODBA 4B43A 2RCNA 1ZRHA 1FQJA 2RGNA 1G1MA 2ZE7A 3WY9A 1SKYB 3T15A 1U0JA 4D6PA 1AS0A 4D0LB 1U0HC 2OXRA 1QZXA 1BMFA 4LBZA 2J45A 3WYFA 1Z47A 2BHRA 4JSTA 4MGIR 1EWQA 3VR1A 4B74A 1E2EA 3THYB 3EWAA 3GQBA 2D2EA 2D3WA 5DYIA 3W6OA 1J90A 1G3UA 1KZGB 1T5IA 3IPYA 5HE9A 3ND9A 2AN9A 3QQ5A 3CWQA 2JLYA 1RRGA 2GZDA 4NMMA 1KI6B 4URYR 5TARA 4GFDA 2O8CA 3H0KA 5K8IA 1KO1A 3EC2A 3U3JA 1E94E 5JZVA 1ZU4A 3U3MA 5J4KA 3FHOA 2ZJ5A 1CF4A 5FUVA 2VRWA 1WA5A 4KVAA 3EZ2A 3CNOA 1M8PA 1XTQA 3P20A 1NSFA 521PA 2YJTD 2RHMA 1IN4A 1WRBA 5L3SB 2GEVA 1OKKA 2C2HA 1CR4A 1LY1A 1W1WA 2IF0A 3SJBA 3QENA 4I1OA 3BB3A 3QF4B 3AKYA 5AR1A 4IDNA 2JLUA 2WWIA 3N2IA 1FPMA 5AJYA 4HSEA 1CU1A 5IF9A 1GVNB 1GKUB 2F55A 2G1KA 1OH7A 1G4AE 1VCNA 2UKDA 3BB1A 5B2ZA 3RRNA 1UKEA 4KSBA 4BE7B 2YWGA 3IHWA 1FNMA 3RAPR 3GEHA 5FPKA 2PLFA 2V55B 2G83A 3I8XA 1NRJB 3EXAA 3CF0A 5GJCA 1FOEB 3NTUA 4EPRA 1KO7A 4I1VA 1KMQA 1XEFA 4MDEA 3W9YA 3LLMA 2CJWB 4DEYA 4EJSA 3OE7A 4XOIA 1I2MA 2ERXA 4OHWA 1OIXA 3M0EA 3T5GA 3EZ9A 2GCPA 5EE9A 5EP2A 3SJAA 2P6RA 1KGDA 4YMTA 5KPJA 5FUXA 1YE8A 3BERA 2YOFA 5C4GB 1Z0JA 1IN7A 5DI9A 3GEIA 5J40A 1O3YA 5ANRB 4M1MA 2CXXA 3TH5A 3TSWA 4OHVA 5AUPB 4DSTA 1HYQA 4I81A 2X2EA 1P2UA 2BEKA 4MA4A 2FX3A 5KSPA 4M1TA 4RZUA 2IF2A 2L0XA 1P60A 1A82A 2BEJA 2W58A 4ZCLA 1AS2A 4BLTA 2NPFA 4RD2A 4BFUA 2DWQA 3UMRA 4KBFA 4C0LA 4FCVA 3U5ZB 1W46A 2FZ4A 4Z1MA 1GG2A 5E3HA 3BBPA 2DBYA 2EWWA 2QMEA 4BEBA 3GJ3A 1YZLA 2R8RA 4QHSA 1ZM7A 2QGZA 3I3SR 2WHXA 1CBUA 3CZQA 3DOEA 3IO5A 2JJ2D 2CHGA 2OEPA 2IWRA 4A8JC 5BYKA 4XSHA 4ACAA 5TY0A 3FTQA 2ZSBA 4Q4HB 1M7GA 1E2IA 3QNUA 3L0IB 4FN5A 3T5DA 1WP9A 2IYQA 3EIEA 1L8QA 3UG7A 4OKSA 4ARZB 1EFRD 4G3XA 4MYTA 3P4YA 1QG4A 1KKMA 3BXZA 2JJ8A 1U9IA 3NEYA 2NMVA 1R0XA 4RD4A 1FUKA 4HLQB 2GRJA 5BN5A 1OXXK 5FBWB 4MRNA 3RABA 1VG0B 2VP2A 4Q4LA 3QJYA 1QVRA 3GPLA 1Z2AA 2O8FA 4U02A 1DOAA 5TVKA 4GL2A 1VYUA 1G3QA 3NEJA 2HJVA 5FR2A 1M1YE 4JLAA 4PSAA 1HQCA 3FMPB 4PC6A 1OFHA 1Q0UA 1UBGA 4TL7A 2D62A 4CZ2A 3PG5A 2IUUA 3OIVA 3OIUA 1ZIPA 4HDOB 2W2TA 1N3BA 4TYQA 4B3CA 1NLYA 2KJQA 3KJIA 4L9SA 2F43B 4HAUA 4TLDA 4OBEA 3TVDA 2WZQA 2LKCA 2J59A 2J9RA 3OEHA 2BMDA 4TMZA 4RZ2A 3EPLA 1TEXA 3NBYC 3LV8A 2ZJBA 2ZANA 4TMVA 3U2QA 1U8AA 1QHNA 4D0NA 2IBMA 1LS6A 2OXCA 5C18A 4Q1AA 2J41A 4DCTA 2ZU6A 4ZKDA 1JAHA 2GJSA 1N0VC 2GEDA 4BPBA 2QTVB 2IEYA 1W47A 1ZIOA 2JATA 3CRQA 4FCWA 4HB0A 4JLOA 2WPDD 4NHOA 3WMEA 2AK3A 4LJ8A 1Q57A 4QM6A 2B21A 1XPOA 3B1YA 4ZDIA 2ZE8A 5B57C 3VNUA 1BO6A 1G3RA 3AUXA 1SHKA 2B8WA 4LPSA 1RRCA 1E2QA 1HQYE 3RC8A 5HZHA 3IQWA 5F9HA 2ANCA 3I1FA 1ZMXA 3L8YA 5DYGA 3H2YA 1U99A 4HAWA 1XNJA 1DO0A 2XB4A 2ZU0C 1DAFA 4TL6A 3C4JA 1ZJ6A 4H9GA 5C1BA 4G0NA 4LZZA 3PEUA 4GDFA 4EFNA 2YV5A 2PZFA 2G6BA 4QHTA 4G5OA 4DLWA 1F5NA 2FH5B 3AKEA 3NBZC 4U00A 3QEOA 1O87A 4IOKA 3UMSA 5KU1A 3FMFA 4WVFA 3LBIA 3AVYA 3HPQA 4CEHA 1MABA 5GJWC 5LB4A 3THYA 2GILA 3AP1A 2BBTA 1OH5A 1NY6A 4UXIA 4YDHB 2G9NA 2V54A 4V0KA 4X8LA 5KPDA 4LV5B 4S2EA 4Y0VA 3S1AA 1XJQA 4GMXA 2VYFA 2QU8A 3CO5A 3QI2A 1QHIA 1UF9A 5B30A 1UDXA 1C1YA 4I1SA 3KQNA 3K8YA 2VH5R 3FE2A 1IN6A 3NH6A 2W6JA 3NG1A 2IYYA 4CEIB 4L4UA 3ZD6A 3T34A 4CF7A 3I32A 2EU8A 1B0UA 3HU3A 1P73A 1XMSA 3L0PA 4D80A 4DIEA 4JIMA 3C16C 4X8OA 5JS8A 1T8UA 3Q85A 2QAJA 4QGGA 5G3ZA 2NGRA 3SFVA 3DOFA 1E4YA 1QHXA 2QAGB 2QT1A 3RC3A 3KKNA 2PEYA 1Q12A 4CYMA 3UKDA 2WSMA 2GETA 1XWIA 3RS0A 1OV4A 4TYWA 2AFIE 1PJRA 4K8OA 4HB3A 1Z08A 4TQUS 3U3OA 1F2TA 1S9HA 3AVOA 3EARA 3PVSA 4MUAA 5BN3A 2I4IA 4QJ5A 3T35A 4IEIA 1HH4A 2OESA 4HDQB 2YWHA 3K0CA 3EPHA 2KB0A 4PZLA 1GUAA 1DVRA 3FB4A 1XJ0A 4Q9KA 3LAWA 4LPKA 4OI2A 1P62B 2ASEA 1P9NA 4P33A 1H8HA 4Q4JA 3GLFB 2GZHA 1G64A 3EIQA 4BLSA 4ZDKA 3U6BA 1Z6TA 3RRYA 1OHHA 1KNQA 3X1WA 4DEXA 1ZD9A 1Z6GA 2W0MA 1F6BA 1P2VA 2F1HA 3FYHA 4A4DA 3HU2A 2J7PA 3WYGA 3W5JA 1TF7A 3W8RA 4HATA 4B33A 3GMTA 4KU4A 4P31A 1G7CA 4FINA 3C41J 1NSTA 2VSFA 3AKCA 2WIAA 4LI0A 1G7SA 1P9WA 1DAHA 1XEXB 2YC4C 2KI5A 4LJYA 1OE0A 2QRZA 5FUYA 4MRPA 4CRWB 3GLIE 2XZLA 3KL4A 2P6NA 3SQWA 1XMVA 2E9SA 4WXPA 4A0FA 2GWHA 3HYTA 5FBLB 2NG1A 3BAFA 1N0WA 4NCHA 2C98A 4HUQB 4U5XA 1XZQA 1KZ7B 2FWRA 2X77A 4PC1A 3PITA 2NTYC 1G17A 3GLGB 2ZJOA 4N0DA 4DCNA 1FFHA 4F38A 4KYUA 4NPHA 2ZYUX 4JT2A 4A82A 3U61B 4FMDB 1NBMD 4EJSC 4F4CA 1N6PA 1VPLA 2ONJA 2WKRA 1FW6A 4Q1CA 5FH9A 4BECA 1EFRA 5BYJA 3GFTA 2PZGA 3K0SA 4UJ5A 1RW4A 1UKYA 5JJKA 4ZV4A 2ZM5A 1E2NA 1XD9A 2DYKA 4GOXA 4GT1A 2GKSA 2WVJA 3B1ZA 3BFVA 5KNBA 3H84A 1OT3A 2O0JA 3A1WA 1FP7A 1RE0A 3ZVMA 1CIPA 4OQLA 2KWIA 1DADA 4DUGD 2DFNA 3JVVA 4H1UA 4RCZA 3A4NA 2A3RA 2HT1A 1XBTA 1ZCAA 4URUR 1NBMA 5JJLA 3IDQA 2P5SA 3TW8B 2I1VB 3UK6A 1W2HA 2MSEB 1FNNA 4S35A 4LJ6A 1QDEA 4EPTA 1IY1A 5KDDA 3P4XA 2OAQ1 3BFXA 5H70A 4D26A 5DNYB 3TR0A 1Z8FA 5J4YA 3O8RA 2WJHA 1SXJD 3BGWA 3OZXA 1AZTA 1NMYA 2V9PA 1AK2A 2DHRA 3VX4A 3NC1C 3AM1A 1EFTA 2A9KA 3AEZA 3U60B 4DVGA 4BASA 4TLEA 1NL3A 2ZTSA 1XCPA 4DRZA 2F6RA 1G19A 4KFUA 3ND8A 3AUYA 4WIAA 2J0UA 2REOA 3OEED 4WBSA 3VMFA 4FMBB 4ASUD 3KTAB 3MAAC 2ZVQX 4IJMA 5L8VA 3O47A 1OXVA 3F0TA 4N1AA 1KAGA 4OI0A 1MO6A 3C5HA 2R9VA 1KOFA 4WW0A 4B75A 2J0UB 4URWR 1JXOA 3ASZA 3VTKA 4BRUA 1TL7C 3SQXA 3PUWA 5JRZA 3V00A 4XTCS 2OT3B 4XVRA 3CRVA 1A4RA 1K8RA 3ZQ6A 3IBYA 4WZBE 3AVWA 1B23P 4L9WA 1GILA 2O8EB 4NYJQ 1CLUA 4BWYA 4E03A 1R0ZA 4Y0AA 1Z6XA 4A2WA 3O8BA 2CMKA 3PEVA 5JMTA 4K46A 5FPHA 4ASUA 1E2HA 3EASA 3K9HA 4Q48A 2NPIA 4AKEA 3DM5A 3U7EB 1TUIA 2ZYTX 4DLRA 2ZJZA 2XOKA 4R98A 3EPJA 1W4BA 1G4UR 1WF3A 3OHMA 5JECA 1BIFA 1TU3A 4PXAA 1NG1A 3UIEA 1KSJA 3MWJA 3RNLA 4I4LA 4EUNA 1XTJA 3U7GA 4QKQA 1YZUA 2NQ2C 3DM9B 2D06A 2Q9CA 4G5GA 2A5GA 3WYAA 5DHAA 2VP5A 2QMOA 1N5IA 1Z5ZA 4P32A 2W6JD 1E2FA 1H8HD 1YKSA 4OI1A 3LVRE 1PLJA 2I1QA 3RSOA 1RKBA 4O25A 1SVSA 1KI8A 4ZDWA 4B3FX 1UAAA 1KI2A 3NC0C 3SFZA 1LNZA 2ZJ2A 2F3RA 2FJUA 3C7KA 2WWFA 4M22A 2QPAA 5JWHA 1LVGA 1NLZA 2IYUA 3KX2A 3RS2A 1UM8A 4JL5A 5SZJA 3QKUA 2YOGA 5TB5A 4C0SA 1E2JA 3BH0A 2ZUBA 3O8DA 4KLZA 5FTMA 3TKLA 4BRWA 2IYXA 2H16A 1VDZA 4AKIA 2EQBA 2IA5A 6Q21A 1K5DA 2HJGA 5DIFA 5SZHB 1XF9A 3GJ7A 3OFND 4RKEA 3Q72A 5HR5A 1G18A 1Z0AA 3A1SA 4UNPA 5FTLA 5EP3A 4NU0A 5H8WA 4AYXA 4Q5IA 1YZQA 5AUQA 3AF4A 3B60A 3RVBA 3K53A 1CXZA 2JLWA 2WICA 3WRYC 4Q7KA 2OM2A 2V7QD 1JECA 2ZREA 2ZETA 2BCJQ 2XSZA 3LNCA 2ZRPA 5BXQC 3ZZTA 2F9MA 1PV4A 1E2KA 1GZSA 1FL9A 1Q1BA 1TEVA 3C15C 4ZDJA 3REFA 4KYIB 3W3AA 4MRVA 1P2TA 2OLKA 4TL8A 2YKGA 3HP1A 3RS7A 1G5PA 5CLLA 3EPKA 4E09A 4Q7LA 1ZVQA 1NMXA 3KTAA 3K09A 4NYIR 4HZIA 5DISB 4RFVA 2OBMA 4V0OA 2JEOA 4G1UC 2ZE5A 4TZ6A 3AVQA 1Z6YA 3QE0A 1DG1G 4Q1FA 4LX0A 3T61A 1E9BA 4IDQA 4M9ZA 4JL6A 1ZC3A 4EPYA 3KXKA 4TL9A 4EQ6B 3MLEA 2PLRA 4W5JA 2EFEB 2J3EA 2HT6A 3V4FA 4NCIA 3RSLA 2O8DB 3OIWA 3PUXA 3CR8A 3A1UA 5LD2C 2AFHE 2O8FB 5F9FA 5JHGB 1OXUA 2ZRFA 1GNQA 1TADA 4LGMA 3SYLA 2VA8A 4C9BA 3SI7A 1J99A 4Q7JB 4A1FA 3KQHA 4OK6A 2C9CA 421PA 3TE6A 2ZUDA 2ZSAA 2AXPA 4DT1B 3NWJA 3CH4B 4M2LA 3O8CA 2KBFA 2EFCB 1E0SA 1XPRA 4IFBA 4EAQA 2ODWA 3K0AA 4HZUA 1NVXQ 4AD8A 3NH9A 4TLAA 3GLIB 1E9SA 4ACBA 3QBTA 1Z6AA 4E5UA 2FSHA 4P4SB 1VTKA 3TNFA 1OW3B 4EPWA 3CF2A 1S1MA 2FE4A 4IRUB 1ZD1A 3G82C 4JLVA 2C96A 3BRWD 4PC2A 3X1YA 3MCAA 1SKYE 1CJMA 5CJ2A 1Z0FA 1Q1EA 3RRMA 3DVLA 1W36B 1XX6A 2ZJ8A 3G0HA 2OCAA 2Q9BA 4EDHA 1KMHA 1W2GA 1FX0B 1X1SA 4XJXA 1H8EA 2VO1A 1IXSB 4KI0A 1AN0A 2FDCA 3IQXA 2N46A 2MSCB 1CJKC 3QPVA 3BK7A 4MUBA 4Z1MD 4WAUA 2C04A 2EFHB 4B35A 2AD5A 2O8DA 2BJVA 3LH5A 2A5YB 4M8NE 4A2QA 1ZM4A 4DSNA 4LDJA 4HLUA 2BC9A 2ZR9A 5DI3B 3WRXC 2IS4A 4HEJA 3LBHA 1E2LA 1G7TA 1KI6A 2IEZA 1VIYA 2D7CA 3TMKA 3PEWA 621PA 2OO7A 3VHXA 5J5CA 2GDJA 2IXFA 3QXSA 2QUZA 4MKIA 3HWSA 4GP6A 2JGNA 2OUKA 2QT0A 2W6ID 2JLVA 2O8BA 4XIGS 2ZROA 3FMOB 1GRQA 1W48A 3WBJA 1AQYA 3TW4A 4BFVA 5J4HA 1E79D 1GM5A 3MGCA 4IOMA 5KHOC 1GL9B 2WIBA 1YHNA 3TUIC 5KDOA 3LXRA 3B78A 1UPTA 4PQFA 4R2HA 3KQKA 2Z4SA 2RHDA 3QVUA 4IVQA 1NN3A 1V5WA 1XB2A 2ZSDA 3GLHB 3WBKA 2DFLA 1E9CA 3VHLB 3I72A 2ZI9A 4E07A 3Q5EA 2VIIA 3D3QA 3KUDA 2VEDA 1QF9A 2JJ1A 2Q3MA 2ZRIA 2CLCX 1FX0A 5HZKA 1RJ9B 4OQFA 2Q0HA 3W90A 4O0MA 2B7CA 3KJEA 1HV8A 4WZ6A 1W0JA 2WTUA 2PJZA 4CEIA 2QP4A 1DARA 1T3SA 3GLGA 1SVIA 1E1RA 4NH0A 2C9OA 4GZMA 3SJZA 3VR2A 3D6TB 3E1SA 1WBBA 3ZS9A 4ESHA 4W5WA 4L8GA 3J81k 4F92B 1YR7A 4XD7D 2GVZC 4QOSA 3ONWA 1SULA 1X3SA 4TSFD 1E1QA 4IHQA 4BZXA 3AKDA 4LYFA 4C2TA 1K5GA 1Y3AA 1N6OA 4CEHB 3PFIA 1S3GA 4D4JA 2EW1A 1HE8B 4NCNA 1NVVQ 4LCBA 1IY0A 1N6KA 4DBLC 4NDZA 1CJTC 4P3YA 4A92A 5HE8A 4FI3C 3RHFA 3FVQA 2REXB 5D3QA 2BCGY 4A0HA 4B2LA 4P4TA 1HEIA 2IYRA 2IYLD 1NMZA 2QQEA 3U4QB 3LY5A 4P4SA 2H1LA 4QGAA 1E4VA 3ADBA 3SN6A 1ELOA 1R5BA 2HV8A 3DHWC 3CNNA 3QOFA 2AWOA 4GOJA 3IO3A 1US8B 3R9XA 4GRAA 1F2TB 2HXYA 2VF8A 5EE3A 3NKVA 1ZINA 1G21E 2V7QA 1H65A 1PUJA 2G88A 2O8EA 4A9AA 1OB2A 1JNYA 2BMJA 1OSNA 3DMNA 3LQQA 1F60A 1ONBA 1SHZA 3SEAA 3SYKA 5JSZB 3BD9A 1J8MF 2CCGA 3WMFA 4LYJA 1WDTA 1E9DA 1T9HA 3LVQE 3ZD7A 4HDCA 4Q21A 1VIAA 1CULC 2IK8A 3TBKA 3X1DA 3X1XA 4QXAA 1U94A 1UEJA 2RGEA 4JVSB 4M1WA 3I73A 1U90A 4QNMA 3K0EA 1W4RA 2WWGA 5FOXA 5EXXA 3T12A 2NO7A 5K8LA 2ECKA 4FCTA 2FA9A 2ZEJA 3WNDA 1XRJA 1YJ5A 1JR3A 4LC1A 3CIOA 5BWMA 1OHHD 1U9IC 2C95A 4KVGA 1GKIA 4DSOA 2AXNA 5DGXA 1KTVA 1JI0A 2J7PD 5JWRA 1S96A 1G5RA 1PLLA 5FTNA 4CEJA 3L8ZA 5HKKD 1NF3A 2YNMA 3W5IA 3TJZA 1BYUA 1KI1A 3THOA 3K70D 2LCFA 4LK2A 3UPUA 3CNLA 3CX6A 1E2DA 1R5NA 1X1RA 4KHZA 1T0HB 3TIFA 5IRCD 2CHVA 3WMGA 4ERNA 4CVNA 1CRQA 3W3ZB 5E95A 4V0ME 1V43A 4FWTA 2V4ZA 2ZSEA 1S1CA 2EFDB 4BFWA 1PUIA 3AV0B 4OHYA 3KKQA 2FSGA 1XCMA 3L82B 3BE4A 3CPHA 3ZIAD 3VQTA 3CPEA 3SHFA 2IL1A 3CLVA 2FPLA 4B73A 5JBQA 2JLSA 3FKSA 4N3NA 4PC7A 2H5EA 5FBQB 1LW7A 2ZRCA 1ESNA 2IYSA 3E2IA 5SZIA 3T1VA 4Q18A 4DZZA 5FTJA 3MWYW 1FQKA 2AD1A 4KFSA 1J70A 1XTSA 2X8AA 2J1LA 3B9PA 2GF0A 3BH6A 3REGA 3QF7A 4M0LA 4PAOA 4C0HA 2XITA 4DXAA 1JR6A 5FOVA 5EJEA 2CJWA 3DZDA 4ILEA 4DIDA 2BVNA 2RB4A 1FZQA 3FHCB 4MRRA 5CK5A 5GVSA 4PHTA 4PFSA 3LX5A 4ESVA 2VBCA 1XD2B 3FOZA 3ECCA 3Q7PA 2IT1A 3BH7A 3Q9LA 2IS1A 1KYIA 1ZUHA 1RVDA 1UKZA 2BJWA 5FL3A 5G41A 5CDFE 4OQMA 3ZQJA 4PSKA 3VR6A 2QGNA 5DO9A 5SZKB 5JI3E 2YINC 1XXHB 1PLKA 4XVUA 1W7AA 4DLYA 2V6IA 2WWXA 5G3YA 3TAHA 4LJ5A 3HJNA 4NKRA 5E4FA 3K0CC 1KK2A 3KZ1E 4M9XA 2NO0A 2P65A 3X2SA 1NLFA 1OB5A 2ZVPX 2CE7A 4A0GA 1XMIA 4NCKA 3NBFA 2ZIAA 5AJWA 1W36C 1EXMA 1KSGA 4DB2A 4PTLA 1TTTA 3K09C 3CX8A 3LQRA 2QBYA 4QRHA 4A6XA 2BBOA 3LW7A 3UWOA 1P5ZB 2ZJYA 1TPZA 1XTIA 3GFOA 3QKSA 1J7KA 1AGRA 1N5KA 4IDOA 4IOLA 4RD3A 1EG7A 1RYFA 4GZLA 1Q44A 2F1IA 1OKKD 2ZS9A 3F8TA 2ZITA 1N0UA 1R8QA 3EC1A 4DUGA 4DDWA 1W0KD 5CK4A 5BQ5A 3T1OA 3NDBB 3CF6R 2VSOA 4BLRA 3PJRA 1SVKA 4IXMA 4LJ4A 4JVNA 3TSOA 1JEDA 1S4QA 4LBVA 3JVUA 3ZJYA 5L3SA 1CRPA 1UFQA 2CK3D 2FPMA 2ZYWX 1W36D 4I1UA 4KO8A 1SXJA 3C14C 3ADDA 2F1RA 2ONKA 1XCGB 3AGPA 2BWJA 4PX9A 4DJTA 3KFXA 2J46A 4Z8YA 4E22A 2J87A 3R7WA 3N5CA 1FP6A 2JLRA 2WSSA 3ZH9B 1RIFA 1FTNA 4CEJB 5L3QB 2UVQA 1TU4A 3AQ4A 3ZYCA 4PHFA 4KJZA 4HAZA 4BQSA 2ODNA 1XDBA 2BBSA 3SS8A 5GJVC 2GCOB 3HU1A 721PA 3TGPA 1WQ1R 4YDSA 3IUYA 2A2ZA 5CYOA 1E2MA 5F3WB 4P0TA 2GAAA 2RGDA 2WMOB 3CR7A 3OESA 5CB6A 1OXSC 1W44A 3B5JA 1ZYUA 2IHBA 4TTPA 2QY9A 3IHLA 1IM2A 3ASYA 4IVPA 1Q3TA 5FI0B 4C2UA 3EAQA 3EZ7A 1KDTA 4B2IA 4XTRA 4TYYA 5JCZA 4PZZA 4F4JA 4GOKA 1OF1A 3PENA 3ZS8A 5ELXA 1IBRA 5JSZA 3IIMA 5KSZA 4AK9A 4F7WA 1YU9A 3QKRB 4QGHA 4TMXA 2FEOA 3IKJA 4PO9A 5JWOA 2J0SA 2FOLA 5EZ5A 2XTMA 1MV5A 1UDWA 1GRNA 4LBWA 2E87A 2FFQA 3OAAD 5FPYA 1CJVC 4BGDA 3Q8XB 3E70C 1T4GA 5E7MA 1D8TA 3D31A 2VL7A 2RGXA 5FFMA 4GP7A 4R7ZA 4DDUA 3IEVA 1NVUQ 2MSDB 4OK3A 3U3RA 2VHQA 4OYHA 2V1UA 2ORWA 1UBFA 3LA6A 1NVWQ 3OIYA 4RD0A 4UXJA 3M6AA 4DLXA 1CEEA 4DDTA 4HLDA 3I5XA 4JS0A 1G7RA 5FUWA 2CK3A 1MO3A 5JCPA 1LF0A 3TAUA 3G5UA 3B85A 2YHSA 4UXHA 4AWXA 1X8LA 1UEIA 2HCJB 1I4TD 2VLIA 1II0A 4LJ9A 1JEEA 1VHLA 1S8FA 3EG5A 2CDNA 2CHQA 1SVOA 3GCGA 1BS1A 1EFHA 1Q22A 2BMFA 3K9NA 2W00A 2O8CB 2BBWA 1G8YA 1R7RA 4JBYA 1ZM3A 3EZFA 4NE2A 1TQDA 1MO4A 4HYYA 3TQCA 4O3MA 4TYPA 2WBLC 3HPRA 2H8KA 3I61A 4PR0A 1I4DD 1TUEA 2GXUA 3BOSA 3K70C 2IYTA 4QHYA 2H17A 4UNNA 2ZQ5A 3UMFA 1ZCBA 1GAJA 3VR4A 5P21A 5B64A 1VMAA 4PC3A 1H8ED 1Q1ZA 2Z5FA 4G5SA 4KODA 3I5YA 4M4SA 4IKEA 1G8GA 4Q19A 2Q3HA 5CLQA 1M6NA 2F43A 2A5FA 4IDPA 4QL3A 4EQ6A 1CJUC 1KJYA 4RVCA 4BEJA 3EZ6A 3OE7D 4Q1EA 2FFHA 2N1BA 2JLXA 4JKYA 1DAGA 4LYAA 1XMJA 1JPNA 3I8SA 4US0R 2BKEA 3SNHA 3OF5A 2C5LA 3TUJC 2G3YA 2IYVA 1MO5A 2CEAA 1GL6A 4NBSA 4URVR 4NP6A 4WXRA 1EFUA 4ZCMA 5FI1B 1VCIA 1IJEA 3GJ8A 1NN1A 2V3CC 1XD2A 1OFTA 1UBEA 221PA 2BKUA 2RH5A 2WJVA 3DEFA 2JAQA 4LWZA 2W6IA 4Q4AA 4C4PA 3SBEA 1AGPA 2NZJA 5EP1A 1RPZA 2ZRLA 4BFYA 1U81A 4CDGA 1E79A 4PPGA 1GITA 2FU5C 3LWNA 3NVAA 4Q4JB 3M4YA 3GLFA 1GWNA 1E9FA 1IJFA 1JPJA 2EYUA 3JZMA 4ARZA 4HB2A 2OILA 3AP2A 4G01B 3QIAA 3GLHE 3ZZ0A 3RLFA 4PO1A 3MG9A 2FSIA 4Q1BA 1FUUA 1YZKA 1KK0A 5AK0A 1QHHA 3U7FB 5KSYA 2ZUCA 4K81B 4XWAA 2C99A 3EA0A 2WMNB 2XXAB 3KQLA 5H1YA 1P6XA 5FR1A 2NOAA 3B13B 4HB4A 5EE5B 4DLZA 3ADCA 5LD2B 2BIFA 4BFXA 1SQ5A 1G3MA 2RGCA 1Z06A 2H7VA 3DKPA 5DH9A 2RMKA 4JLDA 1KI3A 5DN6A 4KITB 5J4VA 5KSOA 4LHZA 2GJ9A 2WSSD 3QKRA 1AIPA 2IW3A 2QG6A 3ETLA 5EXTA 4PPQA 3A6PC 1G6OA 1N5JA 2PBRA 3PIRA 1EK0A 3N2EA 3RS4A 1U98A 1LS1A 1COWD 3QBVA 1QHHB 2HF9A 4PAQA 1QVAA 1G8FA 1IXZA 2PMDA 1J2JA 1JJ7A 4JYCA 3VKWA 4A8JA 3A8TA 5EZ6B 2OV2A 3RRZA 2XZOA 1T91A 3ZLJA 2YOHA 5FTKA 2VTKA 3PXGA 2XNDA 1YZGA 2ZRDA 1KNXA 4BFZA 4Q03A 5EE1A 5CDFA 2P5TB 2Z83A 1NI3A 2Q6TA 3A1TA 4MYHA 2N42A 1VECA 2RGBA 3X1ZA 2P3SA 1DBSA 1E0AA 1T6NA 3SZRA 4FWIB 3I62A 4AG5A 3LFUA 2PX0A 1M34E 3GJ5A 4DCVA 4DCUA 4UJ3A 3K0AB 3P1JA 3LLUA 2QAGA 2NO1A 4LBYA 1WE2A 3FDIA 1X6VA 1HUQA 4OJQA 1TNDA 2RGGA 2FF7A 1W4AA 5CITA 5JJIA 1N6LA 4NYMQ 1TAGA 2G0NA 3FFBA 3WNCA 3H86A 3U4QA 4LV6A 4RZ3A 1Q3HA 3QXJA 5DI3A 1NG9A 3LX8A 3TR5A 1G8PA 2VHCA 1TQ6A 2OBNA 1HT1E 1D9ZA 4JLJA 3RYTC 4R71A 5EP4A 1E1RD 3B82A 2O0HA 2IXGA 2XEXA 4JLMA 2HYDA 3NHAA 2WM9B 2QE7D 2GF9A 4V0MA 5DSZA 1HE1C 2QM8A 4L15A 1KKLA 1DE0A 1UADA 4PHHA 1KI4A 3TSZA 2TMKA 2HXSA 2PT5A 2R6DA 1LTQA 2A5DA 3V4RA 4A2PA 4M53A 1IOZA 2QORA 2DY1A 2J5XA 3PUYA 2MMCA 5F98A 2P6UA 2HCBA 1JQLB 3IIKA 1IXRC 2QP3A 4B32A 4BLQA 3C8UA 1QRAA 3L2OB 1S9DA 3MMPA 2LKDA 3UATA 1EFCA 2QP9X 4AC9A 2VHUA 3QXCA 1DAMA 1KK3A 3WP1B 3VX3A 5LDDC 1W0JD 1DAKA 5CYPA 1AS3A 4FD2A 4B6FA 5AJZA 4OQNA 2QPTA 2KBEA 4PHGA 4RFSB 1NY5A 2AR7A 3HDTA 1S3SA 5CM8B 5IHPA 4HAVA 4JZKA 4M1KA 2GCNA 4NCJA 2A5JA 1HT2E 3CWZA 1QHYA 1NBME 2QMHA 1KJZA 1DEKA 1W5TA 1I2DA 1R10A 5EUQB 2KSQA 2OAP1 4YONB 4PQYA 4DLSA 4DLUA 4EFMA 3GJ4A 2ZR7A 4QFMA 1E32A 5J47A 1ETUA 1LF5A 1RRFA 2ZRGA 2LWIA 4JLNA 3DMDA 3A4MA 4MQBA 2D2FA 4DKXA 2ZRNA 4DDVA 1CR0A 3R20A 3LXXA 2ZXUA 4DSUA 5EUMA 2EVWX 2EWVA 2QI9C 3KKOA 5BN4A 4D0GA 4JJKA 3R9WA 3SYNA 1PVOA 3A37A 3L0SA 1YZTA 1XJCA 4R9UC 1E6CA 1WMSA 3GJ0A 2QN6A 4ZI2A 4HUTA 4UNQA 1Z28A 1VCOA 2FV8A 3SR0A 2FPKA 3FFAA 4OJKA 4Q9HA 2IHYA 2G1JA 2V8OA 5CM9C 3CBQA 3HYRA 2I3BA 2J0VA 5H68A 3WNBA 1X8JA 1VG9B 2VHTA 1G8HA 2Z43A 2VHJA 2GK6A 2FNAA 3KJHA 1XPUA 1SGWA 2ATVA 2DWOA 1XEXA 4MRSA 4XVQA 3THXA 3K70B 4M9SA 1Z0KA 4HLUC 1HURA 4TLBA 2MMGA 2PJRA 1L4YA 1Z63A 4M1OA 5DHFA 1E98A 1NNEA 3GLIA 2FSFA 2G77B 2GESA 2ZI6A 1SXJB 1ZNZA 3A4LA 2Q21A 2RGNC 2BMEA 3PCRB 2CVHA 1G291 5FPSA 3UXMA 1T8TA 4GPTA 4LHXA 1OXTA 2DPXA 2BM0A 4MITA 1DO2A 3LD9A 2XNSA 4O2LA 3LW8A 4Q4HA 2QRNA 3EA5A 2W83A 4LOAA 5AUNB 4G5RA 3QUSA 2DCUA 4LHYA 3QVVA 3A58B 1GTVA 3SU8A 2QL6A 2ZI5A 3BORA 5TXGA 1WCV1 5C2JB 2FG5A 1OLOA 4KFRA 4PAMA 2F9LA 4QBFA 3QF4A 3SC3A 2GAOA 5JRJA 1CP2A 3TLXA 3ZGXA 4D81A 4DC9A 2IYZA 2O5VA 3HR8A 5IDVA 4C30A 4W5HA 5HTKA 821PA 2QBYB 1FTSA 1NKTA 2BOVA 2PCJA 2IYWA 3E5HA 2DWPA 1ZAKA 1P75A 4Z51A 3QPUA 4MDFA 3M1IA 2IUSA 3QSYA 2P0EA 2OZEA 3F3YA 2QTFA 1DAIA 2IX3A 4UNRA 3RWOA 4NYMR 2QSYA 1F48A 2QZ4A 2JCSA 3HR7A 4YMVA 3TK1A 1NIJA 4Q47A 2DFKB 4EJSB 3ICQB 4KLNA 2JASA 2P67A 5AWFC 3CKLA 4X8MA 2KE5A 2XB2A 1Z0IA 1KSHA 2DB3A 2V1XA 4GMDA 4IXNA 2ZRBA 1A2KC 4JBWA 1G16A 4HAYA 4LJAA 1G41A 2Y8EA 3MRSA 3IPXA 2ATXA 3Q7QA 4TSFA 4BZQA 2CLDX 4B76A 2YYZA 4L5BA 2R44A 2GJ8A 4Q00A 4PPFA 3AVXA 4A36A 5B58C 1RC8A 2AHOA 3KUCA 2UZ3A 1GDDA 1P2SA 4JYBA 2IWHA 2OLJA 1R8SA 1XTKA 2WKQA 3NBXX 1N6NA 4NYIQ 5L3RA 1KDRA 4AYWA 5JFGA 1Y63A 4CT5A 1XFAA 1Z07A 4LC0A 1KDOA 1D9XA 1OPXA 4D4LA 1IY2A 1HA3A 2R6FA 4C0BA 2A78A 2FN4A 1AJEA 1F2UA 2ZRHA 1MRNA 3LRPA 1OIVA 4PPNA 3F5FA 2ZAOA 1RJ9A 2CL7X 2JJ2A 5AJVB 3TQFA 1KSFX 2J7KA 3A1VA 1U8ZA 5FBVB 1OIWA 1SVWA 4UQOA 4F91B 1SZPA 4BLOA 4MKFA 4R2IA 2B6HA 1VYTA 1E1QD 1Z83A 2EYQA 4QBHA 1VCMA 2CNWA 4DLVA 4QC2A 1GNRA 4XWKA 2OCYC 3FKQA 4H1VA 1XEWY 1II9A 2WJGA 4LY6A 2ZI7A 3EWSA 3PV0A 5M04A 2O8BB 2RAPA 2WOJA 4HAXA 3AH8A 1OH6A 1D2EA 2GTPA 4KFTA 2OE2A 2XOKD 1IHUA 2JA1A 2BDTA 1ZUIA 2GXQA 3ICEA 2OHFA 3CPJB 1VYVA 1Q1QA 1XXHE 3BFKA 4PQRA 2DR3A 4BFTA 4MGKR 3QKSB 4Q02A 2DFTA 1M2OB 5HCNA 1YQTA 4F93B 1KY3A 2IUTA 2OCBA 3UWKA 2BV3A 4CW7A 2WOOA 5LPNA 1G9XA 4JLBA 5G40A 2C8VA 2VSXA 3RANA 2O52A 1D5CA 3U44A 3VKGA 1ZBDA 2WAXA 4Q1DA 2CNWD 1GOTA 3P32A 4KBGA 3FPAA 3MUFA 1C9KA 3NIBA 4GNKA 2NO6A 4D25A 1GL7A 2QENA 4ABYA 3U44B 4C0JA 1BH2A 2GCOA 1AA9A 3L0OA 1AKEA 2PZEA 2NZ8A 1WB9A 2VP6A 4M21A 4MH0R 1AZSC 4RSGA 2XGJA 3UG6A 1U2RA 2EFGA 3QXXA 1A7JA 3MSXA 3NHBA 5LB2A 1QBKC 2ZRKA 2ZRMA 5HCIA 2HEIA 3R7WB 1EX7A 4MGZR 2H18A 3B1VA 2Z0MA 4RD1A 1EWRA 1JJVA 4URZR 1BMFD 1DELA 3DZ8A 3DKVA 4V02A 2B7BA 3DO6A 2FFAA 1C4OA 1ZC4A 1EGAA 3S1AB 4D2IA 2JJ1D 3QG5A 5D3MB 2CL0X 4EKDA 3CH5A 2QM7A 1KK1A 2OFXA 2H92A 4ITRC 4IVRA 2ERYA 2XZPA 4NYJR 3QXHA 2W2VA 1P9RA 2GXSA 3THXB 1M74A 1N5LA 4AURA 1TQ4A 3OAAA 4X8HA 3FGNA 5D3MA 4JMPA 4NONA 2ZSFA 4LJ7A 4XH9B 3T06B 3TUZC 3IGFA 4OQXA 5JS7A 2PT7A 4IDHA 2GEUA 1JAIA 4TQAA 2D74A 4HZUB 4LUCA 4B48A 4V0LA 3AVPA 3H4MA 1MH1A 3MWLA 1ZU5A 1P61B 3ZDQA 2VF7A 3RS3A 4C0QC 1SVMA 2GK7A 3ZVLA 3NDPA 1LV7A 1YR9A 4RD6A 2QA5A 1KO8A 1VG1A 4EIWA 1EX6A 4TYNA 3BB4A 4XSGA 5FOTA 4G5QA 1COWA 2FMXA 1LFDB 2QROA 3GEEA 1T5LA 1XXHA 4YMUA 1R4AA 1R0WA 4KV9A 2X1VA 1Z0DA 3U7HB 2XAUA 5FL7A 4PZYA 4EFLA 4C0AC 4DWJA 3GD7A 4LYHA 1E2PA 5KO2A 4GSYA 5JLJA 2OSBA 1U8YA 2PL3A 4FIDA 2ZJAA 4MGYR 5F2EA 1N2CE 3JZAA 4RY2A 4DHEA 4Z54A 4FMCF 3PEYA 4A8JB 4LRWA 2VP4A 1ZW6A 2O0KA 4W9MC 3MJRA 1BKDR 3CX7A 4AKGA 4RJLA 4PANA 2NO9A 3BS4A 4J0QA 2CE2X 2AX4A 1UJ2A 1AQUA 1L4UA 2ANBA 2CBZA 2G0TA 1CKEA 4Q4AB 1TQ2A 1PZNA 4B3GA 4ZPXA 4QNRA 4B47A 1ZM2A 5JEDA 2WJJA 1FMJA 1R0YA 4AIIA 1SXJC 1R6BX 4U7DA 4HUQA 5AUOB 5BW8A 2B8TA 5UKDA 1OFUX 5C46F 1II8B 1OYWA 3FHTA 1GP2A 1OYYA 2OFWA 4LSGA 2FFBA 2OBLA 4OHXA 3D8BA 4ZO4A 4JL8A 2QPOA 5K8UA 1QHSA 4EPVA 4AKHA 1KMHB 1KY2A 4WOPA 2GHIA 3EX7C 3V9PA 4M1SA 1P72A 1U0LA 1YRAA 3CUEF 4M1YA 5K8TA 5JEEA 2H57A 2ORVA 3U6KA 3NXSA 4CGZA 1Q20A 2PCLA 4B44A 2CCJA 1A2BA 1JXMA 3K9LA 1IAQA 1NKSA 3Q3JB 3KJGA 2ZS7A 3BIFA 4WZAE 4BZPA 1JQJC 3RDPA 3SOPA 4A0RA 2HYIC 1ZUNB 2HDNB 2ZS8A 1P3JA 1QHGA 3IBGA 1DG3A 3K0FA 4DCSA 3R8FA 1XEWX 2ZE6A 2VPPA 5G53C 1W0KA 4Z8XA 4OI4A 4IW3B 1JALA 2AL7A 1RZ3A 5J4LA 1Z29A 1R5OA 1D2NA 3SJCA 3WHKA 2CVFA 1P7CA 3VU9A 1M7BA 4FXPA 2R2AA
chains in the Genus database with same CATH superfamily
4NE9A 1DRVA 1PK9A 4PFQA 4PX2A 1QIIA 4O6VA 3RE1A 3T7JA 1V7QA 1KIMA 5CCEA 3BJIC 4JASB 5CT9A 5C4MA 4DVJA 4CI9A 3L0CA 1OCEA 4C76A 3HY6A 5TQ0A 3R0VA 2DQSA 3IIJA 3NAZA 2XI4A 4M89A 4QUHA 3NO4A 1TF2A 2HSDA 3IILA 4HLCA 2Q9UA 2ODQA 4Q7MB 4F0JA 5HBGA 4XDHA 3BQMB 3EHDA 4MYCA 1YRBA 4X61A 4YCMA 1LX7A 3GMIA 5JLAA 2Z57A 5KVSA 3C39A 3BG5A 2RGUA 3B7GA 3KDSE 4EATA 4QBGB 2POCA 3SHWA 1DTWB 5GADl 3H0EA 3O9ZA 4RO0A 1TJNA 5AOAA 2YZ2A 5CDUA 1U3VA 1QTRA 3HCPA 3WICA 4CLRA 2EDAA 1SCBA 5K01A 2BEWA 2G28A 3NM4A 4WESB 5IJZA 2R6GA 1J21A 2CLSA 1BFKA 4CKCB 3G13A 2QN7A 5JPIA 3B8HA 3LUFA 1AMOA 2DAPA 4MLZA 5E7JA 5DX1A 3G88A 3T1NA 2B7LA 1DHRA 4DA7A 4ZI7B 3RTAA 4G5HA 4UTNA 2VZ8A 2K6GA 2XT0A 1HORA 4TWAA 5I7WA 4NVRA 5L3VA 4TUYA 2YWFA 4O2RA 3O1IC 3TOZA 1VBFA 2X19A 1WZNA 3T7DA 4H6XA 2NZYA 3CVXA 3OQIA 1A3CA 4MJLA 2PGXA 3JQAB 3WTBA 2AKAB 1XTTA 4RK1A 3OY7A 5EMHA 4EUHA 4H08A 1QOQB 1UPFA 3IEIA 2ZAYA 4IEEA 4O59O 2OQVA 4CE6A 4ZYTA 2RI1A 3TNJA 1H94A 3WLOA 2X15A 1FUYB 1UXOA 4FKMA 4G0ZA 4AJHA 2XCQA 3OLCX 3KB1A 2I54A 1CR6A 1C3LA 3DG9A 1KZ9A 5BVGB 1DBVO 1KBQA 4XWYA 2O7SA 4RFSA 2PWYA 4W6ZA 3V8RA 3WGZA 1ZNQO 4NE2A 4MX8A 2QMUA 2GZAA 4U2CA 3VNQA 3BA6A 1RYHA 2P9CA 4YRDA 1I80A 2AFIA 2G8LA 1AY0A 2G82A 3ONFA 2ZIXB 1LPSA 4JUBA 4V39A 4POAA 3KC2A 3MXTA 3OEEA 1F2UB 2BT4A 2QD5A 3GDWA 2F8SA 4ZHQA 1VOTA 3ENWA 3L5OA 4V3CA 3CZPA 3WFIA 1ZR4A 1UL1X 4C7OB 3DSRA 3KXLA 3QFTA 4YQFA 4ZI3A 2P9YA 2X1HA 3VSDA 3KALA 2IFTA 4MUXA 5ERXA 3WIVA 2E1RA 1T3TA 5FJIA 1BAPA 4OGGA 4U8GA 4MVJI 1BW9A 4LOLA 1WBDA 7REQB 3HN7A 1I7NA 3CE9A 2QN9A 4P35A 4XB6B 4K0RA 4ZGWA 5F2NA 5JS1A 1QYDA 3SCZA 1YVUA 4KSCA 3RIHA 1A98A 4YRBA 1ZHOA 3Q11A 1IQPA 2ST1A 2VF2A 3F5QA 4TS9A 4ZKEA 2CZQA 3GLKA 1QO0A 2ZTUA 3KQMA 4B2PA 3MINA 4TLCA 4TQ9A 4BKQA 1JNXX 3NJ8A 3QUBA 4U3JB 3SZGA 2ZIFA 1SKQA 1N57A 4JC4A 3ZGVA 2EV9A 2R62A 5ABPA 3C3KA 3ROMA 1IN5A 1DEHA 1WUYA 1Y6JA 1YR6A 1NXQA 4TX1A 1Z6ZA 2HLDD 5IK2A 5J9FA 4N0EA 1B0AA 2QZZA 5DNCA 5EE0A 4ZDIA 4ZYYA 1XTBA 4ZQCB 5K3EA 1ODFA 1CZHA 4KAXA 4ZVOA 4BQIA 5HFJA 4CI0B 1Z0SA 1Q3KA 1ZNWA 2AK2A 2FN9A 3WLNA 4E51A 3CVYA 1ILWA 4P4UA 4RTSA 2Q27A 5TDHA 4DMMA 4W9NA 3PYLA 3RT9A 4IRXA 3CZRA 1H9CA 4IMJB 2PUFA 3UANA 2FPGA 3DBHA 2GA8A 2M1ZA 1ZD8A 5KNCA 3D9QX 4NBUA 4EBBA 1KY5A 2TMYA 1RZVA 1GGVA 2GGSA 4PO8A 4UDOA 2BDUA 1ONSA 1P81A 3CLTC 4IHJF 5AVJA 4JHLA 1SIBE 5KVCA 5LKRA 2C0CA 1NVVR 5TS3A 5JNVA 1YI8A 5AM2A 1QG2A 1NN0A 4DE5A 1DMSA 2QEQA 3QLUA 1R88A 1PF7E 3PFNA 3PSAA 2OPBA 3LO5A 4N03A 5KKNB 3IV7A 5D84A 3H65A 5J2TB 4B3BA 3RH0A 1XO1A 3F6YA 1TC2A 1RFLA 3JWPA 1SCAA 4FQ5A 5CEEA 2OO5A 5IC6A 4R6XA 2FGKA 4AO6A 4JBGA 5I9NA 2WPDA 3PJFA 4B3XA 2O5CA 4EWLA 3I2FA 5AK3A 1JSRA 2XCSB 1UBUS 4RHUA 3ETCA 2Z9CA 2ORED 3CRNA 3GPDG 1TMGE 4OXNA 3LC0A 4NBNA 4P4LA 4AF7A 3SE0A 4US2R 5IM4A 3CFYA 1WIWA 3LC7O 3QPWA 4WCVA 4XA8A 2H1WA 2HPZA 2QSUA 2WPNA 3R3YA 1YUNA 2B98A 2ZXFA 4BIMA 2DLDA 1ZNXA 4N6OA 3D43A 4WACA 5JRJA 3D2LA 3M1YA 1I33A 1W85A 4XD7A 4C0KA 4HS9A 1FFEA 1YVRA 1D6NA 4WXYB 1R64A 4OHZA 3CONA 1PWXA 2G08A 3HEAA 3E05A 1RXEA 2V7VA 4MTCA 1BKSB 2JGRA 3AILA 1Q6ZA 2HO4A 4DAOA 3PZBA 1OAOA 4NAUA 4K2AA 1AUQA 4HI0E 1M0EA 1JA1A 1F0YA 5CH5A 2Z1DA 1GFZA 1SIWA 3KZVA 1P8AA 3KD2A 4CU2A 2PGJA 3PPVA 5MF6A 3ET4A 3GJXC 3VU9B 1US8A 5ADWA 3V55A 3W6ZA 2ZCJA 1ISPA 1JFSA 2CXHA 5GINE 4RPCA 2CT8A 2Q4RA 1H1DA 4HNGA 4YNBA 2IVZA 2Q3FA 4NTZA 5KYXA 1ZITA 4YBZA 3D1JA 1NV9A 1ZISA 4HNVA 4LWPA 3U1VA 4MV1A 3NHYA 3UNXA 2GX6A 1R0LA 5IT4A 5KYYA 1GIAA 3QV2A 2ZR0A 5I3CA 5DYWA 4KRFA 2KQUA 1YBFA 1GCUA 1Z5UA 1EFPB 1N25A 3FYUC 3C6XA 1NN5A 3B6EA 2ETVA 1ZK3A 4JKIA 3CEPB 2OGTA 3HACA 1K5PA 4C7BA 2O23A 2QAGC 2V0CA 4K5QA 1KH3A 3AONB 2OFFA 2JGJA 1GLGA 4IEFB 5DE3A 3RK4A 1K63A 1UXJA 1ZNYA 4V0SA 3WXMA 4ZJUA 3OT1B 4JT8A 1KERA 5FRDA 3OLVA 4ZV7A 5DGIA 2QNBA 3FVWA 2Q28A 1R6DA 2B9EA 3H5RA 3PA6A 4G1BA 2RHGB 3T1QA 4HNUA 4WE3A 4ALIA 10MHA 1SQGA 3SDZA 3CRRA 2M1XA 4PSVA 2JFZA 2VKQA 2P4UA 4UAUA 3TDNA 4WCFB 2XA9A 2PGOA 3QMPA 3PR2B 2CNOA 5G1OA 3WP0A 4E5SA 3SVLA 3FUVA 1XP8A 4W7SA 1PZHA 3GN1A 3W34A 1CY2A 4R83A 3C8HA 3QVXA 2QTCA 1P5HA 2JIZA 3M49A 3ZS9A 1TD1A 3A3YA 3BWCA 4IQ0A 4BTVA 3FUWA 2QTTA 4QJ3A 2A94A 4MTLA 3ZKAA 3CRMA 4X65B 3MJHA 2PRZA 1CNEA 4AY3A 5BWOA 4YJ3A 1U3DA 2AWNA 1ID1A 4ECEA 1Z33A 3GLHA 4DANA 4PIVA 1YJBA 2F9FA 2V7EA 3RTBA 5HQJA 3TEJA 2E6UX 3Q41A 4YXWA 4CIDA 3LSTA 1TMOA 3R7NA 2R65A 2JJQA 2X0RA 3O93A 1EX1A 2PEZA 1B43A 4QELA 4ANFA 4AYTA 1TK2A 2YRFA 1ZPDA 3EVFA 3ISVA 4UM8B 5FNVA 3TPCA 4DF3A 3QEJA 1A72A 1CFZA 1QIMA 3KYBA 4WMLA 2AS0A 2BTQA 3LP6A 3NBQA 1QRUA 2PH1A 4AM8A 1LLDA 2OWDA 1M33A 2WJYA 4ZOBA 2O0LA 3ZE0B 2QR2A 1AT1A 3OQOA 1NUSA 1A5AB 2RKOA 4U7TB 4TZKA 1BGWA 2PFSA 3MFYA 6YASA 4PGFA 4EARA 1W5SA 2D7DA 3K1JA 3NIDB 1BYIA 2CLIB 3GHYA 2W2XA 5E7IA 1HRDA 3DWGA 3AKZA 2P2LA 3I64A 4DV6B 2Y1GA 3ORHA 1UCFA 4L02A 4FHEA 1QGAA 2JEZA 2YHAA 2YZNA 3GELA 5ICFA 3PQ2A 4TMKA 4C7OA 2WJAA 3QY0A 1BXRA 2E0IA 2R60A 1C3OA 1JLLA 3ZCPA 3DWEX 4Q3AA 1ZOPA 3G6KA 1JB1A 2OOSA 1CQWA 2I2FA 1YFKA 3HHPA 3RYHB 3RYFB 2AN5A 3OKAA 2W2PA 4OHPA 1ZGZA 4YRFA 3AY3A 1PQUA 3ZWVA 5BQXA 5IKMA 5JDCC 3EVZA 5BW6B 5TF0A 4RH0A 3H8JA 1E9EA 4QUEA 5TV2A 1XPJA 3MS4A 1TCUA 4NFSA 4R5HA 4JXXA 3VU1A 1Q50A 2AFVA 3IOCA 5GIPE 3IEMA 5J1SB 1JBQA 2XTAA 4PF1A 4EZBA 4BNNA 1I1HA 5GVRA 3FCYA 4LHWA 2Q1WA 5DM2A 3CLRD 2VP9A 3K8ZA 5H82A 3JSXA 1FDIA 2WW8A 1C0EA 1BW9B 4DQVA 5T4BA 5DCWA 1FQJA 3PUKA 1PWYE 3RTEA 4QVIA 2UU9B 1RPNA 3JQAA 3O26A 1SKYB 3KYDB 4IDGA 4QT0A 3AJ8A 4U0KA 2PGLA 5JCXA 2G9QA 5JAQA 1AS0A 2C83A 4FS8A 1NOIA 1UIRA 3EZYA 3A25A 2OXRA 1QZXA 2XYHA 3BE5A 3GAFA 3GEMA 4HDNA 4INOA 2J45A 2ZIXA 2FUKA 2FZEA 4I19A 5EKTA 5L3ZA 3WYFA 1DBRA 2W6CX 2Z5VA 1F4LA 4OYLA 1YMUA 3GQBA 2FUNB 4IQGA 1JHZA 1HO3A 5FADA 3DEJA 1KZGB 1T5IA 2ESRA 3H1FA 1G98A 3IPYA 4KQ6A 3UCXA 2HWUA 1VBMA 4R1PA 4M76B 4NMMA 3ZDFA 1KI6B 5EWMA 2RIPA 1E89A 5F5LA 3GLVA 3F9CA 1YCHA 1R6TA 2LPMA 5F4BA 4WCDA 3EMKA 4FX2A 1KO1A 3EC2A 1UT5A 4CMJA 5J4KA 2PR7A 1AK1A 1HGXA 3D3WB 1KMNA 3Q8LA 4QU9A 1ENOA 3CNOA 4GM4A 4HRXA 1R66A 4D56A 1QQTA 2I71A 3P20A 4TT3A 4H0NA 4ZVTA 4AMBA 2YJTD 4M6WB 1RJDA 1XYYA 2HCFA 1A1SA 1WRBA 1IHOA 1OKKA 2BUAA 2Q46A 1LY1A 1W1WA 3L04A 2C2WA 2IF0A 3QUCA 4C3UA 2IDMA 1WNTA 1K7CA 3EIFA 1U7ZA 4M0CA 3GRCA 3N2IA 5DXJA 4BNGA 5AJYA 2J3QA 5JNTA 4X1OA 5J2UA 5FWAA 3VR5D 1Y33E 4ND6A 1QH0A 1CU1A 2GR9A 1NXXA 4ZAGA 1GVNB 4AS2A 2LCIA 2G1KA 3PWTA 4P4NA 3F1LA 3TI9A 1DUIA 1VCNA 2VUIB 4C01A 1ZK1A 5B2ZA 3RCBA 1EVQA 1UKEA 1ULHA 3AY6A 3GJQA 4RKYA 1G63A 1JQ3A 1M5TA 2HWYA 2XE4A 3RAPR 5FLYA 2A88A 1A71A 3PLNA 5FPKA 2I67A 3I8XA 1NRJB 1UQUA 3G2JA 3RG2A 1NHWA 3ZX4A 4C22A 5GJCA 1FOEB 3NTUA 5C8YA 4R1SA 4CV3A 3UWDA 1Z82A 4M87A 1CF2O 5C5CA 1KMQA 1OBCA 2X5XA 5FQNA 1V1MB 2CNBA 2OHOA 4FDUA 2XGSA 4WDQA 1RHMA 1NW3A 2ERXA 2JNWA 2RKWA 4OHWA 1TIKA 3H3FA 4CPDA 1M2OA 1RFGE 1YOVB 1JQDA 4UHDA 3HBJA 1KGDA 2ZWPA 1EG2A 3Q0IA 4CTOA 3BERA 3UY4A 1YAJA 1Z0JA 4PLYA 1BN6A 1IN7A 4M9CA 2FWJA 1N1EA 1CY8A 1O3YA 3H17A 3L4EA 3MN1A 2H7CA 1AH2A 4EP1A 3TH5A 5I7FA 1RXIA 1V9SA 4J94A 4KIFA 3CRZA 2FX3A 1N36B 3MJCA 4C7KA 5HS4A 1QNFA 3FLEA 4N0QA 1D7AA 1OXKB 4MS1A 4N3BA 1P60A 4C7VA 1R8JA 2BEJA 2YZMA 2W58A 4L0QA 4ZCLA 1SU4A 2NPFA 1NXTA 1YGPA 5DP2A 3UMRA 5L45A 1LI7A 3NATA 4C0LA 1TE2A 3NHFA 2R8XA 5KCMA 1VJRA 2PY6A 3LVBA 4DV2B 1SQ0A 2QMEA 1SY7A 3RC9A 3SM3A 4LEIA 1H2ZA 3COVA 3GCZA 3MYYA 2GN9A 5K99A 3PNVA 1IG0A 1ABBA 3IO5A 1XJ5A 3KKEA 3N28A 5L7TA 3BICA 5CLIA 4G6ZA 4C0WA 5TSDA 2ZSBA 1KZYC 1Q15A 2VT3A 3DAGA 3L0BA 4FGKA 2JD1A 2PH5A 3KLPX 4HTAA 4QYMA 3DQZA 4N54A 1P4HA 1QWSA 3F7NA 1USKA 1PT6A 1WP9A 2YNMD 3EIEA 3T5DA 5J2TA 3NKLA 4OKSA 1UXHA 5CT6A 1VC2A 2OD7A 3R74A 4DY4A 3A2NA 3MF4A 3PXAA 3BXZA 3EFOA 2JJ8A 3EK2A 2BD0A 1U9IA 3NEYA 5CM2Z 1R0XA 4RD4A 5J23A 2LGJA 2BR5A 4FBLA 1XDDA 5FX2A 3MQ4A 5FBWB 4BGEA 5DM60 3H3XA 2WKSA 3RABA 1MJ5A 2P5YA 3QJYA 1QVRA 5BQOA 5BV7A 2HQRA 3H1BA 1N3LA 4B79A 4GL2A 2C1EA 1XJWA 1Y7HA 4FOSA 5FR2A 1M1YE 1HQCA 2H2IA 3FMPB 2W6OA 2WTNA 1Q0UA 1QMPA 1UBGA 3GAMA 4IAOA 4PC6A 4RNCA 4TL7A 4IIJB 3ENKA 4XLLA 1YBVA 3N0WA 3PG5A 1UJ6A 1ODIA 3OIUA 3OIVA 3V8MA 4HDOB 3NKFA 4C88A 2W2TA 2EQ5A 1TO1E 3V33A 3JYLA 3FWKA 2Q62A 2KJQA 1VZ2A 3D6NB 3WO0A 2VJMA 3TRJA 4AECA 4LRUA 4U8HA 3D8TA 2QRLA 3R3JA 5ALGA 4ALMA 1OAKA 1MQAA 2WZQA 3R4VA 3S55A 1S8OA 2J9RA 2F64A 2WHQA 2R7NA 5CA0B 1CJCA 3WAJA 5GY7A 2ZJBA 2SICE 3V8PA 5LCXA 2WF8A 3U2QA 1JMKC 1XRRA 5L40A 3W3AD 2IBMA 3KEMA 3OPVA 4Q1AA 3R0XA 4DCTA 5C7YA 2YDYA 1NKVA 2DHEA 4BKRA 3PX7A 5EIFA 3HB5X 4PU0A 3CW9A 1KA9H 2C82A 2GHTA 2GJSA 4RIIA 3V2HA 4G0VA 1U1IA 2HU7A 4JLOA 4QBTA 3WMEA 5D00A 4YLEA 4LJ8A 2I6UA 5F4ZA 1P1CA 1VLMA 3SR3A 4RJKA 1USWA 1XPOA 3NDJA 2PX6A 1OWPA 3HY3A 4CFSA 3DFUA 1HQYE 3Q2KA 4YJFB 2E7ZA 3OQ1A 1QP7A 1K6JA 3KG2A 1MLDA 4IX9A 1A9ZA 2MYUA 2WD7A 3VBCA 5IXSA 1Z7WA 1XNJA 4QULA 1FDTA 1DAPA 4PGHA 3IC5A 5AM0A 4TL6A 4YAGA 3C4JA 3L02A 1ZJ6A 4J4TA 4ZVKA 4HG2A 3I05A 3GBSA 4G0NA 2HWWA 3HU5A 4QYXA 3WSWA 3LS2A 1P45A 3WLKX 3EULA 1NTOA 3MGGA 4TMYA 4EUKA 4FFRA 5G2OA 5I4KA 3BILA 5TGZA 3EQ6A 1MB2A 1UFVA 2FW9A 2XQIA 4G5OA 5F21A 4HQNA 3NBZC 4PLGA 5FORA 2N0SA 4U00A 1OTYA 1O87A 4IOKA 5KU1A 3CF4A 3FMFA 1YB2A 4WVFA 5AJUA 2VJYA 4JP2A 3UHPA 3FA2A 4TUYB 3UV3A 4C43A 5CLJA 4CKBB 3RAFC 3AVYA 2BGKA 2JJMA 3STTA 2JAOA 3BJEA 3O5AA 3QNMA 1Y8ZA 5GJWC 1GTRA 5H0IA 4ZK6A 2C2GA 2MSLA 2BBTA 5M5BA 4UXIA 2P4EA 2C31A 5KINB 4YDHB 5LMNB 1K08A 1U0SY 4UUMA 3DFIA 5ILQA 2I3ZA 3UHOA 4DIKA 4YCSA 5KPDA 1E62A 4UREA 1WZCA 4WOBA 4GI3A 4Y0VA 3W79A 1XJQA 1BQ4A 3AJEA 5C1IA 2ZIEA 5A7FA 1DIRA 1OZ0A 1E1KA 2DTEA 3QI2A 5B53A 1T8WA 5FDFA 1UF9A 1WBJB 4BO9A 2QLNA 3F74A 4AROA 2XDYA 1Z5OA 3E84A 1H23A 3K8YA 2FPWA 2VH5R 3FE2A 5E9WA 2AE1A 3NH6A 3EUAA 1U2SA 2W6JA 2ZJ7A 3D0OA 4NV1A 5IYZF 3QEKA 4A8TA 4CU5A 1CQXA 3ZD6A 3OCXA 2VUTA 3T34A 2HQ1A 2Q6LA 3DHYA 2EU8A 3VHXB 5K0CA 2M6LA 1Y3CE 5K8CA 1BA3A 4X00A 1LPMA 3Q85A 5AKXA 1KJ8A 2OMEA 3NBUA 5G3ZA 3IULA 1FMFA 2DUUA 2HLNA 4EHFA 1PX2A 2QAGB 1MAVA 1WDWB 3KKNA 2PEYA 4IHKA 4GICA 5F3RA 1G9TA 5TPZD 3AI3A 4CYMA 2AQ8A 2IKSA 4MHTA 2WSMA 3RS0A 2FPXA 4M7OA 3V1MA 1LWNA 1PZGA 5HUJA 4AJNA 4JNCA 1OI4A 4PWYA 4TQUS 3GI1A 2NM0A 4CNQA 1F2TA 1S9HA 2J6CA 3BJZA 3LHKA 4EW3A 5BN3A 5KYTA 3T35A 4IEIA 3L05A 2OESA 3GRFA 4HDQB 3PJGA 4FJ0A 3PR3A 4O8ZA 1BWPA 4X6XA 5DHFA 3FDXA 5BW4A 3ELDA 3WKAA 2GD2A 1IEXA 3S68A 3O38A 3U7RA 1F7VA 1Y7IA 3IEKA 4YRAA 3E82A 2WNIA 4PRZA 1HNNA 4LPKA 4OI2A 2PMEA 1T9GS 2ASEA 4P4GA 4AG3A 1MVLA 2DH6A 2NYRA 3GLFB 3EIQA 1DT3A 2UXCB 1Z6TA 4FYVA 3KOZA 2H1VA 3UT5B 3X1WA 5D5PA 4EYOA 1R27A 4QWWA 5C37A 4KRGA 5LWHA 1F6BA 5D1NA 4JD5A 3FYHA 4A4DA 5U9CA 5K6AC 2PH7A 3VTAA 3W5JA 1TF7A 2A59A 3W8RA 4HATA 2GZSA 3OCJA 1G7CA 3C41J 3I9NA 4M88A 3AKCA 2WIAA 4I4TA 4J1TC 4LJYA 1SXGA 4WERA 4XIJA 1T43A 4CWAA 2C2MA 3PEEA 3GLIE 2X3UA 4OYYA 2P6NA 1XAHA 1HYEA 4X9XA 3BGIA 2VNAA 3KSAC 5K0SA 1A77A 4I5IA 5T8KA 3O3NB 2GWHA 1UMBA 4ECAA 5CGQB 5LZ5A 3UW1A 2WLTA 4NCHA 2JIPA 4Z3OA 1V37A 3S81A 2X77A 3K9QO 4RMHA 3P52A 4H35A 4IXDA 3W2FA 4MB6A 4DC1A 3F6PA 4LX8A 3MTIA 4Y98A 1GQRA 2FUG1 5HIJA 4QOJA 1M34B 2RHRA 1PIWA 4NU6A 4RWZA 5DBIA 5ECGC 4B0OA 3U61B 3PHLA 4GOOD 4EJSC 5K20A 3GB9A 1RRMA 1VMIA 2ONJA 2WKRA 4KOEC 3IQDB 1RYMA 4Q1CA 4EF5A 4BY9E 5GGXA 1H4SA 4EENA 3K0SA 5EZQA 1BOOA 1RW4A 2FEXA 2JH3A 2W2KB 3B52X 3H87A 2I8AA 5FUMA 3L4BC 5JJKA 1T26A 4RAQA 1ID8A 3DEAA 3OHPA 2WVJA 3L9XA 3BFVA 3H84A 4YWJA 2FP3A 4H60A 4M7PA 4O4JF 1OBVA 4EG8A 2FOIA 1JDPA 2QDKA 4PRYA 3TL6A 3ZIDA 1Y6ZA 3UJ8A 4DRYA 1GGEA 2GPYA 2Z98A 3UBTA 3VPCA 1JEYB 1V8PA 5DLEA 4XYMA 3ZU2A 5CFQA 1DADA 4DADA 4DUGD 2DFNA 1ISRA 5DPMA 2OGSA 4RCZA 2HT1A 4XD2A 1UZNA 4H15A 2GPBA 1D4AA 5JDCA 4IHAA 2I1VB 3KPUA 4G36A 1FNNA 4ND2A 1PK8A 3QIVA 1CRWG 1A8QA 4LJ6A 5GONB 3PUIA 4NLLA 2NTJA 2WAAA 3O4JA 4ZYLA 2OAQ1 4MZXA 4G67A 1I7QB 4D26A 2DG2A 5DNYB 3TR0A 2OV3A 1Z8FA 4EABA 3O8RA 2WJHA 3S2UA 4FHGA 3ROGA 5CVTA 1AZTA 1T8SA 1UC8A 2IDKA 2P1ZA 1AOXA 2D5IA 2VYND 4FT2A 3UMBA 1FU8A 3KAKA 3ZWNA 3IQHX 2DHRA 5HRCA 5I47A 3JQ8A 3NTXA 4PZ9A 5HMLA 3FTDA 4A91A 1Y5MA 3U60B 3OQVA 4FHZA 2C7GA 2DLCX 3I9LA 1DLIA 5A9TA 5ESXA 5FAXA 4BASA 1TLTA 4HNAB 3HUEA 3ML1A 3AUYA 3ND8A 4WIAA 5EEGA 4WBSA 3FFXA 3GVHA 2XCTB 4OPMA 4EGFA 3ECAA 4FJ1A 1ADGA 2GAJA 2ZAGA 3FZGA 3CSUA 4OSOA 5DCLA 4OI0A 1ZLYA 2GH1A 4XX0A 3SDBA 1BVRA 3I39X 4JODA 3UWSA 4OLFA 5GV7A 3ZW8A 3TBHA 4REQA 1K8ZB 2C2YA 2J0UB 5CDSA 4FDLA 3F6RA 3VTKA 2XWJI 4BRUA 4CQLB 2AB0A 5CNJA 1DZIA 3PUWA 4KJXA 4YAIA 3A0UA 5JXHA 2EGUA 1XE3A 2IQ5A 2XUGA 1LPPA 3CRVA 3KYIB 5COBA 2X0EA 3ZQ6A 4YR7A 2OV4A 1ECFA 4WZBE 4C6RA 4D0SA 4GX5A 4PLWA 3M6MD 4R81A 3S8EA 3PFCA 2QW0X 1GZUA 1C1DA 1L3IA 4R9VA 1WETA 5LJLA 2VJDA 5F3DA 1FJXA 1RYZA 4BAZA 3HZZA 5CPBA 2DHCA 2XAAA 2ADMA 1TRHA 1JKXA 3GZTB 3I2HA 1R0ZA 2OZKA 3JAWB 4Y0AA 3O8BA 1SCDA 3AR5A 2CMKA 2WY2D 3ST7A 2DR2A 4QPNA 2HPHA 2WINI 1MB9A 3EASA 3EZGA 4FTWA 2R8EA 5B1DA 5IFLA 3GFBA 3F3KA 4JJEA 3U7EB 4OMCA 3ZK8A 4AKEA 4DLRA 3C0KA 3RQIA 1NX9A 2ZJZA 4B4DA 4ER5A 3MLAA 3NFYA 3EPJA 2DUWA 1G4UR 4YT8A 3IJ5A 2KLHA 5JECA 1BIFA 3AX6A 1FLNA 1RCTE 4X20A 3KETA 1WY5A 3MWJA 4EMSA 4EUNA 3U7GA 1Z12A 1V95A 2IRWA 2PSHA 3DHEA 1C8BA 2A5GA 3L92A 4ZZIA 4LJKA 3WYAA 2PYZA 2VP5A 4IH9A 2O4CA 1QQ5A 5I6DA 5CNMA 3P9SA 4D5EA 5LLTA 3N9IA 4ESOA 2FW7A 3LL4A 1R3DA 5COAA 2HY7A 1Z5ZA 5EJ9A 2W6JD 1H8HD 3L4KA 1ZHFA 2JCVA 2JIMA 2D1YA 1YKSA 2L19A 4MCHA 4OI1A 2IZ5A 5IAGA 1PLJA 3FM9A 3MWDB 1N4AA 2AC2A 4J0CA 3WBFA 4CF5A 2WNSA 3NYIA 1RZRD 1DQRA 1M8KA 2H2AA 5FNVB 1EK6A 4BV9A 1FVFA 2ZCUA 5C1PA 1VE9A 4M37A 2OHVA 4YMGA 1KC3A 2ZJ2A 2JVIA 2FJUA 3HCCA 5L3SA 1TI7A 3C8MA 1LVGA 4XASA 1Z39A 3D2AA 4JL5A 1SQFA 5TB5A 5HDQA 2C94A 3BH0A 4GH5A 3TKLA 4BMDA 3K6SB 1MZVA 2IYXA 4LZAA 2JCYA 3K6JA 1J0XO 2EQBA 4G2TA 4C2BA 4ZJZA 1A5BB 5SZHB 3H6GA 4LTMA 1XF9A 1KS2A 4RKEA 1USVA 2I2AA 2OHGA 4W5TA 1QUFA 1G18A 1UAYA 2B5OA 2J09A 3ZOZA 1KWGA 1U0GA 2I6XA 2Z5LA 2YXDA 4R9RA 5FTLA 1CUZA 3I0MA 5TE9A 4BNJA 2CNDA 1MJFA 4G41A 3N76A 4AYXA 2Y77A 3DB2A 3S2ZA 1EFKA 4EGAA 5CBPB 1G2PA 4KPUB 3PQ7A 4H4DA 3K53A 3AJDA 2JLWA 3FZNA 3HDVA 1AXEA 3ZCVA 3HFJA 4A73A 1CEQA 3SAJA 1JECA 2NAPA 1ADJA 2BCJQ 2XIQA 1CZLA 1T36B 3LNCA 2R6ZA 2IEBA 2ZRPA 3LKVA 4IIXA 5ALDA 1GZSA 3E7DA 4EA9A 1PJBA 2HA6A 2E4ZA 4PZDA 1TEVA 3UJPA 4ZDJA 2DVMA 1RC0A 1TVKB 2XOXA 4CDMA 5KNBD 2QJOA 2RD2A 3W3AA 2G8NA 1P2TA 1LDGA 4H6VA 4MRVA 4CG1A 4DLLA 1G5PA 2CKMA 4NE7A 2R1UA 5DISB 4NYIR 3X1JA 2BH9A 3O82A 4MDYA 4V0OA 4P34A 5EXDA 1EWVA 1PZXA 2JCBA 1DG1G 3M5CA 3T9BA 4EKGA 3M5WA 1EZ1A 4RANA 3T61A 3ZC3A 5A2QA 4PTZA 2JI8A 4ZOLF 3RD5A 3AJRA 3K7EA 4EPYA 2YR0A 3P5SA 3FNGA 3VR4H 4UEWA 4C29A 3AIKA 4W5JA 1IUNA 2EFEB 2J3EA 5DHTA 4KRYA 1N9KA 1BS9A 3E53A 3K16A 2HIGA 3RSLA 1JI3A 3V4FA 2PX2A 2O8DB 3WISA 3LY9A 1YK1A 4TUYF 1PG0A 3OTIA 1LJLA 5F9FA 3WWEA 2W4IA 1RNLA 1Z6PA 3A10A 1N9ZA 4FQ8A 4YJGA 2WAOA 2I78A 4DLPA 3FMVA 4EHAA 2C9CA 1SCIA 4UBJA 3B36A 2C4TA 2ZUDA 5JAUA 4BO8A 4BKPA 2V9ZA 2JK1A 2OBBA 3CH4B 2KBFA 3CKKA 2EFCB 4W5RA 3DE7X 4RYLA 3L6DA 3WZ2A 4NI5A 1BXGA 2H85A 1NVXQ 5BN5B 4AD8A 2C07A 5M34A 1YQQA 2JC3A 3QBTA 4N5HX 1PGJA 1L7PA 4XYBA 2OHJA 1OW3B 4L28A 4EPWA 1VA5A 2PZ8A 5B58T 1BVYF 2W71A 2H51A 1S1MA 2FE1A 1TFUA 4HWGA 3LC2O 2XV1A 1E3DA 2C96A 4PC2A 2D1QA 4RNDB 4JQYA 3CEHA 1T5SA 1WL8A 1Z0FA 4UFOA 1LV8A 1TXGA 3N7AA 3ZWDA 3BTOA 4TKVA 5AKHA 1OBOA 1GTG1 3G0HA 3GPBA 3HABA 4B4OA 4CM9D 3WL6A 3DV2A 4EDHA 3ZGZA 3DKIA 2WT9A 3O4FA 1FX0B 1V1JA 1X1SA 1YTLA 3BA1A 3HDYA 3LIPA 4K3VA 2VO1A 3KCNA 1P0CA 3TXAA 3S2GA 3ODPA 4TV8B 2UDPA 3R5TA 3SWWA 2FDCA 2XWQA 3QPVA 2MSCB 4ZT5A 3SBXA 3BK7A 2ZBRA 3I01M 2HEGA 3U4IA 2YW9A 2O8DA 1WZIA 1POXA 2XDAA 2B0CA 3M4XA 5EJ6A 1GPUA 2E89A 1E5XA 4A2QA 5A3JA 2PR2A 3GAZA 1CX9B 2H5LA 1QFYA 4WADA 2WP8J 3ORYA 1JU3A 4BV3A 1QQBA 4ZT7A 4YIKA 5DI3B 3N59A 2IELA 3EWIA 4NZZA 4DTIA 5C9ZA 2AQKA 3COYA 1XLWA 4MPJA 1EXDA 1N5DA 1QRRA 1KI6A 5EWMB 1VIYA 2D7CA 3PEWA 3AIMA 3PI6A 3VHXA 5ITSA 3Q0TA 5EQJB 5J5CA 2AZMA 5KTSA 1JG1A 3UVEA 5JIBA 2OCIA 2QUZA 5F1PA 4MKIA 5L4LA 4GP6A 2P9QA 4WK2B 1PAUA 2JGDB 2QG4A 4XIGS 1NMSA 1GRQA 1NJ6A 5GM1A 1IJKA 1JH9A 3IX7A 1YFLA 5L7WA 3HN2A 4BFVA 5J4HA 5H8WA 2DM6A 1CUWA 3L01A 3MGCA 1YZHA 1UJCA 4QUJA 5KHOC 6AT1A 5HQ3A 5LP6C 4ZHQF 4YALA 4QT4A 3DOHA 4Y7DA 3LXRA 1EEHA 4XGKA 2VKTA 1IWOA 2Q5CA 3PD7A 4R2HA 5LU9A 1E7YA 3I42A 3WWOA 4N7MA 1VPTA 1XDWA 4F6RA 1XB2A 4POOA 4YWHA 1ZDMA 2ZSDA 2QN1A 3DNPA 4RJ2A 3P9YA 5LVAA 1E9CA 1QH8B 2GPTA 3VHLB 3L7CA 3KTDA 3LF1A 5DM4A 3V2UA 3QW2A 3LGXA 2VEDA 1QF9A 1ENPA 2H07A 2JJ1A 3FWNA 3KWLA 4OGFA 4E11A 1RJ9B 1OX4B 2V6FA 1WCIA 1O95C 1HV8A 1QPBA 1RQGA 4DC0A 3RYCB 2JW5A 1YIDA 2AFIB 8ABPA 1JFFA 3ANSA 3GLGA 1SVIA 1OTHA 4LY3A 4NH0A 1YL5A 2C9OA 1XQVA 1UBLS 1RLIA 2VJAA 2WU0A 3T3PB 1WBBA 3CUWA 1VFNA 3HDGA 5M2QA 4MCAA 3RVQA 4U5QA 3DZCA 5L4SA 3OE4A 4XUDA 5F35A 3LUJA 4YRRA 3SC2A 1XTVA 1YR7A 4I9NA 2GVZC 5BOSB 1IZYA 2VPWA 4QOSA 3S70A 4WJKB 2O6HA 1ZCFA 4TSFD 1E1QA 3KT0A 1T9DA 2BONA 2HWKA 5EIOA 3RJZA 1IQ0A 1UBMS 2RB5A 3DE3X 3OI7A 3HXLA 1K5GA 2EW1A 1ZIDA 1E6EA 4L95C 4NCNA 4QUDA 4B7ZA 1CEXA 4ROTA 4LCBA 4YP0A 4ZYVA 3NMUF 4G0MA 1N6KA 1Q14A 2PT9A 1DBPA 2QX7A 3ZDCA 1YUBA 1FEZA 1WXFA 3LC1O 3E35A 4FI3C 4YCNA 2VH2A 4DJDC 4JBNA 5D3QA 3AUUA 5TIIA 4NG4A 1HEIA 5ALMA 3THRA 3M1LA 2IYLD 3B2NA 4KL8S 3UPDA 2IE8A 1Q0HA 4XCVA 3U4QB 2A7XA 2P4HX 4FNAA 4H1HA 1HYHA 1I9CA 2E3JA 1E4VA 3QTLA 3ADBA 3URMA 2JHCA 1R5BA 1W5AA 3GCDA 5BW5A 1X77A 1C9DB 2C4UA 3QOFA 2BFDA 3I0ZA 2QWXA 2AWOA 4BJ6A 3IO3A 5AW1A 1OLSB 2JPDA 1W6UA 1AQLA 5EE3A 5BPFA 1G21E 3Q3HA 1PUJA 2GN8A 3ZY4A 2J4FA 1OB2A 3D4LA 2BMJA 4YRQA 2BMWA 1PE0A 3CQ9A 2WD9A 1F60A 1IDOA 5JSZB 1WW8A 1W87A 1K8QA 2FHPA 3LCRA 1ORVA 5TQ0B 2BP7A 3B7WA 1MIHA 1E9DA 4R0VA 3AIOA 1F4VA 5HYVA 3ZD7A 4Q21A 1QFJA 2NQTA 3G5MA 2IOFA 4D9FA 1Y3IA 1NW9B 3TJMA 1UEJA 1QCYA 2FR8A 2RGEA 4BMZA 1UZLA 3A27A 3ME5A 4BVLA 3G2MA 4XUEA 2WMYA 2E2WA 2G09A 4GLBA 2WWGA 2Z2JA 2IPAB 4PZEA 2UXDB 3BE8A 2ECKA 3CW8X 1VB5A 2ZEJA 4OXXA 3ZXIA 4PICA 2EIHA 1XRJA 1YJ5A 1JR3A 1KQOA 1R0SA 5KAPA 2PV0A 4C3VA 5BWMA 4EG1A 1OHHD 3EXIA 3KOXA 3BL5A 3M1AA 3NC4A 5CH8A 2W11A 3OBBA 5BWNA 3BXHA 3MB5A 5JWRA 4EHKA 3L8ZA 1FJHA 4HYTA 3TMAA 3W5IA