4TYYA

Dead-box helicase mss116 bound to ssrna and cdp-bef
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
508
structure length
505
Chain Sequence
SKLIHVPKSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(P*AP*AP*AP*AP*AP*AP*AP*AP*A)-3')
total genus 151
structure length 505
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyyA02
2BMFA 1LY1A 3GJ8A 5FUWA 2OFWA 1E1QA 2W00A 2IWRA 1KI1A 4A15A 4V0KA 1EX7A 3ZJYA 1ZD1A 4C0BA 3KZ1E 5JWRA 5HR5A 4GOKA 2X8AA 1TF2A 4IEIA 2PEYA 3C14C 4Q1BA 4UNNA 1DARA 5KNBA 2OG2A 2QAGA 2WICA 2C78A 3AH8A 2GJAA 3D6TB 4DCSA 1AGRA 4E22A 2VBCA 3TVTA 4B47A 2IYLD 4JJZA 1YHNA 4BFSA 3QI2A 3TKLA 1E2HA 3G82C 3ZZUA 1L8QA 2ANBA 2J9RA 4DCVA 5JI2E 3GLFA 2FH5B 2QUZA 3QXHA 1XJ0A 1SVLA 1DO0A 3AF3A 821PA 5A0FA 3AB3A 4GOJA 3GPLA 3CF6R 3GCGA 4MGKR 4Q4JA 3R7WB 4XWKA 4DSTA 2C9OA 2FSGA 3CONA 1WP9A 2NOAA 4IDPA 1SXJD 3IIJA 2W6IA 4B43A 1XMJA 1VMAA 2WV9A 4OHVA 1PLLA 2ZR0A 4XH9B 3UANA 5EE1A 3UXMA 1R2QA 2FZLA 2GWHA 4D4MA 1NVUQ 2FE4A 4EIWA 1ZCAA 3FYHA 4LPKA 3AVYA 1M1YE 2EWVA 5TVKA 1W0JA 4TYWA 1CJMA 1Z6YA 2QGZA 3LBIA 2JDID 4US1R 2OO7A 1TX4B 4L8GA 5J4LA 1KNQA 3BBPA 2G83A 2MSEB 5JS8A 3BD9A 1AK2A 2F43A 2P6NA 5GJBA 4ZI2A 3RS5A 8OHMA 5G3YA 4TTRA 1LTQA 5JWOA 4PC2A 4XD7D 5BQ5A 3KQHA 1XEFA 2RGNC 4QGHA 1PV4A 2LKCA 4LJ9A 1ZM3A 4DDUA 4JL8A 4Q1FA 4IVPA 1D2MA 2R6AA 2ONJA 3AKYA 3WNDA 4DLTA 3W34A 4DLWA 3VNUA 1XP8A 2QROA 2QEQA 1CJTC 1PZNA 3AF1A 3B78A 4DDTA 3KQNA 2H16A 4C0KA 1Q3HA 1GSIA 3I4LA 3CF2A 1S2MA 4L15A 4M1KA 1OH7A 4KYIB 4URZR 1G4AE 2PCJA 5FPTA 3TBKA 4U02A 3ZDQA 4LYHA 1KJZA 4NE2A 3PUVA 4PQRA 4HAWA 1X1RA 2OBNA 3U61B 2IYRA 4CEIB 1SULA 3LAWA 4UXJA 3PVSA 4C0AC 2Z83A 3I3SR 2JAQA 2B7CA 3U7HB 1KO5A 2QP3A 3AV0B 2GCOB 1WRBA 1A7JA 1SKQA 5E7JA 4K81B 1E1RD 3I32A 1Q1BA 1N3BA 4EKDA 5EXTA 3X1YA 1NLFA 4JL5A 4V0MA 4Q4AB 1SHZA 3Q7QA 4JIMA 4M9SA 3NC0C 2DFKB 2ZRGA 3OE7A 3WMEA 4IDNA 3EPHA 3QE0A 4C0HA 2ZJZA 2A78A 2G0TA 2RGAA 2Q21A 3OZXA 1VYVA 1UFQA 1L4YA 2AKAB 4Q48A 3TQFA 3SYLA 3U5ZB 5DHAA 4LRWA 3PG5A 3UG6A 1XEWX 1R8SA 3AM1A 1KY3A 4US2R 3TR0A 1W48A 5EQTA 2EFGA 4HZUB 3VKWA 3EXAA 3DM9B 1CRPA 5D3MA 3RRMA 3LNCA 1IN5A 1XZQA 4KJZA 2XZLA 2JLSA 1M2OB 2A9KA 5E95A 4O2LA 1NKTA 4RCYA 4KVGA 4XWAA 1VCNA 2F55A 2IC5A 3K9NA 1GL9B 1NIPA 5BYKA 3BH7A 5CITA 4WIAA 2WBLC 5IHPA 1KI7A 3SYNA 4ERNA 1YR7A 3H2YA 1KDRA 2NQ2C 1C1YA 3I8XA 4Q4JB 3R7WA 1GNQA 1OIXA 3CUEF 4A0FA 2BKEA 2WWFA 2IWHA 4HB2A 1Z6AA 3QF7A 4MUBA 4R7ZA 2VL7A 2BCJQ 2PZEA 4RD2A 1KDPA 2P3SA 4MGIR 4PC1A 2V1XA 1Z5ZA 4V0ME 2WWIA 2XJ9A 3BERA 2YWFA 2ZETA 1Z08A 2WKRA 4FIDA 4M9XA 3SOPA 4OI1A 5KSYA 2JLZA 4RZUA 1HQCA 5C2JB 3B1XA 2O8BA 2FFHA 2IYZA 1P75A 1W4AA 1XPRA 4M9QA 4BEJA 4KBFA 1Z0DA 3B6EA 2C03A 4RCZA 2XXAB 3R20A 2B7BA 3EWSA 3BIFA 1OFUX 1VG0B 1ZNYA 4ZCIA 4BZQA 1COWA 3BS4A 4NPHA 2AWOA 3NVAA 3B8HA 5LBIA 3V4RA 3P32A 3AKCA 3ZVRA 3MWYW 2JJ2D 1VYUA 2FFQA 1MO4A 3PEWA 3QY0A 3SNHA 4Q9HA 5FH9A 5KHOC 2KB0A 5FPHA 1Q1ZA 4M0LA 4EPRA 3G0HA 1W36D 2EQBA 3NBFA 1WBBA 4W7SA 1A2BA 4V0LA 2A5FA 1T6NA 3R9IA 3SFVA 4F92B 2UZIR 1UJ2A 4IVQA 121PA 3KJHA 1OH8A 2QU8A 1GL7A 1P60A 2AX4A 4KBGA 2YOHA 5DLQC 2ZRHA 5HKKD 3K0CC 4ACAA 1OIVA 1QHSA 2NO1A 4CEJB 4IOJA 5C46F 4CEIA 3VR6A 2ZSDA 3ADKA 3CLVA 1ZUHA 1CJKC 1N6KA 2VP5A 1R5NA 3FHCB 5FL3A 4LHYA 3A4LA 2L0XA 1GTVA 1HH4A 2HDNB 4LC1A 4EUNA 3GMTA 1QG4A 4B3XA 3TUZC 1JECA 1XPOA 3PCRB 2XAUA 4LSGA 4RZ3A 3KKNA 4CDGA 4U7DA 2VP2A 4FI3C 2DWPA 1MR3F 2BOVA 3W5JA 1B23P 2ZRNA 1N2CE 2WWHA 1Q3TA 3QEJA 1IQPA 2WJIA 4LI0A 2XTMA 1M6NA 4MRNA 2V9PA 2V8OA 4MRPA 1ZU4A 1T5IA 2NO9A 4O3MA 4LHWA 4KXFB 1D2NA 4LYAA 2ZM5A 3SQXA 3BH0A 3ZQ6A 3CWZA 1QG2A 1E9RA 1P9RA 4KITB 4GMDA 1G20E 2R6CA 1TF7A 3GJ6A 2REXB 3EZ9A 2V54A 5FOUA 1E9SA 5L8VA 2D7DA 2FSFA 3W6PA 4QJ3A 3H0KA 5FR2A 4R71A 5F3WB 4NCHA 3OESA 3E1SA 1IXSB 1DEKA 2VIIA 2A5GA 1E9EA 1SQ5A 2PH1A 4ON9A 3MGCA 5GJWC 2QPOA 3CKLA 4OI2A 3A1UA 4B6FA 5JBQA 2VH5R 2QMOA 1ZM9A 2OV2A 5G41A 3PQCA 2HYDA 4IFBA 2KE5A 1ZD8A 1NVXQ 4QNMA 1Q22A 2DCUA 3GFTA 5CIWA 4DVGA 1T3LA 2DB3A 5JJIA 2DFLA 1P6XA 2C8VA 5H68A 4E09A 2HT6A 4ZI3A 4DWJA 1VPLA 4PPNA 3TAUA 1E6CA 1YKSA 3DM5A 4DKXA 3SC3A 4EFLA 5FBQB 1PJRA 2QNRA 3BXZA 3KKQA 1XBTA 2GXQA 1BS1A 2WSSA 1X8JA 2ZAMA 6Q21A 4A8JC 1XTIA 1YZNA 1F2UA 3SE0A 3HP1A 3KFXA 3QENA 2D74A 1BMFD 3FPAA 1AZTA 3AP1A 3EARA 3TSWA 4NKRA 1XX6A 2BIFA 1ZIOA 5KO2A 3K09C 4QC2A 3QQ5A 4LC0A 3MMPA 2RGEA 3CRRA 2G77B 3GLFB 2ZITA 4G5SA 1FQJA 4QOSA 3IEUA 1FTSA 5FOXA 5G3ZA 3U6KA 5DI3B 1N6OA 1U2RA 1E1RA 2Z4SA 4DDVA 5AJVB 5JI3E 1S96A 2A5DA 4H1VA 2C9CA 1D8TA 5CDFA 2ODNA 2BEKA 4A2PA 1NNEA 2GK7A 2WWWA 1SVMA 4JLDA 1G9XA 5FPSA 4F93B 1JNYA 3A4NA 4BLRA 4W9MC 1Z63A 2J45A 4BWYA 4G5GA 4F38A 3BB3A 4NH0A 5A4JA 1KK1A 2RB4A 4LJ6A 2XITA 1W5SA 2RGNA 1OXSC 2RGBA 2WAYA 2OCYC 2OILA 4A6PA 4DLYA 3CPHA 2XOKA 2F9LA 3Q5DA 3A36A 1R8QA 4LJYA 1NRJB 2FFAA 2JASA 3I8SA 5C18A 2F7SA 3OEHA 4FW9A 3K9GA 3EPKA 2EU8A 3AVUA 3L0OA 1UBEA 1XCGB 3MJHA 1RW4A 1C4OA 3QBVA 1CJVC 4RD3A 5FOSA 5BYJA 4Q7LA 1T9HA 3AF4A 1OHHD 2ZYTX 4MRVA 3CPJB 4OL0A 3D8BA 4S2EA 2ZUCA 2IS4A 4RD4A 4RVCA 2GTPA 3PR1A 4Q4LA 4XSGA 1KOFA 3A1VA 3HPRA 5J4HA 4M1SA 4JLPA 4WZ6A 3J81k 2QM7A 1GM5A 4IRUB 1XMSA 4DDWA 2GBLC 3AF2A 2YHSA 1VCOA 1OKKA 4FCWA 1AM4D 1UM8A 4KSCA 1W49A 5HCNA 1R6BX 3MWJA 3ZGXA 3QKUA 4QJ4A 1ELOA 1G8PA 1GRNA 1N5JA 4GBMA 1E2GA 4Z54A 2NGRA 3OEEA 3E70C 3L8ZA 4PX9A 1G3UA 3WP1B 4XVUA 1AGPA 5IF9A 5K8LA 3T1OA 2F6RA 5GJVC 2GCOA 3NTUA 2BJWA 4PC3A 2FPKA 2ZANA 1J8YF 4BRWA 3GLGE 1KKMA 3UIEA 4P4UA 5FPKA 3B1WA 4LBVA 4RKEA 2IXFA 3JZMA 1W7AA 3OEHD 4WVFA 3W5IA 4ZDJA 3SQWA 5KNCA 1DO2A 1R7RA 4X8OA 3MWKA 2BWJA 2AD5A 3LA6A 2PMDA 1N6PA 4I1SA 3LD9A 1XTKA 3ZVNA 1Z0KA 2WAXA 2BBSA 1KJWA 1VYTA 1A5TA 1OE0A 4DT1A 2ZR7A 1VCMA 3BFKA 4LZZA 4HZUA 4DLSA 1F2UB 2B8WA 5FBLB 1W0KD 2FSHA 2VSFA 3LBHA 3BC1A 3N5CA 5D3MB 4HLCA 3WXMA 1AKEA 5DIFA 2RGDA 4XTCS 3KX2A 2EWWA 2FWRA 1P2SA 4MRSA 2J3EA 1SHKA 1N6HA 1VIAA 2WPDA 1GP2A 5EZ5A 621PA 3KB1A 4Q00A 1ZM2A 1M7HA 4DHEA 1YZTA 5KUTA 2V6JA 1G18A 3M6AA 5AUQA 4A36A 1NVWQ 3RABA 1HEIA 1LF5A 1N6IA 3DEFA 3OAAD 3PUZA 1QVRA 4GFDA 4LX0A 1V5WA 5G53C 5CIQA 4Q03A 4DLVA 2XZPA 5TARA 1E9AA 4JVLA 1H8ED 3AVWA 2W2VA 1VDZA 1TUEA 1NG1A 5CK4A 3MG9A 1T0HB 2UZ3A 5K8UA 4WXRA 3A4MA 4XWOA 2ZRJA 3A1SA 2WWGA 2A3RA 4DLZA 1NVVR 4OHWA 1FNNA 2CE7A 3IILA 3TR5A 2Q3FA 5FBVB 3TUIC 1W4BA 1K5GA 4KFSA 3MCAA 3SFZA 5FI0B 4AG5A 4AYWA 4OI4A 1UKZA 3DPUA 2AN9A 5DHFA 4PO8A 1OSNA 1XB2A 3DOFA 2IYSA 2CL0X 5EXSA 2ZU0C 4MH0R 2J7PD 2VTKA 4KO8A 5SZHB 1CS4C 3EA0A 2BBWA 4LY6A 4JYBA 2XSZD 3QKTA 4GPTA 5CM9C 5D3QA 3QG1A 5UKDA 3FKSA 2ZPTX 2ZTSA 1XDBA 1WMSA 1JR3E 3FDIA 4IW3B 3AEZA 1MH1A 4NYJQ 1ZNWA 4ZCLA 2IUSA 2NZ8A 1UKVY 3IPXA 1YR8A 4FXPA 4PAMA 2JJ1A 5ELXA 3NWJA 5JWHA 2YZ2A 2CHQA 3VR4A 1EFRA 4Z1MA 1CR0A 4AIIA 5H1YA 1FP7A 2BMJA 2W83A 3Q9LA 1VECA 1NIJA 5EXXA 1NBME 3QXXA 4XSHA 2QPAA 1IY2A 2ZJ2A 4LHXA 4DC9A 2V7QD 2RCNA 1CJUC 1QHYA 2G0NA 4ASUA 4JVNA 2YNMA 3ADDA 5HE9A 2W58A 3VAAA 4BLPA 3VNVA 3W3ZB 1DAFA 1RYHA 1JEDA 5HZKA 3K70B 4DRZA 2HUPA 3I72A 4TL8A 2QPTA 4OK5A 5CYPA 2XEXA 4DCTA 1FZQA 2EYUA 2V3CC 3C4JA 4UNPA 1TPZA 2IK8A 4WA7A 4FWIB 4B35A 4NTZA 1CEEA 2CCGA 2CDNA 2LCFA 3FFAA 2IBMA 1NVVQ 2WZQA 2CL7X 2D06A 2FV8A 2PLFA 3U7GA 5L3QA 2RHMA 2QBYB 2KI5A 3IQXA 4EDHA 2ZS8A 4RY2A 3SJCA 2W6JD 2ASEA 4G5OA 2C98A 4N3NA 2IS1A 3WMGA 4B73A 3U6BA 1DOAA 1G21E 2R8RA 3VU9B 4XJXA 1AZSC 2QAJA 3OIUA 3HWSA 4FCVA 1Z0FA 4RD0A 2EFEB 4RFSA 1JAHA 5EUMA 4JLNA 3IQWA 4F7WA 1R0WA 4KU4A 2VSXA 3LH5A 4W5WA 3AVOA 5TB5A 2OZEA 3ZLJA 1KO4A 5A5GA 2IUUA 3U2QA 4AKIA 3ND9A 5J4KA 3CNOA 1WDTA 1A82A 2JLRA 2GJKA 2C2HA 4D2IA 1E1QD 3T06B 5HZHA 2IW3A 1IONA 2D7CA 1FL9A 4PPGA 2RKOA 2GK6A 2C04A 3FMPB 1N25A 4PC7A 5DYIA 3AF0A 1DAMA 2JLUA 4HLUC 4LUCA 5JMTA 3IEVA 2F1IA 4CT5A 5AUNB 2JCSA 3U7FB 4M22A 5EZ6B 5BWMA 2CK3D 5BN3A 1F2TA 3HR8A 1D5CA 1CTQA 2GZDA 4P4SB 3UK6A 2VA8A 1IY1A 2GHIA 1DAEA 2O0JA 2R6GA 2C9YA 3VR5A 3T35A 2IYYA 3G5UA 4Q4HA 1HV8A 1YZQA 1BKDR 1DAHA 1G17A 1E2LA 3WMFA 1MRNA 4C0QC 4A0GA 5KSPA 3GLHE 3ZQJA 4LBWA 1DG3A 1P9WA 1N5LA 2ZREA 5FOTA 4AKGA 1YRAA 1KGDA 2Q9AA 1NBMA 3WHLA 1KK2A 4LBYA 1RRCA 4GNKA 1K6MA 1SKYE 1ZRHA 2D4HA 4FMBB 4Z8YA 3SHFA 3EC2A 5DI3A 1IXRC 5IDVA 3LV8A 3KFVA 5H8WA 1ZJ6A 3PEVA 4TN1A 2GCNA 2MSCB 4NYMR 3KJIA 1XD8A 5EE9A 4TT3D 5BN4A 3PIRA 1G3RA 3OHMA 3OFND 3LLMA 3K0FA 4HB4A 2WKPA 4BZPA 3SI7A 4QM6A 1E0AA 1CIPA 3CX8A 2QM8A 1HQYE 2JJ8A 4PHFA 3CNNA 4NCNA 1KSGA 4D0GA 4BGDA 2I1QA 1K5DA 2XB2A 1M8PA 1GITA 4US0R 5F2EA 2IS6A 1G64A 2WMOB 2Q0HA 1BIFA 1NP6A 3C41J 1XJCA 3KXLA 2NG1A 3NXSA 4QHTA 1T3HA 1ZINA 4UKDA 1EWRA 2C5LA 1UADA 2H8KA 2GJ9A 4LV8B 4MKHA 4Z8XA 3RAPR 5JS7A 4RJLA 1ZVQA 1SVOA 2IYUA 3B9QA 4Q21A 1RC8A 1Z3IX 1CP2A 4PZZA 1BH2A 1U0HC 1U81A 1YE8A 1NN5A 1YRBA 5EP4A 4ESHA 1YZKA 3I5XA 4U00A 4M4SA 4HAXA 1D6JA 4WAUA 3HU1A 3QUSA 1X3SA 2RHDA 4XIGS 1CBUA 4B3BA 2QZ4A 1VKJA 4LJ7A 2G9NA 4D0LB 1OFHA 2ZYVX 2OE2A 4EPWA 2Z0MA 4LV5B 4AI6A 2V6IA 2CVHA 1UDWA 4WBSA 5AJYA 2P67A 2DY1A 2HCBA 3CX7A 4L9WA 3QF4B 5FTMA 2CBZA 1E0SA 1G3IA 1KI3A 1W4CA 4M53A 4M1TA 3ZVLA 2VO1A 3VKGA 1HE1C 4I81A 1VIYA 1II9A 4WW0A 4OHZA 2H57A 1FOEB 4OQXA 1KMQA 2QMEA 1LFDB 2QRNA 4PO9A 3EPLA 2AWNA 4UNRA 1GDDA 4B2LA 2ERXA 4G5RA 2RGCA 2N42A 3B60A 3K0CA 1E99A 4ZO4A 4DT1B 1F2TB 1RFLA 2OLKA 4IJMA 4P4SA 4C9BA 4KYUA 1CRQA 1LW7A 2QP9X 4Q01A 4X8LA 2VQSA 2Q6TA 1FMJA 4GP6A 3NIBA 1AJEA 4UNQA 3QXSA 3B7GA 4HYYA 2C95A 3FFBA 1QHNA 4LJ8A 3PUYA 3IBGA 2FJUA 1KI2A 3IIMA 4LHVA 3U3KA 1QHIA 2YWHA 5P21A 4BFTA 2V1UA 1DBSA 2NO7A 3NDPA 4C2UA 1E79A 2GKSA 1HYQA 1I4DD 2CLDX 2QT0A 1DTSA 3LQRA 4TLCA 4AURA 1AA9A 5FTKA 4RD1A 4BASA 5C1BA 3LWNA 1XTRA 1KZGB 2ORVA 1ZM4A 3DHWC 4MDFA 4O0MA 4ACBA 1RRPA 3DKVA 1R5BA 1Z8FA 1XU4A 2ZRCA 1TQ6A 3NC1C 2NPFA 4P33A 3OF5A 1US8A 4JL6A 2AK2A 5SZKB 4JBWA 2UKDA 2F3RA 4URVR 4URWR 4W5JA 1RPZA 1IN6A 4B48A 2A5JA 1Z6GA 2HJGA 5FBRB 4TQAA 1K8RA 2ZUBA 4LJAA 2AL7A 1MRSA 1NLYA 4L9SA 1AIPA 5BXQC 1G3QA 3C16C 3RRNA 2ZE7A 4NDZA 4AYXA 4B3CA 3PV0A 1AS0A 3U3OA 1JI0A 3KTAA 1A4RA 2EYQA 3M0EA 2MMCA 2WVJA 1TUIA 4MKGA 1TQ4A 3MRSA 1P9NA 3OEED 4YMWA 5KDOA 1FUKA 3MSXA 3UPUA 4IDOA 2J0QA 1XZPA 2JEOA 3EG5A 3QXCA 2AKYA 2QQEA 3C7KA 4LYFA 4YMVA 3BGWA 4IXMA 3RDPA 3C15C 1SXJE 4D4JA 4CEHA 1UBFA 4D26A 1KJYA 1LB1B 1ODFA 5LDDC 3AVQA 5FTLA 5BW8A 4D25A 1NKSA 4H9GA 3IBYA 4JSYA 3U60B 4I1UA 4PQYA 2PBRA 4I1OA 1TU4A 4Y0VA 5GVRA 1IN7A 1XNJA 4G0NA 2ZEJA 4NHOA 2GCPA 2GVZC 2OT3B 4IKEA 2F3TA 4V02A 4GDFA 3T5DA 3CNLA 1XCPA 2QTHA 1MKYA 4LGMA 1NN1A 2CHGA 2IF0A 2DPXA 1IHUA 5KPJA 2FDCA 1E9DA 1W4RA 1T3SA 2GJSA 1N6NA 4JLOA 3MAAC 5KDLA 1JPNA 2CJWA 3F3YA 1RE0A 2IF2A 3T12A 3WRXC 3TK1A 5DISB 2IT1A 1QHHB 1WXQA 3DVLA 4Q1DA 3B5JA 4GL2A 3EIEA 3VX4A 2EVWX 1KKLA 1FMLA 2O0KA 2VP4A 3C5CA 4FD2A 2VF7A 2QY9A 2WOOA 3QPUA 4O2RA 1QVAA 1II8B 3ASZA 3F8TA 3KJGA 2CCKA 4TL6A 3DMDA 3BAFA 3CPEA 4NYIQ 3TW8B 3E2IA 2KWIA 3RS3A 5L3QB 2QBYA 1KO1A 1G4UR 2YC4C 5FI1B 4YQFA 2VEDA 1DELA 1F60A 1A2KC 2CL6X 1ZP6A 3MLEA 4XVQA 4FINA 4F4JA 1UAAA 2FFBA 5CM8B 2CXXA 2CMKA 5DSZA 1GNRA 3BH6A 3I61A 3VU9A 3WY9A 2O5VA 1H8HD 3BORA 4C7OA 1G6HA 1N0UA 1ZUIA 3NBXX 4RFSB 4X8HA 2J41A 3KKPA 2HXYA 4EPTA 1KO8A 3SHWA 1G7TA 2IXEA 5EP2A 4CRWB 4BE7B 4ZDKA 5L3SA 4YONB 5CYOA 1COWD 1Z2AA 2WSMA 4NU0A 5KYKA 3TSZA 3Q5EA 3R9WA 3RS4A 3JVUA 3Q72A 1JXOA 5DGXA 3DOEA 4MKIA 1S1MA 3GEHA 2YC2C 2YOGA 1US8B 4MGYR 2OCPA 2SHKA 4TMXA 2E87A 3EX7C 1GG2A 3OIVA 4OHXA 5E7MA 4R9UC 3KUCA 4FWTA 3HR7A 2C96A 4DCNA 4HUTA 4GRAA 1KAGA 3AUYA 4IDHA 4ABYA 4Q1EA 2NZJA 3ZZTA 3ZVMA 2O8FA 2N46A 2WJJA 4MITA 1G5RA 2BVNA 1OXUA 2PCLA 4PPFA 3NHBA 1CLUA 3X1ZA 1NI3A 4A2QA 1SXJA 1SXJC 2JATA 4OJQA 4PPQA 5IK2A 2R62A 3GJXC 4Q4HB 1E2KA 1EFRD 4HATA 4Z1MD 3QOFA 3KTAB 1EFCA 1KI6B 1W44A 2GESA 3I92A 2FF7A 2QT1A 4X8MA 3SJZA 4YXWD 5CB6A 4RZ2A 1IXZA 1NSTA 3CRW1 1P61B 1FW6A 3CB4A 1U8YA 2BBOA 3KKMA 3VHXA 4EPXA 3GLFE 1UBGA 1J7KA 1E2NA 3X1DA 2OFOA 4CVNA 1UEIA 2B21A 4CEHB 2J46A 1B0UA 3VX3A 5FL7D 4TLAA 1ZM7A 2V55B 2PLRA 2HJVA 3B1VA 3SU8A 1VHTA 3K0FB 2RMKA 421PA 3RNLA 5LPNA 3KJEA 2QMUA 2FSIA 5FUXA 3WNBA 4TSFD 1CR1A 3RS2A 2FPLA 3R8CA 5DE3A 2IUTA 3ZD6A 4IFEA 3TUJC 2H1LA 3RS0A 2WJYA 4MYCA 2YINC 2CJWB 2R44A 1E2DA 3VQTA 1PUJA 3ZYCA 2P0EA 3VKHA 2XTZA 4KODA 5CLLA 1MV5A 3QG5A 1UBCA 1KZ7B 3LW8A 1GL6A 1TL7C 1E2JA 1TEVA 4UXHA 4QJ5A 4EQ6A 4IVRA 1TQDA 3H84A 5HE8A 4RZXA 2REOA 3EA5A 1E9FA 2HLDD 4OK3A 1KK0A 3VR2A 1V43A 1R4AA 3THYA 3I62A 1JR6A 2ZRLA 4JJKA 3LVQE 3OE7D 4G1UC 1BYIA 1WCV1 2ZROA 2A7QA 3NEYA 4RSGA 3KQKA 4QRHA 1NF3A 4IXNA 4DIDA 3W9YA 2ZI4A 4C4PA 3CW2A 4ARZB 4DEXA 4C2TA 1ZBDA 4EFMA 2Q9BA 3GFOA 3RANA 2AXNA 2E9SA 1CR4A 4JBXA 2FZ4A 4TWZA 3CRMA 4B71A 1TU3A 4TYYA 5KDDA 5JRZA 1QF9A 3QVVA 4JLBA 1IM2A 2V7QA 2YJTD 5L3SB 1U0LA 4HAUA 4EPYA 2X2EA 1UPTA 3QF4A 2VHJA 1XMVA 4MA4A 4A2WA 3K70C 5SZJA 3AP3A 1G5TA 4Q9LA 3T1QA 4OYHA 3VTKA 4K46A 2PJRA 2RGGA 4JVSB 1XJQA 1Z07A 5LD2C 2IXGA 3NBZC 1HE8B 2F9MA 4A92A 3AVVA 1AS2A 2NO6A 1Z29A 5JJKA 1JALA 2JLQA 4NONA 3A58B 1XFAA 1YVDA 1YJ5A 4RKFA 2CLCX 4YDSA 2OLJA 2O8FB 1JR3A 1ESMA 3ECCA 1FUUA 2DBYA 1JAIA 1XD9A 2QA5A 4XOIA 4DBLC 4HZIA 2H5EA 3AGPA 3NBYC 1FX0A 4QHYA 3ZD7A 3QXJA 4PAOA 3ADCA 1EFTA 4Q66C 1JJVA 2ORIA 3TNFA 4N1AA 1KI6A 1RRGA 1Z83A 2PL3A 1RRFA 3HPQA 1W0JD 3NHAA 4LBZA 1S8FA 5KU1A 2ZXUA 1JBKA 1G7SA 2X1VA 1FTNA 5CK5A 4BQSA 5JCPA 3P27A 2OESA 2EFCB 3AKDA 5J4VA 5EUQB 5CB8A 1FNMA 1GIAA 2ZSEA 2QTVB 4LDJA 3AVXA 5B64A 2EFDB 2W6JA 1KAOA 2JLWA 3LDAA 3U3JA 1WQ1R 5GJCA 2JJ2A 2R9VA 2FPMA 4B76A 4PSVA 2GF9A 1D9ZA 1G8FA 1DPFA 4BECA 4Y0AA 1E2IA 1SVIA 1MO3A 2O8CA 1ZAKA 5E7IA 1MABA 2OCBA 2V4ZA 4OKSA 4CF7A 4E03A 4CYMA 5KOYA 1Z0IA 4PXAA 3WP0A 4IHQA 1OPXA 2B6HA 4EQ6B 4II7A 2Q9CA 5LB2A 4NYJR 3MFYA 1KI9A 3PEYA 2P6RA 1R0YA 3L82B 3N2IA 1OB2A 2Z5FA 2PMKA 2W2XA 2ZSFA 3GEEA 3GLHA 3IIKA 4D0NA 2HYIC 4EPVA 1YU9A 4HAVA 3OAAA 1YZGA 3W8NA 2QQ0A 1E4VA 4DB2A 2OUKA 1AQUA 5LD2B 4ARZA 2BM1A 3KXIA 2BHRA 2CNWD 1Z22A 4JYCA 3TH5A 4ZIRB 2FOLA 5FR1A 1W1WA 3IPYA 2WIBA 1JQLB 4A4DA 2ZIAA 1G1MA 4KCGA 1JB1A 2Z4RA 1KTVA 1LNZA 5FUVA 1E0KA 3QBTA 3RC8A 1IN8A 3L0PA 3CRVA 3AVTA 4HSEA 4AC9A 1P3JA 1EFHA 2D2EA 4GOXA 3K1JA 1TQ2A 3TGPA 1TMKA 1QHHA 1G7RA 2IYQA 3TQCA 2IYXA 2R6DA 2XNDA 2DR3A 3FVQA 1NG9A 3IHWA 5IT5A 1PLJA 3T1TA 3B13B 1OFTA 4JBYA 3DO6A 1KDOA 3NEJA 3O8DA 1N0WA 2ERYA 4ZKEA 1ZCBA 3WYAA 2KBEA 3IO3A 1II8A 2QN6A 1JXMA 2ZI7A 2HF9A 5JRJA 4QBHA 3GEIA 4TLEA 4YLGA 3T5GA 2IL1A 1OKKD 2OSBA 4TLBA 2AK3A 3TLXA 5HKKA 4D4KA 5FL7A 1Z0AA 1FX0B 3RS7A 1QDEA 2XTNA 2WTUA 4QKQA 2GJ8A 4DZZA 2FGKA 2JDIA 2GXSA 3UMRA 3K09A 1G8YA 3AGQA 4TSFA 2ZU6A 4C7OB 4HLDA 1HA3A 1SVWA 1I2MA 2F1HA 2GAAA 3KQUA 2ONKA 1F3OA 5JHGB 1FP6A 3TE6A 4AG6A 5G40A 4Q5IA 2BMDA 2NIPA 3T15A 1G41A 4ESVA 1MO6A 3RWOA 1KSJA 3KDSE 2D62A 5FOWA 5JHHB 1E96A 1WB9A 4UXIA 3CBQA 2FEOA 2P65A 3RSLA 1PLKA 2QP4A 1KHTA 4M21A 4HAYA 1OF1A 3DDCA 3EZ2A 3KQLA 1HT1E 3EIQA 1W47A 4B75A 3KXKA 1E2EA 2D3WA 3MUFA 3KL4A 1XEXA 3ZS8A 5AR1A 3X2SA 3VR3A 4CIDA 1OIWA 4PC6A 3K0EA 2AHOA 1CKEA 1MABB 2ZUDA 1G7CA 4IDQA 4Q19A 3S1AA 4Z51A 3B9PA 1Z28A 2GEVA 1EWQA 1OJLA 1SXJB 2PZGA 2NMVA 4ASUD 3TMKA 3GJ0A 2BM0A 1P62B 4OHYA 4M1MA 1LF0A 3L0IB 4Q02A 2VHUA 1RJ9B 2XGJA 1P5ZB 4BFYA 2JA1A 1YR9A 2NO0A 4IEEA 2ZSBA 1KI8A 1G6OA 2IHBA 1ONBA 3QEOA 4TT3A 2WM9B 1P2VA 4RFVA 4HLUA 3A6PC 2VP9A 3EW9A 3I73A 1A1VA 3LXXA 1QRAA 4BEBA 4HB3A 2IYWA 2IYVA 1ZMXA 3RRYA 3T61A 4AKEA 3SR0A 4S35A 2ZRBA 2WJGA 3TAHA 4MGZR 2ZSAA 4TYQA 2WSSD 3CR8A 2GILA 2FMXA 2PT7A 2QSYA 4A1FA 1ZC3A 4HEJA 2DWQA 1AN0A 3D3QA 4PQFA 1G16A 1YZLA 2QE7A 2ZAOA 3DZ8A 1X1SA 2JIZA 1ZU5A 2PZFA 3AUXA 4H1UA 1R10A 2CCJA 3WHKA 1X6VA 1DE0A 4FMCB 2ZE5A 3SDZA 4OJKA 1E0JA 2J59A 1M7BA 4URUR 5HTKA 4BFVA 2XZOA 3QIAA 4IOKA 3D7MA 1ZIPA 2JLVA 1T8TA 1VG8A 3V9PA 4DLRA 4I4LA 4NZYA 4D81A 4WZBE 3EC1A 3CF0A 4D82A 3NH9A 1E98A 4OQLA 1U0JA 2WWXA 2A2ZA 1J90A 2BEJA 1GFIA 3U3RA 1G8HA 5DYGA 5KTYA 4PHGA 3MWLA 5AK0A 3THYB 3L8YA 1I4TD 2GA8A 4K8OA 2QI9C 2VP0A 4BPBA 3MJRA 1N0VC 1KIMA 1XF9A 4Q1AA 4Q1CA 1R0XA 5KPDA 1JJ7A 2DWOA 2H18A 1DAIA 2W0SA 3EASA 2FGJA 4EJSA 4GZLA 3E5HA 1GZSA 1YQTA 3UMSA 4KSBA 3W6NA 2W0MA 1KK3A 1QBKC 4TMWA 4DB4A 5DN6A 2OM2A 3P20A 1T0JB 3K9LA 4JZKA 3GD7A 1F5NA 2WJHA 2ANCA 3P4YA 1UDXA 2H7VA 2HV8A 3THXB 1DAGA 1HUQA 1RIFA 4QGGA 1SVKA 521PA 5HPYB 2VYFA 1CR2A 5AJWA 3CWQA 4OQMA 3B2EA 1OHHA 3AQ4A 3PEUA 4GI7A 4PANA 5ANRB 1EG7A 2VP6A 1P72A 3QKSB 3P26A 3GLIE 4HUQA 4BLOA 4POAA 4A8JA 1P2TA 3W3AA 4FN5A 4I99A 5TMPA 4B33A 5KNDA 2AFHE 4ZPXA 5EP1A 2OBLA 1XD2A 1QHXA 1ZW6A 3CM0A 2O0HA 2A5YB 1XEXB 1FQKA 1KMHA 1E94E 1HY3A 1T91A 4Q7JB 4EFNA 4HB0A 1XXHA 2X77A 4C0LA 5K8IA 3LLUA 1XPUA 5TV2A 1EK0A 3S1AB 4NYMQ 2ZI6A 4QG7A 1NN3A 2I1VB 3ICEA 2VF8A 2NPIA 4GMXA 1U94A 3T1VA 4BLSA 4BFXA 1ZNXA 4HDOB 2IX3A 2EFHB 4JSTA 3EIHA 1MO5A 2ZYWX 1Y3AA 2CEAA 3FE2A 3NH6A 3X1WA 3FMIA 1SVSA 5KSOA 2YV5A 4XD7A 3ETLA 1IAQA 5C4MA 4ILEA 2GEDA 4HDQB 2ODWA 1J99A 2J0UA 3TIFA 2BJVA 1FFHA 2LWIA 3H86A 3PJRA 4CGZA 1G19A 2GAOA 1OFIA 2CLSA 2BDTA 3BB4A 4F91B 2YYZA 3FHOA 2WWYA 1F6BA 2PX0A 1OYWA 4Q9KA 1F48A 1HURA 3GJ5A 221PA 4P4TA 1UKYA 3U4QA 4D6PA 4DSNA 3SN6A 5F98A 2JJ1D 2VPPA 3SJBA 3GLGA 1GVNB 1PUIA 4DSUA 2ZJ5A 2YVUA 1RKBA 1W36B 4PAQA 2O8CB 4QL3A 4M1YA 3QPWA 4C0JA 2GRJA 2OFXA 3RLFA 4DXAA 1I4LD 3RSOA 1OXTA 1KO7A 1CULC 3P1JA 2FNAA 4R2HA 1XXHE 2G1JA 4HAZA 4BLTA 2XJ4A 1L2TA 1WE2A 3SYKA 1SGWA 1OXXK 1NL3A 1SKYB 2ZJYA 4PO1A 3SZRA 1E2MA 3MD0A 3VFDA 3WNCA 2REBA 3ICQB 4YMUA 3GLHB 2R65A 4QBIA 4BFZA 3PUXA 3AP2A 3NKVA 721PA 2OHFA 4BZXA 3T34A 4URYR 3THWB 2X2FA 3IGFA 1J70A 3U3MA 1G291 3LVRE 3BFXA 2HXSA 1Z0JA 4ZIRA 3ND8A 5H70A 2ZRIA 1NLZA 4TYNA 4L4UA 4UQOA 4YDHB 1W46A 1X8LA 4LWZA 1II0A 3FKQA 4B44A 4AKHA 3IHLA 2BKUA 4GZMA 4QBFA 1L4UA 1ZUNB 5LB4A 4M8NE 4JLKA 2CK3A 1G8GA 3RC3A 1E4YA 1M34E 1NY5A 5AJZA 3CO5A 2P2LA 3LQQA 1JR3D 1O3YA 2JGNA 4YXWA 4ITRC 3EZFA 3TVDA 3F0TA 4TL7A 2GBLA 3RYTC 3WRYC 5F9FA 2YOFA 4KI0A 4NYIR 4MYUA 3VHLB 2J0SA 2QTFA 4V0NA 2J7KA 3V00A 3TSOA 4A8JB 4Q18A 1BOFA 3ONWA 4LYJA 3ZIAD 1OT3A 1GKUB 4Q9IA 1M7GA 3HU3A 3LXRA 2IHYA 1XD2B 4DJTA 3A1WA 2G6BA 4WOPA 1VG1A 1KMHB 2AD1A 1T8UA 5JJLA 1CU1A 4B32A 4TMZA 3U44A 4B3DA 5EE0A 2DFTA 3K0SA 4NCJA 4QXAA 4M1WA 3M4YA 4HDCA 4TLDA 5E4FA 3OFNA 3O8BA 4B2IA 1IY0A 4TZ6A 4QM7A 3CH5A 4OBEA 4JT4A 4ZDWA 4A0HA 4QFMA 2QE7D 2JLXA 3HYTA 1HTWA 1AS3A 2JIZD 3CRQA 3ZZ0A 4OI0A 3C8UA 1T5LA 1OB5A 4AD8A 2E1RA 3CH4B 3WBJA 3VR1A 1TNDA 3RRZA 1LS6A 1NJFA 2EW1A 2C77A 3W90A 3DZDA 3A37A 2A30A 5EE5B 1ZD9A 3GFPA 1U90A 2BMEA 4TZ0A 5FBWB 4JT2A 5J47A 2ZRKA 3NG1A 2DFNA 2IEYA 2ZI5A 4FCTA 5IRCD 4CT4B 1ESNA 4FMDB 3EWAA 4JS0A 3U7EB 2ZRFA 4E07A 3GLIA 2X19A 4G5QA 3UKDA 3U4QB 2XSZA 3GJ7A 1KDTA 3K8YA 3IKJA 1S3GA 2RGXA 4A6XA 3SBDA 1JEEA 1TADA 4JVMA 2BV3A 2K5UA 4KLNA 4BLQA 1XTJA 4JLVA 3TJZA 2Z6VA 2JLYA 3QVUA 3REFA 1GWNA 1RZ3A 1VG9B 5J40A 4ZCMA 1P73A 2F1JA 3DL0A 3UMFA 3LO5A 3B82A 3FKSD 2N1BA 4UJ5A 3IUYA 5DN6D 4LV6A 4PSAA 1T4GA 1OV4A 2QGNA 1RJ9A 4NCKA 5TXGA 3QJYA 5J5CA 2H17A 3ZS9A 2ZRAA 4B34A 2G3YA 4KLZA 3PENA 1EESA 1S4QA 4J0QA 5FPYA 2AXPA 2ZJOA 2CVFA 3CZPA 4Q7KA 4TMVA 3DKPA 1Q0UA 1R5OA 1XCMA 2BBTA 3THWA 1GRRA 1OXVA 2QMHA 3FMOB 3LX5A 5KSZA 5L3RA 4JKIA 3M1IA 4LPSA 5EXPA 2ZS9A 4B74A 1XTQA 2VHQA 2OBMA 1OYYA 1DG1G 5M04A 2GNOA 4NCIA 1Q21A 3LW7A 3I5YA 4QGFA 4KFUA 2XB4A 3QKRA 2HT1A 2ATXA 4N0EA 1NJGA 1UEJA 3H4MA 4JLAA 1MT0A 2OXCA 1M74A 3UWKA 1XTSA 3TRFA 2ZYUX 2AFIE 2F1RA 1NSFA 5JSZB 5FOVA 1NBMD 4LJ4A 1W5TA 2ZRDA 4MYTA 4XVRA 5IK2D 1NMZA 3A1TA 3KKOA 3LFUA 1AKYA 3CR7A 3SEAA 3ADBA 4F4CA 4AYTA 3KUDA 4DUGD 2QSZA 1X86B 3HU2A 4AWXA 1KI4A 2AR7A 3UG7A 3PITA 4EJSC 3V4FA 1CXZA 2QAGC 2FG5A 1DVRA 1GILA 1OLOA 4JKYA 1IN4A 1HT2E 3LRPA 3FB4A 1G5PA 3O8RA 2O8EA 3U44B 2KSQA 1P2UA 2GDJA 2QAGB 2W2TA 5FUYA 4B2PA 1NMXA 5K8TA 3TW4A 4EJSB 4NL4H 1DADA 5B57C 3LX8A 4MDEA 4D80A 1XWIA 4YMTA 4HI0E 2IYTA 4BFWA 2GETA 2IS2A 4P31A 1Y63A 2YKGA 4PSKA 2BCGY 2WJVA 5F9HA 1JQJC 3QPVA 3JZAA 2VHTA 2H92A 2WKQA 3IDQA 5B2ZA 2Q3HA 2D2FA 5DI9A 2GZHA 4WZAE 4R98A 4DCUA 2J7PA 2QORA 3THXA 1Q20A 5TDHA 4Q47A 1XEWY 3K53A 4XTRA 4MQBA 4KVAA 1J2JA 2ORWA 4PHHA 1IBRA 3HYRA 1NY6A 2ZE8A 1Z47A 5DO9A 3WYFA 3I1FA 1U9IC 2KBFA 4TTQA 4MYHA 1Q44A 5GVSA 4DUGA 3JVVA 3QKSA 1QHGA 1E79D 3THOA 3GP8A 2ZQ5A 5JZVA 4ZV4A 4HUQB 3IO5A 3Q8XB 3H1TA 4DLUA 1VHLA 1P4SA 3W6OA 1NN0A 1H65A 5AJXA 4IOLA 3FOZA 1RVDA 5CJPA 4BUJA 2YWGA 1UF9A 1GNPA 1W2HA 1E32A 4B6EA 2NTYC 1XXHB 2QRZA 3RWMB 2ZRPA 4DIEA 1IJEA 1R0ZA 1KYIA 4AY2A 5JFGA 3PXGA 2B92A 2GVDC 4HLQB 2J87A 4GSYA 1GAJA 2ZE6A 3CX6A 3VMFA 1S9HA 4P3YA 3L2OB 4GP7A 1JPJA 2FA9A 1TTTA 3D31A 2O52A 1Q1QA 1IJFA 4TMTA 5E3HA 4F4IA 3PUWA 3EZ6A 4IOMA 4FMDF 1GRQA 1H8EA 1G3MA 2J0UB 2OAQ1 3FWYA 2J1LA 3ASYA 4TMKA 1W0KA 1S9DA 1E3MA 4TTPA 3RHFA 4KHZA 3BFVA 1RYFA 3SJAA 2LKDA 4OQFA 3QNUA 1Q57A 4GT1A 4URXR 3EZ7A 1TF5A 1WA5A 3BJIC 3BB1A 2TMKA 5B58C 1EX6A 3HJNA 2WPDD 4P32A 5CJ2A 2ZJBA 4O25A 3OIWA 3O47A 3P4XA 3QKRB 2ODBA 4QBGB 2MSDB 3GLGB 2XNSA 4M1OA 1C9KA 1GKIA 3A8TA 4C0SA 2ATVA 3F5FA 1S1CA 5AUPB 1W36C 2KJQA 2G88A 4EAQA 5CDFE 3GJ3A 1ZC4A 1YR6A 3QSYA 2CNWA 2J0VA 5SZIA 1OH6A 2VSOA 2PJZA 1EXMA 5JECA 3BK7A 2OAP1 4UJ3A 1E2QA 3LBNA 4NMMA 4E5UA 2Q3MA 5EP3A 2I4IA 5J4YA 3K0AA 1TAGA 1SZPA 3KB2A 2B8TA 1N6RA 2P5SA 5CLQA 4OK6A 4A82A 3SBEA 4JLJA 2ZVQX 1N6LA 3K70D 4RD6A 4CW7A 2WMNB 1YZUA 4L5BA 3BWDD 4NBSA 3WBKA 4TYPA 3EPJA 1KSHA 4DEYA 1PVOA 1E69A 2CE2X 2O8EB 2Y8EA 2XOKD 2O8DB 3PFIA 2P5TB 4KFTA 4MKFA 2R2AA 2HF8A 4MUAA 3AVPA 1ZNZA 1TEXA 3C5HA 3FMFA 3BE4A 2I3BA 1UKEA 2G1KA 1CF4A 5JEEA 4PZYA 4KAXA 2C99A 4LK2A 4CZ2A 3LY5A 5GADl 3CZQA 3GQBA 2OXRA 5JLJA 5B30A 1LS1A 3CIOA 2BC9A 3NDBB 2FEMA 3R9XA 1XMIA 2ZRMA 5JCZA 2GXAA 4KV9A 4G01B 1FPMA 5L3VA 3AKEA 5DH9A 1D2EA 1MOZA 1DAKA 4V03A 2O8BB 4N0DA 4Q9JA 3WYGA 3FGNA 1XRJA 1I2DA 5FTJA 4LHZA 3Q7PA 3RVBA 2VLIA 3L0SA 2XXAA 2Z43A 4I1VA 4DLXA 1Z2CA 2VRWA 2YWEA 2WIAA 4B3GA 2DYKA 4LCBA 1VCIA 2PT5A 2FN4A 1J8MF 3HDTA 3UATA 2OEPA 1D9XA 2PEZA 1IOZA 3Q85A 3UWOA 5AWFC 1Q12A 1U98A 2QG6A 4P0TA 2FU5C 4W5HA 2MMGA 5C4GB 4BRUA 2PX3A 3BRWD 3X1XA 2UVQA 3B85A 4R2IA 2QENA 4ZDIA 2ZJAA 2QL6A 4G3XA 5EE3A 3N2EA 5JEDA 3Q3JB 1Z06A 4TL9A 2R6FA 2ZI3A 2XNDD 1Z6TA 4C3ZA 1BMFA 1E9BA 1W2GA 2GEUA 1S0UA 2VHCA 4JMPA 3L43A 1U8ZA 2WHXA 2XX3A 3SS8A 5EJEA 1AQYA 3GLIB 2WOJA 5AUOB 5FFMA 4U5XA 1OW3B 2IA5A 1ANKA 4CEJA 4BFUA 2GF0A 1N5KA 1ETUA 1U99A 3W8RA 1P7CA 4A0RA 4LJ5A 3K9HA 2RAPA 4WXPA 1L7VC 4QGAA 4ZKDA 2HCJB 1E2PA 4JLMA 5BN5A 1H8HA 5FTNA 2F43B 3O8CA 1WBDA 3DMNA 2J5XA 4M2LA 1KY2A 4V0OA 2ECKA 2FX3A 1QZXA 1OH5A 1U8AA 4AK9A 2ZR9A 1X8KA 4A9AA 1EFUA 1KSFX 4TQUS 1KNXA 2ZS7A 4C30A 2RH5A 5TY0A 2GXUA 3K0AB 1LV7A 4FMCF 4LOAA 4QHSA 2HEIA 3OIYA 1GUAA 1VTKA 4KFRA 4PFSA 1EGAA 2ODEA 2CHVA 1N5IA 4PHTA 1S3SA 1ZYUA 4PTLA 4YC7A 1E2FA 2ZI9A 1O87A 2DHRA 1GKYA 4UNSA 1U9IA 1Z6XA 4MRRA 4YMSA 2GZAA 1LVGA 4QNRA 4NP6A 2OCAA 4TQ9A 3ZH9B 4PR0A 3ZIAA 1DS6A 2O8DA 2HLDA 3FTQA 3REGA 5DNYB 3FHTA 2ZJ8A 1BO6A 4D4LA 1E9CA 4L16A 1GOTA 3R8FA 5HCIA 3BOSA 3GJ4A 2IEZA 3N70A 3B1ZA 5JSZA 2ZVPX 4Q7MB 3EAQA 4OQNA 4B3FX 1Q1EA 4DSOA 1NMYA 4M9ZA 1WF3A 4PZLA 4Q4AA 3B1YA 2W6ID 1BYUA 2P6UA
chains in the Genus database with same CATH superfamily
3KJNA 3RYHA 4K0RA 4IV8A 2HPHA 4ND3A 4C4AA 1LY1A 3LUJA 1I7NA 3JWJA 2ZTVA 2OFWA 2WDZA 4UHKA 2ORYA 3C6ZA 4ZPJA 4ZVKA 4W5RA 1XELA 1ZVJA 2ETVA 1YACA 2GPTA 1LLFA 3KZ1E 2BKXA 1VRCA 4C0BA 1FRVA 4FGWA 1B0PA 4NARA 5CFNA 1TM1E 2X8AA 1TF2A 1QO7A 4IEIA 2QSUA 4Q1BA 1BE1A 2QAIA 2QAGA 1UPFA 2GJAA 1J0BA 4E22A 4Z6KA 2IYLD 3OE4A 3UJBA 1REQA 1DRJA 4C2BA 4YI3A 4QA9A 3FPJA 3A7DA 2QX8A 2FMUA 4KH0A 1XDGA 2CUZA 2ZBRA 3DQPA 3INYA 1TYBE 3L01A 4JGBA 5JI2E 1QFXA 2QUZA 2VCEA 3BHIA 1P7WA 3QXHA 1ND5A 4CM9D 1IL0A 3I52A 1SVLA 4GX0A 1Z4PX 3Q98A 4U4AA 4TKMA 1VI5A 3AF3A 3AB3A 1VHJA 4XYGA 3DQQA 3AZOA 3K9WA 3O4GA 5EHNA 3WYEA 3CONA 4JK3A 1JDUA 4EY5A 3PB3A 1NW4A 3QWAA 1BX1A 2A9JA 2BH9A 3AFGA 3IIJA 4K88A 4W82A 4B43A 4BHTA 3NYIA 2V6GA 4XH9B 4QWWA 4UTOA 3WDKA 2FZLA 3OQHA 1XVLA 4D4MA 5A4KA 2FE4A 1S01A 5LU9A 1P91A 3ACDA 3OU7A 2YRWA 2JAHA 1M1YE 3ML1A 5KCMA 4LJRA 1NZDA 1CJMA 4S12A 4PX2A 5GZ6A 1CQIA 3SLGA 2PZ8A 1Z6YA 4ND2A 3LBIA 4US1R 2FZKA 4GR9A 1N2GA 1DQRA 3CX4A 4O8ZA 5JARA 1KNQA 3BBPA 2MSEB 2WJ4A 1AK2A 1OREA 1UINA 2P6NA 4PQEA 4ZALA 4ZI2A 5GJBA 1LPOA 1F0KA 1KQOA 1LTQA 2W22A 3EEFA 1IQ0A 3T5TA 3G9XA 4GI5A 6PFKA 3KR9A 4W7IA 4WSOA 2LKCA 5GIPE 4AY5A 3WLJA 4Q1FA 3AXTA 2ROQA 3AG6A 2Y77A 5B53A 1I3MA 3AKYA 3LUPA 3D8SA 5CDTA 2QEQA 1CJTC 5C8YF 3PQEA 1MVLA 1V16A 4NJEB 1JDBB 2H16A 1ADFA 3OICA 4YGYA 2CZGA 3CF2A 1S2MA 5LMZA 1X7ZA 4I6EA 1OH7A 1JSLA 1O0CA 4JI2B 4AROA 3INTA 4Z53A 1GNLA 1G4AE 2BFFB 2JAWA 1ZPDA 2M98A 3CKKA 3OA0A 4QTUB 4WY5A 4CFZA 1QIEA 3QGMA 4KMSA 2Q46A 4LYHA 2R6HA 2AMVA 4KE9A 1SAYA 4HAWA 4NJOA 2NYRA 4JEUA 4CE6A 3KOUA 2ZR8A 3D3WA 1EUQA 4CEIB 2JCVA 3RT9A 2V7WA 1SULA 1M83A 3ESDA 5FCDA 1O08A 3RBZA 2ZSIA 1GUZA 3QUBA 2ZXEA 1UJ5A 4KMMA 1E1RD 4J03A 1ODJA 2JEZA 3OQIA 1N3BA 3BX1A 3IUSA 1NLFA 4JL5A 1KP9A 4HJXA 1SC3A 4M9SA 2ZRGA 4JI4B 3HB5X 3EPHA 4PLFA 3O7WA 4OCZA 2A78A 2G0TA 1ZOSA 2Q21A 1NYRA 4HG2A 3TQFA 5F1OA 3U5ZB 4JENA 4GM4A 1ECLA 1PV1A 2IYEA 4FFMA 5D3KA 1R8SA 1BE8A 2VYNA 2XNCA 3QPBA 4BP9A 2NUAB 4LW8A 3OX3A 4US2R 4TKZA 1T4BA 3TR0A 4RQTA 1DFHA 5CB0A 2VH1A 3VTZA 4EF6A 2HLNA 4EFDA 2CV0A 1K75A 2NX2A 3DM9B 1Z5VA 3N8IA 1ZQ1A 4GI1A 3T5CA 1NI4B 2C4UA 1IN5A 1S8OA 4KJZA 4UDYX 2XZLA 1YAJA 2F3QA 5JMWA 1Q0SA 4FP9A 2VHXA 1GDTA 3ISJA 2ZQZA 4J7UA 5F76A 2OA0A 3WA6A 1RTTA 3GBVA 4XWAA 1VCNA 5SICE 1ARZA 1RHJA 2IC5A 1XDZA 3AFNA 2UV8A 1SD1A 3FNGA 2PXHA 1I9GA 5FWAA 3BH7A 1L1QA 3BSWA 3GUHA 2V7TA 2WBLC 4H15A 2QRJA 4KGDA 1YR7A 4QAJA 2AN4A 2BFPA 1H2FA 3NAGA 4ZGBA 3LCMA 1UXOA 2GBPA 3C87A 3S2YA 2WNHA 4MV8A 4A0FA 2BKEA 9MHTA 3B6JA 4FUQA 4HB2A 2IWHA 3H5WA 1NTOA 5BURA 3DMYA 2XDQB 1NXSA 2NSHA 4Y0NA 5D01A 1Q0ZA 3UFXA 3HJBA 4RD2A 1ZKDA 3Q7RA 4BJ3A 1UT8A 3JZIA 3QWBA 3CF4G 4G67A 5G1PA 2Y0CA 2V1XA 3GDWA 3H8JA 2WWIA 1FVHA 3BERA 1H94A 1NW5A 1TQ8A 2AA3A 4EHNA 2ZETA 1AD2A 5T7BA 4FIDA 2JD0A 5BYAA 4QVIA 2CB9A 4IHKA 1QWOA 2VJMB 3BHMA 3FUUA 2JLZA 3G9ZA 1ZWKA 2H4HA 3WL3A 1U0BB 2FFHA 1E6UA 3BGIA 5LVAA 4MJ3A 1TJ3A 1ZGCA 2RK6A 5BMOA 1UBKS 4EX7A 1SUAA 2Q1TA 3AHFA 1NM5A 1JT2A 2H1OA 3RSSA 2ILTA 3SYRA 1W88A 5IP5A 4ZCIA 2FK7A 1G20B 2RI1A 3BS4A 3HV2A 2VK1A 3SAJA 3TRKA 3ZE0B 1QR2A 1WW3A 2WU8A 3NHFA 3QLEA 4IPTA 4E32A 1MO4A 4QULA 1E1KA 2H0QA 4I7EA 1Q0RA 3DAGA 2DPLA 5KHOC 1L7AA 5FH9A 4RELA 1AHNA 4K9NA 1ATZA 2LPMA 1JLMA 4NJEA 1WDWB 3G0HA 1ZSVA 3I23A 5LQDA 4ENWA 2C5SA 1CRLA 1DU4A 1XZNA 3PHGA 2RK4A 3T0GA 4WX2B 3AM5A 4O4HB 2A5FA 3SFVA 1KRWA 6REQB 1ZL2A 2B99A 2UZIR 1UJ2A 4GR5A 2X6TA 121PA 2ZOSA 4IVQA 3QX3A 3ROEA 5F64A 3UN1A 1X7HA 3IODA 3N7UA 2YOHA 3RFTA 5DLQC 1YCHA 4ENPA 2VDJA 4RTKA 2O7RA 4Q3CA 3FPKA 3OEWA 4ND8A 4YQYA 2PZKA 4KR6A 2O48X 1SCUB 4CEIA 2GEKA 1FB5A 2RHTA 3AL3A 4QX6A 4R5MA 3VR6A 5D7NA 1YVPA 1P80A 2H0AA 2F64A 4TRMA 1GU0A 2VP5A 1M1UA 1QVWA 1R5NA 1N34B 3EIXA 2FPIA 1UWVA 2FMHA 4B3XA 4DAEA 2D0OB 1SXIA 2JW5A 1H23A 3DLAA 3RTDA 4PVDA 3TUZC 1K5HA 5EC8A 4RZ3A 4BMCA 1JG7A 2VP2A 2DWPA 1Q74A 1WSAA 1RJEA 3I39X 1JG6A 1Z62A 2CXRA 3PRYA 1OC2A 3IOCA 4GI3A 4RNDB 1N2CE 2AXEA 2C2YA 2WWHA 3AG5A 1IQPA 2WJIA 1XA3A 3H9BA 4BGEA 2AEFA 3HA3A 4MRNA 3ONVA 2V8OA 2NO9A 3L4EA 3SQXA 4LYAA 5CLIA 4NFHA 1HE3A 2G4CA 4YV7A 3EEOA 2FQWA 2PUCA 3RC7A 3PHJA 4DQDA 1P9RA 4Z2YA 4KITB 2EG5A 3SEFA 3COWA 5IYZA 3R6WA 4LZLA 4IUDS 3X43A 4BX0A 2REXB 5L4LA 4OQQA 2H2AA 5LQUA 4LYDA 1E9SA 1TZMA 1VP3A 5JH7A 4OHRA 2D7DA 4K9OA 4WVLA 5PGMA 4QJ3A 4LFCB 1H2ZA 4ZQBA 5IARA 1QYCA 1U31A 4IS3A 3G8YA 4XKJA 2AZXA 4HDNB 4MA0A 3VR6D 2ODPA 5KOJA 1H0SA 3FCUB 3HLYA 2IZ5A 3TEFA 5F12A 3CKLA 4KDCA 3OPYA 4EF4A 2Q4DA 4FBMA 1XL1A 4UCFA 1ZM9A 4W9NA 5G41A 5HGJA 4FM9A 4IFBA 2KE5A 3GAMA 5C8ZA 3HVIA 1O6ZA 3RC2A 4XB2A 2PGNA 1NVXQ 2B0CA 4AU1A 1RVV1 5JRDS 4DVGA 2XDQA 5JJIA 1GCUA 5JDIA 3F1LA 4HWRA 3ZZMA 1PR2A 4G9EA 2HK9A 4HV4A 4P7FA 2A14A 1E6CA 1YKSA 2O2YA 1QRUA 2R25B 4G0PA 3SC3A 3RWBA 1ZKMA 4IG9A 4P7BA 1PJRA 3OPQA 3AV3A 1YZFA 1B7GO 5B1IA 2GXQA 2JK1A 4EKYA 2VJMA 3RGGA 4GPEA 5GOTA 3LX6A 2NSYA 2JAPA 2QRHA 4JODA 4HNVA 1K7SN 1MC4A 3E03A 6Q21A 4F04A 3P9SA 1ZICA 3IFSA 3DYBA 3ILVA 2Q4TA 2AE1A 2W8BB 1SU8A 3D5EA 3QENA 3SE0A 2HEGA 1D7AA 1BMFD 4JLSA 3DLHA 3AP1A 2IP4A 1A7UA 5DWQA 2I55A 1G20A 4I3FA 2ON6A 5LSAA 1GUYA 2OV6A 5KO2A 4BNNA 3K09C 3WGMA 3BJMA 3ONDA 3QQ5A 3MMPA 4IQ0A 5FWNA 2G77B 1TEHA 2RH9B 4UULA 5GY7A 2OV3A 5F1KA 1T6ZA 1J9GA 3TW0A 3W04A 2JI8A 4EI8A 5FLYA 1UXIA 1WB4A 2IPMA 4Q82A 4INZA 5FOXA 5IM5A 4J1SA 5LM3A 5G3ZA 3E7WA 1YK1A 1JMKC 4AP6A 1FMCA 1KAHA 3ZNNA 1KJ9A 4N65A 1U5CA 5JI3E 4H1VA 3F8WA 1AO3A 1M8FA 3IEXA 4WOCA 3EH1A 3HA7A 5CDFA 1XLTC 3H2KA 4P58A 1LPAB 2FUG1 3U40A 5DX8A 1NNEA 2OC4A 2WWWA 1CY7A 1SVMA 1JKMA 2XIQA 5EJAA 4DAOA 2FQXA 1ORVA 4E12A 4F5DA 5FPSA 2YW2A 3GR6A 1JNYA 4QRIA 4P5EA 3R23A 3A4NA 4TKUB 4W9MC 1WU7A 3KIPA 3OSZA 1MB2A 4P83A 5AI8A 3TQRA 4F38A 4R69A 1B26A 1EXVA 1GPUA 3OF3A 2XITA 3OE5A 1PJ8A 3CBGA 2A57A 3KQWA 2NTEA 4GYWA 3VXKA 3A6HA 1F14A 2OILA 3PUIA 2XOKA 5PNTA 4XFJA 4KPEC 2B2CA 3T9CA 5B4TA 4GGOA 2X0FA 2VDMB 3GRYA 3RKUA 3C5VA 3OQPA 4S1TA 2EGGA 4D9JA 4X93A 2ZIXA 3MS2A 1MEOA 4MLDA 4AZVA 4FW9A 2BTQB 2ZP1A 2IUEA 4L8WB 5EGSA 4MV0A 4Z5XA 1XCGB 3BICA 1YQGA 1RW4A 3MJHA 3QBVA 1CJVC 1K9VF 2GERA 2I6SA 2QTMA 3NHLA 2J4CA 3HCOA 4LK3A 2IY7A 2HU8A 5E4JA 4Q05A 1N8NA 2VJCA 1KEWA 4MRVA 1QANA 1A69A 1RWVA 1VBKA 4OL0A 4S2EA 3ZDEA 3DCYA 4WINA 4WNCA 1X1TA 4LF5B 5FADA 3AX6A 3KEGA 1RAFA 3VGPA 1KOFA 3HPRA 2FEPA 2Y1EA 3K9QO 2I4OA 3J81k 4IRUB 3NUQA 3ZE7A 5JPCA 4L4SA 3IUNA 1VA4A 4HXFB 1OROA 1KQFA 3E8MA 5JY1A 2IPXA 3UAGA 1MQSA 2P3QA 1W49A 3W78A 3K92A 5FPPA 3ZGXA 4NQRA 4Y9RA 3DCNA 2BRUC 3T1NA 1NC3A 2QV7A 3KVOA 2P79A 3KZXA 4REMA 3I6BA 4Z54A 2UZ4A 3KRTA 4KWIA 4PX9A 5HKBA 2QIOA 3T1OA 1E3JA 2VNAA 3VZQA 4DKJA 1T5HX 2HU2A 1TCAA 2QJWA 4G41A 2BJWA 2J5BA 3H8VA 2FPKA 3EXG2 1J8YF 3IOBA 3NBQA 1K6JA 4GBJA 4MMXB 5GPBA 4HEHA 3ZNPA 3FRIA 4NV0A 5FPKA 2V5VA 3CINA 2DC1A 3L5OA 2YVKA 4LBVA 4RKEA 2L42A 3IOYA 1A72A 1DO2A 4AMVA 1R8YA 5EINA 2ZUTA 1TAUA 3MWKA 4M3NA 3ZVKA 2YS6A 4RADA 3AM4A 5D2CA 4UATA 2KMLA 1PJ3A 2ESRA 1Z0KA 1SOAA 2YCLA 1GEEA 3EGEA 1KS9A 3RODA 2GM4A 4NFLA 4YT5A 1RWMA 2HDHA 2Z5GA 3ZW8A 3EN0A 1YT5A 3Q6NA 2VZ9A 1M67A 3CJQA 4DGSA 4HZUA 1Z6QA 4DLSA 5JAHA 3BWVA 3HB7A 5FBLB 3VH3A 4P36A 2FSHA 5D3MB 3RT1A 4LQDA 4BJ6A 3EUEA 1A9TA 1EK6A 4FZRA 4KMRA 4B2YA 1AKEA 1N2ZA 3ROMA 3W4IA 5DU2A 2NU9B 4YAGA 1ND6A 2EWWA 3KX2A 1C8BA 1P2SA 2FPWA 5FJIA 1N6HA 3NW9A 1GN9A 4N47A 3ILXA 4IZ6A 5B12A 3KB1A 3W4JA 5BOVA 1WCWA 2D1SA 3P0HA 4PIMA 4LVNA 4AJJA 4MZDA 2OCLA 2V6JA 1DT5A 1V1RA 4WCDA 5AI5A 4EG1A 2VTVA 1NVWQ 3BE5A 5KNBH 2DLCX 3IDSA 3GJYA 5H3HA 4DBZA 2B5OA 4Y9SA 5CA1A 3IP7A 4LX0A 1U0EA 1JYFA 3QNMA 1E1DA 3UTDA 2A9VA 3AINA 5G53C 1GLVA 3DVQX 4Q03A 3LQ4A 2ADOA 4DLVA 3P9PA 2AFIB 5TARA 1JEOA 5DNCA 1PR5A 3UEOA 2CDBA 1H8ED 3R40A 2F00A 2QN7A 2V9ZA 1TUEA 5CG1A 1NG1A 1DQSA 3NU1A 2UZ3A 3IJ5A 4DYVA 3ZHOA 3A4MA 1CDEA 2PKQO 2OO5C 2ZRJA 1E1LA 1YL5A 3D0RA 5A9TA 1WZIA 4DLZA 4S04A 3EXEB 1C9MA 1PWYE 2FUEA 2WJ6A 1FNNA 1QB8A 3MT7A 4OHWA 1U4NA 4Y6RA 3U1VA 2GM3A 2FQ1A 4G85A 1E66A 1MD9A 1PZMA 1Z7YA 2BFOA 3CWCA 3OP4A 3QVGB 5IULC 1K5GA 4RGYA 2Y0PA 1Y7HA 5G0UA 4J76A 4QUDA 3A9TA 3CLRD 1AGYA 1DXQA 3DOFA 4DTIA 3VSDA 2OR3A 5G0VA 4XWWA 1KAEA 3UJ7A 4AS2A 4QXPA 4LY6A 2R87A 2AH5A 4EM6A 4JYBA 4ZQGA 1FFGA 3QKTA 4C78A 3QG1A 2JA2A 1XOIA 3COYA 2R96A 1RXUA 2JNWA 4O6VA 3FKSA 2XGMA 3MGBA 3SVZA 4EHKA 3STHA 3H2GA 3DGEC 4XUEA 3ZE6A 3FDIA 3WS7A 2LV8A 5M29A 1PJSA 3I2HA 2CHEA 4G25A 3K16A 1MH1A 1ZNWA 1LUAA 2IUSA 4CV0A 1R6AA 3IPXA 5I7FA 4C4RA 5IDWA 4FXPA 4R2JA 2P1ZA 3NWJA 5JWHA 2YHIB 3SBOA 4RTRA 4HR7A 3RSQA 3VI3B 4L2IB 4D9HA 4NOKA 1JSZA 1N2BA 4KQ2A 1GTMA 4J8PA 4Z1MA 3TM5A 2B1GA 4MPJA 3NFRA 4AIIA 3DEYX 3JQAB 3FMGA 1NIJA 3D0KA 3L7MA 1QGAA 2PGAA 1N5DA 3PNMA 5ALGA 1N5MA 4GQBA 4LHXA 3ES9A 2H07A 4DC9A 2GEJA 2RCNA 4IIBA 1QHYA 5REQA 2HSDA 1ZH0A 2A0WA 4ASUA 1N78A 3WMWA 5HE9A 4B3RB 4JFAA 4BLPA 4WQMA 3W3ZB 1DAFA 1RYHA 2EJUA 3I0NA 3K70B 1Y81A 3M6VA 3G02A 4FJ1A 3ZDCA 4QYIB 2XCTB 4TL8A 2ET6A 5E2BA 3S2ZA 5FNVB 2XEXA 1BU5A 1FZQA 3NTRA 4E5PA 3JR3A 5F4ZA 3C4JA 2G5TA 1TT7A 3PQFA 5ARDA 4TVSA 1WQ3A 2K4MA 3QUQA 3EWIA 4FWIB 3UGQA 1T0IA 3G68A 3N8NA 3F5MA 3KWFA 5FF9A 2HSGA 4XSVA 2D2IA 2D06A 2GZSA 1LLUA 2P5YA 2XNKA 3AFIA 1H9AA 1V7PC 1IEQA 1NBHA 2FQYA 3DP7A 1U80A 2SKCA 3EQ8A 3DJFA 4LCEA 4X1OA 2ZS8A 4RY2A 3ZWBA 2ASEA 1AG9A 4XWYA 4CQLB 3KQQA 2I62A 1X1QA 1O2DA 4BGUA 4FFWA 3U6BA 4AS3A 1HBJA 2IFTA 3R6LA 5JW6A 1SNYA 3I76A 5KJFA 4ISCA 3QTTA 5AHXA 3V4ZA 4U39A 5HZGA 3GB9A 4JA2A 4RD0A 1IB0A 4BNKA 2E49A 1JDVA 1OR8A 4JLNA 5EUMA 4F7WA 1R0WA 5HWSA 1D5WA 3NFYA 4KU4A 2VSXA 4RKYA 4AKHA 1IWPB 4C6TA 1QOQB 2OZEA 1SH7A 4ZXPA 3ZLJA 2W4IA 2CZCA 1OTXA 1JRLA 2IUUA 3IAS6 1DEXA 3U2QA 3AR9A 5A5GA 1HYGA 2KQUA 1JQEA 4AO8A 5KKNB 2C3OA 2GJKA 5CA1B 4D2IA 2YNMC 2V9CA 1NXQA 5CFLA 3GZJA 1B00A 4HGZA 3A3YA 4FZ3A 2D7CA 1ULBA 4HMPA 4MTCA 1AUVA 5AVRA 1NOJA 2WILA 1O95A 2I2AA 1HYBA 3A3OA 4ZI5A 4Z9AA 1A0OA 1YR1A 1AHHA 1N25A 2ECFA 2GM5A 5DHPA 4BVLA 1RKVA 3GUCA 3AF0A 4Y6GB 2QRLA 1HL7A 1UDCA 4LUCA 4WPGA 1LK5A 1SURA 3IEVA 4CT5A 2JCSA 4BJHB 5JD4A 2PUGA 4UMEA 1ZIDA 4B9AA 3ROPA 4B6GA 4DPKA 4NZZA 1ZEMA 4U2KA 3QVGA 4C76A 1E5TA 1D5CA 2R5WA 3GIDA 4P4SB 2VA8A 2FHPA 1ID1A 4RNCA 3JSXA 2GHIA 3BEDA 3V8RA 2J5RA 2PSFA 3NBUA 1A4UA 3TTTA 3PNSA 4OEHA 1XVUA 4G0MA 2IYYA 4Q4HA 3W2FA 1HV8A 2XWBF 2ZYRA 1DAHA 3D2LA 3VISA 3WGZA 3S0JA 3WMFA 2E85A 4A0GA 5IKMA 1Z0UA 1QPZA 4O4JA 4J94A 1U4SA 4OM7A 2WW8A 2G82A 4CCYB 3EF1A 1YRAA 3HLKA 3HUUA 4IIJB 1E7SA 3ZWMA 4IO1A 3W79A 4GNKA 1ZRHA 5EFZA 1OBFO 5C5EA 3ZV6A 1B41A 5DI3A 5DHTA 1OWMA 3RROA 1PDVA 3W6UA 3M1LA 4IKPA 1DNPA 1QIDA 3QYFA 4TN1A 3ZJ4A 4R1TA 2VT7A 3AZQA 4JUFA 1Q2UA 1WW8A 2HGSA 2IE8A 1WUIS 2DGDA 2PJUA 4MYSA 4RMJA 4YI5A 4HDKB 1G3RA 5BN4A 5C51B 1QQ5A 3LLMA 3ZHUA 1RD4A 4CMEA 4HB4A 4D79A 4BZPA 4QM6A 4OLAA 3QLVC 3ASVA 4OQEA 3DONA 3WLMA 2FR8C 4X6LA 2QM8A 5BV7A 4LYEA 4HDRB 4U7JA 4Y9DA 3NTXA 1Q11A 3GZNA 4PFKA 3M2TA 3LKBA 5CUQA 3SD7A 4FDLA 1T2DA 1E20A 2WMOB 2Q0HA 3AIOA 3S55A 3PXUA 4PIPA 4D9FA 4NV1A 4XUDA 1UQRA 2CJFA 4ZU1X 1SB9A 4PN7A 2WFMA 5FNVA 1PFQA 4UHDA 4C87A 4ZGWA 2C82A 2WJPA 3HJTA 3TLCA 3PX3A 3T7SA 2C5LA 3NTQA 4EF5A 2IIQA 1G42A 3BMNB 2GJ9A 3CLTD 3D7KA 4LV8B 4Z8XA 3SZLA 5BXYA 1F0YA 5F77A 3N0RA 3H3JA 1RC8A 3DEJA 1CP2A 3O82A 1UOOA 4PZZA 5G1NA 1O6FA 1YQUA 1MIOA 4JCOA 1NN5A 3RR2A 4OGGA 2HWYA 3ZBUA 1PGOA 3PNKA 2PKRA 4HGYA 2JZOA 2QI9F 5FV7A 5EJ7A 1YZKA 3TBFA 6YASA 3MCWA 2AW5A 3QUSA 2I4MA 2CW5A 2IOYA 2ZCVA 3JR7A 3RHSA 1JA1A 2VF4X 3EYAA 1EEHA 3BHJA 3BREA 5IBPA 2Q27A 4JB8A 3CX3A 2X4LA 4REQA 1CBUA 3FUXA 4KDEA 3IUEA 3VV2A 1W73A 1U7UA 1LTHR 2LD4A 2YZNA 4JJ8A 4LV5B 1J2EA 3SZUA 4MV9A 1CDOA 3DHVA 1U9CA 3EXHC 5IASA 2FB9A 3PKIA 3SKXA 4EHBA 1Q84A 5K0CA 4QTXA 3KWLA 4MQFB 2ZDQA 2B4RO 3W9BA 4M53A 3ZVLA 1X9IA 1WCYA 2VO1A 5AKGA 2G40A 1HE1C 3NIDB 3VKGA 3A4TA 4MWCA 1O96A 1NW9B 1VIYA 3OCUA 1QYVA 4OQXA 1Z2DA 2Z2ZA 5EIFA 1ZMRA 1JI3A 1UWLA 3RC9A 4BU1A 3L6EA 1EUDA 3U37A 3WJAA 1Q83A 4YRLA 2EFYA 1F4VA 4OJMX 3C2QA 4XEHA 4FYMA 4BV3A 3EPLA 2G9VA 4NE7A 5BWOA 2GHTA 1GDDA 3GC6A 5HSGA 4OUKX 2EOAA 3HNOA 5EXEA 4WDQA 3JVEA 2QVXX 4KNYA 1H1TA 2NZYA 2Z1NA 4TWAA 4DT1B 5K7SA 1WUYA 2UAGA 3O2QB 2IOFA 1MX1A 4L27A 4R01A 5DXFA 4D8XA 5K4GA 1D04A 1TLLA 1NRXA 2UYCA 5EKSA 3OCYA 4KYUA 1ZXXA 1XMQB 4Q01A 2X0EA 4Z7JA 2C0CA 1GCIA 5A7HA 1AMOA 1CNMA 3Q0IA 5TS2A 1YQWA 4QOEA 1PZXA 3WLFA 2R4UA 1L7NA 5JQWA 1XP5A 1TW3A 3CEMA 5GWXA 4GUDA 3SHVA 5LUBA 3QYPA 4PR3A 2V74B 3GGDA 3PHCA 2TRSB 3OU2A 3EE6A 1GFZA 2BI8A 2CLDX 1U0RA 2O7NA 2QT0A 3IR5A 3PXAA 4HL6A 3RF6A 4RD1A 4DMGA 1EXWA 3PGA1 4PY2A 3UV6A 5C1BA 3F73A 2RSLA 2HOQA 5F33A 4N12A 3DHWC 1A88A 1BGXT 1USWA 4X60A 3BMCB 4FD3A 4O0MA 3URKA 5KYVA 2P3LA 2CXQA 1XU4A 4MIYA 1SCBA 3N58A 5KVVA 2NPFA 4MP3A 4P33A 1LGYA 1US8A 1CUUA 2AK2A 5B3KA 1VOTA 5JFOA 1B1CA 2F3RA 1E3TA 2B35A 5IC6A 4URWR 4NBKA 3TTSA 1ILEA 3JWGA 3CNQS 5BWCA 1P3Y1 2Z3ZA 2Y4OA 1HF3A 1VSVA 2HJGA 3SP1A 1BW9B 3EBLA 1SB8A 3AHDA 4OVKA 4TQAA 2ZUBA 5KVAA 1W29A 4KXMA 2QLTA 3VGJA 5A06A 4H4EA 2NZWA 5YASA 1IZ7A 5AI0A 4CIYA 5IAEA 4GC9A 1U8CB 1RYDA 2P9JA 4L6AA 1LJ8A 3C8ZA 2ZE7A 4NDZA 1E6EA 3P2KA 5ICEA 1I36A 1BFDA 1J25A 1D1TA 3NT4A 3FWZA 2MMCA 2AOTA 1TD9A 1TUIA 4QJIA 4HPJB 5DBIA 3MRSA 2F8SA 2NUTA 4YMWA 4RS4A 3VC2A 1JTEA 2RONA 3MSXA 1MQAA 3ANSA 3LYLA 4IDOA 1XNHA 3ZZ1A 3MB8A 1YBMA 1ZSYA 1O9HA 4JJAA 2DKNA 2AKYA 2VVTA 1YDMA 3C7KA 2J9ZB 2OZPA 5HKLA 1G0NA 2O50A 2VZLA 3HWRA 2IIVA 2WWTA 3RDPA 1PBTA 4U9UA 1SXJE 4NI5A 1UBFA 5CMLA 3BZUA 1BD3A 1KJYA 1R0CA 1LB1B 3LHKA 5DEOA 2BGTA 3I9MA 2YW9A 5K1ZA 4F85A 3T7JA 1NVGA 1JE1A 4UEWA 3O4HA 4X24A 2OAEA 4I1UA 4I55A 2XA1A 1I1QB 4WFJA 1TU4A 4Y0VA 5FFNA 3AEKB 4PU0A 4G0NA 2YMQA 2GVZC 5HHTA 2F3TA 3W5BA 3OCXA 4JBLA 3CNLA 3UF0A 2YQ4A 5I9SA 2D00A 2QTHA 2FN9A 2NUPA 1EP2B 3EXFB 3L07A 5T5QA 4E46A 3UMVA 3RJMA 4ZJPA 5KPJA 1IHUA 2YMPA 5KMGB 2GO7A 1W4RA 3OLZA 5DCYA 4JLOA 3CVXA 1LI7A 3MAAC 1CT9A 5KNBD 2QXTA 1LC3A 1VI2A 1ZGZA 5KDLA 3F3YA 1RE0A 3T12A 5BR1A 4EEXA 2AMJA 5DISB 4L02A 2IT1A 2WMDA 2I22A 3AUFA 2H11A 2VBIA 3DVLA 4MXDA 3B5JA 3IVCA 4Q1DA 5LOVF 1ZD4A 3L6UA 4XYEA 3WK7A 5FWXB 2WOOA 3UHOA 4I9HA 2OHXA 4HDAA 2IU0A 1GGFA 3EFBA 1XMPA 2HREA 3CPEA 3KL2A 3K35A 5I7SA 4JX9A 1NSYA 1Q7EA 1XYYA 2IEDA 3HVJA 3NANA 1ZHFA 2YC4C 4F9TA 1C3VA 5CBPA 2I6UA 2QBYA 2VEDA 1ZP6A 3DFMA 3FD8A 4XVQA 3RYIB 4BNYA 2Z2XA 3HB1A 3GEBA 1GUDA 2QVBA 3IIEA 3SMVA 5HS4A 1UAAA 2YNMD 2BFAA 3MGKA 5CM8B 2CXXA 2CMKA 1WXGA 2FHSA 4RA9B 5DSZA 5TF0A 3RUHA 1GPBA 5A3QA 4LF9B 1VBMA 2I7TA 3IELA 2IQIA 4OUDB 4ECEA 1V5FA 3SDSA 4I19A 5DDIP 3WVNA 2WJZB 5LR6A 3AW8A 3WNVA 2Q7XA 2HXYA 3SHWA 5KTKA 5BWLA 2X0JA 3GEMA 3TSZA 1U8XX 2DT5A 2ZJ6A 4BVJA 4Q7QA 3BXOA 5B7QA 3L4JA 3JVUA 4NZOA 1DZ3A 3Q72A 3M1YA 2PH3A 3D59A 3MT9A 5FBZA 3DOEA 1YC2A 1G5FA 1S1MA 1SA0A 5EJ8A 1QIFA 2EKBA 2YC2C 4YYZA 1Z74A 1J9EA 3JY6A 3R1IA 4X66B 4FEEA 4FOTA 5SYAA 2GMWA 3L9WA 4WGGA 1YRLA 4BJ1A 4R9UC 3SE7A 2Z98A 4IQGA 2DP4E 2HSJA 1ETHA 1QLJA 3GYGA 4GRAA 4J90A 2MINA 5GAJA 4ABYA 4Q1EA 1D2GA 2I3ZA 2NZJA 3ZVMA 3IE0A 2IBSA 2Y66A 5B6IA 3JATB 2XVMA 3CLSC 4KPFC 4ARUA 1IM8A 3NM5A 1NNLA 3QKIA 3IQFA 4OHKA 3ORSA 2HZ7A 1ZEJA 3RFXA 1Z5GA 1SXJC 2JATA 4OJQA 5IK2A 1HL3A 2G9ZA 4K1LA 4YJGA 4E5KA 4WNAB 1E2KA 2R7LA 4DMHA 2YHBA 1UR5A 3QOFA 1LQUA 3RM3A 1JYEA 3I92A 1KEEA 2FF7A 4XASA 5I9LA 3V8MA 2AFHB 3TO5A 4RZ2A 1NSTA 2NUTB 3CRW1 3IMEA 5CH8A 1FW6A 1GT91 3OM9A 4DM7A 2FR0A 2GKGA 5ER9A 4C6HA 4OOFA 3GLFE 4XIIA 4OG2A 5TT0A 2WHYA 4G8CA 4CVNA 2XLBA 5HOQA 4J4BA 1CY0A 4HAIA 4ZMRA 4TSRA 4BE4A 4TLAA 3HSSA 4X91A 5KYGA 2PLRA 3TW6A 3LPCA 1AU9A 1QGED 1V9SA 2I76A 2G5CA 3K8OE 3R75A 4JJGA 421PA 4MHTA 1P1HA 2TMGA 3ITDA 3NHJA 1M75A 3AJEA 2OC9A 5FUXA 3DPIA 4TSFD 3OOEA 1YRQA 5KMGA 3TLGA 3E7DA 2RD2A 1TZBA 2FUKA 2HL6A 1TUBA 2ENWA 5F51A 2YINC 3SEZA 4CTNA 1E2DA 2CNLA 1O58A 2P0EA 4W8OA 1L5FA 4NZNA 2HMTA 2V65A 4AAYA 5AFSA 1MV5A 4F2PA 3T3DA 2G1AA 1ZZEA 1EFPA 5U4XA 2VYVA 2QZJA 3OCCA 5BSFA 4UXHA 4G07A 2PFGA 3PIDA 4IVRA 1RKUA 5IJ9B 3LG2A 2G1UA 2Z8YA 4DIBA 4OK3A 1CG6A 4R1LA 2BGKA 3IDAA 3DZGA 3O0DA 3R3UA 2DERA 1PFKA 1AMUA 1J97A 3LVQE 4PYQA 3DBIA 3IV7A 1GV1A 2PZLA 3OP1A 1U5BB 3K05A 5EVJA 3X2FA 3ZWQA 3U4MA 4IXNA 1OX4B 4X64B 4G1CA 4ZOAA 2W2LD 3CW2A 2IU3A 1M2VA 1W59A 3F6YA 3TX2A 3U4IA 2Q9BA 1U1FA 5KWSA 3NHKA 4O4HF 3E5RA 3JYNA 3OJWA 4TWZA 3AI2A 1XQVA 4NK4A 1TU3A 5DNEA 4L5JA 5KDDA 1G0OA 1HDZA 4RDHA 2Z6QA 1YOBA 4PGAA 2V7QA 1N4DA 1XZBA 4U1RA 4EHIA 1NQTA 2YJTD 3I04A 2JAXA 3K4HA 5EIBC 4EPYA 4RK0A 1R37A 2VHJA 3BXXA 2OCGA 1H2WA 2M6LA 2YXPX 2R00C 1SIBE 3TI9A 3G23A 3TL2A 1R1DA 3UB4A 7REQA 5SZJA 3NJRA 1THZA 1IG3A 3GFSA 3IEIA 4AN0A 2CNKA 4MDHA 1GFSA 1GGMA 4F72A 1YI1A 1DTEA 4N3BA 2DMRA 2SCUA 2OO5A 2XMGA 4JVSB 4AF7A 2PH5A 1XC7A 4NE9A 5LD2C 3NBZC 2Q2QA 4RM2A 4XCQA 3C85A 1T9AA 3RFUA 3RYCA 2YWBA 1BVUA 3HEMA 1AS2A 2A33A 3PNVA 2FPSA 1YUMA 2A0FA 2PL5A 3O3OB 1G8JA 3QLVA 1Z29A 4N0PA 4R9RA 5TC4A 4RULA 3S81A 2FRDC 4OJTA 2FVYA 2MINB 1YJ5A 1S5PA 4YDSA 3L5KA 2J3LA 3BXEA 3W1VA 5HRAA 3O93A 1QH8B 4WERA 4RQUA 3ECCA 5C34B 2QA5A 3CSUA 3OHSX 1FDUA 1W85B 4IQ8A 3AGPA 2E4UA 1PNVA 3D0QA 1P8AA 4RS3A 4M6WA 1Y8QB 3QXJA 1EKXA 1R4ZA 2FW0A 1JJVA 4MDYA 1YMUA 4EO7A 4N1AA 2RCYA 1QR6A 1DCKA 2PYZA 4UHCA 2ZXUA 2XUKA 1CZNA 2ATEA 3PC6A 4MWBA 4BCDA 4CM6A 5K0FA 1DWOA 3AK4A 5H59A 4P22A 2XWQA 5L6LB 3OT5A 4J4HA 4IDCA 2ATIA 4BQSA 4YT8A 4YT2A 3GJTA 4K26A 2EFCB 4LRSB 1KBQA 1KKUA 1L5OA 5BUSA 1Z7WA 2PUFA 3W9UA 4K2HA 5EUQB 4R0MA 5J4VA 1LZLA 1MA0A 1IUKA 5KU7A 5K2MA 1SHUX 1Y9JA 1JZQA 3W8RA 4G4SO 3AVXA 5B64A 2AJTA 1SQ0A 1KAOA 3EK2A 3NWEA 1AE1A 5KAPA 1I6WA 3RYFB 3TCXB 1P2FA 1QLHA 2JJ2A 3GUYA 4I9FA 2FPMA 3I9NA 2I9PA 5IJZA 3GRRA 3PDWA 1MZPA 1HKUA 2H7XA 2G4LA 2GT1A 2P27A 4L51A 4YQEA 4K1XA 3MTAA 2J48A 3UK1A 3ZHYA 1E2IA 1SVIA 2BMWA 5LLTA 1TUBB 2QX7A 4FB4A 5E7IA 3I42A 1MABA 3L93A 4CF7A 3QJGA 1RP7A 2P1DA 4E03A 4BMXA 5FWYB 4H4CA 2ZCUA 5K3AA 3WP0A 1SUBA 4MAAA 2CXSA 4CKEA 1KFKB 4DMUB 4G2TA 1UP4A 1BXGB 1YRWA 4MR7B 1RBYA 1DWQA 4HNAA 4J4TA 2P6RA 5F7OA 1D09A 2NXJA 2VTDA 3QVJA 4P5PA 2HYIC 1UJ4A 4DQLA 4EPVA 2A86A 1PKXA 4RQAA 5T41A 3SIXA 1RHKA 5EN4A 1PW7A 4FFNA