4TYYA

Dead-box helicase mss116 bound to ssrna and cdp-bef
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
508
structure length
505
Chain Sequence
SKLIHVPKSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(P*AP*AP*AP*AP*AP*AP*AP*AP*A)-3')
total genus 151
structure length 505
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyyA02
2B8TA 4C0SA 1W7AA 5B30A 4MH0R 4P4UA 4W5JA 1GKUB 2A7QA 4FWIB 2PZGA 5CJ2A 5CK5A 621PA 2C5LA 5EP1A 1SKQA 2GK7A 1GOTA 2AXPA 3LWNA 1XXHA 2GJKA 2EW1A 4JT4A 3ASZA 2J5XA 3P27A 3U3MA 3NTUA 1IQPA 5H70A 3AUXA 5KSZA 4LCBA 4PQYA 1E2MA 1BO6A 4N0EA 3ZDQA 3BH6A 3QE0A 3GJ6A 1G6HA 1DE0A 2W2VA 3I8XA 4I99A 4JLNA 1L4YA 5AJVB 4QNRA 1WE2A 4IDOA 3I72A 2QE7D 1A2BA 4KFSA 4MRPA 5JLJA 1W4RA 3VKGA 4Z54A 4LPSA 4G0NA 3VR1A 2BJWA 2I1VB 3MJRA 2WIAA 1KO4A 1ELOA 5E7IA 4C0JA 4EJSA 2HLDA 1OXSC 4M1MA 1T8UA 1XCGB 4K8OA 4XTRA 4IEEA 4D81A 3G0HA 1NBME 4Q9KA 2NO9A 1G4UR 2W6JA 4JLVA 1X8LA 4F92B 3BH0A 2YV5A 4BRWA 3T15A 1RE0A 2IF2A 1P6XA 4LJ8A 5LD2C 1EFHA 2WSMA 5EE0A 4BLTA 3KXIA 3SJCA 2ZVQX 2QBYA 4URXR 4NMMA 3EA5A 5EJEA 2O8FB 4TTPA 1IN6A 1E9DA 2VHUA 1UKZA 1EFRA 3GD7A 2RGCA 3I92A 2QSYA 5FPTA 2A2ZA 3LH5A 5FUWA 1ZRHA 3NBXX 4Q47A 5KPDA 1LB1B 3B82A 3PJRA 3EX7C 2WWGA 3OIYA 4US0R 4LJ7A 2J0QA 1A1VA 3IEVA 1WCV1 2YC2C 1YE8A 3K1JA 3AVOA 1GKYA 3IO5A 3VFDA 3QPUA 4Q4AB 1XPOA 4DLWA 1T6NA 2L0XA 2A9KA 3GLHE 4E03A 4LZZA 1F2UB 1VCOA 3B8HA 4HDQB 1E6CA 1QZXA 3KQNA 4NDZA 4KV9A 2F1JA 1MABB 4RD4A 4HSEA 3WXMA 4DCNA 2XJ4A 4KHZA 1G3RA 3A1TA 3KZ1E 1J2JA 4PHTA 1WXQA 5GADl 3AF4A 4RD3A 3RS7A 3T5DA 5CITA 3TW4A 2ONJA 4DIDA 5BXQC 1KO1A 3GQBA 3KXLA 1I4TD 3R8CA 2J0SA 3ZJYA 1FQJA 2FGJA 4Y0AA 2YNMA 1D2NA 5KNBA 3CRVA 1YR7A 4IFBA 1N5IA 1IHUA 5F2EA 4CEHA 5CM8B 4UNSA 2OUKA 5BW8A 2AX4A 3SE0A 2GA8A 3T1VA 3K70D 1SVOA 1G19A 1Z5ZA 1C4OA 2VP0A 4IKEA 5GJCA 4LJ4A 4TQAA 2RAPA 1G20E 5GVSA 2WJVA 5HE8A 4F38A 2ZRPA 3SDZA 4WXRA 2QROA 3FVQA 2WMOB 5F9HA 3OIVA 1E9FA 3FOZA 4B43A 2AWNA 3AVYA 1AA9A 1LS6A 5DGXA 2D4HA 4BE7B 1OJLA 2CEAA 2ZXUA 4IW3B 3AH8A 3SHWA 3ZD7A 1T4GA 1BYUA 1FMLA 2IUSA 3LW7A 1JR3D 4YDSA 4NKRA 4NH0A 4XOIA 2ZU6A 4JVLA 2ZU0C 5KYKA 1U98A 2RGDA 4QJ3A 2QMHA 1YU9A 4O2RA 1XTKA 3QKSA 1AS2A 3T5GA 1Z2CA 2CJWB 1HQYE 2CMKA 1XEWX 2QGNA 1AQUA 3KX2A 3QY0A 3PEVA 3CW2A 3BB1A 4IVQA 3GJ0A 3VR2A 1OXUA 2CHQA 3OFNA 1CXZA 1IOZA 5DN6A 4NCIA 1SGWA 4F91B 1KIMA 5FTKA 5TMPA 3UXMA 1NVVR 1GTVA 2IF0A 1NVWQ 4MKIA 3ZGXA 3EPHA 4LI0A 3HP1A 3FMOB 3UMFA 1FW6A 1RIFA 1R0YA 2P0EA 1OH8A 3E1SA 3CNOA 3GEHA 1U81A 5L3QA 3CRW1 1FUUA 2A5GA 4ZKDA 2ZYTX 1KDRA 4KSCA 3VR3A 4I1UA 1DS6A 2O52A 1NVXQ 6Q21A 2V1XA 3Q72A 4II7A 1YZGA 1NLYA 3K9HA 2XSZD 5FI1B 1E2IA 2JASA 5C46F 3V4RA 2ZRDA 3QNUA 2XSZA 3F5FA 3QKRB 2ZEJA 5K8TA 3LV8A 5TV2A 4G5GA 1P4SA 4TMZA 4JLMA 1XPUA 3QF7A 2GXUA 4EFLA 2Q6TA 1OIWA 3TSWA 4MGYR 4HZIA 2HT1A 1H8EA 4BWYA 4YXWD 2JIZA 4MYCA 5UKDA 1DAEA 2XTZA 3O8CA 2P2LA 1JPJA 3WY9A 1E2FA 4KBFA 1VHTA 1R10A 2ZJBA 3W6PA 4XTCS 4B74A 4D0NA 1G3QA 3HJNA 4AD8A 3KUDA 4FMBB 3UIEA 4DVGA 4BGDA 3GPLA 1IXZA 4M2LA 1NJFA 1KJWA 3LD9A 4JSYA 4HZUA 4V0OA 2PMKA 2DFLA 4HUQB 2OV2A 1QHHA 4DLRA 4TYWA 4ESVA 3ZH9B 1EGAA 3FGNA 4KFTA 4ZDIA 1WRBA 5JZVA 1SVKA 3TNFA 4ESHA 4OQMA 3DOEA 3FHCB 4CYMA 4DEYA 3TUIC 4FCWA 3VU9A 2DFKB 3WBJA 2IX3A 1E2KA 4LSGA 4X8OA 3RRYA 1GKIA 121PA 1WBBA 3QI2A 1XNJA 2YWGA 1N6OA 1II9A 3AGPA 3LO5A 1SKYB 2LKDA 3QXHA 1NKSA 2CCKA 1W0JA 5BWMA 2QP4A 4DSNA 4RCYA 2KB0A 1ZM9A 4IXMA 2O0HA 5L3SB 3SN6A 1E9AA 2Z4SA 1XXHE 2CCGA 5FTJA 3ZVRA 5JECA 2FSHA 1JECA 4N1AA 1RKBA 3U3RA 5IHPA 1SXJD 2CE2X 1D2EA 3KUCA 1MOZA 4V0NA 3X1YA 1HQCA 1P5ZB 4G01B 1TU4A 2D7CA 2XX3A 2ZRJA 4OYHA 2B7CA 2WJJA 3RHFA 5B64A 4U02A 4G5RA 3F0TA 1OLOA 3QUSA 1NN1A 4LUCA 1OHHA 1KYIA 2GAOA 3A36A 2XOKA 2F1RA 3AF1A 1KO7A 3K09A 5FOXA 3EASA 2X19A 4LYHA 3RVBA 1OIVA 2QP3A 2J59A 2XNDD 3SQXA 1TQ4A 2QSZA 3FYHA 1E2LA 2XB4A 4CVNA 3MWJA 2Q0HA 3GJXC 4NONA 1G5RA 3D7MA 3IQWA 2HJGA 1U99A 1UBEA 4DHEA 2ZRGA 1FP7A 4IDHA 1Z0AA 3CBQA 1GSIA 2MMGA 5CJPA 4CZ2A 3IUYA 2IXGA 2H17A 3P32A 1LF0A 4FCVA 4HLUC 3LA6A 1GL6A 4LJ6A 3IKJA 3UG7A 4LHZA 1EWRA 2R8RA 4Q4LA 5HE9A 1JEDA 4OHVA 4DSTA 1XTSA 3QXJA 4B6EA 4TL9A 2GCOA 4Z8YA 2ODNA 3QJYA 2W83A 3DZDA 4ARZA 1HV8A 3AVUA 5J4HA 4ZDWA 2IYQA 1KKMA 3THYA 4AY2A 1FTSA 1E2PA 3FKSD 2AN9A 3HU2A 4D2IA 1KDOA 4OJKA 5L3VA 3A1SA 1CJUC 5SZIA 3LBIA 4A0FA 2A5JA 2ZRLA 4HDOB 521PA 3RDPA 2V8OA 2O8BA 4MKFA 5JRJA 2Y8EA 1X1SA 2QU8A 1ZVQA 2QORA 4K81B 4LHVA 2BIFA 8OHMA 4L9SA 5P21A 1W47A 2EQBA 2ZANA 2XGJA 1YVDA 4GMXA 4D82A 3Q3JB 1P62B 3A6PC 1BOFA 3LLMA 4Y0VA 2RGNC 4M1SA 2R6GA 1QHNA 4Q18A 3TSZA 4PO9A 3TKLA 3JZMA 4R71A 1RVDA 5A0FA 4V0MA 3AV0B 2OXCA 3C5HA 4PO8A 5C18A 5JSZA 1TQ6A 3CZPA 2NO6A 3WP0A 1SVLA 4KYUA 1FX0A 4LK2A 3BFXA 3BOSA 2LWIA 3MG9A 1TUIA 2YWEA 2ZRNA 1E9CA 3I62A 4YXWA 2H5EA 2X77A 2FE4A 5EP2A 1G18A 4PZYA 1JB1A 3K53A 1N6RA 3ICQB 5JSZB 2QBYB 1KOFA 4QM6A 3DOFA 4PAOA 3KKQA 1RC8A 2ZRAA 2A78A 4M22A 4HLUA 3U3KA 1YKSA 3AVWA 1E2QA 2BC9A 4ZIRB 4DXAA 4KFUA 1A82A 4I1OA 3RLFA 1QHSA 2VP9A 1AZTA 5EE9A 1XP8A 2C77A 3GLGA 4HATA 2BMFA 1AJEA 3NC0C 2GJ9A 5FBRB 4GRAA 1KI2A 4Q7MB 5FPSA 5BN3A 3ADCA 1E3MA 4U5XA 5G41A 2Q3MA 1YHNA 4RFVA 2BCJQ 1NMYA 3Q5DA 4NPHA 2DB3A 1US8A 2QUZA 1XFAA 2ZI7A 4RZ2A 2Q3FA 5KNDA 1O3YA 4Q9IA 1X1RA 1T91A 4FMDF 4BECA 4RZXA 1XMIA 4ZCMA 2P6RA 1R5NA 4POAA 2BMJA 4BZQA 1S2MA 4LC1A 1TQDA 2OLKA 1W49A 2ZS7A 4WA7A 2ZREA 4BRUA 1M2OB 3U44A 2KE5A 2C98A 3OFND 3PENA 1YZNA 3EIQA 4LC0A 5D3MA 4R2IA 2R6CA 2HCJB 1JPNA 1UM8A 2YVUA 3PIRA 4JLAA 4YC7A 4HUQA 1EFCA 4R2HA 4C0AC 4WW0A 1TX4B 3RYTC 1DADA 3MWYW 4FMCF 1N0VC 4B2IA 2K5UA 3CX6A 2EFHB 2VP5A 4Q1DA 2E9SA 3UANA 1SHZA 4AURA 2C9OA 3IGFA 4BEJA 1XB2A 5FI0B 1DAKA 1HE8B 1Q22A 3L0IB 4RVCA 3NH9A 2WWYA 3VKHA 4W5WA 2ZSFA 1JR3A 2OCBA 4RKEA 5KSYA 3QF4A 2A30A 3THWA 4U00A 3UWKA 4TYNA 3AGQA 4K46A 1XTJA 4KLZA 2O8DB 2WTUA 2WKRA 3W34A 2FH5B 2ZUBA 2JJ1D 3CRMA 4LRWA 4TMKA 1II8A 3CRQA 4Z1MD 4B6FA 3LX8A 3L8YA 2ZJOA 2ORVA 1GRRA 2QPTA 5AUNB 5LB2A 2R6AA 5EE5B 3T35A 1A5TA 3GLHB 3LBHA 3K9NA 3QEOA 4HB4A 4NCKA 1A2KC 2Z6VA 1QG2A 5GJBA 1GIAA 2C03A 1CKEA 1W48A 3O8BA 3QXXA 3TQFA 4E07A 2H57A 4D25A 4Q9JA 2GCOB 4CEJB 3OF5A 4MRVA 3U3OA 4DIEA 1OF1A 1KMHB 1MT0A 4Z1MA 2Q21A 2ZVPX 5TXGA 4DSOA 3PEUA 3EWSA 3THYB 2HXSA 1VPLA 1IY2A 4JLOA 4A8JC 4A15A 2CLCX 5FOVA 1YR8A 2WPDD 3D6TB 5JJKA 4TMXA 2IYZA 5FR1A 221PA 1A7JA 1N5JA 4EQ6B 2PT5A 1KJZA 2XEXA 2ZM5A 3FPAA 4LX0A 1B0UA 3LRPA 3EARA 3QKSB 4JLKA 3U2QA 4DEXA 3OHMA 2OILA 4Q7JB 5FTMA 1M7HA 4I81A 4JZKA 3LY5A 1F5NA 1JNYA 1PJRA 1E4VA 2G0NA 3QOFA 2SHKA 3EC1A 1N0WA 3KFVA 3WRYC 4BFZA 2NMVA 2JDIA 1VG9B 3ICEA 2R65A 1JI0A 3HYTA 1SKYE 1R8QA 3H84A 4FN5A 4WBSA 2ODWA 4TSFA 1E9BA 2AKYA 1LF5A 1ETUA 3VKWA 4B2PA 5CDFA 4KVGA 3KJGA 3KL4A 3P26A 5E7MA 4FI3C 3LXRA 1F2UA 2ZRIA 1XTIA 4F93B 3NXSA 5L3QB 1KZGB 2BKUA 2H1LA 1LV7A 4UNNA 1O87A 2CK3A 2FSIA 4HLDA 2EVWX 1MKYA 5SZHB 2PLRA 3A58B 1KI3A 1ZC3A 2CNWA 3L0SA 2ZI5A 3NVAA 5CLQA 4WIAA 1DBSA 5FFMA 821PA 4E09A 1EWQA 4QC2A 2XXAA 4X8LA 3QXCA 2FOLA 4HB0A 4UXJA 1I2MA 5DHFA 4OI2A 1BKDR 3EZFA 1G8FA 4PC7A 2OESA 4CEHB 1VMAA 4OHWA 2HLDD 2H16A 3CWZA 1DARA 1P2UA 4QBIA 3AM1A 2OT3B 5F3WB 3B7GA 1EFUA 3BORA 5EXTA 5E7JA 1NIJA 2J7PA 5LB4A 3GJ5A 2XTMA 2OBMA 2IS2A 3HYRA 1KGDA 4RCZA 4TL8A 1MR3F 2OAQ1 2WOJA 3GFTA 1JBKA 5FPKA 1F2TA 1W5SA 3IHWA 4A2PA 3TGPA 4M0LA 1N6KA 5CM9C 5J40A 4DDWA 3KKPA 1Z6AA 1ZNYA 4MGIR 4NZYA 1UDXA 5L8VA 4UXHA 1LY1A 1XZPA 3R8FA 1UDWA 4AC9A 3A8TA 2WV9A 1Z22A 4JIMA 5HKKD 2IBMA 1CF4A 3K0FA 2ZRKA 2PT7A 3BC1A 1HE1C 2GBLA 3DEFA 5EE1A 4LBWA 3RAPR 2WWWA 4RD2A 3NWJA 4TWZA 3I1FA 1F60A 3WNCA 3BB4A 1SVWA 1Z0JA 2ERXA 3PUZA 5KSPA 2ATXA 2EU8A 4RZ3A 1KSHA 3ZS9A 4S2EA 2P3SA 3B6EA 2DWQA 5FOUA 2BBTA 4BFTA 1WA5A 1KHTA 3U4QA 3WMEA 2N46A 4NYJR 1W36D 1DAGA 3H86A 5J5CA 3QPWA 1XRJA 1GITA 5HCIA 1BIFA 1G7SA 2BHRA 5B2ZA 2O8BB 1CR2A 4IHQA 2VPPA 5C1BA 1TUEA 3LW8A 1JXOA 2YWHA 4PHFA 4F4IA 4WOPA 4CGZA 2IXFA 4N0DA 2BBOA 4HDCA 2ECKA 4HUTA 4BFSA 4DDUA 3WHLA 2AWOA 2WWIA 2QGZA 4PXAA 2OG2A 4C0BA 2EFCB 5IF9A 2PCJA 1XPRA 4GZLA 1M74A 4Q1CA 3ZZUA 1KI4A 1L7VC 1ZD9A 4TYYA 5FOWA 3T06B 4NYJQ 4MUBA 1Q1BA 1TF5A 3U61B 2VIIA 1Z6YA 4JVMA 3VTKA 2WIBA 2ZJZA 3CX8A 3DMNA 4A0GA 2BKEA 3FB4A 4E5UA 4H1UA 2IYYA 2DPXA 1S3SA 1RFLA 4YDHB 2YWFA 1OYYA 4PC1A 4XVUA 1U2RA 2WSSD 4NTZA 3OIUA 1M6NA 1CR4A 1XTRA 1Z6TA 4MUAA 3VHXA 2GJAA 2FJUA 3SEAA 3C8UA 1H8HD 2F9LA 3IDQA 3Q8XB 5DI9A 4L4UA 2IYUA 2VP2A 4A9AA 3MCAA 3CM0A 721PA 4FIDA 2DYKA 1G9XA 5JHGB 2QMUA 1OXTA 4V0ME 5GVRA 2IL1A 4DDVA 4URUR 1W0JD 5FL7D 2EFGA 4OK6A 2MSCB 1US8B 3Q7PA 3AP1A 1KZ7B 4P31A 4M1WA 4PSAA 1R6BX 5DIFA 4PHHA 1W5TA 4HLCA 1PLJA 2ODEA 2C8VA 1P2TA 1UJ2A 3B9QA 4TT3D 3CF0A 3KJIA 2ZJAA 4M9XA 2R2AA 2RH5A 2IYLD 5G3ZA 5EXXA 1UEIA 4QGGA 1WQ1R 2B92A 5A4JA 2XZLA 4MITA 1MABA 4ITRC 1FQKA 1EESA 4KJZA 2XB2A 4ZDKA 2W0SA 2HXYA 5JI3E 1KO5A 2WBLC 3EZ9A 4XWOA 3CH4B 4EPRA 1KI1A 3QQ5A 1E2GA 1Q44A 1FL9A 2NOAA 1G4AE 3R7WB 3TJZA 3REGA 4DLVA 1XCMA 1Z2AA 2H92A 1NVUQ 3EXAA 3G82C 4R7ZA 3U7EB 5CB6A 1OH7A 1GFIA 5FOTA 2ANBA 3ETLA 2A5DA 4V02A 4J0QA 3QF4B 4FMDB 2OE2A 1KK3A 1XEWY 1II0A 3UWOA 2G3YA 1G41A 1FZQA 4DCUA 1ZUNB 3LVQE 2PMDA 4E22A 1N6IA 2X2FA 4EFMA 2Z5FA 3BFKA 1S9DA 2VP4A 4OHZA 2ZYWX 4QOSA 4BFVA 5EXSA 2JLUA 5CLLA 1QHGA 2GZAA 2OHFA 4B3XA 1E96A 1Z6GA 2VSFA 2X8AA 4HLQB 1P9RA 2CE7A 3PITA 4O2LA 2FN4A 1UBCA 4FW9A 1DPFA 3C16C 3NG1A 5LBIA 4BZXA 3T1TA 1T0JB 2RMKA 1NI3A 4NP6A 2OLJA 2WKQA 2JATA 1IY1A 4DUGA 3BK7A 3C41J 1JJVA 4NCHA 2FPKA 3NH6A 4JKIA 4PFSA 1VYVA 2ZTSA 4PANA 3RS0A 3U44B 1OB2A 4LJ9A 2NO1A 1YZUA 2H7VA 1ZW6A 2JJ2A 3I61A 1ZBDA 3GCGA 2J41A 3K0CC 1K5DA 2R44A 3ECCA 3QG5A 5AJXA 2GHIA 1BYIA 3S1AB 3H1TA 3BD9A 3EWAA 4A82A 4BFXA 1ZJ6A 2IWHA 2F3TA 5IRCD 1ZU4A 5DE3A 3NBZC 5AJYA 1HEIA 4NCNA 2PJZA 2JJ2D 3FWYA 3ONWA 1XJ0A 2QAGC 4TQ9A 1MH1A 3LDAA 3QKUA 1UBFA 2EFEB 2GEUA 3LAWA 4N3NA 1T9HA 1NIPA 2CDNA 4EFNA 1OYWA 2QMOA 4EKDA 3W9YA 3AF2A 3FDIA 3GJ8A 1NSFA 2DWOA 2ZE7A 4KODA 3R9XA 1SXJA 2D2EA 4CT4B 1W0KD 2HT6A 1N6LA 1Z06A 4OL0A 2YYZA 2W58A 4CIDA 4DLSA 1ZINA 1R5BA 3RWMB 1C9KA 1Z8FA 2QTVB 1OE0A 4Q1AA 4MGKR 2VA8A 3K0AB 1W4BA 3U3JA 3PQCA 2IHYA 1K6MA 1DO2A 4G1UC 1SXJB 5EP3A 3BBPA 4RKFA 5DI3B 4ZCIA 4I1VA 1R8SA 2AK2A 2X1VA 3TSOA 2VSXA 4KAXA 1KJYA 4AI6A 1AM4D 1Q0UA 2ZJYA 2IYSA 2WJHA 5E95A 1K5GA 2WAYA 4FCTA 1YR9A 4OK3A 4BASA 4AKIA 1XX6A 3LVRE 3HDTA 4ZIRA 2BBSA 2J87A 3K0CA 2V1UA 4EIWA 4HEJA 4QGFA 2ZRHA 4TLEA 1W1WA 1KDPA 4QBGB 1XD2A 2QQ0A 4D4JA 4DLZA 2AXNA 1P2SA 1NG1A 4Q7KA 4NYIR 4GL2A 3CX7A 2YKGA 4YMSA 1KY3A 2JIZD 3A1WA 2ZAMA 1JAHA 3O8RA 2J0UA 2J7PD 2P67A 1AGRA 5IK2A 4BQSA 4DLXA 1W4CA 2Q3HA 1U90A 1KK1A 2GZDA 3NDBB 3RC8A 4DJTA 4XJXA 421PA 1DTSA 2UZ3A 1TMKA 1E1QA 3GLFB 4DB4A 4JVNA 2ZRFA 4QBHA 1G8HA 2IYVA 4IDPA 4ACBA 1OKKA 2GAAA 3N5CA 3LFUA 2EWVA 3WRXC 3PEWA 5GJVC 2RGAA 2XZPA 4WXPA 2WSSA 1OFTA 1Q1QA 3SS8A 4EDHA 1D6JA 2CL6X 2GVZC 3EC2A 3MJHA 2ZS8A 1W46A 4Q02A 4QGAA 3RSOA 3A4MA 5J4LA 2CK3D 1GUAA 2WAXA 4B71A 3LXXA 4X8MA 4OQNA 2F1IA 1RRCA 4AIIA 3CNNA 1E2JA 3WYAA 4A0RA 4KBGA 4QNMA 2RKOA 2ZI3A 1QHYA 3X1DA 3CNLA 3KTAA 1KAGA 3AP3A 4URZR 4EJSB 2WKPA 3DZ8A 3C4JA 2V6JA 3JVVA 3SFZA 2AK3A 1PLLA 1IJFA 1TF2A 3EIEA 1FOEB 1U0JA 1G3IA 2Q9BA 1SQ5A 1ZC4A 1SVMA 4G5SA 3ZZTA 3LQRA 2GVDC 4ASUA 3GLGB 2IXEA 2QPOA 1X8KA 5G40A 5GJWC 3KTAB 4KLNA 4KITB 4LOAA 2WM9B 2G0TA 4XSGA 4JBWA 2KJQA 2NO7A 4FD2A 4C30A 3ZLJA 3H4MA 4CEJA 2V9PA 4QG7A 1E32A 2E1RA 4OI0A 3EAQA 5B57C 1NJGA 1G3MA 1U8ZA 3W6OA 4A8JA 1SXJC 4HZUB 4AG5A 4Q9LA 1AS0A 3A4NA 2GEVA 4BFYA 4DLYA 1UPTA 2FEMA 1TL7C 1S8FA 1TF7A 2QEQA 2GTPA 1AK2A 3SNHA 3JZAA 1Z3IX 4XWAA 3TRFA 5CIQA 4EAQA 4QJ4A 5H8WA 3EG5A 1G8GA 2AFHE 3HU3A 2NPIA 3SI7A 4IXNA 3B9PA 2GBLC 2J46A 2F6RA 5HKKA 1R5OA 1XD9A 5DO9A 3KFXA 1T5LA 2AHOA 3A1VA 1J7KA 3AVXA 4C7OB 3NIBA 2ZAOA 3AB3A 4YMUA 2ZIAA 1DEKA 3LNCA 1HUQA 1P73A 4B3GA 1HT2E 2BOVA 2GWHA 4B32A 4B75A 2QAGB 5JS8A 1VYTA 5KOYA 3EPJA 1CJTC 1OSNA 2YHSA 4TMWA 3SZRA 4CDGA 1DAHA 3EZ7A 3H0KA 2DHRA 3W3ZB 4DSUA 1CIPA 2B7BA 1S0UA 4B44A 4DT1A 5KDLA 3IIJA 2QTHA 2MSEB 3RRMA 1AZSC 2FSGA 2OBLA 2V4ZA 3P4XA 4CW7A 1NP6A 1RYHA 2JLSA 2JAQA 4P3YA 2ZETA 1ESNA 3D31A 3SYNA 3RWOA 1GRQA 4D0LB 2VHTA 3RANA 3AKEA 1IM2A 1TEXA 2BJVA 4C0HA 3LQQA 4JL8A 3ND8A 3W8NA 1JALA 1G7CA 2XTNA 4IEIA 3E2IA 1MRSA 1J99A 2G1KA 3Q5EA 1GNQA 4TLDA 4RSGA 3B5JA 3RC3A 1J70A 2RGBA 5JMTA 1FTNA 1X6VA 1VG8A 2ZRBA 2DFNA 2ZUDA 4JLDA 1EFRD 5DHAA 1KK0A 2WZQA 2ZROA 3P20A 4Q03A 4B3BA 1CJMA 2BBWA 3SJZA 4MYTA 3AKDA 5AWFC 1KY2A 1NF3A 5DYGA 5EE3A 2LKCA 4EPVA 3QKRA 4B34A 1VCMA 1E9SA 1KTVA 1S9HA 4DDTA 5KDOA 4P33A 4H9GA 3VNUA 3PUVA 2B21A 4JL6A 2W6JD 5K8UA 4WZBE 4GOXA 2O8EA 2IK8A 3WHKA 4HAZA 1GWNA 1GL9B 1UAAA 5FBQB 3O8DA 5A5GA 1CEEA 2ZR9A 3IQXA 3IILA 2IS1A 3UG6A 3FMIA 1AGPA 2RGXA 3M0EA 2R6FA 4ZI2A 3SJAA 3RNLA 4IJMA 4C9BA 1XJQA 4LV6A 4TLAA 1CJVC 1PUIA 3AVQA 5J47A 3GP8A 5EQTA 2HV8A 4Q19A 1RRGA 4GI7A 4PC3A 4GFDA 3OAAD 4Q48A 3TW8B 1CU1A 3AEZA 3TR0A 2IWRA 1ZD1A 5IDVA 5EXPA 2IEZA 2HYDA 3PXGA 2ZI9A 3VU9B 5JCZA 3KDSE 4BPBA 1G7TA 1IN4A 1M1YE 1FNMA 5CDFE 4MKHA 2FWRA 3ZD6A 5JEDA 1NVVQ 4PPGA 1GDDA 2DR3A 5FOSA 4EPYA 3L82B 1TQ2A 1NKTA 4IDNA 5FUYA 4MQBA 3VQTA 2J1LA 4L15A 4NU0A 4L9WA 1P60A 1ZUIA 4MRNA 4OQXA 4P4TA 4PQFA 4BZPA 1T0HB 2Z4RA 4D6PA 2RGNA 2UZIR 1ODFA 3OEHD 3PUYA 3QVUA 5C2JB 4KYIB 1EG7A 2IS4A 4B76A 4CEIA 1KSJA 4AKGA 3U7HB 2YZ2A 2QM7A 4NL4H 4ON9A 3RS3A 4QHYA 5JI2E 2HF9A 4BFWA 3SQWA 1G64A 1II8B 3NKVA 5FBLB 4G3XA 1NL3A 3SC3A 2A3RA 1R4AA 1YRBA 3E70C 4KI0A 4FXPA 1OFIA 3VNVA 1E1RA 2OFXA 1YZKA 3FTQA 1OH5A 3IBGA 4TYQA 2F3RA 1W36C 2W2XA 1ZIOA 5KHOC 4DCSA 4FMCB 2YOHA 1P61B 1TEVA 4B3CA 4W9MC 3QENA 2WJIA 3KJEA 5IK2D 1NMZA 3FMFA 1WP9A 1DAFA 4I1SA 4LYFA 2F9MA 1OIXA 3R20A 5BQ5A 1B23P 3BWDD 3SYLA 2WWHA 3U5ZB 1GP2A 1HT1E 5FR2A 1SHKA 3S1AA 1G3UA 3P4YA 1SXJE 1W0KA 5AUPB 1VYUA 4UXIA 3X1XA 3T34A 4LHXA 3X1WA 1SULA 1AQYA 3BGWA 4IOMA 5HPYB 2GXQA 2IA5A 1GNRA 2X2EA 4JBYA 1MO4A 2HUPA 5FPHA 5H1YA 1NBMD 2YOGA 4BLRA 1Q1ZA 4OHXA 2JA1A 2KI5A 1KAOA 1FPMA 2AD5A 3CKLA 1NNEA 3V00A 1JQJC 4ARZB 3FFAA 1AKYA 1OXVA 2OAP1 4UNQA 3NEYA 4JKYA 1IAQA 3KKMA 4TMTA 3WYFA 4F4JA 1NBMA 3D3QA 3EW9A 4DWJA 4YMTA 2C2HA 2VYFA 4AK9A 3THWB 1T5IA 2OSBA 2QPAA 3I32A 2ZYVX 2FX3A 3OE7A 1ZYUA 1BMFD 3RSLA 5C4GB 2O8CB 2JGNA 1L2TA 4LJAA 2GJSA 2PEYA 2P6UA 3B78A 4JT2A 3K09C 3VR5A 1N6NA 5CYOA 2F1HA 2OFWA 2G77B 1RW4A 2QL6A 1G291 3CPJB 3VX4A 3GLIB 2VLIA 4O25A 3M6AA 3F3YA 4LDJA 2NZ8A 1HYQA 2D74A 1DOAA 2JLZA 3R7WA 3CONA 1Q21A 2C9CA 1NY6A 1JEEA 4WVFA 3LLUA 3AF0A 2JJ8A 4IFEA 1KSGA 3TH5A 1IN7A 4DB2A 3CO5A 5AJZA 4ZI3A 4JJKA 1OFUX 4US1R 4HAWA 4F7WA 4QRHA 1CR0A 1R2QA 1QBKC 4UJ5A 2TMKA 2W6ID 1T8TA 4M9SA 2QTFA 4I4LA 2DFTA 3KB2A 4MYHA 1DG1G 1ZNWA 4M1TA 2V3CC 1NLFA 2VHQA 4URVR 4LV8B 1CTQA 1N5KA 5KDDA 2V6IA 1ESMA 1UF9A 2NTYC 3DO6A 3CZQA 5SZJA 3VR6A 2REXB 2IS6A 1MO3A 1ZM2A 3AVPA 3HR8A 2GNOA 1E69A 1NY5A 2ZR7A 3BB3A 1MRNA 3IO3A 1E9RA 1E1QD 1XMVA 3QVVA 1WDTA 4Q21A 1IN8A 4RY2A 4ZV4A 1E79A 2QMEA 4U7DA 2XNSA 4OHYA 5G3YA 2P5SA 3ZIAA 1QHIA 1E0JA 3CWQA 4EUNA 2O8EB 1H65A 2F43A 2DBYA 2JLXA 3A1UA 3I5YA 1G6OA 2H8KA 1ZM3A 3A4LA 4PPFA 1FNNA 2C96A 4XVQA 4AKHA 4GNKA 5CIWA 3WNDA 1ZMXA 5BN4A 2E87A 1D2MA 1VIYA 3NHBA 2IYWA 4NYIQ 2EWWA 1H8HA 3UKDA 1P75A 5JS7A 2D62A 2REBA 3ND9A 2IUTA 3O47A 4A6XA 4B3FX 3QBVA 4C0LA 4C7OA 5H68A 5KO2A 1ZIPA 5AJWA 1E0KA 3AQ4A 4Q1FA 1VTKA 3CIOA 1IBRA 1YR6A 2WOOA 4B73A 1Z0IA 1EX7A 4Q4AA 5ELXA 5J4KA 1RPZA 1S1CA 2FF7A 3ADKA 3U6BA 3NBYC 2XNDA 3TE6A 4D0GA 4GMDA 3EPLA 1E79D 2J3EA 3RS5A 5JWOA 4EPWA 3SJBA 2YINC 3GLFE 4FWTA 1KNQA 3AVVA 1KI7A 1PLKA 1TNDA 2WICA 4LHYA 5DN6D 2GRJA 4GOKA 1J90A 1AN0A 3H2YA 1OHHD 1P72A 1G16A 4A8JB 4DZZA 1F48A 3B1ZA 3TUZC 1HY3A 3TVTA 4ZPXA 1ZM7A 4XIGS 4GBMA 1Z07A 2JLYA 4Q00A 4EPXA 1BS1A 3SOPA 3Q85A 3X1ZA 4B48A 2HCBA 5DI3A 2J9RA 4JJZA 3OZXA 4CT5A 3IIKA 5KU1A 1BH2A 2ZSDA 4GDFA 3K70B 4PPQA 2VF8A 4DRZA 2W0MA 4NYMQ 1TPZA 4B3DA 2FA9A 2OCPA 3R9WA 3BE4A 4D4MA 4M9QA 4URYR 3FKSA 1G7RA 4TMVA 4TZ0A 1UFQA 2BCGY 1S1MA 3EA0A 4A2WA 2QNRA 2QT1A 3K0FB 5BN5A 4P4SA 2W00A 4V0LA 3SR0A 1ANKA 2KSQA 3V4FA 5D3MB 1XWIA 4CF7A 2OCYC 4TL6A 5CK4A 1KNXA 1F3OA 4IOLA 4F4CA 1QVRA 3PV0A 3NC1C 3T1OA 1CLUA 3VHLB 3OEED 4A36A 4PQRA 4AYWA 1AIPA 1Q1EA 1KI9A 1XBTA 1D8TA 2ASEA 1Q20A 1R0ZA 1LVGA 4IDQA 2XZOA 3K8YA 3B1WA 4HAYA 3OE7D 3ZQJA 3THXA 4TLBA 3DKPA 3MLEA 3SBEA 3Q7QA 1DVRA 1V5WA 1Z47A 4PSKA 4QBFA 4WZAE 4Q4JA 3DM5A 2CLSA 2CLDX 1OT3A 2WHXA 4TQUS 2VBCA 4C4PA 3K70C 1M8PA 5EZ5A 3AP2A 1K8RA 3TVDA 3VR4A 1G1MA 1P7CA 1Z0KA 2VRWA 2FFQA 4D4LA 3I3SR 4JVSB 1EX6A 3C15C 1W44A 2GXSA 3EZ6A 3GJ7A 2R62A 1ZCBA 2ZRCA 5JWHA 3KQUA 3B1YA 4M1OA 2PH1A 3CR8A 2LCFA 2HF8A 3DMDA 4QJ5A 2KBEA 2QP9X 4HAVA 2CVHA 1T3SA 5HCNA 4IOKA 2C95A 3WMGA 3L0PA 4AYXA 2OEPA 4Q9HA 4NE2A 3B2EA 3R9IA 1Q3TA 5TY0A 2HYIC 1GRNA 3X2SA 2PX0A 4Q01A 5FTLA 5BYKA 4LY6A 1FFHA 2GDJA 2CNWD 4TZ6A 4DC9A 2QN6A 2REOA 2QZ4A 3OESA 3C5CA 1CS4C 3RS4A 2VHJA 3KQHA 3M1IA 5TB5A 3OEHA 2O0KA 1L8QA 1OFHA 3DVLA 3FFBA 1CULC 4UNPA 2D2FA 1GNPA 2PZFA 3Q9LA 4H1VA 1UKYA 4YLGA 1N2CE 1KK2A 4KO8A 3TAHA 2GKSA 3TAUA 2V7QD 1XMJA 4ERNA 2FEOA 2V54A 4EQ6A 4YQFA 3KB1A 3V9PA 3TBKA 1E2HA 2O5VA 3C7KA 1A4RA 1RJ9B 2QQEA 4LPKA 4KXFB 1TAGA 4IVRA 2V55B 1P9NA 2QE7A 3GMTA 4M1YA 1XF9A 5JCPA 3OAAA 3EIHA 2C9YA 3OIWA 4MKGA 4QHSA 5DNYB 2QRZA 3EPKA 2YOFA 3QSYA 1Q57A 3SHFA 2GF9A 1H8ED 3GEEA 3N2IA 1WB9A 4LJYA 3MAAC 4TSFD 5TVKA 2WWXA 4Q66C 4OQLA 1QDEA 3C14C 4TN1A 4OK5A 3ASYA 1HH4A 3ZQ6A 4C0KA 2G83A 2JDID 5DSZA 2B8WA 4CEIB 4GZMA 1XDBA 1CR1A 2GK6A 2ZUCA 2CHGA 2BVNA 5KUTA 3W5JA 4Q7LA 3DDCA 2FMXA 3RRZA 1OH6A 2QAGA 2DWPA 3BJIC 3KXKA 2NG1A 2GJ8A 4M9ZA 1FUKA 4LHWA 1RRPA 1ZNZA 2ORWA 4XD7A 3D8BA 3GJ3A 4XVRA 2VF7A 1S96A 1T3HA 1W2GA 4G5QA 2GZHA 3GEIA 2FU5C 2QY9A 4BLQA 3AVTA 4WAUA 1YQTA 5LPNA 2ZSBA 2N1BA 4M53A 3CPHA 3KKNA 5CYPA 3T1QA 2VHCA 3G5UA 2RHDA 4OQFA 4D80A 1YZQA 2D7DA 3MWKA 4C2UA 4PZZA 3W8RA 4TTQA 3TUJC 2ZPTX 2CHVA 2A5FA 1SZPA 3TMKA 3BH7A 4QL3A 1N6PA 3LX5A 4KVAA 1PVOA 3MUFA 2WWFA 3L8ZA 3BFVA 3SYKA 4PHGA 4KSBA 1NLZA 4TLCA 3AUYA 4GT1A 5SZKB 5KNCA 2I4IA 3RRNA 1CBUA 2OBNA 2VSOA 4ZDJA 3MGCA 4AG6A 3M4YA 3K0SA 1TU3A 1G21E 3HPRA 4GOJA 2ODBA 2OFOA 1D5CA 5KTYA 1EXMA 5FL3A 4LWZA 3KJHA 3MSXA 2Z0MA 5HTKA 1JQLB 2WPDA 4US2R 1PV4A 2YJTD 4JSTA 3TR5A 3FHTA 4V03A 3LBNA 5F98A 2ZE6A 1KMHA 4XH9B 2GESA 2WJGA 1AS3A 2PCLA 2J45A 1P9WA 1Z63A 3CF2A 5JJLA 5HZHA 4ABYA 2AKAB 1OXXK 1E0SA 2IYXA 3WYGA 4M4SA 4URWR 3VMFA 1JR6A 2IYRA 1UEJA 4JS0A 1XTQA 2NZJA 4M8NE 4ZKEA 2OZEA 4BUJA 5TARA 1J8YF 2C99A 5C4MA 2Q9CA 4OI4A 3WNBA 3CLVA 3CB4A 3DM9B 5DLQC 4DT1B 3QPVA 3CUEF 1CRQA 2OXRA 2ZI4A 3E5HA 3IIMA 4A6PA 3WP1B 4PSVA 3UPUA 1WBDA 2IC5A 1W36B 3SFVA 3GLIA 2PEZA 2JJ1A 4LJ5A 1RZ3A 4Q1BA 4DCVA 1N0UA 3FHOA 2QRNA 4GP7A 2ZJ5A 4RD1A 1W4AA 2PX3A 4AWXA 1NSTA 1LW7A 4O3MA 1R0WA 5B58C 4Q1EA 4BLPA 3K0AA 4XD7D 4JMPA 3W6NA 1D9ZA 1LS1A 3I4LA 1D9XA 1LNZA 5JEEA 2PLFA 3L0OA 3PVSA 2IEYA 4Q4HA 4FINA 4D26A 3TQCA 2VEDA 1V43A 1EFTA 1XCPA 3U7GA 5E4FA 2Z83A 4HB3A 1UKEA 2BDTA 2AD1A 3K9GA 4JLPA 4Z8XA 5AR1A 5IT5A 5AUOB 1Z6XA 1I2DA 2FPMA 3F8TA 1ONBA 1X8JA 5E3HA 5HR5A 2P65A 4DCTA 5CB8A 4PO1A 4HAUA 4LBVA 1XEFA 1LTQA 4ASUD 3W3AA 1XD2B 2GEDA 2F43B 2W6IA 4BLOA 1ZUHA 4RD6A 1E2EA 2VH5R 1Q12A 1G8PA 2P6NA 1OKKD 3GJ4A 2ZE8A 2ZSAA 3TK1A 1QF9A 1GL7A 2XAUA 5DH9A 4PZLA 4DLUA 1ZCAA 2FFAA 4EPTA 2XITA 3REFA 1VECA 4TYPA 2WMNB 2FSFA 4LGMA 4JLJA 4R9UC 1J8MF 2NO0A 2F7SA 2QAJA 2ZQ5A 1VG1A 3ZYCA 3BAFA 1R0XA 4QKQA 4YMWA 1U9IA 3GLFA 2FZ4A 2V7QA 3FMPB 4PR0A 2IUUA 2O8FA 4IOJA 2JLWA 2CJWA 5FUVA 2UVQA 1VCIA 4PC2A 1EK0A 1DO0A 5AUQA 3ADDA 2BMEA 5JBQA 4YONB 4GSYA 3T61A 1JAIA 2H18A 2NIPA 1GG2A 3B60A 2QG6A 2ZS9A 4LYAA 3THXB 1FP6A 1U0HC 3IHLA 1QHHB 1OB5A 1P2VA 4M1KA 4JLBA 4JYBA 1BMFA 4R98A 2BV3A 1Z83A 5FPYA 4Q5IA 4D4KA 2KBFA 3I8SA 1COWA 2ANCA 2OCAA 1RYFA 4QXAA 3W5IA 5FH9A 2O8CA 3J81k 3ZIAD 2RCNA 5FUXA 1GZSA 5JWRA 5L3SA 3CRRA 4C3ZA 5AK0A 2PL3A 3UMSA 3IBYA 5J4YA 1I4DD 4ACAA 2AFIE 1R7RA 2VTKA 1PUJA 2CVFA 2IHBA 4X8HA 1IY0A 4S35A 2RGGA 4C0QC 2J7KA 2F55A 2CCJA 5KPJA 2XXAB 4NCJA 2J0VA 2GCPA 1N5LA 1XD8A 4MDEA 2D3WA 4QFMA 2RB4A 3OEEA 1UBGA 3MWLA 2JLQA 3RABA 3CF6R 3CPEA 4UQOA 4O0MA 4IRUB 5K8LA 1MO5A 3THOA 3GLHA 2WJYA 4PAMA 2IW3A 4DBLC 4DKXA 4YMVA 3PUWA 2A5YB 3A37A 1WMSA 3P1JA 4DUGD 2FG5A 4L5BA 1E9EA 2BM1A 1DAIA 2XOKD 2NPFA 1ZM4A 2FPLA 3HU1A 2G9NA 2NGRA 3SBDA 4GPTA 3HPQA 3TIFA 5FBVB 1E1RD 3L2OB 4Z51A 1KKLA 1XZQA 4M21A 2JLVA 2FV8A 1X3SA 2ZI6A 1GAJA 3NEJA 5TDHA 1TTTA 4JYCA 1KMQA 5EP4A 4CRWB 1RJ9A 3FE2A 3B85A 2XJ9A 5JHHB 3U60B 3B1XA 4MGZR 2QM8A 1OV4A 2AL7A 5K8IA 3KKOA 1KI8A 1E99A 5J4VA 4HYYA 1LFDB 3NBFA 4Q4JB 1E4YA 2Q9AA 1ZP6A 4B33A 2I3BA 4MA4A 3WMFA 4BFUA 2J0UB 2Z43A 2ATVA 1G17A 2MMCA 2R9VA 4ILEA 2GETA 3DKVA 2ZR0A 3B1VA 3BS4A 2D06A 4AKEA 1KO8A 1YRAA 1UADA 1YZTA 1Q3HA 1MV5A 1M7BA 2QT0A 1RRFA 1COWD 1T3LA 2ORIA 5M04A 2BMDA 4A0HA 2HEIA 2G1JA 3BRWD 1HURA 2ONKA 4PX9A 1NN3A 5JRZA 2EFDB 3K0EA 2FGKA 2IYTA 2ZSEA 5DISB 3FKQA 1S3GA 4W7SA 1XEXB 3U6KA 3NDPA 1IONA 1N3BA 4GP6A 1VG0B 2ZITA 3VAAA 2JLRA 4EJSC 1XU4A 2FNAA 1QG4A 2HJVA 2R6DA 4LBYA 5G53C 1Y3AA 1IN5A 3PFIA 2B6HA 1KI6A 1NN0A 2QENA 3HWSA 4A4DA 3MMPA 4AYTA 1DG3A 4TTRA 3UMRA 5LD2B 1Z28A 1NRJB 3SU8A 3TLXA 4C2TA 1HA3A 3MD0A 1XEXA 1MO6A 2N42A 3ZVLA 5BYJA 4RJLA 4JBXA 2OM2A 1N6HA 1U8AA 1VKJA 3CH5A 3NHAA 2JCSA 4NHOA 1M7GA 2VP6A 4LBZA 2GCNA 1GILA 1P3JA 2BM0A 4W5HA 1Z08A 4A92A 2CL0X 4KU4A 3DPUA 3MRSA 4NBSA 2BEJA 4MRRA 3I5XA 1KSFX 1PZNA 4UJ3A 2RGEA 2ZRMA 2GXAA 1Z0FA 3AKYA 4B47A 3GLGE 2O0JA 2WVJA 3IPXA 4TT3A 3UATA 2ZYUX 3BERA 3JVUA 2DCUA 2NQ2C 2W2TA 2YC4C 2ZE5A 1GM5A 4MRSA 4B2LA 3CR7A 3KQLA 4QM7A 1VCNA 1C1YA 3IPYA 4P4SB 5F9FA 1Y63A 2CXXA 1ZNXA 2KWIA 2IT1A 4L16A 1IJEA 1F6BA 1NN5A 5JFGA 4KCGA 1IXSB 3MFYA 3ZZ0A 2UKDA 4RD0A 2GF0A 3QG1A 1U0LA 5LDDC 1HTWA 2P5TB 4HI0E 4OKSA 1E2NA 4QGHA 4UNRA 4OBEA 2ZJ8A 3ZS8A 4BEBA 1S4QA 4WZ6A 3GLIE 3U7FB 4G5OA 3ZVMA 5JJIA 1Z0DA 5FTNA 2ZJ2A 3PG5A 1XMSA 3L43A 3N70A 1L4UA 1XJCA 3ZVNA 1UKVY 2MSDB 4PAQA 4PC6A 1U9IC 3IEUA 4RZUA 4IVPA 5FL7A 1YZLA 2C04A 2VO1A 4XWKA 3U4QB 3AKCA 4TL7A 5L3RA 2EYQA 3I73A 3BIFA 2FDCA 3QIAA 4ZCLA 3ADBA 1JR3E 4DLTA 5EUQB 1W2HA 1FX0B 2EYUA 5KSOA 3HR7A 3DHWC 3VX3A 1GVNB 5HZKA 1CRPA 1N25A 1VDZA 2O8DA 2VL7A 5EUMA 1NG9A 4P32A 4RFSB 1U94A 5D3QA 1AKEA 3PEYA 3KQKA 5EZ6B 1E98A 2QI9C 3QEJA 4OI1A 4Q4HB 2FFBA 2PBRA 2ERYA 4MYUA 1NMXA 3B13B 1G8YA 2FFHA 1G5TA 5DYIA 4LV5B 1OPXA 2RHMA 1X86B 4LYJA 2PJRA 4RFSA 3WBKA 1JJ7A 4L8GA 1F2TB 2FZLA 2PZEA 1JXMA 4NYMR 2BEKA 4V0KA 2DY1A 4PTLA 2G6BA 4UKDA 1SVSA 2QA5A 1CP2A 3K9LA 2JEOA 3PCRB 3UK6A 4P0TA 1ZU5A 3BXZA 3RS2A 3W90A 1E94E 3PR1A 1G5PA 3GFPA 4MDFA 4HB2A 3QKTA 3AF3A 1E2DA 1ZAKA 2AR7A 3EZ2A 1IXRC 4ZO4A 4B35A 5ANRB 4BLSA 1TADA 1KDTA 2C78A 1M34E 4JL5A 2BWJA 1DELA 2HDNB 4A1FA 2I1QA 2CL7X 3T12A 4QHTA 1QVAA 1VIAA 2CBZA 1CJKC 1FMJA 1QRAA 1U8YA 1Z29A 1ZD8A 4OJQA 2GILA 4HAXA 1SVIA 2OO7A 3PUXA 1OW3B 3GFOA 5FBWB 4XSHA 3QBTA 3QXSA 4KFRA 2G88A 1KI6B 1I4LD 1WF3A 2VQSA 1VHLA 1XXHB 1DAMA 3DL0A 4PPNA 1YJ5A 4A2QA 1E0AA 1QHXA 3N2EA
chains in the Genus database with same CATH superfamily
2Z2ZA 2XUHA 1P31A 1J8VA 4MH0R 4O4JB 4P4UA 4E7OA 2WTMA 2PLWA 2OZLA 3RYCB 4LNAA 1C0EA 1J2EA 4NV0A 5EP1A 5BVHB 1PUXA 1SKQA 2Y1FA 4WKCA 5IASA 1XZJA 3H17A 4K6CA 1P1JA 3IYLW 1C9MA 1E5LA 2J85A 1AD2A 1X0VA 2B36A 3LWNA 1NWHA 3PFFA 2GJKA 3RYFB 2QY6A 1NM5C 1XQXA 4JT4A 1Q17A 1MO2A 1LSOA 5IT4A 1XC7A 3MT7A 3NTUA 1IQPA 3A28A 3GRCA 2I62A 4BL5A 3AUXA 3IEMA 1E2MA 5HBRA 4XWWA 2F3UA 3GJ6A 3TXYA 1EVYA 1Z9BA 2W2VA 3IBCA 3I8XA 3KETA 4N3GA 3IE2A 3C3AA 3FUCA 2YWDA 3FNGA 4QNRA 2QE7D 1A2BA 1GSOA 1OZGA 2CUZA 1LPOA 1XDSA 3LBYA 2GPYA 4Z54A 3ETGA 4LPSA 5CVEA 3KEMA 2QYOA 1Z34A 4MKRA 2BJWA 1QCDA 3MJRA 1R6VA 4MIYA 2Z9DA 3G49A 4O63O 3AHCA 4EJSA 4DA0A 1SUDA 3S8YA 4ZMBA 1T3TA 4M1MA 1T8UA 1XCGB 4KO4S 4XTRA 2AYYA 4P36A 1Y3HA 3OZSA 1PR4A 4U2EA 4NULA 5IEBA 3WRWA 4ZALA 5G1PA 3OPMA 4OGKA 3F1KA 3L79A 1UPBA 3DD5A 5LD2C 2BT4A 2DFVA 4BLTA 1Y81A 4D3YA 1M2EA 3E4CA 2QBYA 3DEKA 1Z6QA 3ONEA 4E88A 5DOVA 1E9DA 2VHUA 2ZTLA 3DMTA 3GRZA 3I92A 5D00A 4WBNA 5FUWA 3LH5A 1DAOA 3SHVA 2KLHA 4FOPA 1LB1B 2QRVA 4NJEB 4HWOA 4PXSA 3ZC3A 2XCQA 4F85A 1HFEL 3Q7EA 3M5CA 4JBGA 4QJIA 1A1VA 4ND8B 3AL2A 4WFJA 3IEVA 1EX9A 1MX3A 5E3IA 1TB4A 1WCIA 3MOGA 1ZN8A 2QU7A 2JVKA 1IJBA 1UH5A 1DCMA 1JLMA 5DLPA 1KH2A 1SEVA 3QPUA 3A9CA 1P9LA 4NMLA 2IXBA 4C7KA 1T6NA 4DM7A 3K96A 3WKCA 3CTPA 3W05A 1YZ3A 2WYVA 3AETA 1ULAA 1NUPA 5F5NA 3F90A 3GLUA 4F5YA 4R2XA 4IL5A 2B61A 3B8HA 3FETA 4FLMA 1WY7A 2BGGA 1G8MA 3A3OA 2C0QA 4MZXA 4EEXA 1XKLA 2A9FA 4WNCA 4I55B 1SU7A 4INZA 4XGRA 3BWMA 2TSYB 3EY4A 1MX5A 4G1FA 4HSEA 2CHFA 5T4BA 3G2LA 3WXMA 4RQAA 4CHGA 4EG6A 4BVLA 5AM3A 1GYPA 2J32A 5KTNA 4PHTA 2VOEA 4JAVC 1WXQA 4FONA 3AF4A 4G0YA 4RD3A 5E9WA 3T5DA 4Z7JA 4HDRA 4LXHA 3TW4A 5CITA 5KBYA 3GRRA 2HMTA 1KZ9A 1SCDA 1XSEA 2Y05A 5CCEA 1I4TD 4RYDA 2ISSD 3HS3A 4HNRA 2IXAA 3PS9A 1R66A 2PKYX 4B8WA 2YNMA 1D2NA 1JDZA 5KNBA 1YR7A 4RWEA 4CG2A 2CXOA 1N5IA 1WXHA 3N6RA 4JR2A 5DGTA 1XZCA 1IHUA 3O2QB 5F2EA 3RB8A 2XVMA 2FN7A 1QFSA 3C3EA 3LOUA 4UNSA 4ZODA 5FQNA 4RGYA 4U2FA 2BF4A 5G1OA 3JAWA 4YRKA 1UR5A 3O82A 1SVOA 1I32A 1DRWA 4BXOB 4LJ4A 1RLOA 1C29B 2QW0X 2YV3A 3ORQA 2ODPA 1UQUA 1DC6A 1I1NA 4YJHA 1VLJA 3SDZA 4ZC8A 1O0BA 3FVQA 4YJGA 3UOGA 2QD3A 3H5LA 2NTVA 4F7DA 2IP1A 1JXQA 2ADOA 3CXUA 2P9YA 4BC0A 4BXOA 4Q0MA 4JUIA 1RI4A 4RVOA 4ARAA 2PAFA 3R6GA 2Q2QA 2KLBA 4IW3B 4IJ5A 1S4MA 2C94A 3SHWA 4TVOA 3ZD7A 1LDGA 1U8UA 2IUSA 3LW7A 2QLTA 1YIAA 5IAEA 3ANNA 1RP1A 2FTKE 2PFGA 4PSCA 1U98A 4GO1A 4O4LF 5FCDA 2RG1A 5HFJA 3OF2A 2QMHA 1BHSA 3PJFA 3BILA 4FEYA 1TW2A 4IIUA 1DG9A 2HL6A 5BOSB 3FWKA 4HWTA 4O2RA 1XTKA 5LN1A 1I1OA 1AS2A 1Z2CA 4LOKA 1T36A 5HILA 1IBLB 4KIGA 4R2WA 3RUDA 3IURA 2R8EA 3QY0A 3RVPA 1JHZA 4ACAA 2E18A 3BB1A 4WZZA 4BMYA 5IM4A 1FLVA 2H4HA 3OFNA 4OA8A 4IGAA 4M7PA 4QVKA 3D3KA 4XIIA 1IOZA 2IE8A 5DN6A 4BO1A 3B6ZA 4K9LA 4WK4B 1X80A 1SXGA 4HNVA 3EHDA 1W9HA 1Z18A 2LE0A 5CLIA 1E61A 4YEDA 2JZNA 3UXMA 4BO0A 3DNPA 4DE5A 1GTVA 5KYNA 2DR2A 5LMUB 1JSLA 3GGGA 1FDUA 1NV9A 3NDRA 3G2OA 5LZ7A 1FW6A 4LZAA 3T41A 2GARA 2P0EA 5IYZA 1Y7TA 1OH8A 1EM8A 1TUBA 3IUPA 4YYEA 2PVSA 1JQBA 5HF5A 4EL5A 5L3QA 5B1HA 3CRW1 1ICIA 4HO1X 4CLDA 3DT9A 2HA6A 2ZYTX 5F73A 2HR1A 5LYJB 4L0MA 4DAOA 1X42A 3LQ1A 1U2PA 2XT0A 4QYMA 1AKRA 2TMDA 3GDOA 4I1UA 3H19A 1CUCA 3P2KA 2JFPA 2V1XA 3CJQA 3K9HA 3B3GA 2MYNA 1W88B 2FRVA 3QNUA 2OD9A 2OHJA 3IP5A 4BO7A 2XSZA 3F5FA 3L40A 1ULUA 2R7AA 3BREA 3CUVA 4GE3A 4XCVA 1EDOA 3EFOA 2O19A 3V2IA 2IEIA 1N2ZA 3AERB 1GHTA 5KC8A 1IHPA 2O59A 3HM9A 4R3WA 1H2AS 3LDHA 2Q29A 2YXPX 3B6IA 4N0MA 2C9DA 2Z2XA 1PZHA 1ZS9A 3VO2A 5FA6A 4OUKX 4YXWD 2JIZA 2VXBA 4ZYXA 4H0CA 4XOUA 4AZSA 3CTMA 3IP9A 3EFOB 2XTZA 5B1IA 5K1ZA 4W9NC 3V4LA 1T9CA 3WY9A 1VHTA 3CUWA 1R10A 5A4IS 2W42A 2ZJBA 4F60A 4B74A 1RXIA 3OJEA 4YAGA 3HJNA 2ARKA 4TVBA 4XAQA 3HKBA 4AD8A 4BGDA 1HG1A 4DLLA 5GM1A 3KZCA 4CNQA 2NO5A 4G86A 5IBRA 3LD9A 2C4VA 2VNSA 4V0OA 5DMHA 2I91A 2DFLA 1B43A 1XDWA 3P9IA 2OV2A 1WOMA 3DGFC 4DLRA 2X9NA 4TYWA 2YRFA 1IWPB 1CUEA 4MV0A 3RIEA 3WI7A 4KFTA 1N9GA 3IKLA 5LBUA 2Y76A 1SVKA 4CMEA 3PXBA 4ESHA 3HVHA 4EHDA 4OQMA 4E7PA 4U6NA 2BN4A 2X8JA 1P1FA 3VU9A 2CT8A 3DH0A 5DEOA 2PA3A 1NVTA 1SZDA 4MUFA 4CKEB 3L6OO 3PF8A 1FRZA 2AOTB 4GLJA 4OQYA 5EEHA 3KLBA 4JYAB 2IODA 3HUDA 3NYQA 2PFKA 2FQXA 4PS1A 4Y2JA 3QI2A 2R66A 1QVZA 1XNJA 2WWRA 4MW9A 4F97A 4KXWA 1SKYB 2LKDA 3CCFA 1LDYA 1N2CA 1NKSA 3QXHA 3BHJA 3UW1A 3H3JA 3JYNA 4TTSA 5BWMA 1IBKB 3I2HA 2KB0A 4AJ2A 2VWGA 3H13A 4IXMA 4MW4A 5D8DA 1JE0A 2GZ1A 5L3SB 4CQNA 2Z4SA 1VKRA 3IPRA 2CCGA 2FRXA 3B9RA 2XKKA 3ZVRA 5JECA 2NV2B 4N1AA 4NXNB 5IHPA 1R8YA 1SUWA 1DV2A 1J9GA 1KTIA 1UMDB 1HQCA 2C9ZA 3G0CA 1L4MA 3QVTA 4G01B 2AZXA 5BSUA 3ER9A 1QO0A 2WJJA 4MDHA 3ZCSA 4G5RA 1A5SB 3F0TA 1KDYA 1RR6A 1B8VA 1NN1A 5ALZA 5F5XA 1KYIA 1MQSA 1IVNA 1QK5A 3K09A 1EUYA 1KO7A 4G85A 3H65A 4M86A 3FCXA 4PCVA 3RYFA 4JQOA 1A2OA 2Z5LA 2Y2UA 2X19A 4G56A 3V34A 2ZWAA 3RH0A 3VH1A 4LYHA 4XEHA 3EMBA 1IEWA 3V6MA 3VDRA 2W2OA 2GLTA 4JXXA 3CGWA 1NQOA 4PLTA 3GVPA 2PSSA 1DV1A 1N8KA 1QVWA 5FUXA 3U13A 1NOKA 1MD9A 1G5RA 2A67A 4YHHB 2ZUSA 3CN9A 3F5MA 4QQKA 3ANSA 1UBEA 1V48A 1O9GA 3DJFA 1IAVA 3W7BA 3CBQA 1GSIA 3IUYA 4L5CA 3S2ZA 2H4XA 3B6JA 1LF0A 2P1RA 3LA6A 4AULA 3IKJA 4FDVA 3UG7A 2R8RA 2FUG1 1JEDA 4OHVA 1XTSA 4DSAA 4Y7CA 3QXJA 4B6EA 1UK9A 1CEYA 3NHLA 2EV9A 4PNZA 2ODNA 3QJYA 5FIUA 3TNDA 3DTNA 4PGAA 4D79A 1IE3A 1CRZA 1HV8A 4AY2A 1KKMA 3WC4A 5CDTA 4N49A 4W7IA 3JARB 1E2PA 1MRZA 2HQ1A 3FKSD 3IC5A 3MN1A 4D2IA 5L3VA 1WMFA 1SBZA 3A1SA 3GI1A 5SZIA 5A62A 1KVSA 4FEGA 2IZ6A 2ZBRA 3OOEA 3UCXA 3UJCA 1L4NA 1AK9A 1DEHA 1YA8A 2A5JA 1T1SA 4A0FA 1XV5A 521PA 2JCXA 4QZVA 2R4TA 1YGYA 1ISMA 2CHEA 2KYRA 2RFLA 3SSOA 3VYWA 2AFRA 3C3PA 4PRLA 4QUEA 5G2OA 3DOCA 1VJRA 1XNRB 2QU8A 3CW8X 2QORA 3IQIX 4K81B 3UOWA 1MEEA 4RO0A 8OHMA 4L9SA 4O0LA 1Q7BA 1ENZA 1K68A 1W0CA 2ZIXB 4R9RA 4V38A 4DF3A 5JD3A 4EJ2A 1N36B 3DL2A 4M1SA 1KWGA 2PQ2A 1QHNA 3L7YA 1EUDB 1FIUA 2IY8A 1JMYA 4PO9A 3T7IA 2EKLA 3JZMA 3UAGA 2VYVD 3AYZB 5D51S 5A0FA 3K0HA 1FYDA 1K97A 4FZ5A 2OXCA 5JSZA 5C18A 3CX4A 3V1NA 2WQ6A 3CZPA 5FT9A 4EUEA 3WP0A 1J07A 5C81A 4OB6A 3K2IA 4AL4A 1WDKA 1Z16A 3CUKA 3HJTA 4YT2A 1H22A 4EQZA 1Y37A 4CKCA 1ESEA 1V16A 4K9QA 2X0KA 3SMQA 3ORFA 1Y1PA 3TNLA 3TTWA 1TO6A 2RHRA 1EK6A 2F8TA 4ERNA 1EKXA 5K51A 1XROA 3ICQB 5JSZB 5HZMA 2QBYB 1KOFA 3I30X 1PKEA 4QM6A 1WHSA 2PX6A 2UUOA 1E6WA 5DTJA 2A78A 4M22A 2Q4OA 1DTEA 4HLUA 1GYRA 3K0BA 5CFRA 1E2QA 1RWBA 3CY6A 4NBTA 4I1OA 4DV0B 1ZO8A 1XCJA 3RLFA 2HPHA 3D59A 1AZTA 5CT8A 4CUJA 3OU7A 4KPYA 1MNQA 2BMFA 1RYMA 3M9XA 1UFVA 4TOIA 4WZAB 5HM6A 5KB3A 1AJEA 2GJ9A 5FBRB 3TJRA 4G5FA 1KI2A 3UT5B 1YS6A 3UMJA 2Z58A 1DKPA 2FWAA 3RYHA 1XRNA 3QYJA 2ZKLA 3PGJA 5BUZA 2GKOA 3UYLA 4FFSA 4IMJB 5KTMA 1E3MA 5G41A 1TFUA 3OLVA 3M6IA 3P5SA 4FX2A 3ZN2A 4RFVA 3EZNA 5I7WA 1PT7A 5JCJA 4KMSA 5H16A 2N0SA 3Q5DA 2I99A 3ZHSA 4KQMA 1QQBA 5H4GA 1B8NA 5CTJA 4LTDA 1OLXA 4MSUA 1X1RA 4QWMA 2OBFA 1MAVA 5EWLA 5CAEA 4POAA 3WWEA 3V2HA 1YRQA 1F8GA 1H23A 5KKAA 4BZQA 1S2MA 4X6LA 3OZFA 4ZTUB 5HGXA 3KR0A 4MB0A 1A4XA 2VJMA 2C98A 2ADMA 1TK2A 3BMCA 3R09A 5C1DA 4DR2B 5D3MA 1Y48E 4NG4A 3K32A 4RORA 3GQBB 5M5BA 4H1HA 3L5KA 1HDOA 1UM8A 2YS6A 1BCRB 2MINA 2ONCA 2RBGA 5FWDA 5ERXA 3QUAA 1TX4B 3E61A 4UEOA 3WV4A 3FWHA 3V7FA 4MB6A 1HLGA 3PEEA 1T5OA 4FMCF 2VXCA 1B2LA 4NOJA 1N0VC 5BSMA 1RCUA 4B2IA 1DDOA 1HDZA 2EFHB 3KE9A 4BEJA 1LU9A 3AOEA 3VBEA 2C9OA 1EIZA 5L7TA 3BWXA 3ONDA 1SUPA 1XB2A 2QJRA 1DAKA 3P9ZA 5ETJA 3HL4A 5EL0A 2IEGA 1CNMA 2W48A 2WWYA 3GLQA 3M3HA 5JADA 2OCLA 5KSYA 3DFIA 4YRCA 1WWKA 1IB0A 1J21A 4TYNA 3NS7A 4K46A 1TCCA 3AHGA 3C1UA 4KLZA 1RQNA 4R5MA 2O8DB 1G2OA 2I2AA 2FH5B 2QXYA 2ZJ1A 2ZUBA 2B5VA 4QTZA 5TQVA 3CRMA 4LRWA 3TZLA 3GPDG 4O4LB 4TMKA 4ZQCB 3OTOB 3SQDA 1SK9A 1JHQA 1GL3A 4OP1A 3L8YA 2WZDA 3LCUA 2AC2A 1SCAA 2F00A 2QPTA 4N3CA 1UDRA 2HPZA 5AUNB 3BJEA 3S29A 3UGQA 1MT3A 1Y6QA 2WDPA 3GLHB 4JJFA 1ST2A 1R0CA 1PYGA 2H7YA 1JEOA 4YFVA 1OGJA 2ZZNA 4BAGA 2W43A 3NHPA 4PYOA 3VJLA 4BQOA 3PYXA 1CKEA 3FYUA 1W48A 2H57A 1ISFA 2RHWA 5AI6A 3D1LA 3OF5A 1X92A 3V3KA 4MRVA 4I2VA 1U2ZA 4BO6A 4Y0NA 4DIEA 1OF1A 4C1BA 1YE5A 2VWPA 4Z1MA 5ITSA 2C3OA 5TXGA 1XELA 4ZYLA 3EWSA 3B3QA 3THYB 4MYSA 4YPFA 4GX5A 4POOA 1IY2A 4KQGA 2A1UA 2JK1A 3ERCA 4IIYA 1MAWA 2XVZA 4A8JC 1TE2A 4A15A 2DETA 1XL1A 2H85A 3INNA 3D6TB 1QYXA 4B4VA 4NZOA 4YRTA 4EVRA 4PYRA 4BBZA 2XEXA 3PVCA 3ETCA 4ZQGA 4R68A 4M36A 1GQSA 4TKMA 1NZDA 1U0FA 4KXNA 1H2ZA 4RF3A 2XF8A 2L82A 5LUBA 4JI1B 1H9CA 2W93A 4OMFG 3PD7A 3QE4A 2FVYA 3UJBA 2VYVA 1TM3E 1F51E 1K08A 3EUEA 1NVGA 1E4VA 1YR3A 1T5HX 2G0NA 2I22A 1N0WA 3H5TA 4QPZA 2A9JA 3IJ5A 2ST1A 1RRMA 1G8AA 3IDZA 1KVRA 4NNPA 5BNFA 4KQJA 1RYBA 1Z0ZA 1JI0A 1YHYA 1O94D 2D5IA 3SHQA 1DIBA 4TSFA 3RG8A 1HSOA 3A4IA 3W4JA 2AKYA 1LF5A 1ETUA 4YV0A 1BDIA 1I8TA 5CDFA 1EJ6A 3KL4A 4LRSB 3PX7A 3N2KB 2DT8A 1TVEA 5LJIA 1IY8A 5IC5A 1F2UA 1PVDA 3Q0IA 2HA4A 4MVJD 4F93B 1PFKA 4B17A 2HPAA 3AEUA 3MWEB 2BKUA 4K26A 5AKKA 1X13A 4JUAA 3H5OA 5AOCA 2PD3A 1ZEJA 5IT9A 1CR6A 4Q16A 2EVWX 1OWPA 2YW9A 4OU4A 3MC1A 4D8UA 6REQA 4FZ3A 2CNWA 5CLQA 3TSYA 1LDNA 1P33A 5FFMA 3ABZA 5FWXB 1AQNA 1KQNA 3JD2A 1ZOIA 4CQLA 4E09A 3JR7A 1N2SA 4QC2A 1ZH6A 2ODAA 3QXCA 4LRYA 3EGVA 2XCOA 3NKLA 4I0WB 1WXWA 1G8FA 4UHCA 3R1IA 4FNOA 5TEWA 4AJHA 2OESA 4GS5A 5FAXA 1ZHHA 3T9FA 1EP1B 1D6MA 1Q0RA 2HDWA 4CEHB 1VMAA 4HKTA 5CVCA 1WSBA 4I3HA 3M82A 3ODPA 1DARA 1XVTA 4QBIA 3ZDBA 3E3MA 3ZW9A 3CVOA 4Y2UA 3T1NA 3FTDA 4JFAA 1GD1O 4YALA 1O6CA 5LB4A 1E7YA 1CE8A 2J4DA 2OBMA 2NYAA 2WJ3A 4RCZA 3DV0B 4TL8A 1L3CA 3HB1A 3DWIA 3RAFC 1T1JA 1YI8A 2G5TA 3RJTA 3VOBA 1IUNA 5IUNC 1ABEA 1NE2A 2NZYA 3AILA 3W8FA 4E4RA 4M0LA 1W85A 1BFDA 1I3OA 1EGMB 3K9BA 3BUSA 3I01A 3JQGB 3KKPA 1ZNYA 2IZ7A 4RVFA 1R6DA 4MGIR 2FMUA 5L8VA 2A0FA 1XZPA 4J90A 1RYDA 5ALYA 4PG8A 1FNSA 4CF3A 3AZOA 2WG2A 1KZ4A 3A8TA 4AC9A 2DUUA 1Z22A 2AVDA 1IRIA 2IBMA 1Y4ZA 3NUZA 2PT7A 1VJTA 1HE1C 3DEFA 5EE1A 4ALKA 5LA6F 3CE9A 2DFPA 5A4DA 3I1FA 1ZVKA 5C32A 3ROXA 3BB4A 5CP8A 1EVQA 3C5EA 1EZ1A 3PUZA 2D7JA 1FFSA 4WCFB 4ZARA 2ATXA 4ER3A 3WL8A 4BE9A 1Q84A 4KR6A 4S2EA 2B1QA 1UT8A 5JH7F 2Q6KA 1UMDA 1RHMA 3U4QA 4AJOA 3Q7TA 4NYJR 4QUIA 5DZSA 1M76A 1Y6GA 2XMGA 1Z2EA 3H86A 4I9UA 1MMFB 3T4XA 3HVRA 2B4QA 4TRMA 3R6LA 4ZT2A 2BHTA 1BDJA 4YAIA 3R7NA 3FCCA 3TR6A 4KWCA 2GK3A 2YWHA 2FN3A 1OYVA 3V8BA 1B14A 1KMCA 1OPRA 2EP8A 4LDZA 4MLCA 4PHFA 4RY9A 4RH3A 1U3FA 5C8VA 2FEKA 2IXFA 2PWZA 2HBYA 2LIVA 2PZBA 4C43A 2ECKA 1JT9A 5J3JA 4WN9B 4ZD6A 3F74A 1BW9B 4P7KA 1N34B 1M6WA 1V9LA 2OG2A 3OTWA 5A9RA 2CXRA 1KF0A 2EFCB 2J6CA 5F33A 1J1ZA 3R0VA 4E1VA 1VE7A 2CVZA 5IJXA 1JN0A 1OA0A 4QG3A 1ZD9A 1NXTA 3EVBA 4QQFA 5ADHA 3PGA1 4YP9A 3OPVA 3PGLA 3DQQA 5ICFA 5CA0B 1TF5A 3W8DA 2X15A 4B40A 2VIIA 3A25A 3HN7A 2FQWA 4CM4A 4YRDA 3F5SA 1TM1E 2AN5A 3LP8A 1Y1LA 2C92A 2XUJA 3DBOB 1JMVA 4Q4DA 4EZEA 3AMVA 5B4TA 1NX6A 4U2BA 3MCVA 2BKEA 5JCJD 4OXKA 2GK4A 3C3BA 4H1UA 2V6MA 4C3OB 2Q5CA 2I2BA 3HFGA 4ZEMA 2DPXA 3KQTA 2C1XA 1RFLA 2I3GA 3ENKA 1KJQA 1AXGA 4U8GA 2LBPA 3IEPA 1M6NA 4TXHA 1W25A 4MUAA 1OZFA 2OFFA 2HQOA 3GCXA 3VYTB 2GJAA 2Z30A 5EAIA 1QIKA 5I9LA 2JGLA 3C8UA 3ZXIA 4B45A 1H8HD 3IDQA 3Q8XB 4ZREA 1XZAA 4L4UA 4OXXA 2WD9A 2VDLB 4IG4A 3UAOA 3F6SA 2EBUA 3MCAA 3DHYA 3DL7A 4FIDA 2HHAA 5KYWA 1JH9A 2DYKA 4MV9A 2AG6A 1P29A 2QMUA 2ECPA 4JI4B 4WUVA 3OOYA 4H7FA 2GT1A 2WINI 3ZE9A 1RAGA 2N47A 1FJXA 3KRTA 5CT6A 1DBVO 1FE8A 5HHTA 2OENG 1R6AA 1FJHA 5D87A 1US8B 1I80A 1U5AA 4FOLA 4M1WA 1RI2A 1YQGA 2P5UA 4D3XA 5IJ0B 1A04A 4HLCA 4N41A 5B58T 3NBKA 1E1LA 1AXEA 3I04A 2J9FA 3U4CA 4DQLA 1XRLA 1JKJB 4G4SO 2I6SA 2IHKA 1UJ2A 3B9QA 4HNAA 4UPEA 2FZWA 3T54A 4YPOA 1RRKA 3N1UA 4Q1VA 4AJ4A 5LXTA 3GF4A 5G3ZA 4YJFA 1Q91A 2C54A 2WFLB 3HP7A 4BUZA 3CLSC 2XZLA 1JG2A 2NZVG 3NR2A 3RHZA 3NOOA 3DHNA 3HM2A 3PQ5A 3R3ZA 1FQKA 1SC4A 2VHYA 1EESA 1C1XA 2P1ZA 4XPIA 3OKCA 3L7LA 1KBZA 3EZ9A 4KI7A 1ZL2A 5JI3E 3L4KA 2UXDB 4Q3DA 1MVLA 4CCYB 1FL9A 3DG9A 3TVYA 2PQMA 4UQPA 3REGA 2O2CA 2FYTA 4HEHA 4FS8A 3G82C 1L5NA 5DIZA 5FB3A 1OH7A 3G89A 3ESYA 5FOTA 5JD4A 2BYTA 4JR0A 5C3UA 1II0A 4TWBA 1IWOA 4Z99A 4IPTA 5AHOA 1QUEA 4FIZA 3ZWAA 1TIKA 3G3EA 1YC2A 2CEKA 2GBCA 2PMDA 3H8WA 1N6IA 2X2FA 5G0WA 1K7XB 1JR4A 2Z5FA 1MEJA 3E58A 4R5HA 4AZ0B 4BFLA 4EFMA 1L8AA 3IT0A 5C51B 2ATCA 5EXSA 5FWYB 5CLLA 3MINA 5AKHA 5FWAA 2PXHA 3ZZMA 1UC9A 3IUEA 2GZAA 4BN5A 1VL0A 3E82A 1T4MA 3QWBA 4CE6A 4EMUA 2FN4A 1UBCA 4MS1B 1DPFA 3HN2A 5LBIA 4BZXA 4LF4B 4MUHA 3T1HB 1I3NA 1GU7A 3FR8A 5IKEA 2FLWA 1JE1A 4ZAXA 2XVYA 2C61A 2OSVA 3C5WP 3G7UA 3LE8A 1YMVA 2B20A 2BGIA 2JATA 4PV7A 4QTYA 3IL2A 1JH8A 1JJVA 5DGIA 3QHPA 2FPKA 4FFPA 4YT4A 3JQ8B 2A4KA 4PFSA 3ZXXA 4BO2A 1RQ7A 3RUCA 3RS0A 2JH3A 2CD9A 5FPPA 4U1RA 1OB2A 1T0PA 4Q37A 4LJ9A 2H7VA 3DAFA 3EQZA 3D5TA 4LY0A 4WJLA 2R44A 4BJHB 4F5EA 4OFZA 2NUTA 5IG2A 1THMA 4YASA 4REOA 5EN4A 3M3DA 1H05A 3N76A 4UULA 4QELA 3OP4A 1P8JA 1HORA 1ZJ6A 2DLNA 2J5KA 1GGJA 2F3TA 2AOTA 5CM2Z 2IWHA 4CKEA 3GNLA 2NVWA 3D8TA 5JMPA 5JCOA 1EAMA 1SPBS 4HT3B 4FZRA 1HEIA 1VRCA 2A57A 2JJ2D 1FY2A 1OWNA 2NU7A 4XX0B 2EJCA 3EGEA 1QRUA 3F7NA 2V9CA 1MH1A 3M6LA 3LDAA 5EXDA 4AMVA 4E13A 2NUAA 3LAWA 4UU8A 1T9HA 5DCWA 2CDNA 4YUYA 3TIVA 3SPXA 2EJVA 3K72B 1A8QA 1N57A 4GL4A 3ZV5A 1VKNA 4L5AA 1KDZA 3U9SA 3BIWA 3QYAA 4Y6GB 1ENOA 2DWOA 4YCNA 3OPYA 4WLUA 3MNFA 1JIKA 4LXXA 5TIIA 3S40A 4EA7A 1UXOA 1U7XA 3HB4X 1M73E 3L8CA 3I9V6 2W58A 5LLSA 4CIDA 3GZNB 1RWPA 4F8EA 1DBIA 1HDGO 2V03A 1R5BA 3LL4A 4IGKA 3RWMB 4EI7A 1C9KA 1VSTA 1Z8FA 1BNCA 4IF6A 4F71A 4Q1AA 1FNDA 1GTG1 3K0AB 3KYBA 1MGPA 1W4BA 4PO3X 2Y4NA 4LEIA 4Y9UA 4ZVVA 3H9GA 4YH1A 1T9BA 1Z8HA 5JALA 1KFCB 5FEMA 1W34A 4L78A 2RGWA 3PDUA 3PQCA 5DT2A 2A9PA 1C30A 1NWCA 3FFWA 4ZP1A 5IN5A 2PR2A 4EB8A 1XMPA 1O97D 3ZHOA 4NAHA 1AO0A 1CYDA 2FW1A 4NEHB 1UMBA 4EK9A 2J3JA 5IN4A 1LBEA 3SD7A 2OB1A 4WOBA 4ZCIA 3PDHA 4C7MA 3DYBA 2QV7A 3GRFA 3S5UA 1ND6A 3G23A 4PX3A 3G0BA 3TSOA 5CD9A 1GSAA 3ZHQA 1TM7E 3N87A 3R5KA 2O4UX 3C3XA 3GQVA 3P0RA 1Q0UA 1JNXX 1ZD3A 2VJLA 1DKRA 2R60A 3BXPA 3M5PA 3RTAA 1K5GA 3BXGA 1OI3A 4DY6A 3HXOA 1GCGA 1S6YA 3Q9NA 5KQLA 3LVRE 3E9MA 1PQUA 4ZIRA 1Z4KA 2BMVA 3A4VA 3OQBA 4GWGA 4IIEA 4HEA6 4QGFA 1OJ7A 3AJDA 1Y5RA 3NRJA 6PFKA 4TTTS 4ROSA 1W1WA 4K3VA 2AFIA 4D44A 3ZJTA 3PJEA 3WLTA 2XF2A 4D4JA 1MB3A 4BQFA 3KVNA 5AXBA 1P2SA 3FCSB 1PE0A 2JEYA 2XWPA 1A9XB 2YKGA 1BH6A 4YMSA 1MB4A 1C8BA 4RIGA 1PRYA 5CEEA 1G66A 1D3AA 3SXJA 1ISRA 2YHIB 2ESRA 4ND1A 4NRDA 3ULKA 2J0UA 2J7PD 5IKMA 3CZAA 3JQAB 3KUKA 4AZ3B 4GDMA 1GGEA 4BWGA 1W4CA 4IQ4A 1SHLA 2R8BA 1FRFS 3EQ2A 4JQSA 4D3FA 3VR3D 3NDBB 3FI0A 4XJXA 3WYCA 3UENA 4CMBA 5ENZA 5AI9A 3VPDA 2WQ7A 1TLLA 1C0PA 1I7PA 4BFXA 1T25A 5MN5A 2IY9A 1YBFA 1ZJ4A 2WF7A 1QIGA 3GLFB 1E1QA 1G6KA 4JP2A 3P9YA 2VK2A 4YREA 4JITA 5ESDA 1IXKA 4P2BA 2P9ZA 3GJZA 2GAAA 3MTAA 4H3VA 1W5AA 2NAPA 1Z56C 4ZV9A 2EWVA 2G5GX 3ZI7A 3WAJA 4RF2A 5BN1A 3BT7A 1QYIA 3SS8A 3K16A 2E5FA 2ZBVA 2ABWA 1R4MB 2GVZC 3R5FA 5E1MA 3RQSA 2EJTA 3TTYA 2VDNB 5KHLB 1W46A 2XCIA 4Q02A 1D4AA 3A4MA 1K86A 2CK3D 4TVSA 2JIQA 1K2WA 1W5EA 4MIEA 4ZT4A 5IJ9A 1UPXA 2C8LA 3SM9A 4NZMA 1TQHA 5E6SB 4AIIA 4BCBA 4CKXA 1E2JA 4B3TB 2WP8J 2FSPA 2B1IA 2ZI3A 2DQKA 3KUUA 1B6GA 2FPIA 3CNLA 3G2MA 3G2IA 1KAGA 2AB0A 2WKPA 3BZUA 3PC8C 3QU7A 3B70A 1E6LA 4EX6A 2GFHA 4J4BA 1PJ3A 3USZA 3L0YA 3EIEA 4G8BA 1FOEB 1G3IA 1SQ5A 2GBGA 3QI7A 1BWPA 4LXIA 4TS4A 4ASUA 1RCTE 3GJYA 1A98A 3VISA 4ZA2A 2IVZA 4NBVA 2WM9B 1NNI1 2C29D 2AMYA 4JBWA 4FD2A 1Y1SA 5TS3A 3H4MA 1I51A 1ATIA 4LWPA 5EJ9A 1ZD2P 5HS6A 4NOKA 4BQIA 4BEWA 1I14A 1P4HA 1E32A 1AMOA 1YF3A 4EB3A 4LF8B 4OI0A 3OZWA 3W6OA 3OTHA 5EIEA 2AXEA 1DJMA 2QTMA 2MTBA 4HZUB 4J0GA 5J59A 5BY2A 2BH2A 3TW0A 3FVRA 2H1HA 3BWBA 1TL7C 2GTPA 4LZPA 3BG5A 3VC1A 4WA8A 3VO9A 1Z7GA 2I4TA 4XWAA 4OREX 2HRRA 5KYTA 2VJMB 4S2UA 1G8GA 3AEKA 4WE3A 1V5EA 1XFDA 2A58A 2XE6A 2P27A 2FSSA 1RADA 1DL5A 2D5AA 2RONA 3MQ2A 1HLPA 1CS0B 4TN5A 4BIMA 1FS6A 1QRRA 2J46A 3B9PA 2NP7A 3NEPX 1XD9A 1I0IA 5DCYA 3A3YA 5DO9A 3AFOA 1VJGA 1P77A 5K45A 1NOJA 1SO8A 3H6HA 5DM0A 4KPFC 3FFTA 2FP4B 4KDFA 5T7BA 1QH1A 2J6BA 3H83A 4LTMA 3U4DA 1HUQA 1P73A 3IUBA 3LVFO 5ALRA 3A6LA 1SCJA 1VYTA 3TW6A 4MVJP 2ZIUB 3HJUA 2V6GA 2VEOA 3OBIA 3H5IA 1NJ8A 3SZRA 1WPGA 1FXUA 2DHRA 4FD3A 1S0UA 2WIDA 4XSVA 5KDLA 3R7FA 4DT1A 3VYUB 5K8VA 2V4ZA 3P4XA 3PHHA 1NP6A 5LP1A 2FWMX 3N58A 4GYYA 4ZQIA 1UUFA 1IK6A 2EBWA 4P3YA 2JAQA 4ZVLA 4F84A 2ZETA 1A9SA 1GRQA 3D3WA 1PF7E 3HBMA 2BFPA 1IM2A 2B2XA 1TEXA 2Q41A 3TOZA 4CHTA 4KXMA 1XZFA 1L4EA 1I5EA 2BJVA 3JYQA 3PNOA 5E8JA 5EFOA 3IAM1 2X1HA 5JQGB 3O4GA 1EA5A 1U63A 1G7CA 3D4IA 4IEIA 1VJ0A 3PQDA 1RU3A 5KNDD 3CNEA 3LF2A 1SBNE 3REOA 3GV0A 4Z4FA 1KFKB 4WGFA 3V2GA 3EQ8A 2A8YA 5KX5F 2OZVA 2QL5A 3HB5X 4JFRA 3A26A 2DFNA 5KNCD 1GLNA 5BMVA 4EA6A 1EFRD 1S5PA 5JAHA 5JNUA 1JDBB 4B3BA 5EIBD 1MBZA 3UB3A 4RJKA 1ZA1A 3EEFA 3VSBA 5KC9A 1KY2A 4BQRA 5K5EA 4NJMA 5EE3A 2LKCA 3OY7A 5DOZA 3IS3A 4EPVA 4B34A 1E7MA 4HS4A 1FUYB 3QRWA 4H9GA 4LJKA 5ALKA 2ZVJA 1YFLA 1G2PA 1UCFA 3DBLA 4A03A 4MV1A 2IK8A 3WHKA 4HAZA 4DCJA 3F3SA 2O8EA 3L8DA 2PXAA 4EHNA 4JBHA 2ZR9A 4QA9A 5ISMA 3NAQA 1V4NA 3INGA 4R3UC 4CF5A 3ETDA 3IILA 4HDSB 1C7EA 2GS9A 3FF1A 4QODA 2QJFA 1PSWA 3GEPA 2CJFA 1AGPA 2RGXA 1U28C 4H31A 3V33A 3UAYA 3T7TA 3VPSA 4C9BA 4V1CA 4J9UE 1JFLA 5KX5A 3AVQA 1ZSYA 3WLAA 2HJRA 1T0IA 4Q19A 1RRGA 4JXKA 1ENYA 3FW1A 4GIBA 2WJZB 5EQTA 5EWLB 1YU6A 5BSFA 4YV7A 1RYZA 2QRMA 2V5AA 3OAAD 1KQGA 3TW8B 3AEZA 5CDGA 1T13A 1YRHA 2K2WA 2Q1YA 5EXPA 4E5SA 3EWNA 2EXXA 2JFHA 1X80B 4QSMA 2R84A 5JLAA 3PXGA 5FI3A 4AMBA 5JCZA 3D2LA 3KDSE 1VL5A 1G7TA 1IN4A 2G4VA 1EVKA 4MKHA 3S1SA 3ZD6A 4HN9A 4R8KA 5B1DA 1N9GB 2M2IA 4FDMA 1Y6ZA 4JNKA 4U5QA 2HSZA 5IXJA 5FOSA 4EYGA 1WXDA 4FNGA 2GBFA 4ER7A 1TI7A 4Q3CA 2P4HX 4LF5B 2GYVA 3Q7RA 2JKYA 5D3KA 3TW8A 5LQCA 4O08A 4IDNA 4MQBA 2J1LA 4NU0A 4ZVTA 1P60A 1ZUIA 3OG9A 4XM1A 3W06A 2ZQZA 5ICCA 2CWDA 2QD4A 4RACA 2DG2A 2Z4RA 3ZWYA 1YJCA 3S2GA 2XUIA 3FNRA 1M1YB 4RQBA 4P3PA 3OCVA 5C2JB 1KYWA 2W2LD 3AT1A 3E05A 4NBNA 3AHDA 3Q3IA 2QLFA 5JI2E 3RS3A 5K0EA 1J22A 4O4IF 5DNVA 5LWHA 2DHDA 2HF9A 3LCJA 4BFWA 2BFOA 3F78A