4TYZA

Crystal structure of the c-terminal domain of an unknown protein from leishmania infantum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
NIEGVFRKSFPDLAGETLLDSFNCAWVEGSALKQGYLFITPHWLCFQSTLAAAHFSIEYDEIKDIIKSKSVKMFENAIEVKTHLNDTIFLTNFLQRDQAYSALMSQWLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Crystal structure of the C-terminal domain of an unknown protein from Leishmania infantum
rcsb
source organism Leishmania infantum
molecule tags Unknown function
total genus 27
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02893 GRAM GRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4tyzA00
2DYQA 2YRYA 2R0DA 2LULA 2ELAA 2NMBA 3ULBA 1WJMA 1P3RA 1BWNA 2GS0A 1OMWA 3PSCA 3FSSA 2DX1A 5LOPB 4A6KA 2LYDA 4KAXB 4GMVA 1Y19B 5DI9B 1AWEA 2VRWB 2K2UA 4ZRKA 1V5MA 2YS3A 1DDVA 1OY2A 3VIAA 5C5BB 4EMOA 2P8VA 3GYPA 2YVCA 1DBHA 2H7DA 2Y8GA 4YONA 4HAYB 2VKIA 4TKNA 4K81A 4CHJA 3M1IB 1U5GA 1Q67A 1XR0B 3FEHA 4HB0B 4K17A 4EKUA 5HE2A 1MK7B 5C16A 1XD4A 1TQZA 2L2IA 5JLJB 1ZVRA 1WVHA 3HK0A 4KHOA 2D9YA 2YS1A 3TW1A 2CY4A 4ZRJA 1W1HA 2ELBA 1FHWA 3ODWA 2RVBB 2ADZA 1I7AA 4Z2MB 2CODA 4HDQA 4TYZA 2V76A 3D8EA 1WG7A 4HDOA 4L6EA 1MPHA 3SO6A 4F7GA 2EMTA 2D9ZA 1U27A 3WYFB 1U29A 4Z2NA 3CXBB 2YT0A 5KCVA 2CAYA 4MT7A 1MIZB 1Z87A 4CHMA 5JHHA 1XCGA 2DTCA 2YT1A 1P5TA 4HAWB 5KQ4A 2UZSA 2RLOA 3P6AA 2UZRA 1BTNA 1U5FA 1N3HA 2XQNM 5C6RA 1PFJA 3HW2B 1MAIA 1EVHA 1UPRA 3PP2A 4WJ7A 2GCLA 5FI1A 4GXBA 2D10A 2EMSA 4F7UP 3UZTA 1PLSA 2P0HA 5D3XA 2AL6A 1UNRA 3SYXA 3G9WA 3TCAA 3NSUA 2PZ1A 1SGHA 1GC7A 5C79A 3QBVB 1RJ2A 4WVFB 2P0DA 1BAKA 4EJNA 2J0MA 1DDMA 5EFXA 3KY9A 2COFA 1FGZA 1UEFA 3RCPA 3ODOA 3BINA 1XODA 1FGYA 1UPQA 5FI0A 2COAA 5CLLB 4CYEA 3V5WA 4A6HA 2BCJA 2X18A 2D9XA 4Y94A 4A6FA 1I2HA 1MIXA 3N7CA 2RNRB 2DHKA 1NI2A 1V61A 2LOXA 2COCA 1WI1A 1FOEA 2R09A 3QWMA 2W2WA 1J0WA 4BBKA 3QIJA 2I5CA 3TVVA 2J59M 2AEHA 2DLWA 2OQBA 3TO1A 3IVFA 1LW3A 1X1FA 1X1GA 1K5DB 5C5BA 1XKEA 1MK9B 1W1DA 4KVGB 3KSYA 3PEGA 2DX5A 1SHCA 2FJLA 2D4QA 5JP4A 4NSWA 3PG7A 2NZ8B 4WSFA 4DBBA 2D9WA 1V88A 5GOWB 4K2OA 1LB1A 3F0WA 2IFSA 1WGQA 2Z0PA 4HAXB 1B55A 2J0KA 4MY6A 2E2XA 2M14A 1TJ6A 2P0FA 3LJUX 1OQNA 1ZSQA 4K2PA 3D8DA 2DKPA 5D3VA 1P6SA 1XX0A 3MDBC 5L81A 2HTHB 1WGUA 2OTXA 3AU4A 1H10A 2K2JA 2I1JA 3AJ4A 3KRWA 4KHAA 1RRPB 2YS5A 2LG1A 1BTKA 2ROZB 2CY5A 4H8SA 4GPTB 4HATB 4ZRIA 2IYBA 2YSZA 3A98B 5DHAB 2KGXB 3ZVRA 3ULCA 5D3YA 3VOQA 2K00A 5HE3A 2QKMA 1QC6A 2GJYA 1X11A 2I5FA 3P7ZA 1GG3A 2DFKA 2DN6A 1EF1A 2ZPYA 4KHBB 2J0JA 1UNQA 1FB8A 4F7HA 1ZC3B 2D2QA 1NTVA 3A8PA 3F5RA 3T06A 1FHOA 2Z0OA 3HQCA 5LONB 3TFMA 2CRFA 1EAZA 2UVMA 3ODXA 1DDWA 5HE0A 3U7DA 2Z0QA 4MK0A 4DX8A 1EGXA 2D11A 4XWXA 2RUKB 4DXAB 2DA0A 3KRXA 3SNHA 2N23A 1M7RA 2JP2A 3PVLA 2Q13A 2DHIA 2KCJA 4A6FB 5KQ1A 2H7EA 1NTYA 5D3WA 3U8ZA 3O96A 1E5WA 1FAOA 1GC6A 2YF0A 5J3YA 2RGNB 2LKOA 1QQGA 3A8QA 3PVUA 2MFQA 1FHXA 1ZC4B 1K5GB 1NU2A 2MWNB 3D8FA 4GN1A 4IOYX 2MKRA 4C0AA 2DKQA 2EJ8A 5DIFB 1AQCA 2EC1A 4NY0A 1X05A 3ML4A 4PNKA 1U5DA 2N0YA 3FM8C 1KZ7A 3MPXA 4HAVB 1WJ1A 1TXDA 4GMXB 3WA0A 3SUZA 5HE1A 4IAPA 1KZGA 2DHJA 5JHGA 2W2XD 2RSGA 4YL8A 4D0NB 3DXEA 2Y8FA 2L1CA 1ISNA 5J3QA 3BJIA 1H4RA 4IFSA 3CIKA 1W1GA 1X86A 4DX90 3GYOA 1V5PA 3PZDA 2M38A 3DXCA 5D27A 2GCJA 4HHVA 3KZ1A 2ROVA 1V89A 3SV1A 2MDXA 1J19A 4P7IA 4HB4B 2Y7BA 1IRSA 3PVWA 1M7EA 4HAUB 3DXDA 5DHFB 5DH9B 1DROA 4B6HA 2DYNA 4HB2B 1U5EA 2G35A 1UNPA 4PQ0A 4HB3B 1PMSA 1Y5OA 1KI1B 1MKEA 4GZUA 2QKLA 4HAZB 1V5UA 2KUPA 2LOZA 3OANA 2VSZA 1DYNA 4A5KA 3X23A 3ZDTA 1ZM0A 5CLQB 2I1KA 1U2BA 2W2XC 2D9VA 5J3TA 2HE7A 3AU5A
chains in the Genus database with same CATH superfamily
2DYQA 2YRYA 2R0DA 2LULA 2ELAA 2NMBA 4KHBA 3ULBA 1WJMA 1P3RA 3A58A 1BWNA 2GS0A 3U12A 1OMWA 3PSCA 3FSSA 2DX1A 5LOPB 1MI1A 4A6KA 2LYDA 4KAXB 4GMVA 1Y19B 5DI9B 1AWEA 4QJ4B 2VRWB 2K2UA 4ZRKA 1V5MA 2YS3A 1DDVA 1OY2A 3VIAA 5C5BB 4EMOA 2P8VA 3GYPA 2YVCA 1DBHA 3NWDA 2H7DA 2Y8GA 4YONA 4HAYB 2VKIA 4TKNA 4K81A 4CHJA 3M1IB 1U5GA 1Q67A 1XR0B 3FEHA 4HB0B 4K17A 4EKUA 5HE2A 1MK7B 5C16A 1T77A 1XD4A 1TQZA 2L2IA 5JLJB 1ZVRA 1WVHA 3HK0A 4KHOA 2D9YA 2YS1A 3TW1A 2CY4A 2RRFA 4ZRJA 3NWFA 1W1HA 2ELBA 1FHWA 3ODWA 2RVBB 2ADZA 1I7AA 4CSQA 4OSNA 4Z2MB 2CODA 4HDQA 4TYZA 3HIEA 2V76A 3D8EA 1WG7A 4HDOA 4L6EA 1MPHA 3SO6A 4F7GA 2EMTA 2D9ZA 1U27A 3WYFB 1U29A 4Z2NA 3CXBB 2YT0A 2Z4DA 5KCVA 2CAYA 4MT7A 4L1RA 1MIZB 1Z87A 5I2SA 4CHMA 5JHHA 1XCGA 2DTCA 2YT1A 1P5TA 4HAWB 5KQ4A 2UZSA 2RLOA 3P6AA 2UZRA 2Z14A 1BTNA 5I2MA 1U5FA 1N3HA 2XQNM 5C6RA 1PFJA 3HW2B 1ZYIA 1MAIA 1EVHA 4GNKB 1UPRA 3PP2A 4WJ7A 5LG4B 2GCLA 5FI1A 4GXBA 2D10A 2KIEA 2EMSA 4F7UP 3UZTA 1PLSA 2P0HA 5D3XA 2AL6A 1UNRA 3SYXA 2KUQA 3G9WA 3TCAA 3NSUA 2PZ1A 1SGHA 1GC7A 5C79A 3QBVB 1RJ2A 4WVFB 2P0DA 1BAKA 4EJNA 2J0MA 1DDMA 5EFXA 3KY9A 2COFA 1FGZA 1UEFA 3RCPA 3ODOA 3BINA 1XODA 3OHMB 1FGYA 1UPQA 5FI0A 2COAA 5CLLB 4CYEA 3V5WA 4A6HA 2BCJA 2X18A 2D9XA 4QJ3B 4Y94A 4A6FA 1I2HA 1MIXA 3N7CA 2KIGA 2RNRB 2DHKA 1NI2A 1V61A 2LOXA 2R2YA 2COCA 3HSAA 1WI1A 1FOEA 2GUMA 2R09A 3QWMA 2W2WA 2KR0A 1J0WA 4BBKA 3QIJA 2I5CA 4OT1A 3TVVA 2J59M 2AEHA 2DLWA 2OQBA 3TO1A 3IVFA 1LW3A 1X1FA 1X1GA 1K5DB 5C5BA 1XKEA 1MK9B 1W1DA 4DIXA 4KVGB 3KSYA 3PEGA 2DX5A 1SHCA 2FJLA 2D4QA 5JP4A 4NSWA 3PG7A 2NZ8B 4WSFA 4DBBA 2D9WA 1V88A 5GOWB 4K2OA 1LB1A 3F0WA 2IFSA 3DCXA 1WGQA 2Z0PA 2ZKMX 4HAXB 1B55A 2J0KA 4MY6A 2E2XA 2M14A 1TJ6A 2P0FA 3LJUX 1OQNA 1ZSQA 4K2PA 3D8DA 2DKPA 5D3VA 1P6SA 1XX0A 3MDBC 5L81A 2HTHB 1WGUA 2OTXA 3AU4A 5M4YB 1H10A 2K2JA 2I1JA 3AJ4A 3KRWA 4KHAA 1RRPB 2YS5A 2LG1A 1BTKA 2ROZB 3FVCA 2CY5A 4H8SA 4GPTB 4HATB 4ZRIA 2IYBA 2YSZA 3A98B 5DHAB 2KGXB 3ZVRA 3ULCA 5D3YA 3VOQA 2K00A 5HE3A 2YT2A 2QKMA 1QC6A 2GJYA 1X11A 2I5FA 3P7ZA 1GG3A 2DFKA 2DN6A 4D6WA 1EF1A 2ZPYA 4KHBB 4GOUA 2J0JA 1UNQA 1FB8A 4F7HA 3NWAA 1ZC3B 2K49A 2D2QA 1NTVA 3A8PA 3F5RA 3T06A 1FHOA 2Z0OA 3HQCA 5LONB 3TFMA 2CRFA 1EAZA 2UVMA 3ODXA 1DDWA 5HE0A 3U7DA 2Z0QA 4MK0A 4DX8A 4QXAB 1EGXA 2D11A 4XWXA 2RUKB 4DXAB 2DA0A 3KRXA 3SNHA 2N23A 1M7RA 2JP2A 3PVLA 3NW8A 2Q13A 2DHIA 2KCJA 4A6FB 5KQ1A 2H7EA 1NTYA 5D3WA 3U8ZA 3O96A 1E5WA 1FAOA 1GC6A 2YF0A 5J3YA 2RGNB 2LKOA 1QQGA 3A8QA 3PVUA 2MFQA 1FHXA 1ZC4B 2Z59A 4HSIA 1K5GB 1NU2A 2MWNB 3D8FA 4GN1A 4IOYX 2MKRA 4C0AA 2DKQA 2EJ8A 5DIFB 1AQCA 2EC1A 4NY0A 1X05A 3ML4A 4PNKA 1U5DA 2N0YA 3FM8C 1KZ7A 3MPXA 4HAVB 1WJ1A 1TXDA 4GMXB 3WA0A 3SUZA 5HE1A 4IAPA 1KZGA 2DHJA 5JHGA 2W2XD 2RSGA 4YL8A 4D0NB 3DXEA 2Y8FA 2L1CA 2FJUB 1ISNA 5J3QA 3BJIA 2Z13A 1H4RA 4IFSA 3CIKA 1W1GA 1X86A 4DX90 3GYOA 1V5PA 3PZDA 2M38A 3DXCA 5D27A 2GCJA 4HHVA 3KZ1A 5IRSA 2ROVA 1V89A 3SV1A 2MDXA 1J19A 4P7IA 4HB4B 3B77A 2Y7BA 1IRSA 3PVWA 1M7EA 4QJ5B 4HAUB 3DXDA 5DHFB 5DH9B 1DROA 4B6HA 2DYNA 4HB2B 1U5EA 2G35A 1UNPA 4PQ0A 4HB3B 1PMSA 1Y5OA 1KI1B 1MKEA 4GZUA 2QKLA 4HAZB 1V5UA 2KUPA 2LOZA 3OANA 2VSZA 1DYNA 4A5KA 3X23A 3ZDTA 1ZM0A 5CLQB 2I1KA 1U2BA 2NBVA 2W2XC 2D9VA 2K8EA 5J3TA 2HE7A 3AU5A
chains in the Genus database with same CATH topology
2DYQA 2YRYA 2R0DA 2LULA 2ELAA 2NMBA 3ULBA 1WJMA 1P3RA 1BWNA 2GS0A 1OMWA 3PSCA 3FSSA 2DX1A 5LOPB 4A6KA 2LYDA 4KAXB 4GMVA 1Y19B 5DI9B 1AWEA 2VRWB 2K2UA 4ZRKA 1V5MA 2YS3A 1DDVA 1OY2A 3VIAA 5C5BB 4EMOA 2P8VA 3GYPA 2YVCA 1DBHA 2H7DA 2Y8GA 4YONA 4HAYB 2VKIA 4TKNA 4K81A 4CHJA 3M1IB 1U5GA 1Q67A 1XR0B 3FEHA 4HB0B 4K17A 4EKUA 5HE2A 1MK7B 5C16A 1XD4A 1TQZA 2L2IA 5JLJB 1ZVRA 1WVHA 3HK0A 4KHOA 2D9YA 2YS1A 3TW1A 2CY4A 4ZRJA 1W1HA 2ELBA 1FHWA 3ODWA 2RVBB 2ADZA 1I7AA 4Z2MB 2CODA 4HDQA 4TYZA 2V76A 3D8EA 1WG7A 4HDOA 4L6EA 1MPHA 3SO6A 4F7GA 2EMTA 2D9ZA 1U27A 3WYFB 1U29A 4Z2NA 3CXBB 2YT0A 5KCVA 2CAYA 4MT7A 1MIZB 1Z87A 4CHMA 5JHHA 1XCGA 2DTCA 2YT1A 1P5TA 4HAWB 5KQ4A 2UZSA 2RLOA 3P6AA 2UZRA 1BTNA 1U5FA 1N3HA 2XQNM 5C6RA 1PFJA 3HW2B 1MAIA 1EVHA 1UPRA 3PP2A 4WJ7A 2GCLA 5FI1A 4GXBA 2D10A 2EMSA 4F7UP 3UZTA 1PLSA 2P0HA 5D3XA 2AL6A 1UNRA 3SYXA 3G9WA 3TCAA 3NSUA 2PZ1A 1SGHA 1GC7A 5C79A 3QBVB 1RJ2A 4WVFB 2P0DA 1BAKA 4EJNA 2J0MA 1DDMA 5EFXA 3KY9A 2COFA 1FGZA 1UEFA 3RCPA 3ODOA 3BINA 1XODA 1FGYA 1UPQA 5FI0A 2COAA 5CLLB 4CYEA 3V5WA 4A6HA 2BCJA 2X18A 2D9XA 4Y94A 4A6FA 1I2HA 1MIXA 3N7CA 2RNRB 2DHKA 1NI2A 1V61A 2LOXA 2COCA 1WI1A 1FOEA 2R09A 3QWMA 2W2WA 1J0WA 4BBKA 3QIJA 2I5CA 3TVVA 2J59M 2AEHA 2DLWA 2OQBA 3TO1A 3IVFA 1LW3A 1X1FA 1X1GA 1K5DB 5C5BA 1XKEA 1MK9B 1W1DA 4KVGB 3KSYA 3PEGA 2DX5A 1SHCA 2FJLA 2D4QA 5JP4A 4NSWA 3PG7A 2NZ8B 4WSFA 4DBBA 2D9WA 1V88A 5GOWB 4K2OA 1LB1A 3F0WA 2IFSA 1WGQA 2Z0PA 4HAXB 1B55A 2J0KA 4MY6A 2E2XA 2M14A 1TJ6A 2P0FA 3LJUX 1OQNA 1ZSQA 4K2PA 3D8DA 2DKPA 5D3VA 1P6SA 1XX0A 3MDBC 5L81A 2HTHB 1WGUA 2OTXA 3AU4A 1H10A 2K2JA 2I1JA 3AJ4A 3KRWA 4KHAA 1RRPB 2YS5A 2LG1A 1BTKA 2ROZB 2CY5A 4H8SA 4GPTB 4HATB 4ZRIA 2IYBA 2YSZA 3A98B 5DHAB 2KGXB 3ZVRA 3ULCA 5D3YA 3VOQA 2K00A 5HE3A 2QKMA 1QC6A 2GJYA 1X11A 2I5FA 3P7ZA 1GG3A 2DFKA 2DN6A 1EF1A 2ZPYA 4KHBB 2J0JA 1UNQA 1FB8A 4F7HA 1ZC3B 2D2QA 1NTVA 3A8PA 3F5RA 3T06A 1FHOA 2Z0OA 3HQCA 5LONB 3TFMA 2CRFA 1EAZA 2UVMA 3ODXA 1DDWA 5HE0A 3U7DA 2Z0QA 4MK0A 4DX8A 1EGXA 2D11A 4XWXA 2RUKB 4DXAB 2DA0A 3KRXA 3SNHA 2N23A 1M7RA 2JP2A 3PVLA 2Q13A 2DHIA 2KCJA 4A6FB 5KQ1A 2H7EA 1NTYA 5D3WA 3U8ZA 3O96A 1E5WA 1FAOA 1GC6A 2YF0A 5J3YA 2RGNB 2LKOA 1QQGA 3A8QA 3PVUA 2MFQA 1FHXA 1ZC4B 1K5GB 1NU2A 2MWNB 3D8FA 4GN1A 4IOYX 2MKRA 4C0AA 2DKQA 2EJ8A 5DIFB 1AQCA 2EC1A 4NY0A 1X05A 3ML4A 4PNKA 1U5DA 2N0YA 3FM8C 1KZ7A 3MPXA 4HAVB 1WJ1A 1TXDA 4GMXB 3WA0A 3SUZA 5HE1A 4IAPA 1KZGA 2DHJA 5JHGA 2W2XD 2RSGA 4YL8A 4D0NB 3DXEA 2Y8FA 2L1CA 1ISNA 5J3QA 3BJIA 1H4RA 4IFSA 3CIKA 1W1GA 1X86A 4DX90 3GYOA 1V5PA 3PZDA 2M38A 3DXCA 5D27A 2GCJA 4HHVA 3KZ1A 2ROVA 1V89A 3SV1A 2MDXA 1J19A 4P7IA 4HB4B 2Y7BA 1IRSA 3PVWA 1M7EA 4HAUB 3DXDA 5DHFB 5DH9B 1DROA 4B6HA 2DYNA 4HB2B 1U5EA 2G35A 1UNPA 4PQ0A 4HB3B 1PMSA 1Y5OA 1KI1B 1MKEA 4GZUA 2QKLA 4HAZB 1V5UA 2KUPA 2LOZA 3OANA 2VSZA 1DYNA 4A5KA 3X23A 3ZDTA 1ZM0A 5CLQB 2I1KA 1U2BA 2W2XC 2D9VA 5J3TA 2HE7A 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYQ A;  2YRY A;  2R0D A;  2LUL A;  2ELA A;  2NMB A;  3ULB A;  1WJM A;  1P3R A;  1BWN A;  2GS0 A;  1OMW A;  3PSC A;  3FSS A;  2DX1 A;  5LOP B;  4A6K A;  2LYD A;  4KAX B;  4GMV A;  1Y19 B;  5DI9 B;  1AWE A;  2VRW B;  2K2U A;  4ZRK A;  1V5M A;  2YS3 A;  1DDV A;  1OY2 A;  3VIA A;  5C5B B;  4EMO A;  2P8V A;  3GYP A;  2YVC A;  1DBH A;  2H7D A;  2Y8G A;  4YON A;  4HAY B;  2VKI A;  4TKN A;  4K81 A;  4CHJ A;  3M1I B;  1U5G A;  1Q67 A;  1XR0 B;  3FEH A;  4HB0 B;  4K17 A;  4EKU A;  5HE2 A;  1MK7 B;  5C16 A;  1XD4 A;  1TQZ A;  2L2I A;  5JLJ B;  1ZVR A;  1WVH A;  3HK0 A;  4KHO A;  2D9Y A;  2YS1 A;  3TW1 A;  2CY4 A;  4ZRJ A;  1W1H A;  2ELB A;  1FHW A;  3ODW A;  2RVB B;  2ADZ A;  1I7A A;  4Z2M B;  2COD A;  4HDQ A;  4TYZ A;  2V76 A;  3D8E A;  1WG7 A;  4HDO A;  4L6E A;  1MPH A;  3SO6 A;  4F7G A;  2EMT A;  2D9Z A;  1U27 A;  3WYF B;  1U29 A;  4Z2N A;  3CXB B;  2YT0 A;  5KCV A;  2CAY A;  4MT7 A;  1MIZ B;  1Z87 A;  4CHM A;  5JHH A;  1XCG A;  2DTC A;  2YT1 A;  1P5T A;  4HAW B;  5KQ4 A;  2UZS A;  2RLO A;  3P6A A;  2UZR A;  1BTN A;  1U5F A;  1N3H A;  2XQN M;  5C6R A;  1PFJ A;  3HW2 B;  1MAI A;  1EVH A;  1UPR A;  3PP2 A;  4WJ7 A;  2GCL A;  5FI1 A;  4GXB A;  2D10 A;  2EMS A;  4F7U P;  3UZT A;  1PLS A;  2P0H A;  5D3X A;  2AL6 A;  1UNR A;  3SYX A;  3G9W A;  3TCA A;  3NSU A;  2PZ1 A;  1SGH A;  1GC7 A;  5C79 A;  3QBV B;  1RJ2 A;  4WVF B;  2P0D A;  1BAK A;  4EJN A;  2J0M A;  1DDM A;  5EFX A;  3KY9 A;  2COF A;  1FGZ A;  1UEF A;  3RCP A;  3ODO A;  3BIN A;  1XOD A;  1FGY A;  1UPQ A;  5FI0 A;  2COA A;  5CLL B;  4CYE A;  3V5W A;  4A6H A;  2BCJ A;  2X18 A;  2D9X A;  4Y94 A;  4A6F A;  1I2H A;  1MIX A;  3N7C A;  2RNR B;  2DHK A;  1NI2 A;  1V61 A;  2LOX A;  2COC A;  1WI1 A;  1FOE A;  2R09 A;  3QWM A;  2W2W A;  1J0W A;  4BBK A;  3QIJ A;  2I5C A;  3TVV A;  2J59 M;  2AEH A;  2DLW A;  2OQB A;  3TO1 A;  3IVF A;  1LW3 A;  1X1F A;  1X1G A;  1K5D B;  5C5B A;  1XKE A;  1MK9 B;  1W1D A;  4KVG B;  3KSY A;  3PEG A;  2DX5 A;  1SHC A;  2FJL A;  2D4Q A;  5JP4 A;  4NSW A;  3PG7 A;  2NZ8 B;  4WSF A;  4DBB A;  2D9W A;  1V88 A;  5GOW B;  4K2O A;  1LB1 A;  3F0W A;  2IFS A;  1WGQ A;  2Z0P A;  4HAX B;  1B55 A;  2J0K A;  4MY6 A;  2E2X A;  2M14 A;  1TJ6 A;  2P0F A;  3LJU X;  1OQN A;  1ZSQ A;  4K2P A;  3D8D A;  2DKP A;  5D3V A;  1P6S A;  1XX0 A;  3MDB C;  5L81 A;  2HTH B;  1WGU A;  2OTX A;  3AU4 A;  1H10 A;  2K2J A;  2I1J A;  3AJ4 A;  3KRW A;  4KHA A;  1RRP B;  2YS5 A;  2LG1 A;  1BTK A;  2ROZ B;  2CY5 A;  4H8S A;  4GPT B;  4HAT B;  4ZRI A;  2IYB A;  2YSZ A;  3A98 B;  5DHA B;  2KGX B;  3ZVR A;  3ULC A;  5D3Y A;  3VOQ A;  2K00 A;  5HE3 A;  2QKM A;  1QC6 A;  2GJY A;  1X11 A;  2I5F A;  3P7Z A;  1GG3 A;  2DFK A;  2DN6 A;  1EF1 A;  2ZPY A;  4KHB B;  2J0J A;  1UNQ A;  1FB8 A;  4F7H A;  1ZC3 B;  2D2Q A;  1NTV A;  3A8P A;  3F5R A;  3T06 A;  1FHO A;  2Z0O A;  3HQC A;  5LON B;  3TFM A;  2CRF A;  1EAZ A;  2UVM A;  3ODX A;  1DDW A;  5HE0 A;  3U7D A;  2Z0Q A;  4MK0 A;  4DX8 A;  1EGX A;  2D11 A;  4XWX A;  2RUK B;  4DXA B;  2DA0 A;  3KRX A;  3SNH A;  2N23 A;  1M7R A;  2JP2 A;  3PVL A;  2Q13 A;  2DHI A;  2KCJ A;  4A6F B;  5KQ1 A;  2H7E A;  1NTY A;  5D3W A;  3U8Z A;  3O96 A;  1E5W A;  1FAO A;  1GC6 A;  2YF0 A;  5J3Y A;  2RGN B;  2LKO A;  1QQG A;  3A8Q A;  3PVU A;  2MFQ A;  1FHX A;  1ZC4 B;  1K5G B;  1NU2 A;  2MWN B;  3D8F A;  4GN1 A;  4IOY X;  2MKR A;  4C0A A;  2DKQ A;  2EJ8 A;  5DIF B;  1AQC A;  2EC1 A;  4NY0 A;  1X05 A;  3ML4 A;  4PNK A;  1U5D A;  2N0Y A;  3FM8 C;  1KZ7 A;  3MPX A;  4HAV B;  1WJ1 A;  1TXD A;  4GMX B;  3WA0 A;  3SUZ A;  5HE1 A;  4IAP A;  1KZG A;  2DHJ A;  5JHG A;  2W2X D;  2RSG A;  4YL8 A;  4D0N B;  3DXE A;  2Y8F A;  2L1C A;  1ISN A;  5J3Q A;  3BJI A;  1H4R A;  4IFS A;  3CIK A;  1W1G A;  1X86 A;  4DX9 0;  3GYO A;  1V5P A;  3PZD A;  2M38 A;  3DXC A;  5D27 A;  2GCJ A;  4HHV A;  3KZ1 A;  2ROV A;  1V89 A;  3SV1 A;  2MDX A;  1J19 A;  4P7I A;  4HB4 B;  2Y7B A;  1IRS A;  3PVW A;  1M7E A;  4HAU B;  3DXD A;  5DHF B;  5DH9 B;  1DRO A;  4B6H A;  2DYN A;  4HB2 B;  1U5E A;  2G35 A;  1UNP A;  4PQ0 A;  4HB3 B;  1PMS A;  1Y5O A;  1KI1 B;  1MKE A;  4GZU A;  2QKL A;  4HAZ B;  1V5U A;  2KUP A;  2LOZ A;  3OAN A;  2VSZ A;  1DYN A;  4A5K A;  3X23 A;  3ZDT A;  1ZM0 A;  5CLQ B;  2I1K A;  1U2B A;  2W2X C;  2D9V A;  5J3T A;  2HE7 A;  3AU5 A; 
#chains in the Genus database with same CATH topology
 2DYQ A;  2YRY A;  2R0D A;  2LUL A;  2ELA A;  2NMB A;  4KHB A;  3ULB A;  1WJM A;  1P3R A;  3A58 A;  1BWN A;  2GS0 A;  3U12 A;  1OMW A;  3PSC A;  3FSS A;  2DX1 A;  5LOP B;  1MI1 A;  4A6K A;  2LYD A;  4KAX B;  4GMV A;  1Y19 B;  5DI9 B;  1AWE A;  4QJ4 B;  2VRW B;  2K2U A;  4ZRK A;  1V5M A;  2YS3 A;  1DDV A;  1OY2 A;  3VIA A;  5C5B B;  4EMO A;  2P8V A;  3GYP A;  2YVC A;  1DBH A;  3NWD A;  2H7D A;  2Y8G A;  4YON A;  4HAY B;  2VKI A;  4TKN A;  4K81 A;  4CHJ A;  3M1I B;  1U5G A;  1Q67 A;  1XR0 B;  3FEH A;  4HB0 B;  4K17 A;  4EKU A;  5HE2 A;  1MK7 B;  5C16 A;  1T77 A;  1XD4 A;  1TQZ A;  2L2I A;  5JLJ B;  1ZVR A;  1WVH A;  3HK0 A;  4KHO A;  2D9Y A;  2YS1 A;  3TW1 A;  2CY4 A;  2RRF A;  4ZRJ A;  3NWF A;  1W1H A;  2ELB A;  1FHW A;  3ODW A;  2RVB B;  2ADZ A;  1I7A A;  4CSQ A;  4OSN A;  4Z2M B;  2COD A;  4HDQ A;  4TYZ A;  3HIE A;  2V76 A;  3D8E A;  1WG7 A;  4HDO A;  4L6E A;  1MPH A;  3SO6 A;  4F7G A;  2EMT A;  2D9Z A;  1U27 A;  3WYF B;  1U29 A;  4Z2N A;  3CXB B;  2YT0 A;  2Z4D A;  5KCV A;  2CAY A;  4MT7 A;  4L1R A;  1MIZ B;  1Z87 A;  5I2S A;  4CHM A;  5JHH A;  1XCG A;  2DTC A;  2YT1 A;  1P5T A;  4HAW B;  5KQ4 A;  2UZS A;  2RLO A;  3P6A A;  2UZR A;  2Z14 A;  1BTN A;  5I2M A;  1U5F A;  1N3H A;  2XQN M;  5C6R A;  1PFJ A;  3HW2 B;  1ZYI A;  1MAI A;  1EVH A;  4GNK B;  1UPR A;  3PP2 A;  4WJ7 A;  5LG4 B;  2GCL A;  5FI1 A;  4GXB A;  2D10 A;  2KIE A;  2EMS A;  4F7U P;  3UZT A;  1PLS A;  2P0H A;  5D3X A;  2AL6 A;  1UNR A;  3SYX A;  2KUQ A;  3G9W A;  3TCA A;  3NSU A;  2PZ1 A;  1SGH A;  1GC7 A;  5C79 A;  3QBV B;  1RJ2 A;  4WVF B;  2P0D A;  1BAK A;  4EJN A;  2J0M A;  1DDM A;  5EFX A;  3KY9 A;  2COF A;  1FGZ A;  1UEF A;  3RCP A;  3ODO A;  3BIN A;  1XOD A;  3OHM B;  1FGY A;  1UPQ A;  5FI0 A;  2COA A;  5CLL B;  4CYE A;  3V5W A;  4A6H A;  2BCJ A;  2X18 A;  2D9X A;  4QJ3 B;  4Y94 A;  4A6F A;  1I2H A;  1MIX A;  3N7C A;  2KIG A;  2RNR B;  2DHK A;  1NI2 A;  1V61 A;  2LOX A;  2R2Y A;  2COC A;  3HSA A;  1WI1 A;  1FOE A;  2GUM A;  2R09 A;  3QWM A;  2W2W A;  2KR0 A;  1J0W A;  4BBK A;  3QIJ A;  2I5C A;  4OT1 A;  3TVV A;  2J59 M;  2AEH A;  2DLW A;  2OQB A;  3TO1 A;  3IVF A;  1LW3 A;  1X1F A;  1X1G A;  1K5D B;  5C5B A;  1XKE A;  1MK9 B;  1W1D A;  4DIX A;  4KVG B;  3KSY A;  3PEG A;  2DX5 A;  1SHC A;  2FJL A;  2D4Q A;  5JP4 A;  4NSW A;  3PG7 A;  2NZ8 B;  4WSF A;  4DBB A;  2D9W A;  1V88 A;  5GOW B;  4K2O A;  1LB1 A;  3F0W A;  2IFS A;  3DCX A;  1WGQ A;  2Z0P A;  2ZKM X;  4HAX B;  1B55 A;  2J0K A;  4MY6 A;  2E2X A;  2M14 A;  1TJ6 A;  2P0F A;  3LJU X;  1OQN A;  1ZSQ A;  4K2P A;  3D8D A;  2DKP A;  5D3V A;  1P6S A;  1XX0 A;  3MDB C;  5L81 A;  2HTH B;  1WGU A;  2OTX A;  3AU4 A;  5M4Y B;  1H10 A;  2K2J A;  2I1J A;  3AJ4 A;  3KRW A;  4KHA A;  1RRP B;  2YS5 A;  2LG1 A;  1BTK A;  2ROZ B;  3FVC A;  2CY5 A;  4H8S A;  4GPT B;  4HAT B;  4ZRI A;  2IYB A;  2YSZ A;  3A98 B;  5DHA B;  2KGX B;  3ZVR A;  3ULC A;  5D3Y A;  3VOQ A;  2K00 A;  5HE3 A;  2YT2 A;  2QKM A;  1QC6 A;  2GJY A;  1X11 A;  2I5F A;  3P7Z A;  1GG3 A;  2DFK A;  2DN6 A;  4D6W A;  1EF1 A;  2ZPY A;  4KHB B;  4GOU A;  2J0J A;  1UNQ A;  1FB8 A;  4F7H A;  3NWA A;  1ZC3 B;  2K49 A;  2D2Q A;  1NTV A;  3A8P A;  3F5R A;  3T06 A;  1FHO A;  2Z0O A;  3HQC A;  5LON B;  3TFM A;  2CRF A;  1EAZ A;  2UVM A;  3ODX A;  1DDW A;  5HE0 A;  3U7D A;  2Z0Q A;  4MK0 A;  4DX8 A;  4QXA B;  1EGX A;  2D11 A;  4XWX A;  2RUK B;  4DXA B;  2DA0 A;  3KRX A;  3SNH A;  2N23 A;  1M7R A;  2JP2 A;  3PVL A;  3NW8 A;  2Q13 A;  2DHI A;  2KCJ A;  4A6F B;  5KQ1 A;  2H7E A;  1NTY A;  5D3W A;  3U8Z A;  3O96 A;  1E5W A;  1FAO A;  1GC6 A;  2YF0 A;  5J3Y A;  2RGN B;  2LKO A;  1QQG A;  3A8Q A;  3PVU A;  2MFQ A;  1FHX A;  1ZC4 B;  2Z59 A;  4HSI A;  1K5G B;  1NU2 A;  2MWN B;  3D8F A;  4GN1 A;  4IOY X;  2MKR A;  4C0A A;  2DKQ A;  2EJ8 A;  5DIF B;  1AQC A;  2EC1 A;  4NY0 A;  1X05 A;  3ML4 A;  4PNK A;  1U5D A;  2N0Y A;  3FM8 C;  1KZ7 A;  3MPX A;  4HAV B;  1WJ1 A;  1TXD A;  4GMX B;  3WA0 A;  3SUZ A;  5HE1 A;  4IAP A;  1KZG A;  2DHJ A;  5JHG A;  2W2X D;  2RSG A;  4YL8 A;  4D0N B;  3DXE A;  2Y8F A;  2L1C A;  2FJU B;  1ISN A;  5J3Q A;  3BJI A;  2Z13 A;  1H4R A;  4IFS A;  3CIK A;  1W1G A;  1X86 A;  4DX9 0;  3GYO A;  1V5P A;  3PZD A;  2M38 A;  3DXC A;  5D27 A;  2GCJ A;  4HHV A;  3KZ1 A;  5IRS A;  2ROV A;  1V89 A;  3SV1 A;  2MDX A;  1J19 A;  4P7I A;  4HB4 B;  3B77 A;  2Y7B A;  1IRS A;  3PVW A;  1M7E A;  4QJ5 B;  4HAU B;  3DXD A;  5DHF B;  5DH9 B;  1DRO A;  4B6H A;  2DYN A;  4HB2 B;  1U5E A;  2G35 A;  1UNP A;  4PQ0 A;  4HB3 B;  1PMS A;  1Y5O A;  1KI1 B;  1MKE A;  4GZU A;  2QKL A;  4HAZ B;  1V5U A;  2KUP A;  2LOZ A;  3OAN A;  2VSZ A;  1DYN A;  4A5K A;  3X23 A;  3ZDT A;  1ZM0 A;  5CLQ B;  2I1K A;  1U2B A;  2NBV A;  2W2X C;  2D9V A;  2K8E A;  5J3T A;  2HE7 A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 2DYQ A;  2YRY A;  2R0D A;  2LUL A;  2ELA A;  2NMB A;  3ULB A;  1WJM A;  1P3R A;  1BWN A;  2GS0 A;  1OMW A;  3PSC A;  3FSS A;  2DX1 A;  5LOP B;  4A6K A;  2LYD A;  4KAX B;  4GMV A;  1Y19 B;  5DI9 B;  1AWE A;  2VRW B;  2K2U A;  4ZRK A;  1V5M A;  2YS3 A;  1DDV A;  1OY2 A;  3VIA A;  5C5B B;  4EMO A;  2P8V A;  3GYP A;  2YVC A;  1DBH A;  2H7D A;  2Y8G A;  4YON A;  4HAY B;  2VKI A;  4TKN A;  4K81 A;  4CHJ A;  3M1I B;  1U5G A;  1Q67 A;  1XR0 B;  3FEH A;  4HB0 B;  4K17 A;  4EKU A;  5HE2 A;  1MK7 B;  5C16 A;  1XD4 A;  1TQZ A;  2L2I A;  5JLJ B;  1ZVR A;  1WVH A;  3HK0 A;  4KHO A;  2D9Y A;  2YS1 A;  3TW1 A;  2CY4 A;  4ZRJ A;  1W1H A;  2ELB A;  1FHW A;  3ODW A;  2RVB B;  2ADZ A;  1I7A A;  4Z2M B;  2COD A;  4HDQ A;  4TYZ A;  2V76 A;  3D8E A;  1WG7 A;  4HDO A;  4L6E A;  1MPH A;  3SO6 A;  4F7G A;  2EMT A;  2D9Z A;  1U27 A;  3WYF B;  1U29 A;  4Z2N A;  3CXB B;  2YT0 A;  5KCV A;  2CAY A;  4MT7 A;  1MIZ B;  1Z87 A;  4CHM A;  5JHH A;  1XCG A;  2DTC A;  2YT1 A;  1P5T A;  4HAW B;  5KQ4 A;  2UZS A;  2RLO A;  3P6A A;  2UZR A;  1BTN A;  1U5F A;  1N3H A;  2XQN M;  5C6R A;  1PFJ A;  3HW2 B;  1MAI A;  1EVH A;  1UPR A;  3PP2 A;  4WJ7 A;  2GCL A;  5FI1 A;  4GXB A;  2D10 A;  2EMS A;  4F7U P;  3UZT A;  1PLS A;  2P0H A;  5D3X A;  2AL6 A;  1UNR A;  3SYX A;  3G9W A;  3TCA A;  3NSU A;  2PZ1 A;  1SGH A;  1GC7 A;  5C79 A;  3QBV B;  1RJ2 A;  4WVF B;  2P0D A;  1BAK A;  4EJN A;  2J0M A;  1DDM A;  5EFX A;  3KY9 A;  2COF A;  1FGZ A;  1UEF A;  3RCP A;  3ODO A;  3BIN A;  1XOD A;  1FGY A;  1UPQ A;  5FI0 A;  2COA A;  5CLL B;  4CYE A;  3V5W A;  4A6H A;  2BCJ A;  2X18 A;  2D9X A;  4Y94 A;  4A6F A;  1I2H A;  1MIX A;  3N7C A;  2RNR B;  2DHK A;  1NI2 A;  1V61 A;  2LOX A;  2COC A;  1WI1 A;  1FOE A;  2R09 A;  3QWM A;  2W2W A;  1J0W A;  4BBK A;  3QIJ A;  2I5C A;  3TVV A;  2J59 M;  2AEH A;  2DLW A;  2OQB A;  3TO1 A;  3IVF A;  1LW3 A;  1X1F A;  1X1G A;  1K5D B;  5C5B A;  1XKE A;  1MK9 B;  1W1D A;  4KVG B;  3KSY A;  3PEG A;  2DX5 A;  1SHC A;  2FJL A;  2D4Q A;  5JP4 A;  4NSW A;  3PG7 A;  2NZ8 B;  4WSF A;  4DBB A;  2D9W A;  1V88 A;  5GOW B;  4K2O A;  1LB1 A;  3F0W A;  2IFS A;  1WGQ A;  2Z0P A;  4HAX B;  1B55 A;  2J0K A;  4MY6 A;  2E2X A;  2M14 A;  1TJ6 A;  2P0F A;  3LJU X;  1OQN A;  1ZSQ A;  4K2P A;  3D8D A;  2DKP A;  5D3V A;  1P6S A;  1XX0 A;  3MDB C;  5L81 A;  2HTH B;  1WGU A;  2OTX A;  3AU4 A;  1H10 A;  2K2J A;  2I1J A;  3AJ4 A;  3KRW A;  4KHA A;  1RRP B;  2YS5 A;  2LG1 A;  1BTK A;  2ROZ B;  2CY5 A;  4H8S A;  4GPT B;  4HAT B;  4ZRI A;  2IYB A;  2YSZ A;  3A98 B;  5DHA B;  2KGX B;  3ZVR A;  3ULC A;  5D3Y A;  3VOQ A;  2K00 A;  5HE3 A;  2QKM A;  1QC6 A;  2GJY A;  1X11 A;  2I5F A;  3P7Z A;  1GG3 A;  2DFK A;  2DN6 A;  1EF1 A;  2ZPY A;  4KHB B;  2J0J A;  1UNQ A;  1FB8 A;  4F7H A;  1ZC3 B;  2D2Q A;  1NTV A;  3A8P A;  3F5R A;  3T06 A;  1FHO A;  2Z0O A;  3HQC A;  5LON B;  3TFM A;  2CRF A;  1EAZ A;  2UVM A;  3ODX A;  1DDW A;  5HE0 A;  3U7D A;  2Z0Q A;  4MK0 A;  4DX8 A;  1EGX A;  2D11 A;  4XWX A;  2RUK B;  4DXA B;  2DA0 A;  3KRX A;  3SNH A;  2N23 A;  1M7R A;  2JP2 A;  3PVL A;  2Q13 A;  2DHI A;  2KCJ A;  4A6F B;  5KQ1 A;  2H7E A;  1NTY A;  5D3W A;  3U8Z A;  3O96 A;  1E5W A;  1FAO A;  1GC6 A;  2YF0 A;  5J3Y A;  2RGN B;  2LKO A;  1QQG A;  3A8Q A;  3PVU A;  2MFQ A;  1FHX A;  1ZC4 B;  1K5G B;  1NU2 A;  2MWN B;  3D8F A;  4GN1 A;  4IOY X;  2MKR A;  4C0A A;  2DKQ A;  2EJ8 A;  5DIF B;  1AQC A;  2EC1 A;  4NY0 A;  1X05 A;  3ML4 A;  4PNK A;  1U5D A;  2N0Y A;  3FM8 C;  1KZ7 A;  3MPX A;  4HAV B;  1WJ1 A;  1TXD A;  4GMX B;  3WA0 A;  3SUZ A;  5HE1 A;  4IAP A;  1KZG A;  2DHJ A;  5JHG A;  2W2X D;  2RSG A;  4YL8 A;  4D0N B;  3DXE A;  2Y8F A;  2L1C A;  1ISN A;  5J3Q A;  3BJI A;  1H4R A;  4IFS A;  3CIK A;  1W1G A;  1X86 A;  4DX9 0;  3GYO A;  1V5P A;  3PZD A;  2M38 A;  3DXC A;  5D27 A;  2GCJ A;  4HHV A;  3KZ1 A;  2ROV A;  1V89 A;  3SV1 A;  2MDX A;  1J19 A;  4P7I A;  4HB4 B;  2Y7B A;  1IRS A;  3PVW A;  1M7E A;  4HAU B;  3DXD A;  5DHF B;  5DH9 B;  1DRO A;  4B6H A;  2DYN A;  4HB2 B;  1U5E A;  2G35 A;  1UNP A;  4PQ0 A;  4HB3 B;  1PMS A;  1Y5O A;  1KI1 B;  1MKE A;  4GZU A;  2QKL A;  4HAZ B;  1V5U A;  2KUP A;  2LOZ A;  3OAN A;  2VSZ A;  1DYN A;  4A5K A;  3X23 A;  3ZDT A;  1ZM0 A;  5CLQ B;  2I1K A;  1U2B A;  2W2X C;  2D9V A;  5J3T A;  2HE7 A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...