4TZZA

Co-crystals of the ternary complex containing a t-box stem i rna, its cognate trnagly, and b. subtilis ybxf protein, treated by removing lithium sulfate and increasing peg3350 concentration from 20% to 45% post crystallization
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
b'SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-associated protein L7Ae-like
publication title Dramatic Improvement of Crystals of Large RNAs by Cation Replacement and Dehydration.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ribosomal protein/rna
total genus 19
structure length 81
sequence length 81
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4tzzA00
4LCKA 1GZ0A 1N8RH 5DCVA 5GANK 1W41A 1SDSA 4X3LA 1T0KB 3LWQC 1KQSF 2BO1A 3CCQF 1QVFF 1YIJF 3CXCF 1H7MA 1Q7YH 1K8AH 3G71F 3CMAF 1VQPF 3I56F 2LBXA 1Q82H 1IPAA 1W3EX 1NMUB 2HVYD 3ON1A 1YJNF 5IT9M 1W42A 3SIVA 4C4WC 3JAMM 1XBIA 3GYQA 3E1YA 3HJWC 1PXWA 2VGNA 2OTLF 5FJ4C 2OTJF 3OW2F 3LWVC 3CPQA 3V7QA 3LWRC 1YJ9F 2FC3A 2QA4F 2LBWA 4BW0B 3OBWA 2QI2A 1RA4A 3CCJF 3O85A 3CCUF 3MCAB 3LWPC 2AIFA 1K9MH 1Q81H 2CZWA 1X7PA 3G4SF 3CG6A 3NK7A 1KD1H 3VMFB 3CMEF 3RA6A 1W40A 2QEXF 3AGKA 5G4UC 4X3MA 3VI6A 3OBYA 5GINC 1K73H 4BY9D 1VQNF 2JNBA 3WXMB 5A2QM 3CCLF 2WALA 1YI2F 1M90H 3N4YA 3I55F 2I6DA 4NUTA 3CCVF 1W2BF 3IR9A 3N4ZA 3CCEF 3HAXD 1ZWZA 2OZBA 1S72F 3RA5A 3E20B 3J7AR 5GIOC 3CD6F 3V7EA 3CCRF 1CN7A 3CPWF 1VQKF 3G6EF 1Q86H 5GIPC 1GO0A 3NMUC 1DT9A 4TZZA 1VQ6F 1RLGA 5FLXM 3PAFA 2ALEA 1VQ7F 1CK2A 1JJ2F 3NVIB 1X52A 1YJWF 3PLAC 1E7KA 1VQ8F 3FFMA 2KTUA 3CCSF 3J81M 1NJIH 3JCMM 1M1KH 2VGMA 1VQ5F 3CC4F 1VQ4F 3CCMF 3SIUA 3J80M 2OHWA 1YITF 1VQLF 1YHQF 1QVGF 1VQ9F 1GO1A 3NK6A 2KTVA 3CC2F 5EWRA 1VQOF 1X7OA 2KG4A 3NVKE 1VQMF 3CC7F 3LFOA 5GAPK 5EO3A 3LWOC 1KC8H 5G4VC
chains in the Genus database with same CATH superfamily
3Q8HA 5GONA 4O4IB 4EI7A 5KX5A 3L7QA 1IV2A 1JFFB 4O2BB 3ESJA 4ZOLB 5HP8A 4ZHYB 3MQWA 1KC8H 5JCOA 2H8EA 3CXCF 4EB6A 3MDOA 1K8AH 3G71F 3K14A 1SA0B 3OONA 1IPAA 3VOBA 1NMUB 1OAPA 5IYZA 1U43A 4IHJB 2HVYD 4LNUB 3ON1A 4BVRA 3N2GA 4KWEA 5IT9M 3CYQA 4FFBB 2GLZA 2N48A 4O4JA 2ZAUA 3GYQA 1VK3A 4BT3A 5FJ4C 1YQNA 3OW2F 3LDTA 5JVDB 3VO8A 3IKEA 3LWRC 3JARB 5JQGA 5C8YB 3FD5A 3M4SA 4BW0B 3ZOPA 3S0YA 2QI2A 5GONB 3O85A 4XCQA 3KE1A 1OFUA 2AIFA 3LWPC 1K9MH 5FNVB 2CZWA 1X7PA 2GVIA 4O4LB 3CG6A 3C8LA 3RYCA 3S02A 3CMEF 2YXZA 4DRXA 4X3MA 3VI6A 3N2KA 1K73H 3WGNA 5J2UA 2WALA 3RYFB 1M90H 3HTNA 3I55F 1W55A 4NUTA 4ZI7B 1W2BF 2H6LA 2UZHA 1Q8RA 3IR9A 2B33A 4O4JB 2Z1FA 2UYNA 3U0OA 3RA5A 3QHDA 3CB2A 4B62A 5HY2A 4BT2A 2LCAA 3RE3A 3S0HA 5HY1A 1QAHA 5CB4B 4ZHQA 3E22A 3GTZA 3KJJA 2HS4A 2ALEA 3GHZA 3NVIB 4X1YB 3HKBA 2PHNA 3WGJA 1VQ8F 2IG8A 3MCQA 3J81M 1NJIH 4DRXB 3FD6A 5EYPA 2ZVZA 2DYYA 3SIUA 1R1MA 2KGWA 3J80M 1YHQF 3JATB 3NK6A 2KTVA 3CC2F 5EWRA 4BVTA 1X7OA 5HY4A 5IJ0A 3JASA 3V4DA 1U3LA 3ZP4A 1JN1A 2OTMA 2Q1YA 2GZLA 3WJRA 4C82A 5HWEA 3F6MA 3LYBA 3C9TA 3FBAA 2ZVYA 1TUBB 2BO1A 3HKDA 1FNJA 4I50A 3E22B 5EAZA 3CCQF 2HP0B 1IV3A 2BTOA 5B8FA 5ITZB 3HKBB 1VQPF 3I56F 2LBXA 2Z1UA 1UFYA 1RQ7A 2I6RA 4BVQA 5J2TB 1YJNF 5CA0A 1IV4A 1W42A 3SIVA 2Z01A 4C4WC 3E1YA 1PXWA 2VGNA 2UYPA 4X1KB 1RQ2A 4X20A 2OTJF 3K0TA 3IMPA 1W5AA 4DXDA 3CPQA 3K2XA 3KJKA 1YJ9F 2QA4F 3JASB 2Z1EA 2LBWA 5BMVB 1H47A 5CA1A 4HNAB 5EB1B 4YJ3A 3CCUF 2F9ZC 4ZHWA 3QUWA 1Q81H 3G4SF 1YGYA 5MN4A 2ZOVA 1XV2A 3D54A 3RA6A 2HS3A 3WPWA 3IKFA 5IJ9B 2CW4A 4BY9D 3RYIA 1JY8A 2JNBA 3WXMB 2RHHA 3VCZA 1FFXB 5LYJA 5LP6B 3CCVF 1TVKA 4M8IA 3HAXD 2OZBA 3VYUC 2CHSA 4TV8B 2CHTA 3JALB 5GIOC 3JAKB 5KX5B 4IIJA 1CN7A 1VHAA 2RB9A 5KMGA 1VQKF 1Q86H 5GIPC 1J7HA 1DT9A 3JVHA 4G4XA 4TZZA 1VQ6F 1RLGA 4O4HA 1VQ7F 3D01A 4EB6B 4YJ3B 5EIBC 4E6EA 4YJ2A 3VTIC 1H48A 5IYZB 4U39A 2DT4A 2Q1XA 3N2GB 3T80A 2QTPA 1VQ4F 1W5EA 2RHJA 3WGLA 2IQQA 5JH7A 3RYIB 1VQLF 3B6NA 2ZF8A 1QVGF 4TV9A 4NQ3A 3WGMA 1ODEA 4BT6A 3DDNA 3V3TA 5JQGB 4TUYA 1FNKA 3LFOA 5GAPK 4G4WA 2CWJA 3LWOC 2HRUA 1W581 1N8RH 5EIBD 5DCVA 5GANK 5KMGB 2AIZP 1SDSA 4X3LA 1T0KB 1W57A 3F0EA 2R6R1 4C8GA 3RYCB 1QVFF 4EI8A 1YIJF 3HKEA 3DC2A 4WBNA 3JAWA 1Q7YH 3N2KB 3CMAF 4I4TA 2L26A 5J2UB 1QD9A 3C9SA 2IAFA 2RHLA 3M84A 4B5CA 4BVSA 4G4YA 4BT5A 2UYNB 3K12A 1XBIA 3JAMM 5JH7B 3UT5A 2P6YA 2OTLF 3LMEA 3LWVC 1NQ3A 3I3FA 4C8IA 1RLUA 4ZHQB 5LA6A 3OBWA 5LOVA 1ONIA 2V9YA 3MCAB 1X25A 1FSZA 3NK7A 2HX0A 3VMFB 3TD4A 5EYPB 1W40A 2LBTA 3KHNA 5JCOC 1JD1A 2RHOA 4I4TB 5GINC 1VQNF 3M1XA 3ZP7A 1YI2F 3N4YA 3EORA 4IHJA 3N4ZA 5IJ0B 4FFBA 2VAPA 1S72F 3UT5B 3E20B 3RYHA 3C9UA 1KNJA 4RHAA 3CCRF 3P10A 5JVDA 3NMUC 3F0FA 3P4EA 5LA6B 3HKDB 4I50B 1W59A 5C8YA 3PAFA 3P0ZA 1W5FA 3PLAC 5FNVA 2HS0A 2CSLA 3FFMA 2HP3A 1KNKA 4O4LA 3S06A 3JCMM 1M1KH 2VGMA 1VQ5F 5CA0B 3CC4F 3VOAA 3CCMF 2VAMA 2G9IA 2PMPA 2OHWA 3R0PA 1YITF 2CVLA 3QTYA 3RYFA 4X20B 2AMTA 4G4ZA 2Z1TA 4G4VA 4ZI7A 1VQOF 2KG4A 3CC7F 4C81A 5HP7A 3WPXA 1QU9A 3RYHB 5CA1B 5EO3A 1U40A 3FPIA 1ZWZA 5G4VC 4LCKA 1GZ0A 1COMA 3S03A 2VXYA 4O2AA 1W41A 3LWQC 1KQSF 5HXUA 5CB4A 1Z5WA 3CYPB 4EI9A 3S0WA 4B45A 1H7MA 2HRYA 2R751 4X1YA 1Q82H 1W3EX 4ERHA 5MN5A 1DBFA 3VYTC 5LYJB 4F6RA 5AVMA 1U3PA 2H8CA 1TVKB 1Z5VA 3MBMA 5EZYA 4C8EA 3WGKA 3HJWC 3JATA 4IIJB 3WJPA 1SZQA 2FGYA 1PF5A 3V7QA 5LXTA 2EWCA 2FC3A 4BT4A 3F0GA 3D00A 2UYKA 2BTUA 2W8BC 4R40B 4O4HB 4I55A 1RA4A 3CCJF 1GX1A 1UI9A 4O2AB 3ERNA 3HKCA 4YJ2B 4G88A 4ZK7A 2K1SA 1KD1H 1TUBA 2HQSC 3KIZA 2HP0A 2QEXF 3VIUA 3AGKA 4U3JA 5G4UC 5HXZA 3OBYA 5ITZA 5A2QM 3CCLF 4TV9B 2ZODA 1W5BA 4F6RB 2I6DA 3TD5A 2BTQB 2MQEA 5J2TA 4TUYB 5EZYB 4X1IA 4ZHVA 3CCEF 3C9RA 1XHOA 5LP6C 5HY0A 1XRGA 4BT7A 3J7AR 4X1KA 3CD6F 3V7EA 2YYEA 4O4IA 3CPWF 3G6EF 5LXTB 1GO0A 1JFFA 4ZOLA 4O2BA 5MN6A 3HKEB 5FLXM 4I55B 4RQOA 5BMVA 1CK2A 3IEWA 4WBNB 3JAWB 1JJ2F 4B46A 4HNAA 3WJQA 1X52A 5EB0A 1T0AA 3HKCB 1YJWF 1E7KA 1SA0A 2VAWA 2KTUA 3CCSF 3VYSC 4NWOB 2UYJA 4LNUA 3I7TA 4U3JB 3TD3A 3F0DA 1VH8A 5IJ9A 1VQ9F 1VQVA 1FFXA 1GO1A 4PWTA 2NMUA 1CLIA 5LP6A 4X1IB 3JARA 3NVKE 1VQMF 3IEQA 1IV1A 3ZO8A 4TV8A 3BYQA 5LOVB 3HWUA 3ELCA 3JALA 3JAKA
chains in the Genus database with same CATH topology
4LCKA 1GZ0A 4EI7A 1N8RH 5DCVA 5GANK 5HWEA 1W41A 1SDSA 4X3LA 1T0KB 3LWQC 1KQSF 5HXUA 2BO1A 3CCQF 1QVFF 4EI8A 1YIJF 4EI9A 3CXCF 1H7MA 1Q7YH 1K8AH 3G71F 3CMAF 1VQPF 3I56F 2LBXA 1Q82H 1IPAA 1W3EX 1NMUB 2HVYD 4BVQA 3ON1A 4BVRA 4BVSA 1YJNF 5IT9M 1W42A 5G4VC 2GLZA 3SIVA 4C4WC 3JAMM 1XBIA 3GYQA 3E1YA 3HJWC 1PXWA 2VGNA 2OTLF 5FJ4C 2OTJF 3OW2F 2FGYA 3LWVC 3CPQA 3V7QA 3LWRC 1YJ9F 2FC3A 2QA4F 3D00A 2LBWA 4BW0B 3OBWA 2QI2A 1RA4A 3CCJF 3O85A 3CCUF 3MCAB 4XCQA 2F9ZC 3LWPC 2AIFA 1K9MH 1Q81H 2CZWA 1X7PA 3G4SF 3CG6A 3NK7A 1KD1H 3VMFB 3CMEF 3RA6A 1W40A 2QEXF 3AGKA 5G4UC 5HXZA 4X3MA 3VI6A 3OBYA 5GINC 1K73H 4BY9D 1VQNF 2JNBA 3WXMB 5A2QM 3CCLF 2WALA 1YI2F 1M90H 3N4YA 3I55F 2I6DA 4NUTA 3CCVF 1W2BF 3IR9A 3N4ZA 3CCEF 3HAXD 2OZBA 5HY0A 1S72F 3RA5A 3E20B 3J7AR 5GIOC 3CD6F 3V7EA 5HY2A 3CCRF 1CN7A 3CPWF 1VQKF 3G6EF 1Q86H 5HY1A 5GIPC 1GO0A 3NMUC 1DT9A 4TZZA 1VQ6F 1RLGA 5FLXM 3PAFA 2ALEA 1VQ7F 1CK2A 1JJ2F 3NVIB 1X52A 1YJWF 3PLAC 1E7KA 1VQ8F 3FFMA 2KTUA 3CCSF 3J81M 1NJIH 3JCMM 1M1KH 2VGMA 1VQ5F 3CC4F 1VQ4F 3CCMF 3SIUA 3J80M 2OHWA 1YITF 1VQLF 1YHQF 1QVGF 1VQ9F 1GO1A 3NK6A 4NQ3A 2KTVA 3CC2F 5EWRA 4BVTA 1VQOF 3V3TA 1X7OA 5HY4A 2KG4A 3NVKE 1VQMF 3CC7F 3LFOA 5GAPK 5EO3A 3LWOC 1KC8H 1ZWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCK A;  1GZ0 A;  1N8R H;  5DCV A;  5GAN K;  1W41 A;  1SDS A;  4X3L A;  1T0K B;  3LWQ C;  1KQS F;  2BO1 A;  3CCQ F;  1QVF F;  1YIJ F;  3CXC F;  1H7M A;  1Q7Y H;  1K8A H;  3G71 F;  3CMA F;  1VQP F;  3I56 F;  2LBX A;  1Q82 H;  1IPA A;  1W3E X;  1NMU B;  2HVY D;  3ON1 A;  1YJN F;  5IT9 M;  1W42 A;  3SIV A;  4C4W C;  3JAM M;  1XBI A;  3GYQ A;  3E1Y A;  3HJW C;  1PXW A;  2VGN A;  2OTL F;  5FJ4 C;  2OTJ F;  3OW2 F;  3LWV C;  3CPQ A;  3V7Q A;  3LWR C;  1YJ9 F;  2FC3 A;  2QA4 F;  2LBW A;  4BW0 B;  3OBW A;  2QI2 A;  1RA4 A;  3CCJ F;  3O85 A;  3CCU F;  3MCA B;  3LWP C;  2AIF A;  1K9M H;  1Q81 H;  2CZW A;  1X7P A;  3G4S F;  3CG6 A;  3NK7 A;  1KD1 H;  3VMF B;  3CME F;  3RA6 A;  1W40 A;  2QEX F;  3AGK A;  5G4U C;  4X3M A;  3VI6 A;  3OBY A;  5GIN C;  1K73 H;  4BY9 D;  1VQN F;  2JNB A;  3WXM B;  5A2Q M;  3CCL F;  2WAL A;  1YI2 F;  1M90 H;  3N4Y A;  3I55 F;  2I6D A;  4NUT A;  3CCV F;  1W2B F;  3IR9 A;  3N4Z A;  3CCE F;  3HAX D;  1ZWZ A;  2OZB A;  1S72 F;  3RA5 A;  3E20 B;  3J7A R;  5GIO C;  3CD6 F;  3V7E A;  3CCR F;  1CN7 A;  3CPW F;  1VQK F;  3G6E F;  1Q86 H;  5GIP C;  1GO0 A;  3NMU C;  1DT9 A;  4TZZ A;  1VQ6 F;  1RLG A;  5FLX M;  3PAF A;  2ALE A;  1VQ7 F;  1CK2 A;  1JJ2 F;  3NVI B;  1X52 A;  1YJW F;  3PLA C;  1E7K A;  1VQ8 F;  3FFM A;  2KTU A;  3CCS F;  3J81 M;  1NJI H;  3JCM M;  1M1K H;  2VGM A;  1VQ5 F;  3CC4 F;  1VQ4 F;  3CCM F;  3SIU A;  3J80 M;  2OHW A;  1YIT F;  1VQL F;  1YHQ F;  1QVG F;  1VQ9 F;  1GO1 A;  3NK6 A;  2KTV A;  3CC2 F;  5EWR A;  1VQO F;  1X7O A;  2KG4 A;  3NVK E;  1VQM F;  3CC7 F;  3LFO A;  5GAP K;  5EO3 A;  3LWO C;  1KC8 H;  5G4V C; 
#chains in the Genus database with same CATH topology
 3Q8H A;  5GON A;  4O4I B;  4EI7 A;  5KX5 A;  3L7Q A;  1IV2 A;  1JFF B;  4O2B B;  3ESJ A;  4ZOL B;  5HP8 A;  4ZHY B;  3MQW A;  1KC8 H;  5JCO A;  2H8E A;  3CXC F;  4EB6 A;  3MDO A;  1K8A H;  3G71 F;  3K14 A;  1SA0 B;  3OON A;  1IPA A;  3VOB A;  1NMU B;  1OAP A;  5IYZ A;  1U43 A;  4IHJ B;  2HVY D;  4LNU B;  3ON1 A;  4BVR A;  3N2G A;  4KWE A;  5IT9 M;  3CYQ A;  4FFB B;  2GLZ A;  2N48 A;  4O4J A;  2ZAU A;  3GYQ A;  1VK3 A;  4BT3 A;  5FJ4 C;  1YQN A;  3OW2 F;  3LDT A;  5JVD B;  3VO8 A;  3IKE A;  3LWR C;  3JAR B;  5JQG A;  5C8Y B;  3FD5 A;  3M4S A;  4BW0 B;  3ZOP A;  3S0Y A;  2QI2 A;  5GON B;  3O85 A;  4XCQ A;  3KE1 A;  1OFU A;  2AIF A;  3LWP C;  1K9M H;  5FNV B;  2CZW A;  1X7P A;  2GVI A;  4O4L B;  3CG6 A;  3C8L A;  3RYC A;  3S02 A;  3CME F;  2YXZ A;  4DRX A;  4X3M A;  3VI6 A;  3N2K A;  1K73 H;  3WGN A;  5J2U A;  2WAL A;  3RYF B;  1M90 H;  3HTN A;  3I55 F;  1W55 A;  4NUT A;  4ZI7 B;  1W2B F;  2H6L A;  2UZH A;  1Q8R A;  3IR9 A;  2B33 A;  4O4J B;  2Z1F A;  2UYN A;  3U0O A;  3RA5 A;  3QHD A;  3CB2 A;  4B62 A;  5HY2 A;  4BT2 A;  2LCA A;  3RE3 A;  3S0H A;  5HY1 A;  1QAH A;  5CB4 B;  4ZHQ A;  3E22 A;  3GTZ A;  3KJJ A;  2HS4 A;  2ALE A;  3GHZ A;  3NVI B;  4X1Y B;  3HKB A;  2PHN A;  3WGJ A;  1VQ8 F;  2IG8 A;  3MCQ A;  3J81 M;  1NJI H;  4DRX B;  3FD6 A;  5EYP A;  2ZVZ A;  2DYY A;  3SIU A;  1R1M A;  2KGW A;  3J80 M;  1YHQ F;  3JAT B;  3NK6 A;  2KTV A;  3CC2 F;  5EWR A;  4BVT A;  1X7O A;  5HY4 A;  5IJ0 A;  3JAS A;  3V4D A;  1U3L A;  3ZP4 A;  1JN1 A;  2OTM A;  2Q1Y A;  2GZL A;  3WJR A;  4C82 A;  5HWE A;  3F6M A;  3LYB A;  3C9T A;  3FBA A;  2ZVY A;  1TUB B;  2BO1 A;  3HKD A;  1FNJ A;  4I50 A;  3E22 B;  5EAZ A;  3CCQ F;  2HP0 B;  1IV3 A;  2BTO A;  5B8F A;  5ITZ B;  3HKB B;  1VQP F;  3I56 F;  2LBX A;  2Z1U A;  1UFY A;  1RQ7 A;  2I6R A;  4BVQ A;  5J2T B;  1YJN F;  5CA0 A;  1IV4 A;  1W42 A;  3SIV A;  2Z01 A;  4C4W C;  3E1Y A;  1PXW A;  2VGN A;  2UYP A;  4X1K B;  1RQ2 A;  4X20 A;  2OTJ F;  3K0T A;  3IMP A;  1W5A A;  4DXD A;  3CPQ A;  3K2X A;  3KJK A;  1YJ9 F;  2QA4 F;  3JAS B;  2Z1E A;  2LBW A;  5BMV B;  1H47 A;  5CA1 A;  4HNA B;  5EB1 B;  4YJ3 A;  3CCU F;  2F9Z C;  4ZHW A;  3QUW A;  1Q81 H;  3G4S F;  1YGY A;  5MN4 A;  2ZOV A;  1XV2 A;  3D54 A;  3RA6 A;  2HS3 A;  3WPW A;  3IKF A;  5IJ9 B;  2CW4 A;  4BY9 D;  3RYI A;  1JY8 A;  2JNB A;  3WXM B;  2RHH A;  3VCZ A;  1FFX B;  5LYJ A;  5LP6 B;  3CCV F;  1TVK A;  4M8I A;  3HAX D;  2OZB A;  3VYU C;  2CHS A;  4TV8 B;  2CHT A;  3JAL B;  5GIO C;  3JAK B;  5KX5 B;  4IIJ A;  1CN7 A;  1VHA A;  2RB9 A;  5KMG A;  1VQK F;  1Q86 H;  5GIP C;  1J7H A;  1DT9 A;  3JVH A;  4G4X A;  4TZZ A;  1VQ6 F;  1RLG A;  4O4H A;  1VQ7 F;  3D01 A;  4EB6 B;  4YJ3 B;  5EIB C;  4E6E A;  4YJ2 A;  3VTI C;  1H48 A;  5IYZ B;  4U39 A;  2DT4 A;  2Q1X A;  3N2G B;  3T80 A;  2QTP A;  1VQ4 F;  1W5E A;  2RHJ A;  3WGL A;  2IQQ A;  5JH7 A;  3RYI B;  1VQL F;  3B6N A;  2ZF8 A;  1QVG F;  4TV9 A;  4NQ3 A;  3WGM A;  1ODE A;  4BT6 A;  3DDN A;  3V3T A;  5JQG B;  4TUY A;  1FNK A;  3LFO A;  5GAP K;  4G4W A;  2CWJ A;  3LWO C;  2HRU A;  1W58 1;  1N8R H;  5EIB D;  5DCV A;  5GAN K;  5KMG B;  2AIZ P;  1SDS A;  4X3L A;  1T0K B;  1W57 A;  3F0E A;  2R6R 1;  4C8G A;  3RYC B;  1QVF F;  4EI8 A;  1YIJ F;  3HKE A;  3DC2 A;  4WBN A;  3JAW A;  1Q7Y H;  3N2K B;  3CMA F;  4I4T A;  2L26 A;  5J2U B;  1QD9 A;  3C9S A;  2IAF A;  2RHL A;  3M84 A;  4B5C A;  4BVS A;  4G4Y A;  4BT5 A;  2UYN B;  3K12 A;  1XBI A;  3JAM M;  5JH7 B;  3UT5 A;  2P6Y A;  2OTL F;  3LME A;  3LWV C;  1NQ3 A;  3I3F A;  4C8I A;  1RLU A;  4ZHQ B;  5LA6 A;  3OBW A;  5LOV A;  1ONI A;  2V9Y A;  3MCA B;  1X25 A;  1FSZ A;  3NK7 A;  2HX0 A;  3VMF B;  3TD4 A;  5EYP B;  1W40 A;  2LBT A;  3KHN A;  5JCO C;  1JD1 A;  2RHO A;  4I4T B;  5GIN C;  1VQN F;  3M1X A;  3ZP7 A;  1YI2 F;  3N4Y A;  3EOR A;  4IHJ A;  3N4Z A;  5IJ0 B;  4FFB A;  2VAP A;  1S72 F;  3UT5 B;  3E20 B;  3RYH A;  3C9U A;  1KNJ A;  4RHA A;  3CCR F;  3P10 A;  5JVD A;  3NMU C;  3F0F A;  3P4E A;  5LA6 B;  3HKD B;  4I50 B;  1W59 A;  5C8Y A;  3PAF A;  3P0Z A;  1W5F A;  3PLA C;  5FNV A;  2HS0 A;  2CSL A;  3FFM A;  2HP3 A;  1KNK A;  4O4L A;  3S06 A;  3JCM M;  1M1K H;  2VGM A;  1VQ5 F;  5CA0 B;  3CC4 F;  3VOA A;  3CCM F;  2VAM A;  2G9I A;  2PMP A;  2OHW A;  3R0P A;  1YIT F;  2CVL A;  3QTY A;  3RYF A;  4X20 B;  2AMT A;  4G4Z A;  2Z1T A;  4G4V A;  4ZI7 A;  1VQO F;  2KG4 A;  3CC7 F;  4C81 A;  5HP7 A;  3WPX A;  1QU9 A;  3RYH B;  5CA1 B;  5EO3 A;  1U40 A;  3FPI A;  1ZWZ A;  5G4V C;  4LCK A;  1GZ0 A;  1COM A;  3S03 A;  2VXY A;  4O2A A;  1W41 A;  3LWQ C;  1KQS F;  5HXU A;  5CB4 A;  1Z5W A;  3CYP B;  4EI9 A;  3S0W A;  4B45 A;  1H7M A;  2HRY A;  2R75 1;  4X1Y A;  1Q82 H;  1W3E X;  4ERH A;  5MN5 A;  1DBF A;  3VYT C;  5LYJ B;  4F6R A;  5AVM A;  1U3P A;  2H8C A;  1TVK B;  1Z5V A;  3MBM A;  5EZY A;  4C8E A;  3WGK A;  3HJW C;  3JAT A;  4IIJ B;  3WJP A;  1SZQ A;  2FGY A;  1PF5 A;  3V7Q A;  5LXT A;  2EWC A;  2FC3 A;  4BT4 A;  3F0G A;  3D00 A;  2UYK A;  2BTU A;  2W8B C;  4R40 B;  4O4H B;  4I55 A;  1RA4 A;  3CCJ F;  1GX1 A;  1UI9 A;  4O2A B;  3ERN A;  3HKC A;  4YJ2 B;  4G88 A;  4ZK7 A;  2K1S A;  1KD1 H;  1TUB A;  2HQS C;  3KIZ A;  2HP0 A;  2QEX F;  3VIU A;  3AGK A;  4U3J A;  5G4U C;  5HXZ A;  3OBY A;  5ITZ A;  5A2Q M;  3CCL F;  4TV9 B;  2ZOD A;  1W5B A;  4F6R B;  2I6D A;  3TD5 A;  2BTQ B;  2MQE A;  5J2T A;  4TUY B;  5EZY B;  4X1I A;  4ZHV A;  3CCE F;  3C9R A;  1XHO A;  5LP6 C;  5HY0 A;  1XRG A;  4BT7 A;  3J7A R;  4X1K A;  3CD6 F;  3V7E A;  2YYE A;  4O4I A;  3CPW F;  3G6E F;  5LXT B;  1GO0 A;  1JFF A;  4ZOL A;  4O2B A;  5MN6 A;  3HKE B;  5FLX M;  4I55 B;  4RQO A;  5BMV A;  1CK2 A;  3IEW A;  4WBN B;  3JAW B;  1JJ2 F;  4B46 A;  4HNA A;  3WJQ A;  1X52 A;  5EB0 A;  1T0A A;  3HKC B;  1YJW F;  1E7K A;  1SA0 A;  2VAW A;  2KTU A;  3CCS F;  3VYS C;  4NWO B;  2UYJ A;  4LNU A;  3I7T A;  4U3J B;  3TD3 A;  3F0D A;  1VH8 A;  5IJ9 A;  1VQ9 F;  1VQV A;  1FFX A;  1GO1 A;  4PWT A;  2NMU A;  1CLI A;  5LP6 A;  4X1I B;  3JAR A;  3NVK E;  1VQM F;  3IEQ A;  1IV1 A;  3ZO8 A;  4TV8 A;  3BYQ A;  5LOV B;  3HWU A;  3ELC A;  3JAL A;  3JAK A; 
#chains in the Genus database with same CATH homology
 4LCK A;  1GZ0 A;  4EI7 A;  1N8R H;  5DCV A;  5GAN K;  5HWE A;  1W41 A;  1SDS A;  4X3L A;  1T0K B;  3LWQ C;  1KQS F;  5HXU A;  2BO1 A;  3CCQ F;  1QVF F;  4EI8 A;  1YIJ F;  4EI9 A;  3CXC F;  1H7M A;  1Q7Y H;  1K8A H;  3G71 F;  3CMA F;  1VQP F;  3I56 F;  2LBX A;  1Q82 H;  1IPA A;  1W3E X;  1NMU B;  2HVY D;  4BVQ A;  3ON1 A;  4BVR A;  4BVS A;  1YJN F;  5IT9 M;  1W42 A;  5G4V C;  2GLZ A;  3SIV A;  4C4W C;  3JAM M;  1XBI A;  3GYQ A;  3E1Y A;  3HJW C;  1PXW A;  2VGN A;  2OTL F;  5FJ4 C;  2OTJ F;  3OW2 F;  2FGY A;  3LWV C;  3CPQ A;  3V7Q A;  3LWR C;  1YJ9 F;  2FC3 A;  2QA4 F;  3D00 A;  2LBW A;  4BW0 B;  3OBW A;  2QI2 A;  1RA4 A;  3CCJ F;  3O85 A;  3CCU F;  3MCA B;  4XCQ A;  2F9Z C;  3LWP C;  2AIF A;  1K9M H;  1Q81 H;  2CZW A;  1X7P A;  3G4S F;  3CG6 A;  3NK7 A;  1KD1 H;  3VMF B;  3CME F;  3RA6 A;  1W40 A;  2QEX F;  3AGK A;  5G4U C;  5HXZ A;  4X3M A;  3VI6 A;  3OBY A;  5GIN C;  1K73 H;  4BY9 D;  1VQN F;  2JNB A;  3WXM B;  5A2Q M;  3CCL F;  2WAL A;  1YI2 F;  1M90 H;  3N4Y A;  3I55 F;  2I6D A;  4NUT A;  3CCV F;  1W2B F;  3IR9 A;  3N4Z A;  3CCE F;  3HAX D;  2OZB A;  5HY0 A;  1S72 F;  3RA5 A;  3E20 B;  3J7A R;  5GIO C;  3CD6 F;  3V7E A;  5HY2 A;  3CCR F;  1CN7 A;  3CPW F;  1VQK F;  3G6E F;  1Q86 H;  5HY1 A;  5GIP C;  1GO0 A;  3NMU C;  1DT9 A;  4TZZ A;  1VQ6 F;  1RLG A;  5FLX M;  3PAF A;  2ALE A;  1VQ7 F;  1CK2 A;  1JJ2 F;  3NVI B;  1X52 A;  1YJW F;  3PLA C;  1E7K A;  1VQ8 F;  3FFM A;  2KTU A;  3CCS F;  3J81 M;  1NJI H;  3JCM M;  1M1K H;  2VGM A;  1VQ5 F;  3CC4 F;  1VQ4 F;  3CCM F;  3SIU A;  3J80 M;  2OHW A;  1YIT F;  1VQL F;  1YHQ F;  1QVG F;  1VQ9 F;  1GO1 A;  3NK6 A;  4NQ3 A;  2KTV A;  3CC2 F;  5EWR A;  4BVT A;  1VQO F;  3V3T A;  1X7O A;  5HY4 A;  2KG4 A;  3NVK E;  1VQM F;  3CC7 F;  3LFO A;  5GAP K;  5EO3 A;  3LWO C;  1KC8 H;  1ZWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...