4TZZA

Co-crystals of the ternary complex containing a t-box stem i rna, its cognate trnagly, and b. subtilis ybxf protein, treated by removing lithium sulfate and increasing peg3350 concentration from 20% to 45% post crystallization
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-associated protein L7Ae-like
publication title Dramatic Improvement of Crystals of Large RNAs by Cation Replacement and Dehydration.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ribosomal protein/rna
total genus 19
structure length 81
sequence length 81
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4tzzA00
5GINC 3ON1A 2LBWA 3PAFA 3N4ZA 3LWOC 1M1KH 5EWRA 3OBWA 3LWQC 1Q81H 1K9MH 5G4VC 3AGKA 3CC4F 1X7PA 1QVFF 3O85A 3HAXD 2OHWA 3I55F 1PXWA 2OZBA 3G6EF 1VQ9F 1KQSF 1GO0A 2QA4F 1T0KB 3V7QA 3NK7A 3RA5A 3CMAF 2KTVA 2LBXA 2QI2A 1E7KA 3J80M 2FC3A 3CCJF 3CD6F 1YIJF 1Q82H 3HJWC 4LCKA 1S72F 1GO1A 1Q7YH 3CPQA 1KD1H 5GANK 5A2QM 1VQLF 4BY9D 1X52A 1W40A 1YITF 2CZWA 1SDSA 3CPWF 2HVYD 1RLGA 5GAPK 3IR9A 3G71F 3MCAB 1VQKF 5FJ4C 1X7OA 1NJIH 2JNBA 3LWRC 3I56F 3WXMB 4BW0B 1K8AH 3E20B 1VQ4F 3SIUA 1VQPF 1CK2A 3NVKE 2BO1A 1XBIA 5GIOC 4TZZA 3J7AR 3OW2F 1JJ2F 5IT9M 1N8RH 1W2BF 3CXCF 1VQ7F 1H7MA 2VGMA 3CCSF 1ZWZA 1VQOF 1Q86H 1KC8H 3CG6A 3CCQF 2WALA 2KTUA 4NUTA 1VQ8F 3OBYA 1VQ5F 1YJ9F 2OTJF 2KG4A 3CCLF 1YJWF 2ALEA 1YHQF 3VMFB 1NMUB 1YJNF 3CCVF 3CC7F 3NVIB 3JAMM 3V7EA 3GYQA 3LWPC 1K73H 3CCMF 5FLXM 4C4WC 3E1YA 2VGNA 3FFMA 1W42A 3CCRF 3RA6A 3CCEF 1YI2F 1VQMF 5G4UC 3N4YA 1RA4A 3G4SF 3CMEF 2AIFA 1GZ0A 3LFOA 2I6DA 1M90H 5EO3A 3VI6A 3JCMM 1DT9A 1CN7A 1W41A 5GIPC 3NMUC 1W3EX 4X3LA 3PLAC 1QVGF 3CCUF 1IPAA 2QEXF 1VQNF 3CC2F 3SIVA 2OTLF 1VQ6F 3LWVC 3NK6A 3J81M 4X3MA 5DCVA
chains in the Genus database with same CATH superfamily
4BVTA 4ZHYB 3PAFA 4C8GA 3KJKA 5LOVB 3N4ZA 1SZQA 3LWOC 1M1KH 3DDNA 2RHLA 5LYJB 1X7PA 1COMA 4G4XA 4KWEA 1DBFA 2OHWA 5CA1B 1KNJA 1JFFA 3JAWA 1TUBB 1VQ9F 1KQSF 1GO0A 1PF5A 5HY2A 1RQ7A 2ZVYA 3F0FA 5IJ9A 2UYNB 1ONIA 3HKBA 3J80M 3LYBA 2FC3A 4TV8B 1W5AA 3CCJF 3K2XA 3ZOPA 4C81A 5LOVA 5EIBC 3JALA 2H6LA 3C9RA 2BTUA 3VYTC 1S72F 5LXTB 1KD1H 5FNVB 5A2QM 3CYQA 1X52A 3M84A 1RLGA 3IR9A 4WBNB 4X1YA 4FFBB 1K8AH 4ERHA 2AMTA 1VQ4F 1VQPF 2VAPA 4BT2A 1OFUA 4I50B 4G4ZA 1W581 5FNVA 4BT3A 2CHSA 1H7MA 2VGMA 3OONA 4WBNA 4O2AA 2HP3A 3CCQF 2EWCA 1Z5WA 4X20A 1IV1A 4G4YA 1YGYA 3OBYA 5MN6A 5EB1B 5HY4A 5JCOC 2OTJF 2KG4A 3BYQA 4O2BA 3CCLF 1R1MA 1YHQF 2Z1TA 3JATA 1NMUB 3EORA 3KJJA 4R40B 3VMFB 4ZHQB 1YQNA 3CC7F 2BTQB 5HP8A 4BVQA 3S0WA 3RYFB 4O4LB 1U3PA 4DXDA 1IV4A 3V3TA 2VAWA 2CW4A 1K73H 4NWOB 5FLXM 5ITZB 4C4WC 4NQ3A 2VGNA 3C9UA 5CB4B 4TUYB 3CB2A 3JASB 3G4SF 4DRXB 2AIFA 2CSLA 4ZHQA 1GZ0A 3RYIA 1M90H 5HWEA 3RYFA 1DT9A 3QTYA 3WGNA 4B62A 2F9ZC 4X3LA 5C8YB 5ITZA 3PLAC 4ZOLA 4TV9B 2OTLF 2FGYA 3LMEA 1VQ6F 3RE3A 3VOBA 2LCAA 1SA0A 3T80A 3CYPB 3MDOA 5GINC 1X25A 3ON1A 4PWTA 2LBWA 4DRXA 4EB6B 5B8FA 4IIJB 5LP6C 3LWQC 1Q81H 5JCOA 1QVFF 2Z1EA 3O85A 5HY0A 1U40A 5IYZB 2QA4F 1OAPA 2NMUA 3C8LA 3NK7A 3RA5A 4U3JA 2KTVA 3S02A 5BMVA 1JFFB 3JAWB 1U43A 2YXZA 3Q8HA 1XHOA 4EB6A 3GHZA 5IJ9B 1YIJF 3HJWC 4BT5A 4IIJA 5DCVA 3HKBB 4O4JA 4X1IA 1Q7YH 4LNUA 3LDTA 3CPQA 1VQLF 5IYZA 5LP6B 3JALB 1SDSA 4E6EA 2L26A 5HXUA 4C82A 4F6RA 1VHAA 3MCAB 1VQKF 5FJ4C 2VAMA 2KGWA 4BW0B 3E20B 4BT6A 4ZI7A 2RHHA 2Z1FA 2HS4A 5LA6A 2BO1A 4X1YB 5GIOC 3ELCA 3RYCA 4I4TA 2ZOVA 4YJ3A 2HS0A 5IT9M 5LP6A 1W2BF 1UFYA 1VQ7F 3QUWA 4X1KA 3CCSF 1QU9A 1ZWZA 5EZYA 5J2UA 3HKEA 5EIBD 4G88A 4EI7A 3FD6A 4O2AB 1YJ9F 1JN1A 3VCZA 3IEWA 1NQ3A 4X20B 5HY1A 1Q8RA 2AIZP 5AVMA 2UYJA 5MN5A 1YJNF 3V7EA 3MQWA 2GVIA 4O2BB 1GX1A 2HQSC 3CCMF 3P4EA 3JATB 4C8IA 3FFMA 3IEQA 3CCRF 3RA6A 1U3LA 5G4UC 2ZAUA 3MCQA 3VYSC 4G4VA 3CMEF 1CLIA 1RQ2A 3TD3A 2PHNA 4ZK7A 2I6DA 5HXZA 3ZO8A 3F6MA 3JCMM 3E22B 1CN7A 2Z1UA 1W41A 3ESJA 1FFXB 2Q1YA 3RYIB 1QVGF 2CHTA 3WPWA 3WGJA 2H8CA 1J7HA 3UT5A 4ZOLB 1W5FA 1H47A 5EWRA 3L7QA 3VTIC 1SA0B 2QTPA 4HNAA 5G4VC 3AGKA 3GTZA 3HKDA 3WJQA 3E22A 3HAXD 1JD1A 1FFXA 4EI9A 3V7QA 1XV2A 2LBXA 2QI2A 3JAKB 3JARB 1E7KA 3HTNA 4U3JB 4BVSA 5BMVB 3KIZA 4O4IA 4LCKA 3WGMA 3N2GA 2W8BC 1GO1A 3FD5A 5GANK 5IJ0A 4BT7A 4BY9D 5KMGA 3WJPA 4YJ2A 2CZWA 5EAZA 2HX0A 4O4JB 4X1IB 4LNUB 1KNKA 3JAKA 2B33A 2Q1XA 3JARA 2DYYA 3VYUC 5HP7A 3S0YA 3LWRC 3I56F 1NJIH 3M4SA 5GONA 3SIUA 3P0ZA 3NVKE 4F6RB 2RHOA 4O4HA 4TZZA 4ZI7B 2I6RA 1JJ2F 1N8RH 4G4WA 3FBAA 5LA6B 3ERNA 3RYCB 5JH7A 1W5EA 4I4TB 5CA0A 1VQOF 1Q86H 3K12A 3CG6A 2HP0A 4YJ3B 3RYHA 4B5CA 5JQGB 1ODEA 2ZVZA 3MBMA 4ZHVA 3F0DA 2WALA 3F0GA 3IKFA 4NUTA 4X1KB 4B45A 1VQ8F 5EZYB 3VOAA 5J2UB 3HKEB 1VQ5F 4M8IA 5EYPA 2MQEA 2R6R1 2UYPA 2IQQA 2ALEA 1YJWF 1QAHA 3CCVF 3JAMM 3LWPC 4IHJB 1FNJA 1RLUA 5JQGA 3S03A 2G9IA 3TD5A 3E1YA 3S06A 1IV3A 1YI2F 2GLZA 3HKCA 4I55A 1VQMF 2OTMA 3ZP7A 1TVKA 3N4YA 3I3FA 2RHJA 1T0AA 2GZLA 3LFOA 3B6NA 3I7TA 3VI6A 5KX5A 5EB0A 1W57A 3M1XA 3N2KA 4IHJA 3NMUC 3DC2A 1IPAA 2QEXF 1VQNF 3SIVA 3WPXA 5LYJA 1UI9A 1H48A 5CA1A 1TUBA 3VO8A 3OBWA 1K9MH 3CC4F 3UT5B 2UYNA 3S0HA 2R751 1PXWA 2V9YA 3I55F 3G6EF 2OZBA 1T0KB 4TV8A 3VIUA 4HNAB 1VH8A 4U39A 3CMAF 1JY8A 3HKDB 1XRGA 3IKEA 3WGKA 3CD6F 5LXTA 1W59A 2BTOA 1QD9A 2HS3A 1Q82H 2H8EA 3P10A 2LBTA 1FSZA 3QHDA 3C9SA 4BT4A 4FFBA 1W40A 4B46A 1YITF 4O4IB 3CPWF 1FNKA 3N2GB 2HVYD 5GAPK 2YYEA 3K14A 3G71F 5IJ0B 1X7OA 5KMGB 4I50A 2JNBA 4YJ2B 3WXMB 2CVLA 3D00A 1CK2A 3KE1A 1XBIA 1W5BA 5GONB 3J7AR 3OW2F 5MN4A 3KHNA 3CXCF 2IAFA 4O4HB 2Z01A 1KC8H 1IV2A 5J2TB 2ZODA 4C8EA 1W55A 2KTUA 3K0TA 5JH7B 1VQVA 5CA0B 3RYHB 2HP0B 2P6YA 2VXYA 4RHAA 4O4LA 3U0OA 3IMPA 3NVIB 5EYPB 5CB4A 3R0PA 3GYQA 4TUYA 3F0EA 3ZP4A 2K1SA 5JVDB 3TD4A 5J2TA 3JASA 2PMPA 4BVRA 1VK3A 2UZHA 3HWUA 1W42A 2HRYA 2DT4A 3CCEF 4XCQA 1RA4A 3JVHA 4EI8A 5C8YA 3HKCB 3V4DA 4I55B 4RQOA 2CWJA 4TV9A 1TVKB 5EO3A 2UYKA 1Z5VA 4ZHWA 5GIPC 1W3EX 5JVDA 2N48A 3FPIA 3CCUF 2HRUA 2IG8A 3CC2F 3D54A 2RB9A 5KX5B 3WGLA 3D01A 3N2KB 3LWVC 3NK6A 3WJRA 3C9TA 3J81M 4X3MA 2ZF8A
chains in the Genus database with same CATH topology
5GINC 4BVTA 3ON1A 2LBWA 3PAFA 3N4ZA 3LWOC 1M1KH 5EWRA 3OBWA 3LWQC 1Q81H 1K9MH 5G4VC 3AGKA 3CC4F 1X7PA 1QVFF 3O85A 5HY0A 3HAXD 2OHWA 3I55F 1PXWA 2OZBA 3G6EF 1VQ9F 1KQSF 1GO0A 4EI9A 5HY2A 2QA4F 1T0KB 3V7QA 3NK7A 3RA5A 3CMAF 2KTVA 2LBXA 2QI2A 1E7KA 3J80M 2FC3A 3CCJF 3CD6F 4BVSA 1YIJF 1Q82H 3HJWC 4LCKA 1S72F 1GO1A 1Q7YH 3CPQA 1KD1H 5GANK 5A2QM 1VQLF 4BY9D 1X52A 1W40A 1YITF 2CZWA 1SDSA 5HXUA 3CPWF 2HVYD 1RLGA 5GAPK 3IR9A 3G71F 3MCAB 1VQKF 5FJ4C 1X7OA 1NJIH 2JNBA 3LWRC 3I56F 3WXMB 4BW0B 1K8AH 3E20B 1VQ4F 3SIUA 1VQPF 3D00A 1CK2A 3NVKE 2BO1A 1XBIA 5GIOC 4TZZA 3J7AR 3OW2F 1JJ2F 5IT9M 1N8RH 1W2BF 3CXCF 1VQ7F 1H7MA 2VGMA 3CCSF 1ZWZA 1VQOF 1Q86H 1KC8H 3CG6A 3CCQF 4EI7A 2WALA 2KTUA 4NUTA 1VQ8F 3OBYA 1VQ5F 5HY4A 1YJ9F 2OTJF 2KG4A 5HY1A 3CCLF 1YJWF 2ALEA 1YHQF 3VMFB 1NMUB 1YJNF 3CCVF 3CC7F 4BVQA 3NVIB 3JAMM 3V7EA 3GYQA 3LWPC 3V3TA 1K73H 3CCMF 5FLXM 4C4WC 4NQ3A 4BVRA 3E1YA 2VGNA 3FFMA 1W42A 3CCRF 3RA6A 3CCEF 1YI2F 2GLZA 1VQMF 5G4UC 3N4YA 4XCQA 1RA4A 3G4SF 4EI8A 3CMEF 2AIFA 1GZ0A 3LFOA 2I6DA 1M90H 5HXZA 5EO3A 3VI6A 5HWEA 3JCMM 1DT9A 1CN7A 1W41A 5GIPC 3NMUC 1W3EX 2F9ZC 4X3LA 3PLAC 1QVGF 3CCUF 1IPAA 2QEXF 1VQNF 3CC2F 3SIVA 2OTLF 2FGYA 1VQ6F 3LWVC 3NK6A 3J81M 4X3MA 5DCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GIN C;  3ON1 A;  2LBW A;  3PAF A;  3N4Z A;  3LWO C;  1M1K H;  5EWR A;  3OBW A;  3LWQ C;  1Q81 H;  1K9M H;  5G4V C;  3AGK A;  3CC4 F;  1X7P A;  1QVF F;  3O85 A;  3HAX D;  2OHW A;  3I55 F;  1PXW A;  2OZB A;  3G6E F;  1VQ9 F;  1KQS F;  1GO0 A;  2QA4 F;  1T0K B;  3V7Q A;  3NK7 A;  3RA5 A;  3CMA F;  2KTV A;  2LBX A;  2QI2 A;  1E7K A;  3J80 M;  2FC3 A;  3CCJ F;  3CD6 F;  1YIJ F;  1Q82 H;  3HJW C;  4LCK A;  1S72 F;  1GO1 A;  1Q7Y H;  3CPQ A;  1KD1 H;  5GAN K;  5A2Q M;  1VQL F;  4BY9 D;  1X52 A;  1W40 A;  1YIT F;  2CZW A;  1SDS A;  3CPW F;  2HVY D;  1RLG A;  5GAP K;  3IR9 A;  3G71 F;  3MCA B;  1VQK F;  5FJ4 C;  1X7O A;  1NJI H;  2JNB A;  3LWR C;  3I56 F;  3WXM B;  4BW0 B;  1K8A H;  3E20 B;  1VQ4 F;  3SIU A;  1VQP F;  1CK2 A;  3NVK E;  2BO1 A;  1XBI A;  5GIO C;  4TZZ A;  3J7A R;  3OW2 F;  1JJ2 F;  5IT9 M;  1N8R H;  1W2B F;  3CXC F;  1VQ7 F;  1H7M A;  2VGM A;  3CCS F;  1ZWZ A;  1VQO F;  1Q86 H;  1KC8 H;  3CG6 A;  3CCQ F;  2WAL A;  2KTU A;  4NUT A;  1VQ8 F;  3OBY A;  1VQ5 F;  1YJ9 F;  2OTJ F;  2KG4 A;  3CCL F;  1YJW F;  2ALE A;  1YHQ F;  3VMF B;  1NMU B;  1YJN F;  3CCV F;  3CC7 F;  3NVI B;  3JAM M;  3V7E A;  3GYQ A;  3LWP C;  1K73 H;  3CCM F;  5FLX M;  4C4W C;  3E1Y A;  2VGN A;  3FFM A;  1W42 A;  3CCR F;  3RA6 A;  3CCE F;  1YI2 F;  1VQM F;  5G4U C;  3N4Y A;  1RA4 A;  3G4S F;  3CME F;  2AIF A;  1GZ0 A;  3LFO A;  2I6D A;  1M90 H;  5EO3 A;  3VI6 A;  3JCM M;  1DT9 A;  1CN7 A;  1W41 A;  5GIP C;  3NMU C;  1W3E X;  4X3L A;  3PLA C;  1QVG F;  3CCU F;  1IPA A;  2QEX F;  1VQN F;  3CC2 F;  3SIV A;  2OTL F;  1VQ6 F;  3LWV C;  3NK6 A;  3J81 M;  4X3M A;  5DCV A; 
#chains in the Genus database with same CATH topology
 4BVT A;  4ZHY B;  3PAF A;  4C8G A;  3KJK A;  5LOV B;  3N4Z A;  1SZQ A;  3LWO C;  1M1K H;  3DDN A;  2RHL A;  5LYJ B;  1X7P A;  1COM A;  4G4X A;  4KWE A;  1DBF A;  2OHW A;  5CA1 B;  1KNJ A;  1JFF A;  3JAW A;  1TUB B;  1VQ9 F;  1KQS F;  1GO0 A;  1PF5 A;  5HY2 A;  1RQ7 A;  2ZVY A;  3F0F A;  5IJ9 A;  2UYN B;  1ONI A;  3HKB A;  3J80 M;  3LYB A;  2FC3 A;  4TV8 B;  1W5A A;  3CCJ F;  3K2X A;  3ZOP A;  4C81 A;  5LOV A;  5EIB C;  3JAL A;  2H6L A;  3C9R A;  2BTU A;  3VYT C;  1S72 F;  5LXT B;  1KD1 H;  5FNV B;  5A2Q M;  3CYQ A;  1X52 A;  3M84 A;  1RLG A;  3IR9 A;  4WBN B;  4X1Y A;  4FFB B;  1K8A H;  4ERH A;  2AMT A;  1VQ4 F;  1VQP F;  2VAP A;  4BT2 A;  1OFU A;  4I50 B;  4G4Z A;  1W58 1;  5FNV A;  4BT3 A;  2CHS A;  1H7M A;  2VGM A;  3OON A;  4WBN A;  4O2A A;  2HP3 A;  3CCQ F;  2EWC A;  1Z5W A;  4X20 A;  1IV1 A;  4G4Y A;  1YGY A;  3OBY A;  5MN6 A;  5EB1 B;  5HY4 A;  5JCO C;  2OTJ F;  2KG4 A;  3BYQ A;  4O2B A;  3CCL F;  1R1M A;  1YHQ F;  2Z1T A;  3JAT A;  1NMU B;  3EOR A;  3KJJ A;  4R40 B;  3VMF B;  4ZHQ B;  1YQN A;  3CC7 F;  2BTQ B;  5HP8 A;  4BVQ A;  3S0W A;  3RYF B;  4O4L B;  1U3P A;  4DXD A;  1IV4 A;  3V3T A;  2VAW A;  2CW4 A;  1K73 H;  4NWO B;  5FLX M;  5ITZ B;  4C4W C;  4NQ3 A;  2VGN A;  3C9U A;  5CB4 B;  4TUY B;  3CB2 A;  3JAS B;  3G4S F;  4DRX B;  2AIF A;  2CSL A;  4ZHQ A;  1GZ0 A;  3RYI A;  1M90 H;  5HWE A;  3RYF A;  1DT9 A;  3QTY A;  3WGN A;  4B62 A;  2F9Z C;  4X3L A;  5C8Y B;  5ITZ A;  3PLA C;  4ZOL A;  4TV9 B;  2OTL F;  2FGY A;  3LME A;  1VQ6 F;  3RE3 A;  3VOB A;  2LCA A;  1SA0 A;  3T80 A;  3CYP B;  3MDO A;  5GIN C;  1X25 A;  3ON1 A;  4PWT A;  2LBW A;  4DRX A;  4EB6 B;  5B8F A;  4IIJ B;  5LP6 C;  3LWQ C;  1Q81 H;  5JCO A;  1QVF F;  2Z1E A;  3O85 A;  5HY0 A;  1U40 A;  5IYZ B;  2QA4 F;  1OAP A;  2NMU A;  3C8L A;  3NK7 A;  3RA5 A;  4U3J A;  2KTV A;  3S02 A;  5BMV A;  1JFF B;  3JAW B;  1U43 A;  2YXZ A;  3Q8H A;  1XHO A;  4EB6 A;  3GHZ A;  5IJ9 B;  1YIJ F;  3HJW C;  4BT5 A;  4IIJ A;  5DCV A;  3HKB B;  4O4J A;  4X1I A;  1Q7Y H;  4LNU A;  3LDT A;  3CPQ A;  1VQL F;  5IYZ A;  5LP6 B;  3JAL B;  1SDS A;  4E6E A;  2L26 A;  5HXU A;  4C82 A;  4F6R A;  1VHA A;  3MCA B;  1VQK F;  5FJ4 C;  2VAM A;  2KGW A;  4BW0 B;  3E20 B;  4BT6 A;  4ZI7 A;  2RHH A;  2Z1F A;  2HS4 A;  5LA6 A;  2BO1 A;  4X1Y B;  5GIO C;  3ELC A;  3RYC A;  4I4T A;  2ZOV A;  4YJ3 A;  2HS0 A;  5IT9 M;  5LP6 A;  1W2B F;  1UFY A;  1VQ7 F;  3QUW A;  4X1K A;  3CCS F;  1QU9 A;  1ZWZ A;  5EZY A;  5J2U A;  3HKE A;  5EIB D;  4G88 A;  4EI7 A;  3FD6 A;  4O2A B;  1YJ9 F;  1JN1 A;  3VCZ A;  3IEW A;  1NQ3 A;  4X20 B;  5HY1 A;  1Q8R A;  2AIZ P;  5AVM A;  2UYJ A;  5MN5 A;  1YJN F;  3V7E A;  3MQW A;  2GVI A;  4O2B B;  1GX1 A;  2HQS C;  3CCM F;  3P4E A;  3JAT B;  4C8I A;  3FFM A;  3IEQ A;  3CCR F;  3RA6 A;  1U3L A;  5G4U C;  2ZAU A;  3MCQ A;  3VYS C;  4G4V A;  3CME F;  1CLI A;  1RQ2 A;  3TD3 A;  2PHN A;  4ZK7 A;  2I6D A;  5HXZ A;  3ZO8 A;  3F6M A;  3JCM M;  3E22 B;  1CN7 A;  2Z1U A;  1W41 A;  3ESJ A;  1FFX B;  2Q1Y A;  3RYI B;  1QVG F;  2CHT A;  3WPW A;  3WGJ A;  2H8C A;  1J7H A;  3UT5 A;  4ZOL B;  1W5F A;  1H47 A;  5EWR A;  3L7Q A;  3VTI C;  1SA0 B;  2QTP A;  4HNA A;  5G4V C;  3AGK A;  3GTZ A;  3HKD A;  3WJQ A;  3E22 A;  3HAX D;  1JD1 A;  1FFX A;  4EI9 A;  3V7Q A;  1XV2 A;  2LBX A;  2QI2 A;  3JAK B;  3JAR B;  1E7K A;  3HTN A;  4U3J B;  4BVS A;  5BMV B;  3KIZ A;  4O4I A;  4LCK A;  3WGM A;  3N2G A;  2W8B C;  1GO1 A;  3FD5 A;  5GAN K;  5IJ0 A;  4BT7 A;  4BY9 D;  5KMG A;  3WJP A;  4YJ2 A;  2CZW A;  5EAZ A;  2HX0 A;  4O4J B;  4X1I B;  4LNU B;  1KNK A;  3JAK A;  2B33 A;  2Q1X A;  3JAR A;  2DYY A;  3VYU C;  5HP7 A;  3S0Y A;  3LWR C;  3I56 F;  1NJI H;  3M4S A;  5GON A;  3SIU A;  3P0Z A;  3NVK E;  4F6R B;  2RHO A;  4O4H A;  4TZZ A;  4ZI7 B;  2I6R A;  1JJ2 F;  1N8R H;  4G4W A;  3FBA A;  5LA6 B;  3ERN A;  3RYC B;  5JH7 A;  1W5E A;  4I4T B;  5CA0 A;  1VQO F;  1Q86 H;  3K12 A;  3CG6 A;  2HP0 A;  4YJ3 B;  3RYH A;  4B5C A;  5JQG B;  1ODE A;  2ZVZ A;  3MBM A;  4ZHV A;  3F0D A;  2WAL A;  3F0G A;  3IKF A;  4NUT A;  4X1K B;  4B45 A;  1VQ8 F;  5EZY B;  3VOA A;  5J2U B;  3HKE B;  1VQ5 F;  4M8I A;  5EYP A;  2MQE A;  2R6R 1;  2UYP A;  2IQQ A;  2ALE A;  1YJW F;  1QAH A;  3CCV F;  3JAM M;  3LWP C;  4IHJ B;  1FNJ A;  1RLU A;  5JQG A;  3S03 A;  2G9I A;  3TD5 A;  3E1Y A;  3S06 A;  1IV3 A;  1YI2 F;  2GLZ A;  3HKC A;  4I55 A;  1VQM F;  2OTM A;  3ZP7 A;  1TVK A;  3N4Y A;  3I3F A;  2RHJ A;  1T0A A;  2GZL A;  3LFO A;  3B6N A;  3I7T A;  3VI6 A;  5KX5 A;  5EB0 A;  1W57 A;  3M1X A;  3N2K A;  4IHJ A;  3NMU C;  3DC2 A;  1IPA A;  2QEX F;  1VQN F;  3SIV A;  3WPX A;  5LYJ A;  1UI9 A;  1H48 A;  5CA1 A;  1TUB A;  3VO8 A;  3OBW A;  1K9M H;  3CC4 F;  3UT5 B;  2UYN A;  3S0H A;  2R75 1;  1PXW A;  2V9Y A;  3I55 F;  3G6E F;  2OZB A;  1T0K B;  4TV8 A;  3VIU A;  4HNA B;  1VH8 A;  4U39 A;  3CMA F;  1JY8 A;  3HKD B;  1XRG A;  3IKE A;  3WGK A;  3CD6 F;  5LXT A;  1W59 A;  2BTO A;  1QD9 A;  2HS3 A;  1Q82 H;  2H8E A;  3P10 A;  2LBT A;  1FSZ A;  3QHD A;  3C9S A;  4BT4 A;  4FFB A;  1W40 A;  4B46 A;  1YIT F;  4O4I B;  3CPW F;  1FNK A;  3N2G B;  2HVY D;  5GAP K;  2YYE A;  3K14 A;  3G71 F;  5IJ0 B;  1X7O A;  5KMG B;  4I50 A;  2JNB A;  4YJ2 B;  3WXM B;  2CVL A;  3D00 A;  1CK2 A;  3KE1 A;  1XBI A;  1W5B A;  5GON B;  3J7A R;  3OW2 F;  5MN4 A;  3KHN A;  3CXC F;  2IAF A;  4O4H B;  2Z01 A;  1KC8 H;  1IV2 A;  5J2T B;  2ZOD A;  4C8E A;  1W55 A;  2KTU A;  3K0T A;  5JH7 B;  1VQV A;  5CA0 B;  3RYH B;  2HP0 B;  2P6Y A;  2VXY A;  4RHA A;  4O4L A;  3U0O A;  3IMP A;  3NVI B;  5EYP B;  5CB4 A;  3R0P A;  3GYQ A;  4TUY A;  3F0E A;  3ZP4 A;  2K1S A;  5JVD B;  3TD4 A;  5J2T A;  3JAS A;  2PMP A;  4BVR A;  1VK3 A;  2UZH A;  3HWU A;  1W42 A;  2HRY A;  2DT4 A;  3CCE F;  4XCQ A;  1RA4 A;  3JVH A;  4EI8 A;  5C8Y A;  3HKC B;  3V4D A;  4I55 B;  4RQO A;  2CWJ A;  4TV9 A;  1TVK B;  5EO3 A;  2UYK A;  1Z5V A;  4ZHW A;  5GIP C;  1W3E X;  5JVD A;  2N48 A;  3FPI A;  3CCU F;  2HRU A;  2IG8 A;  3CC2 F;  3D54 A;  2RB9 A;  5KX5 B;  3WGL A;  3D01 A;  3N2K B;  3LWV C;  3NK6 A;  3WJR A;  3C9T A;  3J81 M;  4X3M A;  2ZF8 A; 
#chains in the Genus database with same CATH homology
 5GIN C;  4BVT A;  3ON1 A;  2LBW A;  3PAF A;  3N4Z A;  3LWO C;  1M1K H;  5EWR A;  3OBW A;  3LWQ C;  1Q81 H;  1K9M H;  5G4V C;  3AGK A;  3CC4 F;  1X7P A;  1QVF F;  3O85 A;  5HY0 A;  3HAX D;  2OHW A;  3I55 F;  1PXW A;  2OZB A;  3G6E F;  1VQ9 F;  1KQS F;  1GO0 A;  4EI9 A;  5HY2 A;  2QA4 F;  1T0K B;  3V7Q A;  3NK7 A;  3RA5 A;  3CMA F;  2KTV A;  2LBX A;  2QI2 A;  1E7K A;  3J80 M;  2FC3 A;  3CCJ F;  3CD6 F;  4BVS A;  1YIJ F;  1Q82 H;  3HJW C;  4LCK A;  1S72 F;  1GO1 A;  1Q7Y H;  3CPQ A;  1KD1 H;  5GAN K;  5A2Q M;  1VQL F;  4BY9 D;  1X52 A;  1W40 A;  1YIT F;  2CZW A;  1SDS A;  5HXU A;  3CPW F;  2HVY D;  1RLG A;  5GAP K;  3IR9 A;  3G71 F;  3MCA B;  1VQK F;  5FJ4 C;  1X7O A;  1NJI H;  2JNB A;  3LWR C;  3I56 F;  3WXM B;  4BW0 B;  1K8A H;  3E20 B;  1VQ4 F;  3SIU A;  1VQP F;  3D00 A;  1CK2 A;  3NVK E;  2BO1 A;  1XBI A;  5GIO C;  4TZZ A;  3J7A R;  3OW2 F;  1JJ2 F;  5IT9 M;  1N8R H;  1W2B F;  3CXC F;  1VQ7 F;  1H7M A;  2VGM A;  3CCS F;  1ZWZ A;  1VQO F;  1Q86 H;  1KC8 H;  3CG6 A;  3CCQ F;  4EI7 A;  2WAL A;  2KTU A;  4NUT A;  1VQ8 F;  3OBY A;  1VQ5 F;  5HY4 A;  1YJ9 F;  2OTJ F;  2KG4 A;  5HY1 A;  3CCL F;  1YJW F;  2ALE A;  1YHQ F;  3VMF B;  1NMU B;  1YJN F;  3CCV F;  3CC7 F;  4BVQ A;  3NVI B;  3JAM M;  3V7E A;  3GYQ A;  3LWP C;  3V3T A;  1K73 H;  3CCM F;  5FLX M;  4C4W C;  4NQ3 A;  4BVR A;  3E1Y A;  2VGN A;  3FFM A;  1W42 A;  3CCR F;  3RA6 A;  3CCE F;  1YI2 F;  2GLZ A;  1VQM F;  5G4U C;  3N4Y A;  4XCQ A;  1RA4 A;  3G4S F;  4EI8 A;  3CME F;  2AIF A;  1GZ0 A;  3LFO A;  2I6D A;  1M90 H;  5HXZ A;  5EO3 A;  3VI6 A;  5HWE A;  3JCM M;  1DT9 A;  1CN7 A;  1W41 A;  5GIP C;  3NMU C;  1W3E X;  2F9Z C;  4X3L A;  3PLA C;  1QVG F;  3CCU F;  1IPA A;  2QEX F;  1VQN F;  3CC2 F;  3SIV A;  2OTL F;  2FGY A;  1VQ6 F;  3LWV C;  3NK6 A;  3J81 M;  4X3M A;  5DCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...