4U01A

Hcv ns3/4a serine protease in complex with 6570
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and structural diversity of the hepatitis C virus NS3/4A serine protease inhibitor series leading to clinical candidate IDX320.
pubmed doi rcsb
source organism Hepatitis c virus (isolate con1)
molecule tags Hydrolase
molecule keywords Non-structural 3 protease
total genus 37
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, J
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u01A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4u01A01
2XYAA 3PMHB 1P01A 1F92A 3BG8A 3F68H 4U2WA 1E38B 4I32A 3GY8A 1L1GA 1EX3A 1TA2A 2H1UA 1GHWH 1F0SA 1S0RA 3FAOA 4D7FA 3CS0A 1YM0A 3SQEE 3SZEA 5LH8A 2TGPZ 2R0KA 1C2KA 4X1PU 1P8VC 4ZXXH 1JIMA 2B9LA 1SGCA 1TYNA 2VGCC 1TGSZ 5FXLA 3BTEE 2XRCA 2J34A 2HNTC 2BD2A 1ZMJA 3E8LA 4X1RU 4ISLA 1PQ8A 2XBWA 4GCHF 4WWYA 1Y3UA 4XBBA 5C3NA 2BVXH 1YPMH 3F6UH 5TCCA 4I8JA 3ZZAA 3PV5A 1QBOA 3M7TA 4J2YB 1XVOA 2AMPA 2JKHA 1FLEE 4U30A 1BZXE 1DWEH 1P2QA 3A8CA 4NIVA 4K1SA 5DKMA 4NZQA 2AEIH 4ZHAA 3AW0A 5FX6A 1K2I1 1G30B 2SFAA 1W10U 1UO6A 1SGTA 4GSOA 1NU7B 1W13U 1HIAA 3PWCA 5EXNA 2PKSB 1V2PT 1UMAH 1INCA 4LOYH 3LGYA 3T27A 1YBWA 1TLDA 3RLYH 3BTQE 4ZHMU 1RTFB 2RCEA 2PW8H 3BEUA 1LMWB 2C8WB 1CT0E 3UWJH 3PM3A 1NT1A 1WAYB 1GI0A 3MO9A 3MTYA 3A88A 4Q7XA 3T62A 2CHAC 2R2WU 2H5CA 2W3IA 1ABIH 1TMBH 1BTYA 1L1JA 1D3DB 4FUCA 5F03A 4VGCC 4NFFA 3D65E 5L6NH 1O2YA 1LTOA 1RFNA 1IQIA 1TPPA 5T1VA 3SOSA 3ZVGA 1ZLRA 3LDXH 4Y6DA 7GCHF 2ZDNA 5AHGH 1GJ7B 3VXFH 3UOPA 4IC6A 3RMMH 3VB7A 4X1QU 1D6RA 1OWDA 2PKAA 3IG6B 3UR6A 2F9PA 4K5ZA 1OP2A 1E34B 3MO6A 1GBMA 3AW1A 3GDUA 4FU7A 1KDQA 1K1LA 2LPRA 1OYQA 4YLUA 1IOEA 3U9AH 4F49A 2C8ZB 2EEKA 1P2OA 2KAIA 3IWMA 4YT6H 1OXGA 4DG4A 1BBRE 3QLPH 1KTSB 4MPVA 2VIQA 1QJ7B 1A61H 3H7TA 4TPIZ 2ZFQH 3QX5H 4ABHA 4I8LA 2HGTH 1C5ZB 2CGAA 2OC8A 4X8VH 4E7RG 2HNTE 3MYWA 1Y3VA 1A2CH 4X2YA 4YOIA 1TABE 2FOAA 3RXAA 2ZHFH 1MCTA 1SB1H 3TH3H 4X6NA 3RU4E 1K1MA 1JXPA 1TBZH 3ATMA 3QUMP 1CBWB 4ZKOU 2ZI2H 1T8MA 4TYDA 4CR9A 1DSTA 4B2BA 1BITA 2SGAA 3GY5A 1O30A 1P3EA 3PYHA 1BHXB 3TU7H 4AX9H 1SVPA 3TGIE 3M3VA 2FS9A 2GTBA 4Y79A 2DE9A 1TNLA 1D3PB 1N1LA 1OSSA 1OWIA 2BM2A 4ABFA 1PPBH 3A7VA 1FAXA 2WPHS 3U8OH 3HPTB 4DCDA 1SGFA 2GKVE 2Z9JA 1TX8A 1G3DA 2CXVA 1LHDH 4NIXA 4K60A 3PB1E 1KXBA 5J4SA 1C2EA 1A0LA 4DT7B 1MTWA 3R0FA 2D26C 4TWWA 5C1XA 1LVMA 4UEHH 4XSKU 1DWDH 2QF0A 2CF9H 1ZGVA 3EYDA 4M9FA 3E91A 1GGDB 4FVDA 1GVKB 1NRSH 3PV2A 1EJMA 1O3PB 4ISHH 5J4QA 1GBLA 3QWCH 1LPGB 1V2UT 2A5KA 3ZYDA 1O37A 1FN6A 1W2KH 1AHTH 1GJDB 1WQSA 1BRBE 2WUBA 1LHCH 3BEFB 5DP4A 1P06A 1C5MD 1S81A 1TNJA 2HLCA 4X0WU 1J16A 3ZV8A 1ZMLA 5JBAS 5ETXA 2J38A 4DVAU 1ELCA 1A1RA 2CMYA 1UVUH 4OS1A 4X2XA 2J92A 2FOCA 2O8LA 3GCNA 1ESBA 3E1XB 4H42U 1O32A 4X2WA 1SLVB 1PPFE 5B6LA 1EZXC 4GLYA 2OK5A 3NZIA 1JMOH 4DJZB 4NZLA 1NRNH 1O3GA 4WMFA 2B7DH 2IPHA 2NWNA 1K9OE 4AGJA 1XUFA 2VIVA 2ZGCA 1C1UH 1PFXC 1LVBA 1XUJA 3R3GB 3Q3XA 2ZP0H 4AFUA 1XM1A 2ESTE 1GL1A 3A89A 4BAOB 1C5PA 1QY6A 1ELEE 3TK6A 1ELDE 2TBSA 1AIXH 2Y81A 5CE1A 3RU4T 2PHBA 4IN2A 1ID5H 2HPQH 4ABGA 2GT7A 3PMBB 5EXLA 1G9IE 1RTLA 1O2MA 1DOJA 1VITF 5E2OA 4AFZA 1CT2E 4BANB 2C90B 1BQYA 2FIRH 1NFWA 2UWPA 4ZMAH 3RMLH 1EOJA 3URDA 1HV7A 2YOLA 1IQKA 1TB6H 1DLKB 2QAAA 5C1YA 1NZQH 1GBBA 1PYTC 3ZVEA 1UK2A 1GJ5H 3AAUA 4O9VA 1V2TT 1W12U 1SL3A 1W7XH 5A09A 4Y7AA 5ABWA 2ZU2A 1BDAA 2VWNA 2Y7ZA 3SJKA 1E35B 1GBAA 1JWTA 1RRKA 1FY4A 5EGMA 1O2TA 4CRCA 3SNDA 1TRYA 1W3CA 4FU9A 1GJBB 1LKAA 3RXRA 3E90B 1IHTH 1EJAA 3B23B 3EA9A 3GYMA 2D1JA 1DANH 1GBFA 3LONA 1OWJA 5ESBA 2ZO3H 2GCHF 4CHAB 4JCNA 3I77A 4BNRA 1HJ8A 5A8YA 1AVGH 1Z7KA 3U8TH 2OP9A 3B8JA 4B74A 5C67A 1C5NH 1FUJA 2UWLA 1WU1A 1T7CA 3TGJE 1QJ1B 1WSSH 1NFUA 3L3TA 1QA7A 8ESTE 3A8DA 1PQ5A 1SBWA 4HI3A 3TVJB 3RMNH 1SLWB 4TY7A 4WVPE 1Y5UT 1JBUH 1DDJA 3UY9A 2NU4E 3PMAB 3KQBA 3RXOA 1KXFA 3HGPA 1RTKA 1T32A 4JZDH 3OX7U 1EPTA 1TQ0B 1DXWA 4UDWH 1PPEE 3VFEA 2Q6FA 1FIZA 5BRRE 1HGTH 4BTIB 1TGCA 1YCPH 2UUKB 4AORA 1A0HB 4I7YH 1Y3XA 1GHZA 4ISIH 1UCYH 2AH4X 3SHCH 2UUFB 4Q80A 2A45B 1B0EA 4Y76A 1C2MA 4ZKRU 3H09A 2ZCLP 3HKJB 1DVAH 3STJA 2WYGA 4BTUB 3M7QA 1BTHH 4FUGA 3MH4A 2FOEA 1YPGH 1P2KA 1TMTH 4A1XA 5DO4H 1ETRH 1CSOE 5GJ4B 3OU0A 1NC6A 4OS6A 1LDTT 4HFPB 2IOTA 4AZ2B 3RM2H 2PV9B 2Z9IA 4OS7A 2HNTF 3CP7A 1MTVA 2C4FH 3VGCB 5G4BA 1MKWH 1ZPBA 1K28D 1SQOA 1WTGH 3LOXA 2IJOB 1T4UH 3ZVCA 1MBQA 2A4GA 2RA3A 4NA8A 2BX3A 1F2SE 2BMGB 5I46H 2UUYA 3O8RA 1CU1A 5HM9A 1H1BA 1GI4A 4X2VA 2FLRH 1PQAA 1HAIH 1CQQA 2WHXA 4YO9A 2UUJB 2VVVA 1BMNH 4VGCB 3E3TA 1S82A 2W7UA 1GMDF 5F8XA 1Y8TA 1NN6A 4NCYA 1C1PA 3V0XA 3MH7A 1HCGA 2IN2A 5DGJA 2ZDLA 5HYOA 1AB9B 2VIPA 1XUIA 2VU8E 3RXGA 1PPCE 1GBEA 1ANEA 1SOZA 4QT8C 1AVWA 2WPIS 2HOBA 4TPYA 3NCLA 2OUAA 2ZTXA 5A0AE 4Y0ZE 4MTBA 1UHBA 3GICB 1FN8A 3GCOA 3CENA 5C5NA 4AYVB 3EGKH 1GJ8B 2BD9A 1O2QA 2PKSC 3SN8A 1XUKA 1MKXK 1S5SA 3M37A 1AE5A 2G52A 4E05H 1N8OB 1GMHG 3BTTE 4GVUA 2SGEE 4FUBA 2BXUH 1HXEH 5IYTA 3O8DA 2OBOA 2EC9H 3I29A 4X8UH 4JMYA 5C1UA 2R0LA 3SHAH 2A4OA 1SC8U 3DUXH 5DP6A 1L1NA 3RXKA 1KLTA 5FBEA 1RGQA 4JZEH 3PV4A 3M5NA 1Z8RA 3ENSB 4CREA 5C2ZA 2HPPH 4ZAEA 2FX4A 4AB8A 1AUJA 2NU1E 3RXDA 2TGDA 1AVXA 1HAGE 2A2XH 3SV8A 1XKAC 1BTUA 3BN9A 1T31A 1O39A 1GHVH 2FM2A 3SU0A 2ZF0H 4AOQA 3UFAA 3MU1A 4R0IA 3RXPA 2FS8A 1EPTB 2PTNA 1NM6A 3C27B 3EQ0H 5EODA 4X6OA 4NSYA 1V2WT 3SJIA 3S9BA 1IQMA 4ZXYH 2TIOA 3M35A 5EG4A 3Q77A 5L2ZH 1PPZA 1QL8A 2SGDE 1EQ9A 1FONA 2WZQA 1VGCB 1V2RT 2PGQB 4B6FA 2VVUA 3S7KB 1P3CA 2BDAA 3DHKH 2EI6A 5A0BA 2P3UB 6CHAB 1EB1H 3S9AA 4BAKB 1C9TA 3KCGH 3ATKA 3E0NB 4D76A 1MTUA 1HIAB 1O3AA 4Y8ZA 2XBXA 2J95A 1AWFH 3M5MA 1GI9B 4YOGA 2Q6GA 5GDSH 1P2IA 2SNWA 2ULLA 2OBQA 2YNBA 2G4UA 1T8OA 2W5EA 1FQ3A 3E0PB 1YPJH 1DPOA 2FXRA 2ZGBH 1O5GH 1GJ4H 3GCTG 1A46H 1QHRB 2ANYA 3TH2H 1O2XA 3A8AA 1DX5M 4YM9A 2FYRA 3P95A 2Z3DA 1D9IA 2AGEX 4H4FA 3M3SA 3BF6H 2XXLA 3KEEA 1Z1JA 2AYWA 3KN2A 1ETTH 1O3LA 3RMOH 2IJD1 1A5HA 1V2QT 2B0FA 3OY5U 1KIGH 1P05A 1GBHA 4DIIH 1UTOA 3MI4A 1SGQE 2Z7FE 4ZROA 4CHAC 1GMDG 1G3EA 5SGAE 1FV9A 4LZ4B 3LGUA 1ANDA 1O3OA 3RXIA 3SJOA 4A7IB 1Z6EA 1AGJA 5E2PA 1DT2A 3PWBA 1CA0B 2SGQE 5A0CA 3K9XB 1P9UA 3RXVA 1C1SA 3NKKA 2VH0A 1O2ZA 4X8TH 5B6OA 3DFLA 1GCDA 1HJ9A 5DPAA 1T8NA 1QA0A 4D8NA 4U32A 2Z3EA 3E16B 4CBNA 1TGTA 1HB0B 1MU6B 3T29A 2FLBH 3AVZA 3TGKE 2BLQA 3ATWA 1JOUB 1JRTA 1V2MT 3NXPA 4UD9H 2ZDVH 4GPGA 4JYTA 5EXMA 1TNGA 2C8XB 5C5OA 1QRZA 3ATIA 1D3TB 1VR1H 1TX7A 1FIWA 5E8EH 2F9UA 1O3KA 1TWXB 2F4LA 2V35A 2ZFSA 4IMZA 1ARBA 2YNAA 4NWLA 3TNSA 4YOJA 4TWYA 3L33A 1DLEA 1GBKA 4BXWA 1DS2E 4MVNA 2W7SA 1XXFA 1W0YH 2CHAB 3V12A 1O2RA 4X1SU 1NY22 1S0QA 1Z8JB 6GCHF 8GCHG 1GDQA 2EI8A 4ISNA 1TNHA 3TJVA 2XNIA 1C4Y2 3QDZB 1BJUA 1GCTC 5FX5A 3ZV9A 1V2LT 2AERH 2Y5GA 3U69H 3QN7A 7GCHG 4PROA 1ELTA 1SGRE 3FFGA 4THNH 3MU5A 3MH5A 3D62A 3ZZ8A 2CF8H 3RLWH 2VGCB 4Y7BA 1DY8A 4CH8B 4I33A 1Y59T 1B7XB 2ZC9H 1PYTD 2BX4A 2G4TA 4I8HA 1AB9C 1RD3B 2ZQ1A 1MAXA 2ZIQH 2WPLS 1GMCF 1ZJDA 1G2MA 4Q7ZA 3FZDA 2BQ6B 1GHAG 1Z8IB 4ZKNU 1NPMA 4UE7H 3H5CB 2BLOA 1OOKB 3HK6B 2C3SA 1EUFA 4IBLH 1BHXF 4RKOB 1SGNE 5EOKA 1ARCA 4Q7YA 2GV6A 2O8UA 1A0JA 3PO1B 2QXHA 2HWLB 1ORFA 1O3JA 1KLIH 1QJ6B 1EATA 1CGHA 1O3DA 1TX6A 1DXPA 3K2UA 3RM0H 3ZZ9A 3PROA 3LGWA 1FDPA 3RXJA 3KF2A 1GI6A 2Q1JA 5GWZA 1UCYK 1GBIA 2HALA 4ABIA 5DP8A 5A8XA 3A7ZA 5L2YH 1IQEA 1C1RA 1OWEA 3BTME 3FVFB 1XUGA 2H9EH 1O3HA 4WJG2 1G37A 1ZSKA 1BMAA 2K1QA 1BMLA 1CO7E 3O8BA 1TOMH 1SPJA 2SGPE 1HNEE 2QGRA 3SUDA 4RSPA 2A2QH 3KQCA 3U1JB 1EAIA 3MHWU 4GHQA 1CBWC 3DT0H 2OC0A 3SV2H 2GCTB 1GBCA 1NRRH 1Y5BT 2AMDA 1CGIE 1O3CA 3MH6A 1FPHH 4IMQA 3BEIB 1UVOA 1EAWA 2PSYA 1SFQB 2ZU3A 5F8TA 2BB4A 1GI1A 2BD3A 3MNBA 2WV4A 1HFDA 2FPZA 2ZHEH 3NPSA 5LPFA 1BB0B 3TK9A 1GJ6A 2FDAA 4CR5A 1O3MA 1V2ST 1THPB 4KKDA 4FUIA 1ZHRA 2ZU4A 1A3EH 2BY9X 3SNBA 1O2PA 4XDEA 4INHA 1D3QB 3D49H 1ZR0A 1L4DA 3ZZ7A 1GI7B 2ODYB 1GI8B 1HRTH 1HXFH 2ANKH 2NU3E 5JPMH 1TGNA 2QCYA 2FI5E 2THFB 1W0ZU 1ANCA 1SSXA 4IC5A 2EI7A 3ODDA 1E37B 2XW9A 3W94A 1IQHA 2A7HA 4CRGA 2JETB 4NFEA 1THSH 2P3FH 2TRMA 3Q00A 1SR5C 4MNWA 1YPHC 2Y5FA 1O5EH 3BTWE 1LHFH 1N6XA 1ZHMA 1UHBB 3RC6A 1GHBF 1MKXH 2FYQA 3G01A 3NK8A 5FCRA 2I6QA 1YC0A 1H8IH 4IGDA 2ZFTA 3LU9B 1LQEA 2XBYA 3ZVAA 5DP9A 4A5TS 1C5UA 1ELAA 2D8WA 1VCPA 1EOLA 3SUFA 4YLQH 1JIRA 1LQDB 1AKSB 3P8OA 5JB8S 4ZKSU 1Y5AT 1BBRK 3IITA 2ZPQA 2SGFE 3RXBA 3S0NA 1C2HA 1UTPA 2OINA 3RXMA 3MFJA 2C8YB 5GNDA 1NROH 1SOTA 2A7CA 3EDXB 1C1QA 4Q2KA 1HJAC 1C5XB 1WBGB 5F6MA 1VITG 2H9TH 1S6HA 2ZEBA 1GMCG 1DITH 4H6TA 2J2UA 3F9GA 2ZFFH 1J14A 1ZPZA 1C1OA 2ANMH 1HJAB 2ZA5A 5AFZH 1C1TA 1QURH 2SNVA 4CRDA 4F4OC 1EZQA 1QBNA 3TJUA 1O3FA 3NUMA 1ANBA 3A87A 1GJ9B 4X6MA 3MNSA 4Y11E 2V6NA 3EAJA 1LPZB 1Z71A 2WV5A 2O8TA 1YF4A 2QXIA 5CMXH 4K3JA 1AI8H 1AFQB 1YCPK 4HTCH 1O33A 2BY7X 2TGAA 3BG4B 2V3OH 1GJAB 3RP2A 2FTLE 2CJIA 1BCUH 2ALPA 3GY2A 2F83A 2O8WA 1ETSH 2XC0A 1AFQC 3F9FA 3UR9A 1P09A 3SGBE 1HAYB 3BTKE 3FP6E 1XVMA 1HAVB 3V7TA 4Z0KA 4BXSA 3P70B 3LGIA 4JK6A 1D6WA 1KXAA 2V3HH 4O3TA 2OD3B 3SZNA 1K1JA 2PLXA 1QQUA 2AMQA 5DP3A 3RUOA 5PTPA 1ESAA 1C4U2 2GZ8A 2V0BA 4GAWA 2ZQ2A 1TRNA 1NFXA 2A31A 3P92A 1QFKH 2CN0H 3LIWA 2ZKSA 4U01A 2ZCKP 1S83A 4B2AA 5I25A 2BD5A 3UWIA 2GZ9A 1G32B 1JRSA 1MU8B 2RDLA 3QTOH 4DW2U 2F9BH 3KNXA 1YCPM 4LK4A 1FY3A 1AU8A 1O2KA 1QB1A 1GDNA 1MBMA 2F91A 2ZGJA 3UNQA 3MOCA 2P3TB 2ZDKA 1LVOA 4AN7A 4RN6A 2XWBI 3O8CA 4LXBH 3SO3A 1O5AB 4KELA 5T6GA 4DOQA 4FXGH 3SU2A 2H9HA 1C5WB 1V2JT 1AMHA 1GWAA 1AFEH 1O31A 1ZRBA 1FY1A 1SHHB 1GPZA 4BAQB 1TALA 3UUZA 4AGKA 3KQDA 3ZZBA 1ZTJA 3PLPA 1EP5A 1C1MA 2ZPRA 4ZH8A 1GHBG 2FEQH 2A5IA 3RXUA 4ABAA 1UK4A 1ABJH 1O36A 2FESH 2G8TA 2RA0A 3RXHA 5K7RA 1GI3A 2ILNA 2QY0B 2BDCA 3SV7A 1O2UA 3CS7A 2ZU1A 2VIOA 2ZZUH 1FI8A 1C5VA 1SGEE 5T3HA 2R9PA 1CHOF 3A82A 1O2NA 2G55A 2ZDMA 3QK1A 4FUJA 2VWLA 1MTNB 1ELBA 2W26A 1CA8B 3URCA 2BY5X 1XUHA 7ESTE 1XXDA 4Y8YA 1KYNA 3MU0A 3E6PH 4H6SB 3AK5A 3LT3A 1BOQA 1S85A 4WMEA 4BAHB 1WYKA 1MUEB 3ZZ5A 1AE8H 1TOCB 2PSXA 5AF9H 2FZZA 4FUDA 5A8ZA 1ZSJA 5JB9S 2GCHG 4ZHLU 3Q3KA 3LGVA 3BTFE 1DICA 1DUAA 1TPSA 2NU2E 1GDUA 2ZGHA 1ZTKA 4FU8A 3SNCA 1RXPA 3SU6A 5LPEA 5FCKA 1QB6A 2ALVA 3ESTA 4TY6A 2F9VA 1QRWA 5E0JA 1VJAU 4MQAA 3RC5A 1C5LH 4X1NU 2JETC 6ESTA 1F5KU 4WMDA 1VZQH 2PUQH 3STIA 1TRMA 1GG6C 1UTMA 2ZHDA 2GDEH 4NIYA 1ZPCA 1Y3YA 1WV7H 2B8OH 4CRBA 2GMTB 1G2LA 3A7YA 2ZHWH 1L4ZA 5K0HA 2BVRH 1F0UA 5HMAA 1BRUP 1YPKH 1GHYH 4YTAA 2OTVA 1RIWC 3ZVDA 1IQLA 1HYLA 8LPRA 1V2KT 2ZTZA 3FZZA 3K6ZA 3S9CA 2ANWA 3ZVBA 1A4WH 1O3BA 2H5DA 1NESE 1TMUH 3BTDE 1W7GH 3LC3A 2TGTA 2QA9E 1BTWA 2XCNA 4JYUH 1RS0A 2F9OA 1QL7A 1SGFG 3UQVA 3PLBA 4J1YA 1C2LA 3ODFA 1YKTA 2HRVA 4K69A 2QN5T 1C5QA 4OM9A 4ABEA 1NU9A 1HLTH 3S7HB 1IQNA 1CA0C 2ZHQH 3BIVH 3QZQA 9ESTA 1OX1A 1UTNA 1GG6B 2OXSA 3A81A 5TJXA 1QGFA 2FP7B 4MG3A 4I8GA 1QR3E 2J94A 2QYIA 3ATLA 4K2YA 1V2VT 4K8YA 3UQOA 4E06H 3M5LA 4Y10E 3EE0B 1VGCC 4NA9H 1XX9A 1MCVA 2QF3A 3DD2H 4UFGH 2Y80A 4OGYA 3HGNA 1SQAA 2OC7A 1O34A 3OTPA 4X6PA 1A7SA 5TCAA 2XC4A 1QNJA 4YZUA 3P8NA 1KDQB 4KTCA 4CRAA 2VVCA 3KGPA 1AD8H 2A5AA 2G51A 1VCWA 5FHTA 1XMNB 2P94A 3GCHB 5A2MH 1TPOA 5DK1A 5EQQA 1SHYA 3SI4H 2QXJA 1B0FA 1HAHH 3QZRA 1E0FD 3UNRA 2P95A 4MPXA 4E7NA 5LPRA 3T5FH 4INLA 1RJXB 1DE7H 4ABJA 4ASHA 1MTNC 3VEQB 2ODQA 3H7OA 1BTXA 3LH1A 4FUEA 3M36A 2BOKA 1VITH 2CV3A 2A32A 3VXEH 3RXCA 2WYJA 2A0QB 1P2JA 1SQTA 2GP9B 1O5BB 4ZUHA 4I8KA 1GGDC 5GXPA 1AY6H 3V13A 1EKBB 2O8MA 1MMJN 4WF8A 1HAOH 1P57B 4CH2B 3SW2B 5FAHA 1P03A 1YLCA 2Z9GA 4I31A 1HAVA 2ZG0H 1O3IA 3LGTA 3OSYA 1B5GH 1UJ1A 2JH5D 2ZU5A 2FOHA 3MMGA 1DWCH 1N6YA 3GY7A 1Z6JH 2G5NA 4ABBA 3GY3A 1G36A 1GL0E 2LNCA 3P8FA 3U8RH 2BD4A 2BQ7B 3ELAH 4HGCA 2BLVA 1O0DH 3ZZ4A 1WCZA 3PTBA 1SGPE 4UFFH 4O97A 9LPRA 1ZMNA 1ZSLA 4DY7B 3JZ2B 1TGBA 2WUCA 1PPGE 3SU5A 2HVXA 4B6EA 2OQUA 4AG2A 1ZHPA 1KTTB 2M5TA 5IDKA 3AASA 1CVWH 2KAIB 1UTJA 4Y8XA 1HAPH 5E0GA 1RIWB 2ZCHP 4A1VA 1DWBH 1AZZA 3OY6U 1P11E 3A7TA 3KHVA 4O03A 3RXEA 3RXFA 2A4QA 1X7AC 4AFQA 2PR3A 2P8OC 7LPRA 1J9CH 2VJ1A 3F9EA 1H4WA 3UNSA 2BDYA 3M7UA 1TE0A 4O3UA 2FTMA 2RG3A 2PGBB 2FMJA 2WPMS 2ZNKH 4INKA 3T2NA 1KXDA 2GGVB 2VB0A 4DGJA 2P59A 1W8BH 4A92A 2A4RA 6CHAC 2UWOA 2GV7A 4NGAH 4OS4A 4AG1A 2R2MB 4R8TB 5LGOA 1AQ7A 1MD7A 1NTPA 3PMJA 1FZZA 4GCHG 2AIQA 3M5OA 3C1KA 3ITIA 1P2NA 4RI0A 2STBE 1MH0A 3LH3A 1QB9A 1J15A 1AN1E 4AB9A 3FP8E 1LVYA 1ZZZA 3ZZ6A 2ZWLH 4GUXA 3GY4A 4BTTB 2P93A 3BTHE 1HAZB 1V2OT 1MZDA 2GDDA 5H4IB 1IHSH 1Q3XA 4JZ1A 2ZFRH 1K1NA 3K65B 3SUGA 3MU4A 3BG4C 1ELVA 5FPYA 3GDSA 3LJJA 4ISOA 1TAWA 2DE8A 2STAE 1MZAA 5DP5A 2DUCA 1MTSA 5FBIA 1C9PA 2AGGX 1C2DA 3GDVA 1OPHB 1TONA 8KME2 3Q76A 3A8BA 2AS9A 2FOBA 1WTHD 4LZ1H 2Q6DA 5GIBA 2ZTYA 4WH6A 3M3TA 3GISB 1W11U 1UTKA 1QBVH 4WXIA 3DFJA 3HKIB 3MNCA 3SUEA 2Y6TA 1IQFA 4MDSA 5E0HA 4Y71A 4K1TA 3LC5A 1KXCA 1O2HA 2G81E 2JH0D 1C5TA 1UTLM 4NWKA 4DURA 2Z3CA 2C93B 2XTTB 4XE4A 5DG6A 3V3MA 1TFXA 2G5VA 2J9NA 5EW1H 4FVBA 1O2JA 3ZZ3A 2AFQB 1Q2WA 1C2IA 3N7OA 1DUEA 3I78A 1OYTH 1YLDA 4B76A 2FWWA 3S69A 2FOMB 3VB3A 1NS3A 2BZAA 2ZPSA 4B71A 4IN1A 3QGNB 4IW4E 2FOGA 2OQ5A 6LPRA 1F5LA 3SI3H 3ZZDA 2OCVB 1D4PB 3JZ1B 5F8ZA 3RXSA 3A7XA 1O2WA 1CHOG 1LHEH 3A85A 4WH8A 1UTQA 3BSQA 1YYY1 3BTGE 3OTJE 4D7GA 3RC4A 2W3KA 1DY9A 2R3YA 1P04A 1E36B 1TIOA 1M9UA 4CRFA 1A5IA 4JZFH 1SLXB 4WY3A 1FY5A 3GCTF 3RDZA 3EA8A 3ZZCA 1J8AA 1WOFA 2BLWA 1BRCE 1SGYE 4UFDH 3T28A 4B73A 5JBTA 4MPWA 1C5YB 2VBCA 3PTNA 4JK5A 1EAUA 1QCPA 2FX6A 4A1TA 2BDGA 1EB2A 7KMEH 1VJ9U 4NG9H 1ZOMA 2ODPA 2QXGA 1KLJH 1GI5A 1CT4E 1EASA 2XWAA 4SGBE 1SI5H 5FPTA 3SGQE 2ZDAH 1KXEA 1C4V2 1WQVH 1GCTB 4DIHH 1LHGH 4UONA 1BMMH 1ESTA 1EZUC 1C2JA 5C20A 5FPSA 3SU4A 1GI2A 4RKJB 1SLUB 1H9LB 2XCFA 1T4VH 5BPEA 1BTZA 2F3CE 3TLOA 2Y7XA 4AYYB 2VINA 4Y0YE 3KIDU 1SGDE 1F0RA 1O3EA 1IQGA 4IS5A 2XC5A 1YPLH 1YPEH 5DP7A 5HM2A 1BIOA 2FI4E 6GCHG 1GVZA 1O35A 1K21H 1ZYOA 3HK3B 5AFYH 3TIUA 1AKSA 4CBOA 3MWIU 3FP7E 1P12E 2VIWA 1O3NA 2BXTH 1F5RA 4OS2A 1Z1IA 1HAXB 3B9FH 3SJ9A 1FPCH 2R3UA 4NSVA 3U98H 3DA9B 2F9NA 1P02A 1MKWK 1ZRKA 1J17T 1G3BA 3SNAA 2H6MA 3SGAE 3A83A 1SMFE 2GX4A 2FOFA 2ASUB 1UVSH 2XBVA 3SBKA 1O2SA 5JBCS 5CHAB 4D9RA 1N8OC 1ELGA 3SJ8A 1UVTH 2PUXB 2BZ6H 1MQ6A 5EQSA 3TJNA 1CHGA 3SV9A 2WPJS 1YP9A 3A86A 1VCQA 4JYVH 2QV1A 1H9IE 8GCHF 1GBJA 5EW2H 1LPKB 3SV6A 1P2MA 4FUFA 3FANA 5EU8A 3WY8A 2BVSH 1EXFA 1T8LA 5HXFA 2Y82A 4KTSA 1CGJE 1EAXA 1UVPA 3VB6A 2WINI 1OS8A 1C5SA 2Z94A 2ZECA 4M7GA 3GY6A 1BTPA 1K1OA 4KTUA 1XKBC 4K8BA 2PWXA 4MNVA 1A3BH 4JZIA 1H8DH 1AUTC 2OLGA 1OWHA 4Z6AH 2BOHB 3W95A 3SQHE 2TPIZ 3TH4H 2QC2A 3MU8A 2BQWB 4YESB 3UREA 1KY9A 3UPEA 1NRPH 1W14U 1YGCH 5EQRA 1BUIA 1C5RA 1PJPA 2NU0E 1WXRA 1MD8A 4A6LA 1L0ZA 1AO5A 3GOVB 5T6DA 3T26A 4MPUA 1GVLA 1QRXA 3UTUH 3NWUA 2ZGXH 3GCHC 4HZHA 1EZSC 1V6DA 4GHTA 4BAMB 1O2LA 1EJNA 5EPNA 2GT8A 5GCHF 2BD7A 1FXYA 2BDIA 2Y5HA 2Z9LA 1O5FH 3RXQA 2BY6X 4XOJA 3AAVA 4KP0A 3RXTA 3SU3A 2D2DA 1OWKA 2GD4B 1V2NT 4XBCA 1TNKA 3PLKA 1C2FA 1C1NA 3F9HA 2A7JA 4B75A 1C2GA 1LCYA 3UOUA 1F0TA 2GVFA 3A80A 5GCHG 1IAUA 2WPKS 1K1PA 1DSUA 5EPYA 1LO6A 1O2VA 3ZVFA 3MNXA 3QTVH 4KGAA 1O38A 3QO6A 1OP0A 3SORA 1AZ8A 3BV9B 1GJCB 1C1WH 3VGCC 2ZFPH 2Z6BD 1YPHE 3OYPA 4NA7A 1NFYA 1SGIB 4NIWA 3D23A 2G00A 4ABDA 4AFSA 2VWMA 1P9SA 1ZGIA 2BYAX 1S6FA 1NRQH 5JYIA 2PTCE 1TQ7B 2I6SA 1TPAE 2WV9A 4FUHA 4B2CA 3SNEA 1BT7A 4MLFB 2BY8X 3QGJA 3TJOA 1THRH 2O9QA 1HUTH 2A1DB 1QL9A 1ELFA 1WUNH 4D9QA 1KSNA 1P0SH 1UK3A 4BOHA 2VH6A 1GMHF 3HATH 4B1TA 3TK5A 1S84A 2JH6D 1AWHB 1IQJA 3K6YA 2VNTA 1QIXB 4YT7H 1Y3WA 1QQ4A 1FAKH 4SGAE 3U1IB 5JDUB 1G3CA 5ESTE 2GZ7A 1FY8E 3PO1C 1V3XA 1GHXH 2VWOA 1K1IA 4WXVA 1O5DH 4XBDA 2GMTC 1O2IA 1NO9H 5GPIB 5L30H 4MNXA 1Q31A 3ZYEA 4UFEH 5T6FA 1FMGA 1FJSA 3KQEA 1C5OH 3SYJA 3A7WA 2PKAB 3TNTA 2P16A 1SG8B 1Z8GA 5CHAC 2AGIX 1QTFA 4K1EA 1MQ5A 1O5CB 1DM4B 1GBDA 2OC1A 1BRAA 1U6QA 3F1SB 2B5TB 2P8OB 3EA7A 1GHAF 4OS5A 1EPTC 1BA8B 2PFEA 3P6ZB 5JBBS 3SU1A 1LKBA 1C1VH 3GYLB 4X8SH 2FO9A 1OKXA 3A84A 1EP6A 1O2OA 2QIQA 2GCTC 1TBQH 3LPRA 3KL6A 1CE5A 3P17H 2FODA 2VIDA 3VB5A 3L6PA 2J4IA 2BHGA 3RXLA 1HDTH 2BDBA 1DFPA 2Z9KA 4ESTE 1FNIA 3M61U 1BBRH 3T25A 1PPHE 3LJOA 4XFQA 3VPKA 5HGGA 1TA6A 1BJVA 3BIUH 2FI3E 1A5GH 3TITA 5AVDA 3VB4A 1PQ7A 2EA3A 1ZTLA 3MO3A 1H9HE 4MNYA 1MAYA 3TPIZ 1ACBE 1K22H 2BD8A 1P10A 1UCYE 1TBRH 1ZJKA 2AIPA 3LKWA 3Q3YA 3P8GA 1F7ZA 2BDHA 1L2EA 1HPGA 4OGXA 1OP8A 3UIRA 1HBTH 1SFIA 2BTCE 3RU4D 1GBTA 1TNIA 5DJ7A 1O2GH 2H2ZA
chains in the Genus database with same CATH superfamily
2XYAA 3PMHB 1P01A 1F92A 4AC9A 3BG8A 3F68H 4U2WA 1E38B 4I32A 3GY8A 1L1GA 1EX3A 1TA2A 3DCLA 2H1UA 1GHWH 1F0SA 1S0RA 3FAOA 4D7FA 3CS0A 1YM0A 3SQEE 3SZEA 5LH8A 2TGPZ 2R0KA 1C2KA 4X1PU 1P8VC 4ZXXH 1JIMA 2B9LA 1SGCA 1TYNA 2VGCC 1TGSZ 5FXLA 3BTEE 2XRCA 2J34A 2HNTC 2BD2A 1ZMJA 3E8LA 4X1RU 4ISLA 1PQ8A 2XBWA 4GCHF 4WWYA 1Y3UA 4XBBA 5C3NA 2BVXH 1YPMH 3F6UH 5TCCA 1H8HD 4I8JA 3ZZAA 3PV5A 3OEHD 1QBOA 3M7TA 4J2YB 1XVOA 2AMPA 2JKHA 1FLEE 4U30A 1BZXE 1DWEH 1P2QA 3A8CA 3KYFA 4K1SA 4NIVA 5DKMA 4NZQA 2AEIH 4ZHAA 3AW0A 5FX6A 1VKYA 1K2I1 1G30B 2SFAA 1W10U 1UO6A 1SGTA 4GSOA 1NU7B 1W13U 1HIAA 3PWCA 5EXNA 2PKSB 1V2PT 1UMAH 1INCA 4LOYH 3LGYA 3T27A 1YBWA 1TLDA 3RLYH 3BTQE 4ZHMU 1RTFB 2RCEA 2PW8H 3BEUA 1LMWB 2C8WB 1CT0E 3UWJH 3PM3A 1NT1A 1WAYB 3NRLA 1GI0A 3MO9A 3MTYA 2XNDD 3A88A 4Q7XA 3T62A 2CHAC 2R2WU 2H5CA 2RDEA 1ABIH 2W3IA 2YMSC 1TMBH 1BTYA 1L1JA 1D3DB 4FUCA 5F03A 4VGCC 4NFFA 3D65E 4YXWD 5L6NH 1O2YA 1LTOA 1RFNA 1IQIA 1TPPA 5T1VA 3SOSA 2L6OA 3ZVGA 2K8IA 1ZLRA 3LDXH 5HIZA 4Y6DA 7GCHF 2ZDNA 5AHGH 1GJ7B 3VXFH 3UOPA 4IC6A 3RMMH 3VB7A 4X1QU 1D6RA 1OWDA 2PKAA 3IG6B 3UR6A 2F9PA 4K5ZA 1OP2A 1E34B 3MO6A 1GBMA 3AW1A 3GDUA 4FU7A 1W0KD 1KDQA 1K1LA 2LPRA 1OYQA 4YLUA 1IOEA 2KZ4A 3U9AH 4F49A 2C8ZB 2EEKA 1P2OA 2KAIA 3IWMA 4YT6H 1OXGA 4DG4A 1BBRE 3QLPH 1KTSB 4MPVA 2VIQA 1QJ7B 1A61H 3H7TA 4TPIZ 2ZFQH 3QX5H 4ABHA 4I8LA 2HGTH 1C5ZB 2CGAA 2OC8A 4X8VH 4E7RG 2HNTE 3MYWA 1Y3VA 1A2CH 4X2YA 4YOIA 1TABE 2FOAA 3RXAA 2ZHFH 1MCTA 1SB1H 3TH3H 4X6NA 3RU4E 4P00A 1K1MA 1JXPA 1TBZH 3ATMA 3WWBA 3QUMP 1CBWB 4ZKOU 2ZI2H 1T8MA 4TYDA 4CR9A 4P02A 1DSTA 4B2BA 1BITA 2SGAA 3GY5A 1O30A 1P3EA 3PYHA 1BHXB 3TU7H 4AX9H 1SVPA 4Q4LA 3TGIE 3M3VA 2FS9A 2GTBA 4Y79A 2DE9A 1TNLA 1D3PB 1N1LA 1OSSA 1OWIA 2BM2A 4ABFA 1PPBH 3A7VA 1FAXA 2WPHS 3U8OH 3HPTB 4DCDA 1SGFA 2GKVE 2Z9JA 1TX8A 1G3DA 2CXVA 1LHDH 4NIXA 4K60A 3PB1E 1KXBA 5J4SA 1C2EA 1A0LA 4DT7B 1MTWA 3R0FA 2D26C 4TWWA 3FN8A 5C1XA 1LVMA 4UEHH 4XSKU 1DWDH 2QF0A 2CF9H 1ZGVA 3EYDA 4M9FA 2WSSD 3E91A 1GGDB 4FVDA 1GVKB 3F2GA 1NRSH 3PV2A 1EJMA 1O3PB 4ISHH 5J4QA 1GBLA 2KCOA 3QWCH 1LPGB 1V2UT 2A5KA 3ZYDA 1O37A 1FN6A 1W2KH 1AHTH 1GJDB 1WQSA 1BRBE 2WUBA 1LHCH 3BEFB 5DP4A 1P06A 1C5MD 1S81A 1TNJA 2HLCA 4X0WU 1J16A 3ZV8A 1ZMLA 5JBAS 3GS9A 5ETXA 2J38A 4DVAU 1ELCA 1A1RA 2CMYA 1UVUH 4OS1A 5CHBA 4X2XA 2J92A 2FOCA 2O8LA 3GCNA 1ESBA 3E1XB 4H42U 1O32A 4X2WA 1SLVB 4RT1A 1PPFE 5B6LA 1EZXC 4GLYA 2OK5A 3NZIA 1JMOH 4DJZB 4NZLA 1NRNH 1O3GA 4WMFA 2B7DH 2IPHA 2NWNA 1K9OE 4AGJA 1XUFA 2VIVA 2ZGCA 1C1UH 1PFXC 2W6JD 1LVBA 1XUJA 3R3GB 3Q3XA 2ZP0H 4AFUA 1XM1A 2ESTE 1GL1A 3A89A 4BAOB 1C5PA 1QY6A 1ELEE 3TK6A 1ELDE 2TBSA 1AIXH 2Y81A 5CE1A 3RU4T 3VG8A 2PHBA 4IN2A 1ID5H 2HPQH 4ABGA 2GT7A 3PMBB 5EXLA 1G9IE 1RTLA 1O2MA 1DOJA 1VITF 5E2OA 4AFZA 1CT2E 4BANB 2C90B 1BQYA 2FIRH 1NFWA 2UWPA 4ZMAH 3RMLH 1EOJA 3URDA 1HV7A 2YOLA 1IQKA 1TB6H 1DLKB 2QAAA 5C1YA 1NZQH 1GBBA 1PYTC 3ZVEA 1UK2A 1GJ5H 3AAUA 4O9VA 1V2TT 1W12U 1SL3A 1W7XH 5A09A 4Y7AA 5ABWA 1NBME 2ZU2A 1BDAA 2VWNA 2Y7ZA 3SJKA 1E35B 1GBAA 1JWTA 1RRKA 1FY4A 5EGMA 1O2TA 4CRCA 3SNDA 1TRYA 1W3CA 4FU9A 1GJBB 1LKAA 2J97A 3E90B 3RXRA 1IHTH 1EJAA 3B23B 3EA9A 3GYMA 2D1JA 1DANH 1GBFA 3LONA 1OWJA 1YY3A 5ESBA 2ZO3H 2GCHF 4CHAB 4JCNA 3I77A 4BNRA 1HJ8A 5A8YA 2IPQX 1AVGH 1Z7KA 3U8TH 2OP9A 3B8JA 4B74A 5C67A 1C5NH 1FUJA 2UWLA 1WU1A 1T7CA 3TGJE 1QJ1B 1WSSH 1NFUA 3L3TA 1QA7A 8ESTE 3A8DA 1H8ED 1PQ5A 1SBWA 4HI3A 3TVJB 3RMNH 1SLWB 4TY7A 4WVPE 1Y5UT 1JBUH 1DDJA 3UY9A 2NU4E 3PMAB 3KQBA 3RXOA 1KXFA 3HGPA 1RTKA 1T32A 4JZDH 3OX7U 1EPTA 1TQ0B 1DXWA 4UDWH 1PPEE 3VFEA 2Q6FA 1FIZA 5BRRE 1HGTH 2KFWA 4BTIB 1TGCA 1YCPH 2UUKB 4AORA 1A0HB 4I7YH 1Y3XA 1GHZA 4ISIH 1UCYH 2AH4X 3SHCH 2UUFB 4Q80A 2A45B 1B0EA 4Y76A 1C2MA 3H09A 4ZKRU 2ZCLP 3HKJB 1DVAH 3STJA 2QF5A 2WYGA 4BTUB 3M7QA 1BTHH 4FUGA 3MH4A 2FOEA 1YPGH 1P2KA 1TMTH 4A1XA 5DO4H 1ETRH 1CSOE 5GJ4B 3OAAD 1EFRD 3OU0A 1NC6A 4OS6A 1LDTT 4HFPB 2IOTA 4AZ2B 3RM2H 2PV9B 2Z9IA 4OS7A 2HNTF 3CP7A 1MTVA 2KCPA 2C4FH 3VGCB 5G4BA 1MKWH 1ZPBA 1K28D 1SQOA 1WTGH 3LOXA 2IJOB 1T4UH 3ZVCA 1MBQA 2A4GA 2RA3A 4NA8A 5KECA 2BX3A 1F2SE 2BMGB 5I46H 2UUYA 3O8RA 1CU1A 5HM9A 1H1BA 1GI4A 4X2VA 2FLRH 1PQAA 1HAIH 1CQQA 2WHXA 4YO9A 2UUJB 2VVVA 1BMNH 4VGCB 3E3TA 1S82A 2W7UA 1GMDF 5F8XA 1Y8TA 1NN6A 4NCYA 1C1PA 3V0XA 3MH7A 3WW7A 1HCGA 2IN2A 5DGJA 2ZDLA 5HYOA 1AB9B 2VIPA 1XUIA 2VU8E 3RXGA 1PPCE 1GBEA 1ANEA 1SOZA 4QT8C 1AVWA 2WPIS 2HOBA 4TPYA 3NCLA 2OUAA 2ZTXA 5A0AE 4Y0ZE 4MTBA 1UHBA 3GICB 1FN8A 3GCOA 3CENA 5IK2D 5C5NA 1SQRA 4AYVB 3EGKH 1GJ8B 5KGOA 2BD9A 4RT0A 1O2QA 4Q63A 2PKSC 3SN8A 1XUKA 5C17A 1MKXK 1S5SA 3M37A 1AE5A 2G52A 4E05H 1N8OB 1GMHG 3BTTE 4GVUA 2SGEE 4FUBA 2BXUH 1HXEH 5IYTA 3O8DA 2OBOA 2EC9H 3I29A 4X8UH 4JMYA 5C1UA 2R0LA 3SHAH 2A4OA 1SC8U 3DUXH 5DP6A 1L1NA 2QE7D 3RXKA 1KLTA 5EJ1A 5FBEA 1RGQA 4ASUD 3PRDA 4JZEH 3PV4A 3M5NA 1Z8RA 3ENSB 4CREA 5C2ZA 2HPPH 4ZAEA 2FX4A 4AB8A 1AUJA 2NU1E 3RXDA 2TGDA 1AVXA 1HAGE 2A2XH 3SV8A 1XKAC 1BTUA 3BN9A 1T31A 1O39A 1GHVH 2FM2A 3SU0A 2ZF0H 4AOQA 3UFAA 3MU1A 4R0IA 3RXPA 2FS8A 1EPTB 2PTNA 1NM6A 3C27B 3EQ0H 3F0OA 5EODA 4X6OA 4NSYA 1V2WT 3SJIA 3S9BA 1IQMA 4ZXYH 2TIOA 3M35A 5EG4A 3Q77A 5L2ZH 1PPZA 1QL8A 2SGDE 2PP6A 1EQ9A 1FONA 2WZQA 1VGCB 1V2RT 2PGQB 4B6FA 2VVUA 3S7KB 1P3CA 2BDAA 3DHKH 2EI6A 5A0BA 2P3UB 6CHAB 1EB1H 3S9AA 4BAKB 1C9TA 3KCGH 3ATKA 3E0NB 4D76A 1MTUA 1HIAB 1O3AA 4Y8ZA 2XBXA 2J95A 1AWFH 3M5MA 1GI9B 4YOGA 2Q6GA 5GDSH 1P2IA 2SNWA 2ULLA 2OBQA 2YNBA 2G4UA 1T8OA 2W5EA 1FQ3A 3E0PB 1YPJH 2KCAA 1DPOA 2FXRA 2ZGBH 1W0JD 1O5GH 1GJ4H 3GCTG 1A46H 1QHRB 2ANYA 3TH2H 1O2XA 3A8AA 1DX5M 4YM9A 3N7DA 2FYRA 1FX0B 3P95A 2Z3DA 1D9IA 2AGEX 4H4FA 3M3SA 3BF6H 2XXLA 3KEEA 1Z1JA 2AYWA 3KN2A 1ETTH 1O3LA 3RMOH 2IJD1 1A5HA 1V2QT 2B0FA 3OY5U 1KIGH 1P05A 1GBHA 4DIIH 1UTOA 3MI4A 5EIYA 1SGQE 2Z7FE 4ZROA 4CHAC 1GMDG 1G3EA 5SGAE 1FV9A 4LZ4B 3LGUA 1ANDA 1O3OA 3RXIA 3SJOA 4A7IB 1Z6EA 1AGJA 3OFND 5E2PA 1DT2A 3PWBA 1CA0B 2SGQE 5A0CA 3K9XB 1P9UA 3RXVA 1C1SA 3NKKA 2VH0A 1O2ZA 4X8TH 5B6OA 3DFLA 1GCDA 1HJ9A 5DPAA 1T8NA 1QA0A 4D8NA 4TSFD 4U32A 2Z3EA 3E16B 4CBNA 1TGTA 1HB0B 1MU6B 3T29A 2FLBH 3AVZA 3TGKE 2BLQA 3ATWA 1JOUB 1JRTA 1V2MT 3NXPA 4UD9H 2ZDVH 4GPGA 4JYTA 5EXMA 1TNGA 2C8XB 5C5OA 1QRZA 3ATIA 1D3TB 1VR1H 1TX7A 1FIWA 5E8EH 2F9UA 1O3KA 1TWXB 2F4LA 2V35A 2ZFSA 4IMZA 1ARBA 2YNAA 4NWLA 3TNSA 4YOJA 4TWYA 3L33A 1DLEA 1GBKA 4BXWA 1DS2E 4MVNA 2W7SA 1XXFA 1W0YH 2CHAB 3V12A 1O2RA 4X1SU 1NY22 1S0QA 1Z8JB 6GCHF 8GCHG 1GDQA 2EI8A 4ISNA 1TNHA 3TJVA 3OE7D 2XNIA 1C4Y2 3QDZB 1BJUA 1GCTC 5FX5A 3ZV9A 1V2LT 2AERH 2Y5GA 3U69H 3QN7A 7GCHG 4PROA 1ELTA 1SGRE 3FFGA 5F53A 4THNH 3MU5A 3MH5A 5EJLA 3D62A 3ZZ8A 2CF8H 3RLWH 1NBMD 2VGCB 4Y7BA 1DY8A 4CH8B 4I33A 1Y59T 1B7XB 2ZC9H 1PYTD 2BX4A 2G4TA 4I8HA 1AB9C 1RD3B 2ZQ1A 1MAXA 2ZIQH 2WPLS 1GMCF 1ZJDA 1G2MA 4Q7ZA 3FZDA 2BQ6B 1GHAG 1Z8IB 4ZKNU 1NPMA 4UE7H 3H5CB 2BLOA 1OOKB 3HK6B 2C3SA 1EUFA 4IBLH 1BHXF 4RKOB 1SGNE 5EOKA 1ARCA 4Q7YA 2GV6A 2O8UA 1A0JA 3PO1B 2QXHA 2HWLB 1ORFA 1O3JA 1KLIH 1QJ6B 1EATA 1CGHA 1O3DA 1TX6A 4FETA 1DXPA 3K2UA 3RM0H 3ZZ9A 3PROA 3LGWA 1FDPA 3DSGA 3RXJA 4F48B 3KF2A 1GI6A 2Q1JA 5GWZA 3WWFA 1UCYK 1GBIA 2HALA 4ABIA 5DP8A 5A8XA 3A7ZA 5L2YH 1IQEA 1C1RA 1OWEA 3BTME 3FVFB 1XUGA 2H9EH 1O3HA 4WJG2 3FKSD 1G37A 1ZSKA 1BMAA 2K1QA 1BMLA 1CO7E 3O8BA 1TOMH 1SPJA 2SGPE 1HNEE 2QGRA 3SUDA 4RSPA 1OHHD 2A2QH 3KQCA 3U1JB 1EAIA 3MHWU 4GHQA 1CBWC 3DT0H 2OC0A 3SV2H 2GCTB 1GBCA 1NRRH 1Y5BT 2AMDA 1CGIE 1O3CA 3MH6A 1FPHH 4IMQA 3BEIB 3N7EA 1UVOA 1EAWA 2PSYA 1SFQB 2ZU3A 5F8TA 2BB4A 1GI1A 2BD3A 2JJ2D 3MNBA 2WV4A 1HFDA 2FPZA 4ZCNA 2ZHEH 3NPSA 5LPFA 1BB0B 3TK9A 1GJ6A 2FDAA 4CR5A 1O3MA 1V2ST 1THPB 4KKDA 4FUIA 1ZHRA 2ZU4A 1A3EH 2BY9X 3SNBA 2YMSD 5C94A 1O2PA 4XDEA 4INHA 1D3QB 3D49H 1ZR0A 1E1RD 1L4DA 3ZZ7A 1GI7B 2ODYB 1GI8B 1HRTH 1HXFH 2ANKH 2NU3E 5JPMH 1TGNA 2QCYA 2FI5E 2THFB 1UW7A 1W0ZU 1ANCA 1SSXA 4IC5A 2EI7A 3ODDA 1E37B 2XW9A 3W94A 1IQHA 2A7HA 4CRGA 2JETB 4XD7D 3FO8D 4NFEA 1THSH 2P3FH 2TRMA 3F0PA 3Q00A 1SR5C 4MNWA 1YPHC 2Y5FA 1O5EH 3BTWE 1LHFH 1N6XA 1ZHMA 1UHBB 3RC6A 1GHBF 1MKXH 2FYQA 3W1EA 3G01A 3NK8A 5FCRA 2I6QA 1YC0A 1H8IH 4IGDA 2ZFTA 3LU9B 1LQEA 3FOAA 2XBYA 3ZVAA 5DP9A 4A5TS 1C5UA 1ELAA 2D8WA 1VCPA 1EOLA 3SUFA 4YLQH 1JIRA 1LQDB 1AKSB 3P8OA 5JB8S 2GJGA 2HLDD 4ZKSU 1Y5AT 1BBRK 3U28C 3IITA 2ZPQA 2SGFE 3RXBA 3S0NA 1C2HA 1UTPA 2OINA 3RXMA 3MFJA 2C8YB 5GNDA 1NROH 1YLNA 1SOTA 2A7CA 3EDXB 1C1QA 4Q2KA 1HJAC 1C5XB 1WBGB 5F6MA 1VITG 2H9TH 1S6HA 2ZEBA 1GMCG 1DITH 4H6TA 2J2UA 3F9GA 2ZFFH 1J14A 1ZPZA 1C1OA 2ANMH 1HJAB 2ZA5A 2V7QD 5AFZH 1C1TA 1QURH 2SNVA 4CRDA 4F4OC 1EZQA 1QBNA 3TJUA 1O3FA 3NUMA 1ANBA 3A87A 1GJ9B 2KM0A 4X6MA 3MNSA 4Y11E 2V6NA 3EAJA 1LPZB 1Z71A 2WV5A 2O8TA 1YF4A 2QXIA 5CMXH 2JIZD 4K3JA 1AI8H 1AFQB 1YCPK 4HTCH 1O33A 2BY7X 2TGAA 3BG4B 2V3OH 1GJAB 3RP2A 2FTLE 2CJIA 1BCUH 2ALPA 3GY2A 2F83A 2O8WA 1ETSH 2XC0A 1AFQC 3F9FA 3UR9A 1P09A 3SGBE 1HAYB 3CNRA 3KYGA 3BTKE 3FP6E 1XVMA 1HAVB 3V7TA 4Z0KA 4BXSA 3P70B 3LGIA 4JK6A 1D6WA 1KXAA 2V3HH 4O3TA 2OD3B 3SZNA 1K1JA 2PLXA 1QQUA 2AMQA 5DP3A 3RUOA 5PTPA 1ESAA 1C4U2 2GZ8A 2V0BA 2YMSB 4GAWA 2ZQ2A 1TRNA 1NFXA 2A31A 3P92A 1QFKH 2CN0H 3LIWA 2ZKSA 4U01A 2ZCKP 1S83A 4B2AA 5I25A 2BD5A 3UWIA 2GZ9A 1G32B 1JRSA 1MU8B 2RDLA 3N99A 3QTOH 4DW2U 2F9BH 3KNXA 1YCPM 2CK3D 4LK4A 1FY3A 1AU8A 1O2KA 1QB1A 1GDNA 1MBMA 2F91A 2ZGJA 3UNQA 3MOCA 2P3TB 2ZDKA 1LVOA 4AN7A 4RN6A 2XWBI 3O8CA 4LXBH 3SO3A 1O5AB 4KELA 5T6GA 4DOQA 4FXGH 3SU2A 2H9HA 1C5WB 1V2JT 1AMHA 1GWAA 1AFEH 1O31A 1ZRBA 1FY1A 1SHHB 1GPZA 4BAQB 1TALA 3UUZA 4AGKA 3KQDA 3ZZBA 1ZTJA 3PLPA 1EP5A 1C1MA 2ZPRA 4ZH8A 1GHBG 2FEQH 2A5IA 3RXUA 4ABAA 1UK4A 1ABJH 1O36A 2FESH 2G8TA 2RA0A 3RXHA 5K7RA 1GI3A 2ILNA 2QY0B 2BDCA 3SV7A 1O2UA 4FOUC 3CS7A 2ZU1A 2VIOA 1E79D 2ZZUH 1FI8A 1C5VA 1SGEE 5T3HA 2R9PA 1CHOF 3A82A 1O2NA 2G55A 2ZDMA 3QK1A 4FUJA 2VWLA 1MTNB 1ELBA 2W26A 1CA8B 3URCA 2BY5X 1XUHA 3F2HA 7ESTE 2RFKC 1XXDA 2AHME 4Y8YA 1KYNA 3MU0A 3E6PH 4H6SB 3AK5A 3LT3A 2XOKD 1BOQA 1S85A 4WMEA 4BAHB 1WYKA 1MUEB 3ZZ5A 1AE8H 1TOCB 2PSXA 5AF9H 2FZZA 5KEDA 4FUDA 5A8ZA 1ZSJA 5JB9S 2GCHG 4ZHLU 3Q3KA 3LGVA 3BTFE 1DICA 1DUAA 1TPSA 2NU2E 1GDUA 2ZGHA 1ZTKA 4FU8A 3SNCA 1RXPA 3ZIAD 3SU6A 5LPEA 5FCKA 1QB6A 2ALVA 3ESTA 4TY6A 2F9VA 1QRWA 5E0JA 1VJAU 4MQAA 3RC5A 1C5LH 4X1NU 2JETC 6ESTA 1F5KU 4WMDA 1VZQH 2PUQH 3STIA 1TRMA 1GG6C 1UTMA 2ZHDA 2GDEH 4NIYA 1ZPCA 1Y3YA 1WV7H 2B8OH 4CRBA 2GMTB 1G2LA 3A7YA 2ZHWH 1L4ZA 5K0HA 2BVRH 1F0UA 5HMAA 1BRUP 1YPKH 1GHYH 4YTAA 2OTVA 2J98B 1RIWC 3ZVDA 1IQLA 1HYLA 8LPRA 1V2KT 2ZTZA 3FZZA 3K6ZA 3S9CA 2ANWA 3ZVBA 1A4WH 1O3BA 2H5DA 1NESE 1TMUH 3BTDE 1W7GH 3LC3A 2TGTA 2QA9E 1BTWA 2XCNA 4JYUH 1RS0A 2F9OA 1QL7A 1SGFG 3UQVA 3PLBA 4J1YA 1C2LA 3ODFA 1YKTA 2HRVA 4K69A 2QN5T 1C5QA 4OM9A 4ACAA 4ABEA 1NU9A 1HLTH 3S7HB 1IQNA 1CA0C 2ZHQH 3BIVH 3QZQA 9ESTA 3PRBA 1OX1A 1UTNA 1GG6B 1MABB 2OXSA 3A81A 5TJXA 1QGFA 2JDID 2FP7B 4MG3A 4I8GA 1QR3E 2J94A 2QYIA 3ATLA 4K2YA 1V2VT 4K8YA 3UQOA 4E06H 3M5LA 4Y10E 3EE0B 1VGCC 4NA9H 1XX9A 1MCVA 2QF3A 3DD2H 4UFGH 2Y80A 4OGYA 3HGNA 1SQAA 2OC7A 1O34A 3OTPA 4X6PA 1A7SA 5TCAA 2XC4A 1QNJA 4YZUA 3P8NA 1KDQB 4KTCA 4CRAA 2VVCA 3KGPA 1S6LA 1AD8H 2A5AA 2G51A 1VCWA 5FHTA 1XMNB 2P94A 3GCHB 5A2MH 1TPOA 5DK1A 5EQQA 1SHYA 3SI4H 5CDFE 2QXJA 1B0FA 1HAHH 3QZRA 1E0FD 3UNRA 2P95A 4MPXA 4E7NA 5LPRA 3T5FH 4INLA 1RJXB 1DE7H 4ABJA 4ASHA 1MTNC 3VEQB 2ODQA 4DT4A 3H7OA 1BTXA 3LH1A 4FUEA 3M36A 2BOKA 1VITH 2CV3A 2A32A 3VXEH 3RXCA 2WYJA 2A0QB 1P2JA 1SQTA 2GP9B 1O5BB 4ZUHA 4I8KA 1GGDC 5GXPA 1AY6H 3V13A 1EKBB 2O8MA 1MMJN 4WF8A 1HAOH 1P57B 4CH2B 3SW2B 5FAHA 1P03A 1YLCA 2Z9GA 4I31A 1HAVA 2ZG0H 1O3IA 3LGTA 3OSYA 1B5GH 1UJ1A 2JH5D 2ZU5A 2FOHA 3F2FA 3MMGA 1DWCH 1N6YA 3GY7A 1Z6JH 2G5NA 4ABBA 3GY3A 1G36A 1GL0E 2LNCA 3P8FA 3U8RH 2BD4A 2BQ7B 3ELAH 3F3BA 4HGCA 2BLVA 1O0DH 3ZZ4A 1WCZA 3PTBA 1SGPE 1BMFD 4UFFH 4O97A 9LPRA 1ZMNA 1ZSLA 4DY7B 3JZ2B 1TGBA 2WUCA 1PPGE 3SU5A 2HVXA 4B6EA 2OQUA 4AG2A 1ZHPA 1KTTB 2M5TA 3DSOA 3AASA 3UB0A 1CVWH 5IDKA 2KAIB 1UTJA 4Y8XA 1HAPH 5E0GA 1RIWB 2ZCHP 4A1VA 1DWBH 1AZZA 3OY6U 1P11E 3A7TA 1KMHB 3KHVA 4O03A 3RXEA 3RXFA 2A4QA 1X7AC 4AFQA 5HIYA 2PR3A 2P8OC 7LPRA 1J9CH 2HVYB 2VJ1A 3F9EA 1H4WA 3UNSA 2BDYA 3M7UA 1TE0A 4O3UA 2FTMA 2RG3A 2PGBB 2FMJA 2WPMS 2ZNKH 4INKA 3T2NA 1KXDA 2GGVB 2VB0A 4DGJA 2P59A 1W8BH 4A92A 2A4RA 6CHAC 2UWOA 2GV7A 4NGAH 4OS4A 4AG1A 2R2MB 4R8TB 5LGOA 1AQ7A 1MD7A 1NTPA 3PMJA 1FZZA 4GCHG 2AIQA 4I86A 3M5OA 2M2AA 3C1KA 3ITIA 1P2NA 4RI0A 2STBE 1MH0A 3LH3A 1QB9A 1J15A 1AN1E 4AB9A 3FP8E 1LVYA 1ZZZA 5DSFA 3ZZ6A 2ZWLH 4GUXA 3GY4A 4BTTB 2P93A 3BTHE 1HAZB 1V2OT 1MZDA 2GDDA 5H4IB 1IHSH 1Q3XA 4JZ1A 2ZFRH 1K1NA 3K65B 3SUGA 3MU4A 3BG4C 1ELVA 5FPYA 3GDSA 3LJJA 4ISOA 1TAWA 2DE8A 2QF4A 2STAE 1MZAA 5EJZA 5DP5A 2DUCA 1MTSA 5FBIA 1C9PA 2AGGX 1C2DA 3GDVA 1OPHB 1TONA 8KME2 3Q76A 3A8BA 2AS9A 2FOBA 1WTHD 4ACBA 4LZ1H 2Q6DA 5GIBA 2ZTYA 4WH6A 3M3TA 3GISB 1W11U 1UTKA 1QBVH 4WXIA 3DFJA 3HKIB 3MNCA 3SUEA 2Y6TA 1IQFA 4MDSA 5E0HA 4Y71A 4K1TA 3LC5A 1KXCA 1O2HA 2G81E 2JH0D 1C5TA 1UTLM 4NWKA 4DURA 2Z3CA 2C93B 2XTTB 4XE4A 5DG6A 3V3MA 1TFXA 1YWUA 2G5VA 2J9NA 5EW1H 4FVBA 1O2JA 3ZZ3A 2AFQB 1Q2WA 2JJ1D 1C2IA 3N7OA 1DUEA 3I78A 1OYTH 1YLDA 4B76A 2FWWA 3S69A 2FOMB 3VB3A 1NS3A 2BZAA 2ZPSA 4B71A 4IN1A 3QGNB 4IW4E 2FOGA 2OQ5A 6LPRA 1F5LA 3SI3H 3ZZDA 2OCVB 1D4PB 3JZ1B 5F8ZA 3RXSA 3A7XA 2KR7A 1O2WA 1CHOG 1LHEH 3A85A 4WH8A 1UTQA 3BSQA 1YYY1 3BTGE 3OTJE 4D7GA 3RC4A 2J98A 2W3KA 1DY9A 2R3YA 1P04A 1E36B 1TIOA 1M9UA 4CRFA 1A5IA 4JZFH 1SLXB 4WY3A 1FY5A 3GCTF 3RDZA 3EA8A 3ZZCA 1J8AA 1WOFA 2BLWA 1BRCE 1SGYE 4UFDH 2W6ID 3T28A 4B73A 5JBTA 4MPWA 1C5YB 2VBCA 3PTNA 4JK5A 1EAUA 1QCPA 2F43B 2FX6A 2BDGA 4A1TA 1EB2A 7KMEH 2KCYA 1VJ9U 4NG9H 1ZOMA 2ODPA 2QXGA 1KLJH 1GI5A 1CT4E 1EASA 2XWAA 4SGBE 1SI5H 5FPTA 3SGQE 2ZDAH 1KXEA 1E1QD 1C4V2 1WQVH 1GCTB 4DIHH 1LHGH 4UONA 1BMMH 1ESTA 3MQKC 1EZUC 1C2JA 5C20A 5FPSA 3SU4A 1GI2A 4RKJB 1SLUB 1H9LB 2XCFA 1T4VH 2L74A 5BPEA 1BTZA 2F3CE 3TLOA 2Y7XA 4AYYB 2VINA 4Y0YE 3KIDU 1SGDE 1F0RA 1O3EA 1IQGA 4IS5A 2XC5A 1YPLH 1YPEH 5DP7A 5HM2A 1BIOA 2FI4E 6GCHG 1GVZA 1O35A 1K21H 1ZYOA 3HK3B 5AFYH 3TIUA 1AKSA 4CBOA 3MWIU 3FP7E 1P12E 2VIWA 1O3NA 2BXTH 1F5RA 4OS2A 1Z1IA 1HAXB 2EY4C 3B9FH 3SJ9A 1FPCH 2R3UA 4NSVA 3U98H 3DA9B 2F9NA 1P02A 1MKWK 1ZRKA 1J17T 1G3BA 3SNAA 1WDIA 2H6MA 3SGAE 3A83A 1SMFE 2GX4A 2FOFA 2ASUB 1UVSH 2XBVA 3SBKA 1O2SA 5JBCS 5CHAB 4D9RA 1N8OC 1ELGA 3SJ8A 3DSPA 1UVTH 2PUXB 2BZ6H 1MQ6A 5EQSA 3TJNA 1CHGA 3SV9A 2WPJS 1YP9A 3A86A 1VCQA 4JYVH 2QV1A 1H9IE 8GCHF 1GBJA 2LELA 5EW2H 1LPKB 4TT3D 3SV6A 1P2MA 4FUFA 1SKYE 3FANA 5EU8A 3WY8A 2BVSH 1EXFA 1T8LA 5HXFA 2Y82A 4KTSA 1CGJE 1EAXA 1UVPA 3VB6A 2WINI 1OS8A 1C5SA 2Z94A 2ZECA 4M7GA 3GY6A 1BTPA 1K1OA 4KTUA 1XKBC 4K8BA 2PWXA 4MNVA 1A3BH 5C0UA 4JZIA 1H8DH 1AUTC 2OLGA 1OWHA 4Z6AH 2BOHB 3W95A 3SQHE 2TPIZ 3TH4H 2QC2A 3OEED 3MU8A 2BQWB 4YESB 3UREA 1KY9A 3UPEA 5HKKD 1NRPH 1W14U 1YGCH 5EQRA 1BUIA 1C5RA 1PJPA 2NU0E 1WXRA 1MD8A 4A6LA 1L0ZA 1AO5A 4F55A 3GOVB 5T6DA 3T26A 4MPUA 1GVLA 1QRXA 3UTUH 2J5UA 3NWUA 2ZGXH 3GCHC 4HZHA 1EZSC 1V6DA 4GHTA 4BAMB 1O2LA 1EJNA 5EPNA 2GT8A 5GCHF 1QZ8A 2BD7A 1FXYA 2BDIA 2Y5HA 2Z9LA 1O5FH 3RXQA 2BY6X 4XOJA 3AAVA 4KP0A 3RXTA 3SU3A 2D2DA 1OWKA 2GD4B 1V2NT 4XBCA 1TNKA 3PLKA 1C2FA 1C1NA 3F9HA 2A7JA 4B75A 1C2GA 1LCYA 3UOUA 1F0TA 2GVFA 3A80A 5GCHG 1IAUA 2WPKS 1K1PA 4XRNA 4Z1MD 1DSUA 5EPYA 1LO6A 1O2VA 3ZVFA 3MNXA 3QTVH 4KGAA 1O38A 3QO6A 1OP0A 2KX4A 3SORA 1AZ8A 3BV9B 1GJCB 1C1WH 3VGCC 2ZFPH 2Z6BD 1YPHE 3OYPA 4NA7A 1NFYA 1SGIB 4NIWA 5FL7D 3D23A 2G00A 4ABDA 4AFSA 2VWMA 1P9SA 1ZGIA 2BYAX 1S6FA 1NRQH 5JYIA 2PTCE 1TQ7B 2I6SA 1TPAE 2WV9A 4FUHA 4B2CA 3SNEA 1BT7A 4MLFB 2BY8X 3QGJA 3TJOA 1THRH 2O9QA 1HUTH 2A1DB 1QL9A 1ELFA 1WUNH 4D9QA 1KSNA 1P0SH 1UK3A 4BOHA 2VH6A 1GMHF 3HATH 4B1TA 3TK5A 1S84A 2JH6D 1AWHB 1IQJA 3K6YA 2VNTA 1QIXB 4YT7H 1Y3WA 1QQ4A 1FAKH 4SGAE 3U1IB 5JDUB 1G3CA 5ESTE 2GZ7A 1FY8E 3PO1C 1V3XA 1GHXH 2VWOA 1K1IA 4WXVA 1O5DH 4XBDA 2GMTC 1O2IA 1NO9H 5GPIB 3EE7A 5L30H 5C0TA 4MNXA 1Q31A 3ZYEA 4UFEH 5T6FA 1FMGA 1FJSA 3KQEA 2LP6A 1C5OH 3SYJA 3A7WA 2PKAB 3TNTA 2P16A 1SG8B 1Z8GA 5CHAC 2AGIX 1QTFA 2WPDD 2K0QA 4K1EA 1MQ5A 1O5CB 3KQ5A 1DM4B 1GBDA 2OC1A 1BRAA 4HG6A 1U6QA 3F1SB 2B5TB 2P8OB 3EA7A 1GHAF 4OS5A 1EPTC 1BA8B 2PFEA 3P6ZB 1COWD 5JBBS 3SU1A 1LKBA 1C1VH 3GYLB 4X8SH 2FO9A 2V3MA 1OKXA 3A84A 1EP6A 1O2OA 2QIQA 2GCTC 1TBQH 3LPRA 3KL6A 1CE5A 3P17H 2FODA 2VIDA 3VB5A 3L6PA 2J4IA 2BHGA 3RXLA 1HDTH 2BDBA 1DFPA 2Z9KA 4ESTE 1FNIA 3M61U 1BBRH 3T25A 1PPHE 3LJOA 4XFQA 3VPKA 5HGGA 1TA6A 1BJVA 3BIUH 2FI3E 1A5GH 3TITA 5AVDA 3VB4A 1PQ7A 2EA3A 1ZTLA 3MO3A 1H9HE 4MNYA 1MAYA 5DN6D 2EQNA 3TPIZ 1ACBE 1K22H 2BD8A 1P10A 1UCYE 1TBRH 1ZJKA 2AIPA 3LKWA 3Q3YA 3P8GA 1F7ZA 2BDHA 1L2EA 1HPGA 4OGXA 1OP8A 3UIRA 1HBTH 1SFIA 2BTCE 3RU4D 1GBTA 1K0HA 1TNIA 5DJ7A 1O2GH 2H2ZA 3UAIC
chains in the Genus database with same CATH topology
2XYAA 3PMHB 1P01A 1F92A 3BG8A 3F68H 4U2WA 1E38B 4I32A 3GY8A 1L1GA 1EX3A 1TA2A 3DCLA 2H1UA 1GHWH 1F0SA 1S0RA 3FAOA 4D7FA 3CS0A 1YM0A 3SQEE 3SZEA 5LH8A 2TGPZ 2R0KA 1C2KA 4X1PU 1P8VC 4ZXXH 1JIMA 2B9LA 1SGCA 1TYNA 2VGCC 1TGSZ 5FXLA 3BTEE 2XRCA 2J34A 2HNTC 2BD2A 1ZMJA 3E8LA 4X1RU 4ISLA 1PQ8A 2XBWA 4GCHF 4WWYA 1Y3UA 4XBBA 5C3NA 2BVXH 1YPMH 3F6UH 5TCCA 4I8JA 3ZZAA 1H8HD 3PV5A 3OEHD 1QBOA 3M7TA 4J2YB 1XVOA 2AMPA 2JKHA 1FLEE 4U30A 1BZXE 1DWEH 1P2QA 3A8CA 4NIVA 4K1SA 5DKMA 4NZQA 2AEIH 4ZHAA 3AW0A 5FX6A 1K2I1 1G30B 2SFAA 1W10U 1UO6A 1SGTA 4GSOA 1NU7B 1W13U 1HIAA 3PWCA 5EXNA 2PKSB 1V2PT 1UMAH 1INCA 4LOYH 3LGYA 3T27A 1YBWA 1TLDA 3RLYH 3BTQE 4ZHMU 1RTFB 2RCEA 2PW8H 3BEUA 1LMWB 2C8WB 1CT0E 3UWJH 3PM3A 1NT1A 1WAYB 3NRLA 1GI0A 3MO9A 3MTYA 2XNDD 3A88A 4Q7XA 3T62A 2CHAC 2R2WU 2H5CA 2W3IA 1ABIH 2YMSC 1TMBH 1BTYA 1L1JA 1D3DB 4FUCA 5F03A 4VGCC 4NFFA 3D65E 5L6NH 4YXWD 1O2YA 1LTOA 1RFNA 1IQIA 1TPPA 5T1VA 3SOSA 2L6OA 3ZVGA 2K8IA 1ZLRA 3LDXH 4Y6DA 7GCHF 2ZDNA 5AHGH 1GJ7B 3VXFH 3UOPA 4IC6A 3RMMH 3VB7A 4X1QU 1D6RA 1OWDA 2PKAA 3IG6B 3UR6A 2F9PA 4K5ZA 1OP2A 1E34B 3MO6A 1GBMA 3AW1A 3GDUA 4FU7A 1W0KD 1KDQA 1K1LA 2LPRA 1OYQA 4YLUA 1IOEA 3U9AH 2KZ4A 4F49A 2C8ZB 2EEKA 1P2OA 2KAIA 3IWMA 4YT6H 1OXGA 4DG4A 1BBRE 3QLPH 1KTSB 4MPVA 2VIQA 1QJ7B 1A61H 3H7TA 4TPIZ 2ZFQH 3QX5H 4ABHA 4I8LA 2HGTH 1C5ZB 2CGAA 2OC8A 4X8VH 4E7RG 2HNTE 3MYWA 1Y3VA 1A2CH 4X2YA 4YOIA 1TABE 2FOAA 3RXAA 2ZHFH 1MCTA 1SB1H 3TH3H 4X6NA 3RU4E 1K1MA 1JXPA 1TBZH 3ATMA 3WWBA 3QUMP 1CBWB 4ZKOU 2ZI2H 1T8MA 4TYDA 4CR9A 1DSTA 4B2BA 1BITA 2SGAA 3GY5A 1O30A 1P3EA 3PYHA 1BHXB 3TU7H 4AX9H 1SVPA 3TGIE 4Q4LA 3M3VA 2FS9A 2GTBA 4Y79A 2DE9A 1TNLA 1D3PB 1N1LA 1OSSA 1OWIA 2BM2A 4ABFA 1PPBH 3A7VA 1FAXA 2WPHS 3U8OH 3HPTB 4DCDA 1SGFA 2GKVE 2Z9JA 1TX8A 1G3DA 2CXVA 1LHDH 4NIXA 4K60A 3PB1E 1KXBA 5J4SA 1C2EA 1A0LA 4DT7B 1MTWA 3R0FA 2D26C 4TWWA 3FN8A 5C1XA 1LVMA 4UEHH 4XSKU 1DWDH 2QF0A 2CF9H 1ZGVA 3EYDA 4M9FA 2WSSD 3E91A 1GGDB 4FVDA 1GVKB 3F2GA 1NRSH 3PV2A 1EJMA 1O3PB 4ISHH 5J4QA 1GBLA 2KCOA 3QWCH 1LPGB 1V2UT 2A5KA 3ZYDA 1O37A 1FN6A 1W2KH 1AHTH 1GJDB 1WQSA 1BRBE 2WUBA 1LHCH 3BEFB 5DP4A 1P06A 1C5MD 1S81A 1TNJA 2HLCA 4X0WU 1J16A 3ZV8A 1ZMLA 5JBAS 3GS9A 5ETXA 2J38A 4DVAU 1ELCA 1A1RA 2CMYA 1UVUH 4OS1A 5CHBA 4X2XA 2J92A 2FOCA 2O8LA 3GCNA 1ESBA 3E1XB 4H42U 1O32A 4X2WA 1SLVB 1PPFE 5B6LA 1EZXC 4GLYA 2OK5A 3NZIA 1JMOH 4DJZB 4NZLA 1NRNH 1O3GA 4WMFA 2B7DH 2IPHA 2NWNA 1K9OE 4AGJA 1XUFA 2VIVA 2ZGCA 1C1UH 1PFXC 2W6JD 1LVBA 1XUJA 3R3GB 3Q3XA 2ZP0H 4AFUA 1XM1A 2ESTE 1GL1A 3A89A 4BAOB 1C5PA 1QY6A 1ELEE 3TK6A 1ELDE 2TBSA 1AIXH 2Y81A 5CE1A 3RU4T 3VG8A 2PHBA 4IN2A 1ID5H 2HPQH 4ABGA 2GT7A 3PMBB 5EXLA 1G9IE 1RTLA 1O2MA 1DOJA 1VITF 5E2OA 4AFZA 1CT2E 4BANB 2C90B 1BQYA 2FIRH 1NFWA 2UWPA 4ZMAH 3RMLH 1EOJA 3URDA 1HV7A 2YOLA 1IQKA 1TB6H 1DLKB 2QAAA 5C1YA 1NZQH 1GBBA 1PYTC 3ZVEA 1UK2A 1GJ5H 3AAUA 4O9VA 1V2TT 1W12U 1SL3A 1W7XH 5A09A 4Y7AA 5ABWA 2ZU2A 1NBME 1BDAA 2VWNA 2Y7ZA 3SJKA 1E35B 1GBAA 1JWTA 1RRKA 1FY4A 5EGMA 1O2TA 4CRCA 3SNDA 1TRYA 1W3CA 4FU9A 1GJBB 1LKAA 3RXRA 3E90B 1IHTH 1EJAA 3B23B 3EA9A 3GYMA 2D1JA 1DANH 1GBFA 3LONA 1OWJA 5ESBA 2ZO3H 2GCHF 4CHAB 4JCNA 3I77A 4BNRA 1HJ8A 5A8YA 1AVGH 1Z7KA 3U8TH 2OP9A 3B8JA 4B74A 5C67A 1C5NH 1FUJA 2UWLA 1WU1A 1T7CA 3TGJE 1QJ1B 1WSSH 1NFUA 3L3TA 1QA7A 8ESTE 3A8DA 1H8ED 1PQ5A 1SBWA 4HI3A 3TVJB 3RMNH 1SLWB 4TY7A 4WVPE 1Y5UT 1JBUH 1DDJA 3UY9A 2NU4E 3PMAB 3KQBA 3RXOA 1KXFA 3HGPA 1RTKA 1T32A 4JZDH 3OX7U 1EPTA 1TQ0B 1DXWA 4UDWH 1PPEE 3VFEA 2Q6FA 1FIZA 5BRRE 1HGTH 2KFWA 4BTIB 1TGCA 1YCPH 2UUKB 4AORA 1A0HB 4I7YH 1Y3XA 1GHZA 4ISIH 1UCYH 2AH4X 3SHCH 2UUFB 4Q80A 2A45B 1B0EA 4Y76A 1C2MA 4ZKRU 3H09A 2ZCLP 3HKJB 1DVAH 3STJA 2QF5A 2WYGA 4BTUB 3M7QA 1BTHH 4FUGA 3MH4A 2FOEA 1YPGH 1P2KA 1TMTH 4A1XA 5DO4H 1ETRH 1CSOE 5GJ4B 3OAAD 1EFRD 3OU0A 1NC6A 4OS6A 1LDTT 4HFPB 2IOTA 4AZ2B 3RM2H 2PV9B 2Z9IA 4OS7A 2HNTF 3CP7A 1MTVA 2KCPA 2C4FH 3VGCB 5G4BA 1MKWH 1ZPBA 1K28D 1SQOA 1WTGH 3LOXA 2IJOB 1T4UH 3ZVCA 1MBQA 2A4GA 2RA3A 4NA8A 2BX3A 1F2SE 2BMGB 5I46H 2UUYA 3O8RA 1CU1A 5HM9A 1H1BA 1GI4A 4X2VA 2FLRH 1PQAA 1HAIH 1CQQA 2WHXA 4YO9A 2UUJB 2VVVA 1BMNH 4VGCB 3E3TA 1S82A 2W7UA 1GMDF 5F8XA 1Y8TA 1NN6A 4NCYA 1C1PA 3V0XA 3MH7A 3WW7A 1HCGA 2IN2A 5DGJA 2ZDLA 5HYOA 1AB9B 2VIPA 1XUIA 2VU8E 3RXGA 1PPCE 1GBEA 1ANEA 1SOZA 4QT8C 1AVWA 2WPIS 2HOBA 4TPYA 3NCLA 2OUAA 2ZTXA 5A0AE 4Y0ZE 4MTBA 1UHBA 3GICB 1FN8A 3GCOA 3CENA 5IK2D 5C5NA 4AYVB 3EGKH 1GJ8B 2BD9A 1O2QA 4Q63A 2PKSC 3SN8A 1XUKA 5C17A 1MKXK 1S5SA 3M37A 1AE5A 2G52A 4E05H 1N8OB 1GMHG 3BTTE 4GVUA 2SGEE 4FUBA 2BXUH 1HXEH 5IYTA 3O8DA 2OBOA 2EC9H 3I29A 4X8UH 4JMYA 5C1UA 2R0LA 3SHAH 2A4OA 1SC8U 3DUXH 5DP6A 1L1NA 2QE7D 3RXKA 1KLTA 5FBEA 1RGQA 4ASUD 3PRDA 4JZEH 3PV4A 3M5NA 1Z8RA 3ENSB 4CREA 5C2ZA 2HPPH 4ZAEA 2FX4A 4AB8A 1AUJA 2NU1E 3RXDA 2TGDA 1AVXA 1HAGE 2A2XH 3SV8A 1XKAC 1BTUA 3BN9A 1T31A 1O39A 1GHVH 2FM2A 3SU0A 2ZF0H 4AOQA 3UFAA 3MU1A 4R0IA 3RXPA 2FS8A 1EPTB 2PTNA 1NM6A 3C27B 3EQ0H 3F0OA 5EODA 4X6OA 4NSYA 1V2WT 3SJIA 3S9BA 1IQMA 4ZXYH 2TIOA 3M35A 5EG4A 3Q77A 5L2ZH 1PPZA 1QL8A 2SGDE 1EQ9A 1FONA 2WZQA 1VGCB 1V2RT 2PGQB 4B6FA 2VVUA 3S7KB 1P3CA 2BDAA 3DHKH 2EI6A 5A0BA 2P3UB 6CHAB 1EB1H 3S9AA 4BAKB 1C9TA 3KCGH 3ATKA 3E0NB 4D76A 1MTUA 1HIAB 1O3AA 4Y8ZA 2XBXA 2J95A 1AWFH 3M5MA 1GI9B 4YOGA 2Q6GA 5GDSH 1P2IA 2SNWA 2ULLA 2OBQA 2YNBA 2G4UA 1T8OA 2W5EA 1FQ3A 3E0PB 1YPJH 2KCAA 1DPOA 2FXRA 2ZGBH 1W0JD 1O5GH 1GJ4H 3GCTG 1A46H 1QHRB 2ANYA 3TH2H 1O2XA 3A8AA 1DX5M 4YM9A 3N7DA 2FYRA 1FX0B 3P95A 2Z3DA 1D9IA 2AGEX 4H4FA 3M3SA 3BF6H 2XXLA 3KEEA 1Z1JA 2AYWA 3KN2A 1ETTH 1O3LA 3RMOH 2IJD1 1A5HA 1V2QT 2B0FA 3OY5U 1KIGH 1P05A 1GBHA 4DIIH 1UTOA 3MI4A 1SGQE 2Z7FE 4ZROA 4CHAC 1GMDG 1G3EA 5SGAE 1FV9A 4LZ4B 3LGUA 1ANDA 1O3OA 3RXIA 3SJOA 4A7IB 1Z6EA 1AGJA 3OFND 5E2PA 1DT2A 3PWBA 1CA0B 2SGQE 5A0CA 3K9XB 1P9UA 3RXVA 1C1SA 3NKKA 2VH0A 1O2ZA 4X8TH 5B6OA 3DFLA 1GCDA 1HJ9A 5DPAA 1T8NA 1QA0A 4D8NA 4TSFD 4U32A 2Z3EA 3E16B 4CBNA 1TGTA 1HB0B 1MU6B 3T29A 2FLBH 3AVZA 3TGKE 2BLQA 3ATWA 1JOUB 1JRTA 1V2MT 3NXPA 4UD9H 2ZDVH 4GPGA 4JYTA 5EXMA 1TNGA 2C8XB 5C5OA 1QRZA 3ATIA 1D3TB 1VR1H 1TX7A 1FIWA 5E8EH 2F9UA 1O3KA 1TWXB 2F4LA 2V35A 2ZFSA 4IMZA 1ARBA 2YNAA 4NWLA 3TNSA 4YOJA 4TWYA 3L33A 1DLEA 1GBKA 4BXWA 1DS2E 4MVNA 2W7SA 1XXFA 1W0YH 2CHAB 3V12A 1O2RA 4X1SU 1NY22 1S0QA 1Z8JB 6GCHF 8GCHG 1GDQA 2EI8A 4ISNA 1TNHA 3TJVA 3OE7D 2XNIA 1C4Y2 3QDZB 1BJUA 1GCTC 5FX5A 3ZV9A 1V2LT 2AERH 2Y5GA 3U69H 3QN7A 7GCHG 4PROA 1ELTA 1SGRE 3FFGA 5F53A 4THNH 3MU5A 3MH5A 3D62A 3ZZ8A 2CF8H 3RLWH 1NBMD 2VGCB 4Y7BA 1DY8A 4CH8B 4I33A 1Y59T 1B7XB 2ZC9H 1PYTD 2BX4A 2G4TA 4I8HA 1AB9C 1RD3B 2ZQ1A 1MAXA 2ZIQH 2WPLS 1GMCF 1ZJDA 1G2MA 4Q7ZA 3FZDA 2BQ6B 1GHAG 1Z8IB 4ZKNU 1NPMA 4UE7H 3H5CB 2BLOA 1OOKB 3HK6B 2C3SA 1EUFA 4IBLH 1BHXF 4RKOB 1SGNE 5EOKA 1ARCA 4Q7YA 2GV6A 2O8UA 1A0JA 3PO1B 2QXHA 2HWLB 1ORFA 1O3JA 1KLIH 1QJ6B 1EATA 1CGHA 1O3DA 1TX6A 4FETA 1DXPA 3K2UA 3RM0H 3ZZ9A 3PROA 3LGWA 1FDPA 3RXJA 3KF2A 1GI6A 2Q1JA 5GWZA 3WWFA 1UCYK 1GBIA 2HALA 4ABIA 5DP8A 5A8XA 3A7ZA 5L2YH 1IQEA 1C1RA 1OWEA 3BTME 3FVFB 1XUGA 2H9EH 1O3HA 4WJG2 3FKSD 1G37A 1ZSKA 1BMAA 2K1QA 1BMLA 1CO7E 3O8BA 1TOMH 1SPJA 2SGPE 1HNEE 2QGRA 3SUDA 4RSPA 1OHHD 2A2QH 3KQCA 3U1JB 1EAIA 3MHWU 4GHQA 1CBWC 3DT0H 2OC0A 3SV2H 2GCTB 1GBCA 1NRRH 1Y5BT 2AMDA 1CGIE 1O3CA 3MH6A 1FPHH 4IMQA 3BEIB 3N7EA 1UVOA 1EAWA 2PSYA 1SFQB 2ZU3A 5F8TA 2BB4A 1GI1A 2BD3A 2JJ2D 3MNBA 2WV4A 1HFDA 2FPZA 4ZCNA 2ZHEH 3NPSA 5LPFA 1BB0B 3TK9A 1GJ6A 2FDAA 4CR5A 1O3MA 1V2ST 1THPB 4KKDA 4FUIA 1ZHRA 2ZU4A 1A3EH 2BY9X 3SNBA 2YMSD 1O2PA 4XDEA 4INHA 1D3QB 3D49H 1ZR0A 1E1RD 1L4DA 3ZZ7A 1GI7B 2ODYB 1GI8B 1HRTH 1HXFH 2ANKH 2NU3E 5JPMH 1TGNA 2QCYA 2FI5E 2THFB 1W0ZU 1ANCA 1SSXA 4IC5A 2EI7A 3ODDA 1E37B 2XW9A 3W94A 1IQHA 2A7HA 4CRGA 2JETB 4XD7D 3FO8D 4NFEA 1THSH