4U01A

Hcv ns3/4a serine protease in complex with 6570
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
182
Chain Sequence
b'APITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural 3 protease
molecule tags Hydrolase
source organism Hepatitis c virus (isolate con1)
publication title Discovery and structural diversity of the hepatitis C virus NS3/4A serine protease inhibitor series leading to clinical candidate IDX320.
pubmed doi rcsb
total genus 37
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G, H, J
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u01A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4u01A01
3SNEA 2FX6A 3M35A 3AW0A 1VJAU 3TGJE 1P12E 4AG1A 2FOAA 5EGMA 1BMNH 1E38B 1TPSA 2UUYA 4XDEA 3MU0A 1MQ6A 3O8CA 3BEUA 4BTTB 2BD3A 1LCYA 3A8AA 1QIXB 4FUBA 1LDTT 1ZZZA 6CHAB 3HKJB 1YC0A 3O8BA 2F91A 3MFJA 1IQGA 2BDYA 4NWLA 3T25A 1TGSZ 4X2VA 1KXEA 3D65E 1F0RA 4MPWA 4JYUH 1EAIA 3FP6E 2UUFB 1ABJH 2SNVA 3V3MA 1NN6A 2A4RA 3RXGA 1LHFH 4BTUB 1JIMA 2OQ5A 2VH6A 1INCA 3TH2H 1RTFB 3SO3A 1PPZA 1DSUA 2BZ6H 3V0XA 1GI9B 1DVAH 2PV9B 1GVLA 1TOMH 1O3AA 2A4OA 2AIPA 2ZHWH 3RMLH 1OWIA 2ANKH 2SGEE 1O37A 2EC9H 3E91A 1O3FA 4THNH 5DP9A 1TA6A 1O3HA 1PPEE 1ETSH 1S6FA 4ABDA 2FDAA 3AK5A 2OCVB 1GVKB 3T26A 3OSYA 1QJ1B 1A4WH 1BBRE 2ZF0H 5CMXH 2J34A 1U6QA 1C4Y2 2F4LA 2ZO3H 1TONA 3TNSA 3U9AH 2ESTE 3KQCA 5F8ZA 1KYNA 4OS5A 1JXPA 1K1MA 3ELAH 1UVOA 1ZRBA 4OS6A 1GI5A 1G3BA 4KTUA 3U8TH 5DJ7A 1AE5A 1P9SA 2G8TA 1GJ9B 4AZ2B 3MTYA 4UDWH 2BY5X 2ZU2A 2JKHA 2OC8A 1QURH 2WV9A 1J8AA 1PYTC 2G52A 1F5RA 1H8IH 1XX9A 2QF3A 3PWCA 3OY6U 1G32B 4JK5A 1C2HA 1LVYA 3PYHA 1GJCB 5GWZA 1MU8B 3KNXA 4MG3A 4RSPA 2VWOA 4H4FA 3A8BA 1EAXA 1Z1JA 2WINI 2WPIS 2ODPA 3HPTB 1LPGB 2QC2A 1IQJA 4NSYA 1TNIA 4FXGH 1G37A 2HRVA 1G3CA 2FI3E 1PQAA 3RXJA 1HAYB 2AH4X 4NZLA 9ESTA 1AMHA 2ZU5A 5ETXA 3TK6A 4I8LA 3LC3A 4NFEA 3VB3A 4NGAH 3M3TA 1SGNE 1ANCA 2Z9JA 4XE4A 1O2VA 2BM2A 2H1UA 3LIWA 4K5ZA 4XFQA 1QL8A 4HTCH 1L4ZA 2VVCA 3LPRA 5FCRA 1Z8RA 1KTTB 2ZTZA 4BAMB 1TMTH 1YPMH 1QQ4A 4E7RG 1W3CA 4E7NA 2FOGA 2HNTE 2A7JA 1FI8A 1D6WA 1HAZB 1MCTA 2IJOB 1Z8JB 2BY6X 3A7XA 3QWCH 1UO6A 3EGKH 1A3BH 4GHTA 1TLDA 4M7GA 5CHAB 3P95A 5GNDA 4TY6A 4ABJA 1HV7A 3PTNA 4UD9H 7GCHF 3LONA 1FY8E 1UMAH 4X8VH 3ODFA 3Q76A 3SI4H 3S7KB 3FZDA 5AHGH 4O97A 1E0FD 1THRH 3ZVDA 4I33A 3ZZDA 1S85A 5A09A 4X2WA 1C2DA 2VIWA 1W7XH 1SQAA 3A7WA 1DY8A 4U32A 1L2EA 4U2WA 2GDEH 1EJNA 1LHDH 5ESBA 3PTBA 1BRUP 1P10A 1J17T 3A87A 1NRNH 3SOSA 1JBUH 3NKKA 2D26C 3LOXA 3RP2A 1ARBA 1WYKA 1FONA 2FLRH 2ANYA 4ABBA 2A2QH 1BOQA 1A7SA 4K3JA 1JIRA 1BJUA 1GL0E 2ZIQH 3UQOA 3EDXB 2CHAB 3FAOA 2J4IA 3RXKA 4DJZB 1G30B 2NU1E 2C90B 5I46H 2G51A 1O3PB 1HDTH 1SGYE 4JK6A 4A7IB 1F2SE 1A1RA 3ZZ3A 2R3YA 2BY9X 3SZNA 1L0ZA 3KN2A 1LHEH 2VH0A 3MH4A 5C1UA 1CE5A 3B8JA 3TH3H 5JDUB 1O2PA 2V3OH 3E0PB 1RS0A 2B9LA 4MVNA 3T28A 4M9FA 1CT2E 1OWKA 2F9NA 1E37B 2XYAA 1YGCH 2BD8A 5E2OA 1GG6C 1P11E 1CSOE 5LGOA 1HAVB 3UWJH 1ETTH 2Q6DA 1AY6H 1QL7A 2V6NA 1O39A 1SOTA 1WTHD 2O8LA 2ZTYA 3BTME 4YLQH 3SW2B 3VGCB 4MLFB 2ZPRA 2F9BH 4KTSA 1A2CH 2WPJS 2PUQH 3AAVA 4FUGA 3VB5A 1OSSA 1DDJA 1GJAB 3EA8A 1D3TB 1GJ8B 1NFUA 1TNLA 3GY5A 2ZHFH 3ZZCA 1DX5M 1L1NA 1IQHA 2A4QA 3MNSA 1MTNB 3RM0H 5I25A 1C1OA 4DCDA 2G81E 1C2GA 3UPEA 1VITH 2W3KA 1QJ6B 2GCTB 2R2WU 1O34A 2BDHA 3LDXH 3RC5A 3LT3A 1C1NA 4YOGA 3KL6A 4B2AA 4K69A 5GXPA 2ZZUH 4WMEA 1UK4A 3RU4D 3SU3A 4Y76A 4Q2KA 3VGCC 4RKOB 1TGBA 5EOKA 5EQRA 2TGAA 6CHAC 1GHBF 1ZTLA 3UIRA 1WV7H 3LGTA 1S0QA 4IGDA 2FS9A 1MQ5A 1WTGH 1AD8H 2BB4A 3M5OA 4FUJA 1Q2WA 1ELEE 3R0FA 2ZQ2A 3E6PH 3M3VA 1PFXC 3SJIA 1LHCH 2HOBA 1TA2A 4Y7BA 2IJD1 2A5KA 4CRDA 4DG4A 3HGNA 1BTZA 2W26A 3BV9B 4KTCA 2ANMH 3RXEA 3URDA 5GCHG 1D3PB 3F6UH 1DITH 4ABGA 1FNIA 1PQ5A 1HJ9A 3ZZ9A 2B0FA 2Z3EA 3BTWE 1BBRH 5JYIA 3RXBA 3GY8A 4IMQA 2QXGA 3PLKA 7LPRA 1ID5H 1TX6A 1ZSKA 1ACBE 3FZZA 3MH6A 1QFKH 1ZHMA 1WU1A 3E16B 1RTKA 5A0CA 1PQ8A 1GHWH 3U98H 4DURA 4AYYB 3NWUA 5C1XA 3LJJA 3KF2A 3PMHB 1DY9A 3BG8A 1HJ8A 2PLXA 3E3TA 1HAPH 3LGUA 1ZMJA 1QY6A 1MU6B 3KIDU 3U1JB 3HGPA 3HKIB 5T6DA 2A7HA 1GMDF 7KMEH 3A84A 4A1VA 1RGQA 4BAHB 1EAWA 1DE7H 1GMCF 4ZKSU 2JH0D 2GX4A 3M7QA 1HAOH 5LH8A 1MD8A 1RFNA 1ELDE 3FP7E 2OBQA 3RXMA 1QGFA 3RXUA 1DANH 1C1TA 4JYTA 1EASA 2JH5D 3HATH 4YT6H 1TQ7B 2V35A 1O2NA 2H5DA 5T3HA 1V2QT 4IN2A 4K1EA 2WV5A 2QY0B 2RCEA 2NU4E 3ODDA 1VGCC 4D9QA 1EJAA 2UUJB 4OGYA 2V3HH 5EODA 2XCNA 1GHVH 2FXRA 1AVXA 1W14U 2VVUA 2GP9B 4A1TA 1O5EH 1O2JA 3S0NA 1BRAA 5IYTA 5CE1A 1HAIH 1V2PT 1LKBA 1SFQB 3GY7A 2NU2E 2M5TA 2BZAA 1SLUB 1C1UH 3VXFH 4X1NU 3O8RA 2ZI2H 1A0HB 1K1JA 1GJBB 1EJMA 5F6MA 1RIWB 2ZGCA 4B75A 3UNRA 4U30A 3Q77A 1OWJA 2ZHQH 3MU4A 4CRAA 4X8TH 2XTTB 7GCHG 4ESTE 2BDBA 4DY7B 4ZUHA 4YT7H 1DWCH 4Q7XA 1OOKB 4WVPE 1O2OA 1G36A 1S82A 3UR9A 2PSYA 1DUAA 1MKWK 3FANA 2QIQA 3MWIU 4CRCA 1G2LA 1IQMA 4IC5A 1QA7A 3SGQE 1C2FA 1C5TA 3M61U 2BDAA 2R0LA 1YBWA 4NFFA 1XUKA 2P59A 1CA0C 3A7VA 1D3QB 1NU9A 1SBWA 1P2NA 1TMUH 2OQUA 3ZVGA 4GPGA 1VR1H 1ZGVA 5ESTE 4Y11E 1TRMA 1C2JA 2ZTXA 3D49H 3EA9A 2GKVE 4K8BA 3VPKA 1BZXE 1N1LA 1Z7KA 5FBIA 1IQNA 1GMHF 1RTLA 5EXLA 2C8ZB 1V2ST 1O2IA 2OINA 3U69H 1JRTA 1KTSB 3SQEE 3ZZ4A 1ESBA 3PV2A 1RIWC 2XNIA 3PB1E 1CBWC 1GJ4H 2AGEX 3T29A 4B76A 4Y0ZE 1YLCA 2FIRH 1K28D 4Z0KA 5T6FA 2FOMB 1PQ7A 1Q3XA 2ZFSA 1OWHA 4A5TS 2ANWA 1CT0E 1GHZA 2ODYB 2GCHF 3DFJA 3NXPA 3TGKE 1N6XA 4CRFA 2FESH 2BVSH 1YPHC 3GCHB 3UFAA 2XBVA 1WUNH 3BTGE 5G4BA 1OYQA 2BOKA 1L1GA 1V6DA 2BLWA 2FLBH 1GJ5H 1NFWA 2BD2A 3PLBA 3NUMA 2FMJA 5HXFA 1QCPA 4FU8A 2OTVA 2XBXA 5EW1H 1HYLA 1V2RT 2ZGBH 4IW4E 1AQ7A 1BUIA 4OS4A 1NU7B 2Q6FA 1K1NA 2A2XH 4TPIZ 1O2ZA 1SG8B 1GI7B 1GGDC 3BIUH 3PWBA 4HI3A 1H9IE 2P93A 1NC6A 3LGIA 3BTQE 3LH1A 4O3UA 2A1DB 1LTOA 4INHA 4K1TA 2WYGA 2BVRH 1YP9A 1YPJH 4J1YA 2HNTC 1C1QA 1BRCE 4UE7H 2G00A 3P92A 5BRRE 2J2UA 4ABFA 3MU5A 1FY3A 4WXIA 1FAKH 1XUGA 2ZU1A 5C3NA 2G55A 3MNXA 1C5ZB 4A6LA 1HUTH 1EB2A 3LJOA 1D6RA 1MKWH 2A5AA 1FIZA 3TJUA 1AKSB 4FUDA 5EXNA 3ENSB 5FBEA 2H6MA 2JETC 1GBLA 3UOUA 4IN1A 2KAIB 1ZRKA 2P94A 2AERH 2VJ1A 2QA9E 4WY3A 2Q1JA 2ULLA 2VIDA 4CR9A 2AGGX 1O3GA 2A5IA 2A4GA 1GDUA 2I6QA 3M5NA 1GMDG 2WPLS 2F9PA 1GJ6A 1TABE 1OP2A 4WWYA 1P2JA 5A2MH 3UR6A 2SGDE 2ZDVH 2GCTC 1C5MD 1LHGH 1NTPA 3K6YA 1F0TA 1ELGA 3PMBB 4NG9H 3TITA 1NRPH 3RUOA 1ZJDA 1UVUH 1O2RA 1LMWB 4X2YA 4KKDA 4ISOA 2GGVB 3SJ8A 9LPRA 1EOLA 1WBGB 2D1JA 1KLTA 1C5QA 2JH6D 1GBAA 2CF9H 5GPIB 1F5LA 4B71A 4D7FA 2ZG0H 2GT8A 1GHAF 2UWLA 1FPHH 1LKAA 4HZHA 3FVFB 1NPMA 1WOFA 1W2KH 1YCPK 1HGTH 3GCOA 4X2XA 5JB8S 3UWIA 1NFXA 2QXJA 1CT4E 4R8TB 4IMZA 5F8XA 3RXIA 5EQSA 5AFZH 1ANBA 1FY4A 2OBOA 3GCTG 1EB1H 3SUEA 4TPYA 4KGAA 3ZVFA 1AKSA 4Q7YA 3CP7A 1O0DH 1O2LA 1FJSA 1RRKA 3A8CA 3EA7A 1PPHE 1ANEA 3A7ZA 2LNCA 3RU4T 3NZIA 3QX5H 2WHXA 2ZPQA 3V7TA 3K9XB 1ZR0A 2O8MA 1THSH 3MNBA 1YPEH 4JMYA 1TX8A 1M9UA 5DP7A 2DE8A 5GIBA 1GCTB 3R3GB 1TRYA 5EW2H 5EG4A 1DT2A 2F3CE 1KXDA 1SLXB 1SFIA 1DSTA 1O32A 3LH3A 3ZYEA 1WQSA 1XUIA 5ABWA 3OY5U 5IDKA 4ISLA 6GCHG 4MPXA 2ZFTA 3DUXH 3SBKA 4CH8B 3P6ZB 5DP4A 1GHYH 1QNJA 5JBAS 3ITIA 3TJOA 1O5AB 3D62A 1NT1A 3OU0A 1F5KU 4AFZA 1IQKA 3GDSA 4SGAE 1ZTJA 5LPRA 3L33A 2CJIA 5H4IB 1P05A 2PR3A 1K1PA 5C67A 1W7GH 1HJAC 1O3LA 4ZHAA 1KXCA 5FHTA 4B74A 1T32A 8GCHF 3GY3A 2FOHA 1MTWA 5FPYA 2JETB 3MHWU 4NIYA 1NRRH 1GG6B 2Z94A 1IAUA 2GZ7A 1ELFA 1O3MA 3E90B 4GSOA 1JRSA 2BD9A 4OM9A 2FOEA 4JZEH 2P8OC 1YPHE 1G2MA 1GBBA 2QXHA 8KME2 3IITA 4MNWA 1AVWA 2BDGA 3TH4H 1S5SA 1BCUH 2CF8H 4B2CA 1MKXK 1TYNA 2YOLA 4WMFA 2XC4A 3HK3B 1QB6A 1GHXH 3BN9A 4IS5A 2THFB 1KXAA 1Z71A 2VWLA 1Y3WA 2ASUB 4YESB 4VGCC 4NIXA 5C20A 1P06A 1UVTH 3STIA 1UVPA 4JZIA 3UNSA 4LZ4B 2WPKS 2H9TH 1YLDA 2IN2A 8LPRA 1GDNA 2ZKSA 3SGAE 2OC1A 3E8LA 3ZZ8A 4NA9H 5T1VA 1Z8IB 1O2XA 3F9HA 3UOPA 5JBTA 1BB0B 1JWTA 4U01A 3KCGH 2AMDA 5FPSA 1D3DB 2H9HA 4B2BA 1OP8A 4LOYH 5T6GA 3W95A 1AU8A 5L2YH 4NSVA 2WYJA 1P2MA 4FUIA 3UTUH 4IBLH 2PSXA 1W0YH 2XBYA 4X6MA 3RMMH 4LZ1H 5A0AE 1TPOA 4OS2A 1KXFA 2R0KA 1GI1A 3BSQA 2PUXB 2ZDAH 2GV6A 1G3EA 3P8NA 2PGQB 4Y8XA 1CBWB 6GCHF 3TJVA 3OTPA 1BBRK 2HPQH 2GVFA 5GJ4B 4TYDA 2CV3A 2SNWA 4Y8YA 1NESE 2ZCKP 1IQFA 3GOVB 3S9BA 1C5YB 1C4U2 1GBKA 3MOCA 2CMYA 4YOIA 1LQEA 2I6SA 2ZGJA 3QDZB 5FX5A 2D2DA 1Y3XA 3M3SA 1YPKH 4INLA 4A1XA 4JZFH 1GBFA 2F9VA 2IOTA 1GHBG 2XCFA 3BTDE 4ABIA 1VITG 5DP6A 3GY6A 4X1RU 4ZH8A 1GMHG 5FCKA 1O36A 1PPBH 1E35B 2O9QA 4AX9H 2BXTH 1MKXH 2J92A 1UHBA 1EATA 2TPIZ 1BMAA 4B6EA 2VNTA 4I8GA 1P2QA 1V2TT 1V2LT 2ZC9H 1OX1A 1WQVH 1O3BA 1AHTH 1Y3YA 2DE9A 3M5MA 1UTKA 1C5WB 3C27B 4CBNA 3PMAB 1C5RA 1Y3UA 3P70B 3S9AA 1SQTA 3MO3A 3TVJB 1A5GH 1D4PB 2BDCA 1V2KT 3FP8E 2FWWA 1NS3A 2VIPA 3RMOH 3SORA 1XUHA 1T4VH 2ZEBA 1PPCE 2B8OH 2PTCE 1GMCG 2GMTB 1DXPA 1V2VT 3LGVA 4YOJA 3ATWA 4FUHA 3RXRA 2R9PA 5DP3A 2QCYA 1YPLH 2QAAA 2STAE 3N7OA 5EU8A 2HGTH 3T62A 2XBWA 1SI5H 1BTYA 4BAKB 3SZEA 2Z9GA 4FUFA 2RA3A 1GBJA 1UTJA 1FY5A 3SQHE 1IOEA 3ATLA 2VWMA 4BNRA 1OPHB 1SLWB 2BOHB 1P2IA 2A32A 2H5CA 5A8XA 2WZQA 4Y0YE 4ZKNU 3OTJE 4GAWA 3GDVA 3I77A 1IQLA 3UNQA 1TOCB 2ALPA 4YTAA 3ZZ6A 1WXRA 1QBNA 2AS9A 1SGEE 3S9CA 1HNEE 1C5UA 3PROA 1SGIB 5E0JA 2ZGXH 1C5XB 4BTIB 1QB1A 3SUGA 1Z6EA 2SGAA 1ZSLA 4SGBE 1FZZA 1VCPA 3QN7A 1P2OA 2HLCA 4HFPB 1Z8GA 1OWEA 2ZDKA 3RXCA 1ELBA 1TALA 4AORA 5L2ZH 3RXFA 3RXAA 1V2MT 1MCVA 1SC8U 5AF9H 1DLKB 2VIVA 2XC0A 4ABHA 3VXEH 1IQEA 3L3TA 1BJVA 1KDQA 1GHAG 2G5NA 1VCWA 3BEFB 8GCHG 4UFFH 2ZWLH 2VIOA 4F4OC 2ZU3A 3CS0A 3NPSA 4X1QU 4ZMAH 3SHCH 2ZDLA 1T8OA 3CS7A 1C5PA 1GI2A 3WY8A 1GPZA 2QF0A 1Y5AT 3PO1C 2FS8A 5JB9S 1P9UA 5DGJA 3BTTE 3Q3YA 1JOUB 1ZPCA 4AB8A 2XW9A 3MI4A 4ZXYH 1C9TA 1P57B 4E05H 3M37A 2NU0E 2BLOA 3OX7U 1W8BH 1C1MA 3OYPA 3SHAH 1XVOA 2YNBA 3H7OA 4CRGA 1QBVH 1P09A 3T27A 4JZ1A 1T31A 3C1KA 2J9NA 1C2KA 1CU1A 1LVOA 3RMNH 1TGCA 4D9RA 1SPJA 4OS7A 2ZFPH 1E36B 5A8ZA 2VINA 1DUEA 1HBTH 1SR5C 3I78A 4ASHA 2K1QA 4UFDH 4Y8ZA 4K60A 3SI3H 1SOZA 1TGNA 1HXFH 3DA9B 4NIVA 1K2I1 1VCQA 1CVWH 1N8OC 2BD4A 1AUTC 1GCTC 2PKAB 2A31A 5J4SA 4JZDH 2TBSA 4H6TA 4PROA 3LKWA 1ETRH 2ZECA 2FTMA 3F9FA 2Y80A 1TBZH 1Y8TA 5DKMA 4Y7AA 1J9CH 1Z6JH 1LO6A 3ZVEA 1O33A 2BHGA 4ZKRU 1KDQB 1ZJKA 3BIVH 2W3IA 2UUKB 1F7ZA 2TIOA 4FU9A 1MAYA 3DFLA 1C2IA 1J15A 1O5CB 1DICA 3QZRA 4X6PA 1GJ7B 5DG6A 1F0UA 1UTPA 1YPGH 1MH0A 2ZCHP 1T8MA 4BAQB 1OWDA 4J2YB 1LVMA 1CGHA 3SJ9A 2BXUH 1MTUA 1BHXB 4AYVB 1MTNC 2FOCA 2CHAC 3BF6H 2H9EH 2AMPA 1KY9A 1UCYE 1NFYA 3SU5A 1O2SA 4UEHH 3BTEE 5JBBS 3T5FH 2BX3A 2C8WB 3S7HB 2ZNKH 2ALVA 1P04A 1AZZA 1TPPA 2FM2A 1A5IA 2A0QB 1QBOA 2BTCE 1SGTA 1MTSA 1VITF 5DK1A 2VBCA 4UFGH 1MMJN 2Y5FA 3GYMA 2R2MB 4F49A 1GBTA 1BQYA 4X8UH 1DM4B 1O2QA 4GLYA 4O9VA 1ZHPA 4AG2A 3RLWH 3ZVBA 3H5CB 1GVZA 4D76A 1ANDA 3LGWA 3SGBE 1XKBC 3TK9A 2J95A 2BY7X 4GHQA 6LPRA 3BG4C 5JPMH 1O3CA 1DFPA 1CHOG 4JYVH 2GDDA 1AI8H 1UHBB 5CHAC 1C2MA 1QHRB 1A3EH 2BQ7B 4MPVA 4CRBA 4I8HA 2QN5T 4GVUA 3A81A 1NRQH 2AYWA 3MNCA 1A46H 3S69A 1V3XA 1EUFA 4X6NA 2OK5A 2Z6BD 5AFYH 4ZROA 4TY7A 1C9PA 1DOJA 2TGTA 4WMDA 3RXDA 1XXDA 3QLPH 1EAUA 2Z3CA 1GGDB 1SVPA 2VVVA 4GCHG 4RKJB 3RC6A 1FN8A 3P8GA 1AFQC 1C1RA 5HYOA 1NY22 2F9UA 2Q6GA 2VIQA 3MU8A 4IC6A 2Y6TA 3U1IB 4D7GA 1O35A 1W10U 1T8NA 2G4TA 1EP6A 2FPZA 2ZGHA 1EPTB 4DVAU 4BOHA 2ZP0H 1FN6A 1O2MA 1FXYA 2ILNA 5JBCS 3RC4A 1G3DA 3SU4A 2EI7A 1SQOA 1Y5BT 2OC7A 2NWNA 4KELA 1UK2A 2BQWB 3GCHC 5HMAA 4FU7A 3T2NA 3A89A 3B23B 5HM2A 3SU6A 4UFEH 2D8WA 1J14A 4FUEA 1EPTA 1SL3A 1HAGE 2VB0A 1UTOA 3H7TA 2Y82A 1GL1A 2OP9A 1BDAA 1UTLM 3PLPA 3SUFA 1TGTA 1FMGA 5AVDA 3RU4E 1TFXA 1AFEH 3A8DA 2OXSA 2P3FH 7ESTE 3BTKE 1EP5A 1K1LA 3SUDA 1SGPE 3QTOH 2WPHS 1O31A 2OUAA 1C5OH 3F9GA 5K7RA 5DPAA 2RG3A 2XWAA 1AVGH 1HB0B 2BLQA 2BYAX 3RXPA 1FPCH 1FQ3A 1SGDE 5E0HA 4Y79A 4WXVA 4NA7A 3TPIZ 2FOFA 2Z7FE 3AASA 1TAWA 2ZU4A 5C1YA 3SNCA 1AO5A 2BY8X 1ARCA 3NCLA 3RLYH 1BMMH 4X0WU 4XOJA 1S6HA 1SGQE 3SV6A 2V0BA 5L30H 1IHTH 1P02A 5TCCA 4A92A 5C5NA 1GBIA 3QUMP 2BMGB 4DW2U 2O8WA 2ZDNA 4HGCA 3MO9A 5DO4H 3BEIB 3QTVH 2XC5A 1FDPA 3BG4B 3Q3XA 4BANB 3RXVA 2Y81A 1GCDA 1SGFA 4BXWA 1B0FA 2GTBA 1FIWA 3M5LA 1GI3A 4CR5A 1QTFA 2ZA5A 1B5GH 2EA3A 1GWAA 2PW8H 2FYQA 3AAUA 1IQIA 1PPFE 1O2HA 3JZ1B 1O5BB 2BX4A 1ZHRA 1H4WA 1F0SA 4MPUA 1ZPBA 2UWOA 2FP7B 3SJOA 1C1WH 2O8TA 4ISNA 1NM6A 3F68H 3M7TA 1HAVA 1PYTD 1DXWA 1K1OA 3DD2H 1HXEH 3ZZ7A 4AFUA 1F92A 3STJA 1Y5UT 2AFQB 2PGBB 3ESTA 1ZYOA 2FEQH 1XXFA 1DPOA 1G9IE 4FUCA 1S83A 2HWLB 2YNAA 4AGKA 1ESAA 1V2WT 3VB6A 3TJNA 1L4DA 2QYIA 1OP0A 5J4QA 2XWBI 1HJAB 2PFEA 2WUCA 2Y7XA 3W94A 1O30A 3ZYDA 1YCPH 3F9EA 1SHYA 4YO9A 5FPTA 3TNTA 1ZMNA 1MTVA 1GBMA 2BDIA 2Y5HA 1H9HE 5B6LA 4MNXA 4ZHMU 1HAHH 4I32A 2SGFE 4RI0A 1SMFE 3UQVA 1SGRE 1C4V2 3E1XB 1UK3A 2SFAA 3SU0A 1BTHH 5L6NH 1SGCA 4DT7B 1NRSH 2XRCA 1KSNA 2FYRA 2PKSC 2P95A 1TPAE 2EI8A 2Y7ZA 3B9FH 1P2KA 1KLJH 5F03A 1TMBH 1H8DH 2Y5GA 3ATKA 1C5NH 2W7SA 3ZV9A 1HIAB 1LVBA 5FX6A 3GDUA 2ZDMA 1H1BA 1KLIH 5K0HA 4MNVA 3SV9A 3V12A 3DT0H 1YYY1 4I31A 1SGFG 3TU7H 2LPRA 5EQQA 3JZ2B 2FZZA 4LXBH 3A88A 3QGNB 1W13U 3GCNA 4Q7ZA 4ZHLU 2FO9A 1TNGA 1QRZA 4ZAEA 1GBHA 1SHHB 1B7XB 4DIIH 1ELTA 3SU2A 2HALA 4OGXA 3MU1A 4MQAA 1A61H 1ZTKA 3A80A 1W0ZU 3BTHE 4WH6A 1ORFA 1QRWA 1P3EA 1SSXA 1AUJA 2CN0H 2Z9LA 3VB4A 3GCTF 3MH7A 5C5OA 4CH2B 4BXSA 1MUEB 1O2UA 4QT8C 1CGJE 2SGPE 1DS2E 5DP8A 2C93B 2VGCC 1UJ1A 3PO1B 3U8OH 1ZMLA 2QV1A 1X7AC 3RXQA 3E0NB 4K2YA 5A0BA 1K1IA 3RXSA 2GZ9A 4ZXXH 4GCHF 1CHGA 3K2UA 1DWBH 1P0SH 3SYJA 3VEQB 2PKSB 3GICB 3ZVAA 1YF4A 3RDZA 1AN1E 1K22H 1O5FH 4ABEA 3AW1A 1MZAA 2ZFFH 4AGJA 1BA8B 1EKBB 1ZOMA 1AB9B 4MTBA 5E0GA 3QGJA 1IHSH 3KQDA 1HFDA 1O3NA 4D8NA 1Y59T 5DP5A 1EQ9A 1XMNB 3D23A 3UREA 1PJPA 1CA8B 2P3TB 4XSKU 1BTWA 3LU9B 3URCA 1TNHA 3SV7A 2J94A 2FX4A 3A7YA 3PV4A 4YZUA 2NU3E 1MBQA 1UCYK 1ELAA 2FOBA 1ELVA 5TCAA 2ZQ1A 4KP0A 4ABAA 3SV2H 1CQQA 1MAXA 1O2YA 3EE0B 3FFGA 3SV8A 4AFQA 1N6YA 1MZDA 1B0EA 3SU1A 4B73A 3KEEA 1C2LA 3KGPA 2ZCLP 3A85A 1XVMA 4WF8A 4O3TA 4CHAC 1O2KA 1V2JT 3CENA 4ZKOU 5HGGA 3PV5A 2GMTC 2P3UB 5F8TA 5EXMA 2O8UA 4NIWA 4X6OA 1DWEH 1CHOF 2ZPSA 1GJDB 1FAXA 2PTNA 1C5LH 4GUXA 6ESTA 4TWYA 3A82A 2B7DH 1CA0B 4K1SA 3UUZA 2CGAA 3RXHA 1ESTA 4B6FA 2G4UA 1SLVB 1T8LA 1D9IA 3RXOA 5LPFA 1UTQA 1OS8A 2BD7A 1HRTH 3KQBA 5BPEA 1BIOA 4Y71A 3ZVCA 1ABIH 1EZUC 4NA8A 1A0JA 1C1SA 1S84A 2ZFRH 1O3DA 3F1SB 3MYWA 3LGYA 1GBCA 4X8SH 4E06H 2PKAA 1BTXA 3SNAA 2VWNA 1HAXB 1Y3VA 5PTPA 3M7UA 1YM0A 1TRNA 1W12U 3A83A 2R3UA 3AVZA 3IG6B 1GBEA 1FV9A 5LPEA 1J16A 5TJXA 1RD3B 2FTLE 3H09A 1ZGIA 1EZXC 2CXVA 1MBMA 1FUJA 2H2ZA 3Q3KA 1C2EA 1QA0A 2AGIX 2OC0A 1VGCB 3O8DA 1XUFA 3UY9A 3VB7A 2BVXH 5FAHA 1W11U 4XBDA 1EOJA 1C1VH 2P16A 3P8FA 1GBDA 3LC5A 2VU8E 2TRMA 4ISIH 2PHBA 1GDQA 4NCYA 1TNJA 1A5HA 4BAOB 1EX3A 8ESTE 1LQDB 1KIGH 4MNYA 3RXLA 1O3KA 1QRXA 3K6ZA 4I8JA 1K21H 1LPKB 1AWFH 4Y6DA 4H6SB 1OXGA 1SB1H 1GI8B 1GI6A 4CREA 1BT7A 1TIOA 2A7CA 1S0RA 2FI4E 1ZSJA 1AIXH 1V2OT 2J38A 3M36A 1EPTC 3PMJA 5HM9A 1QR3E 3SN8A 4WH8A 4DIHH 2FI5E 2ZFQH 3EAJA 4I8KA 1V2NT 4INKA 5GCHF 1WAYB 3SNDA 1OKXA 4R0IA 2STBE 1O5DH 1P3CA 1NO9H 2BQ6B 1P8VC 1T7CA 1WCZA 4AFSA 4DGJA 1O2TA 2WUBA 5A8YA 1ZLRA 1O2WA 1THPB 3QK1A 5EPNA 4YM9A 1QB9A 1BRBE 3QO6A 1QJ7B 2SGQE 4FVDA 2C8XB 3HK6B 1S81A 2HVXA 3BTFE 4VGCB 5FXLA 4B1TA 1QL9A 2DUCA 1HLTH 2C8YB 1BTUA 2Z9IA 2FODA 1O3OA 2QGRA 4I7YH 1CO7E 2KAIA 1HPGA 2C4FH 2W5EA 3ZV8A 3RM2H 5E2PA 3MMGA 3GY4A 1NZQH 1P03A 1CGIE 5E8EH 1AZ8A 1V2UT 2GZ8A 2P8OB 1T4UH 1EXFA 3GY2A 1P01A 5EPYA 3DHKH 4FVBA 3EYDA 3ZZ5A 2Z9KA 4H42U 1TX7A 2EEKA 4XBCA 2TGDA 1EZQA 1E34B 1KXBA 2EI6A 3L6PA 3ZZAA 3P17H 1AFQB 3ATMA 1A0LA 4RN6A 1TB6H 2OLGA 1WSSH 1AB9C 1RXPA 3SJKA 3PM3A 2AIQA 1BHXF 2F9OA 3TK5A 1TQ0B 1TBRH 4AOQA 1VJ9U 1AGJA 4UONA 1YKTA 2ZHDA 3TLOA 4Y10E 1L1JA 1O3IA 5GDSH 4WJG2 1GI0A 1XKAC 1GI4A 3VFEA 1BMLA 2XXLA 2UWPA 3IWMA 3QZQA 2RA0A 1O3JA 3A7TA 1PPGE 4K8YA 1UVSH 1BITA 2C3SA 2G5VA 3I29A 4Z6AH 2B5TB 2F83A 2W7UA 4CHAB 2RDLA 1C5VA 1UCYH 2VGCB 3GISB 4TWWA 2BLVA 3TIUA 4Q80A 1QQUA 3P8OA 4AN7A 1AE8H 1TNKA 1XUJA 1UTNA 3A86A 1O38A 1TBQH 4NWKA 1C5SA 2AMQA 1N8OB 1BTPA 3NK8A 2OD3B 2A45B 1HIAA 2ZHEH 3SNBA 3K65B 2TGPZ 1TE0A 1O3EA 3KHVA 5SGAE 3TGIE 2ODQA 2WPMS 1Z1IA 1RJXB 3RXTA 1JMOH 5C2ZA 2QXIA 2AEIH 3G01A 1FY1A 2Z3DA 1TWXB 3MH5A 4XBBA 1NROH 2BD5A 4YLUA 4OS1A 1EZSC 1H9LB 4LK4A 3EQ0H 3U8RH 4NZQA 1O5GH 2HPPH 4X1SU 2GCHG 3Q00A 4CBOA 4MDSA 3V13A 1YCPM 1ZPZA 4X1PU 2HNTF 5B6OA 3ATIA 1AWHB 2WV4A 1FLEE 3GYLB 1DLEA 1K9OE 1LPZB 2PWXA 1XM1A 1HCGA 1DWDH 4DOQA 2GV7A 3KQEA 4AB9A 1MD7A 2IPHA 1C1PA 1O2GH 3ZZBA 1VZQH 1Q31A 1UTMA 2GT7A 4JCNA 3MO6A 1ELCA 1OYTH 2GD4B 4ISHH 4O03A
chains in the Genus database with same CATH superfamily
3SNEA 2FX6A 3M35A 3AW0A 1VJAU 3TGJE 1P12E 3KQ5A 4AG1A 2FOAA 5EGMA 1BMNH 1E38B 1TPSA 2UUYA 4XDEA 3MU0A 1MQ6A 3O8CA 3BEUA 4BTTB 2BD3A 1LCYA 3A8AA 1QIXB 4FUBA 1LDTT 1ZZZA 6CHAB 3HKJB 1YC0A 3O8BA 2F91A 3MFJA 1IQGA 2BDYA 4NWLA 3T25A 1TGSZ 4X2VA 1KXEA 3D65E 1F0RA 4MPWA 4JYUH 1EAIA 3FP6E 2UUFB 5C94A 1ABJH 2SNVA 3V3MA 1NN6A 2A4RA 3RXGA 1LHFH 4BTUB 1JIMA 2OQ5A 2VH6A 1INCA 3TH2H 1RTFB 3SO3A 1PPZA 1DSUA 2BZ6H 3V0XA 1GI9B 1DVAH 2PV9B 1GVLA 1TOMH 1O3AA 2A4OA 2AIPA 2ZHWH 3RMLH 1OWIA 2ANKH 2SGEE 1O37A 2EC9H 3E91A 1O3FA 4THNH 5DP9A 1TA6A 1O3HA 1PPEE 1ETSH 1S6FA 4ABDA 2FDAA 3AK5A 2OCVB 1GVKB 3T26A 2HLDD 3OSYA 1QJ1B 1A4WH 1BBRE 2ZF0H 4XRNA 5CMXH 2J34A 1U6QA 1C4Y2 2F4LA 2ZO3H 1TONA 3TNSA 3U9AH 2ESTE 3KQCA 5F8ZA 1KYNA 4OS5A 1JXPA 1K1MA 3ELAH 1UVOA 1ZRBA 4OS6A 1GI5A 1G3BA 4KTUA 3U8TH 5DJ7A 1AE5A 1P9SA 2G8TA 1GJ9B 4AZ2B 3MTYA 4UDWH 1E1RD 2BY5X 2ZU2A 2JKHA 2OC8A 1QURH 2WV9A 1J8AA 1PYTC 2G52A 1F5RA 1H8IH 1XX9A 2QF3A 3PWCA 3OY6U 1G32B 4JK5A 1C2HA 1LVYA 3PYHA 1GJCB 5GWZA 1MU8B 3KNXA 4MG3A 4RSPA 2VWOA 4H4FA 3A8BA 1EAXA 1Z1JA 3CNRA 2WINI 2WPIS 2ODPA 3HPTB 1LPGB 2QC2A 1IQJA 4NSYA 1TNIA 4FXGH 1G37A 2HRVA 1G3CA 2FI3E 1PQAA 3RXJA 1HAYB 2AH4X 5CDFE 4NZLA 9ESTA 1AMHA 2ZU5A 5ETXA 3TK6A 1K0HA 4I8LA 3LC3A 4NFEA 3VB3A 4NGAH 3M3TA 1SGNE 5C17A 1ANCA 2Z9JA 4XE4A 1O2VA 2BM2A 2H1UA 3LIWA 4K5ZA 4XFQA 1QL8A 4HTCH 1L4ZA 2VVCA 3LPRA 5FCRA 1Z8RA 1KTTB 2ZTZA 4BAMB 1TMTH 1YPMH 1QQ4A 4E7RG 1W3CA 4E7NA 2FOGA 2HNTE 2A7JA 3F2GA 1FI8A 1D6WA 1HAZB 1MCTA 2IJOB 1Z8JB 2BY6X 3A7XA 3QWCH 1UO6A 3EGKH 4HG6A 1A3BH 4GHTA 1TLDA 4M7GA 5CHAB 3P95A 5GNDA 4TY6A 4ABJA 1HV7A 3PTNA 4UD9H 7GCHF 3LONA 2XOKD 1FY8E 1UMAH 4X8VH 3ODFA 3Q76A 3SI4H 3S7KB 3FZDA 5AHGH 4O97A 1E0FD 1THRH 3ZVDA 4I33A 3ZZDA 1S85A 5A09A 4X2WA 1C2DA 1H8HD 1W7XH 2VIWA 1YWUA 1SQAA 3DSPA 3A7WA 1DY8A 4U32A 1L2EA 4U2WA 2GDEH 1EJNA 1LHDH 5ESBA 3PTBA 1BRUP 1P10A 3PRBA 1J17T 3A87A 1NRNH 2J98A 3SOSA 1JBUH 3NKKA 2D26C 3LOXA 3RP2A 1ARBA 1WYKA 1FONA 2FLRH 2ANYA 4ABBA 2A2QH 1BOQA 1A7SA 4K3JA 1JIRA 1BJUA 1GL0E 2ZIQH 3UQOA 3EDXB 2CHAB 2W6ID 3FAOA 2J4IA 3RXKA 4DJZB 1G30B 2NU1E 2C90B 5I46H 2G51A 1O3PB 1HDTH 1SGYE 4JK6A 4A7IB 1F2SE 1A1RA 3ZZ3A 2R3YA 2BY9X 3SZNA 1L0ZA 2CK3D 3KN2A 1LHEH 2VH0A 3MH4A 5C1UA 1CE5A 3B8JA 3TH3H 5JDUB 1O2PA 2V3OH 3E0PB 1RS0A 2B9LA 4MVNA 3T28A 4M9FA 1CT2E 1OWKA 2F9NA 1E37B 2XYAA 1YGCH 2BD8A 5E2OA 1GG6C 1P11E 1CSOE 5LGOA 4RT1A 1HAVB 3UWJH 2YMSD 1ETTH 2Q6DA 1AY6H 1QL7A 5EJLA 2V6NA 2K8IA 1O39A 1SOTA 1WTHD 2O8LA 2ZTYA 3BTME 4YLQH 3SW2B 3VGCB 4MLFB 2ZPRA 2F9BH 4KTSA 1A2CH 2QE7D 2WPJS 2PUQH 3AAVA 4FUGA 1COWD 2KCPA 1OSSA 3VB5A 1DDJA 1GJAB 3EA8A 1D3TB 1GJ8B 1NFUA 3UB0A 1TNLA 3GY5A 2ZHFH 3ZZCA 1DX5M 1L1NA 1IQHA 2A4QA 3MNSA 1MTNB 3RM0H 5I25A 1C1OA 4DCDA 2G81E 1C2GA 3UPEA 1VITH 1QJ6B 2W3KA 2GCTB 2R2WU 1O34A 2BDHA 3LDXH 3RC5A 3LT3A 1C1NA 4YOGA 3KL6A 4B2AA 4K69A 5GXPA 2ZZUH 4WMEA 1UK4A 3RU4D 3SU3A 4Y76A 4Q2KA 3VGCC 4RKOB 1TGBA 5EOKA 5EQRA 2TGAA 6CHAC 1GHBF 1ZTLA 3UIRA 1WV7H 5EIYA 3LGTA 1S0QA 4IGDA 2FS9A 1MQ5A 1WTGH 1AD8H 2BB4A 3M5OA 4FUJA 1Q2WA 1ELEE 3R0FA 2ZQ2A 3E6PH 3M3VA 5HKKD 1PFXC 3SJIA 1LHCH 2HOBA 1TA2A 4Y7BA 2IJD1 2A5KA 4CRDA 4DG4A 3HGNA 1BTZA 2W26A 3BV9B 3WWBA 4KTCA 2ANMH 3RXEA 3URDA 1NBME 5GCHG 1D3PB 3F6UH 1DITH 4ABGA 1FNIA 1PQ5A 1HJ9A 3ZZ9A 2B0FA 2Z3EA 3BTWE 1BBRH 5JYIA 3RXBA 3GY8A 4IMQA 2QXGA 3PLKA 7LPRA 1ID5H 1TX6A 1ZSKA 1ACBE 3FZZA 3MH6A 1QFKH 1ZHMA 1WU1A 3E16B 1RTKA 5A0CA 1PQ8A 1GHWH 3U98H 4DURA 4AYYB 3NWUA 5C1XA 3LJJA 3KF2A 3PMHB 1DY9A 3BG8A 1HJ8A 2PLXA 3E3TA 1HAPH 3LGUA 1ZMJA 1QY6A 1MU6B 3KIDU 3U1JB 3HGPA 3HKIB 5T6DA 2A7HA 1GMDF 7KMEH 3A84A 4A1VA 1RGQA 4BAHB 1EAWA 1DE7H 1GMCF 4ZKSU 2JH0D 2GX4A 3M7QA 1HAOH 5LH8A 2F43B 1MD8A 1RFNA 1ELDE 1UW7A 3FP7E 2OBQA 3RXMA 1QGFA 3RXUA 1DANH 3WW7A 1C1TA 4JYTA 1EASA 2JH5D 3HATH 4YT6H 1TQ7B 2V35A 1O2NA 2H5DA 5T3HA 1V2QT 4IN2A 4K1EA 2WV5A 2QY0B 2RCEA 2NU4E 3ODDA 1VGCC 4D9QA 1EJAA 2UUJB 4OGYA 2V3HH 5EODA 3F3BA 2XCNA 1GHVH 2FXRA 1AVXA 1W14U 2VVUA 2GP9B 4A1TA 1O5EH 1O2JA 3S0NA 1BRAA 5IYTA 5CE1A 1HAIH 1V2PT 1LKBA 1SFQB 3GY7A 2NU2E 2M5TA 2BZAA 1SLUB 1C1UH 3VXFH 4X1NU 3O8RA 2WPDD 2ZI2H 1A0HB 3MQKC 1K1JA 1GJBB 3F0OA 1EJMA 5F6MA 1RIWB 2ZGCA 4B75A 3UNRA 4U30A 3Q77A 1OWJA 2ZHQH 3MU4A 2JIZD 4CRAA 4X8TH 2XTTB 7GCHG 4ESTE 2BDBA 4DY7B 4ZUHA 4YT7H 1DWCH 4Q7XA 1OOKB 4WVPE 1O2OA 1G36A 1S82A 3UR9A 2PSYA 1DUAA 1MKWK 3FANA 2QIQA 3MWIU 4CRCA 1G2LA 1IQMA 4IC5A 1QA7A 3SGQE 1C2FA 1C5TA 3M61U 2BDAA 2R0LA 1YBWA 4NFFA 1XUKA 2P59A 1CA0C 3A7VA 1D3QB 1NU9A 1SBWA 1P2NA 1TMUH 2OQUA 3ZVGA 4GPGA 1VR1H 1ZGVA 5ESTE 4Y11E 1TRMA 1C2JA 2ZTXA 3D49H 3EA9A 2GKVE 4K8BA 3VPKA 1BZXE 5C0TA 1N1LA 1Z7KA 5FBIA 1IQNA 1GMHF 1RTLA 5EXLA 2C8ZB 1V2ST 1O2IA 2OINA 3U69H 1JRTA 1KTSB 3SQEE 3ZZ4A 1ESBA 3PV2A 1RIWC 2XNIA 3PB1E 1CBWC 1GJ4H 2AGEX 3T29A 4B76A 4Y0ZE 2KCOA 1YLCA 2FIRH 1K28D 4Z0KA 5T6FA 2FOMB 1PQ7A 1Q3XA 2ZFSA 1OWHA 4A5TS 2ANWA 3FOAA 1CT0E 1GHZA 2ODYB 2GCHF 3DFJA 3NXPA 3TGKE 1N6XA 4CRFA 2FESH 2BVSH 1YPHC 3GCHB 3UFAA 2XBVA 1WUNH 3BTGE 5G4BA 1OYQA 2BOKA 1L1GA 1V6DA 2BLWA 2FLBH 1GJ5H 1NFWA 2BD2A 3PLBA 3NUMA 4RT0A 2FMJA 5HXFA 1QCPA 4FU8A 2OTVA 2XBXA 5EW1H 1HYLA 1V2RT 2ZGBH 4IW4E 4P00A 1AQ7A 1BUIA 4OS4A 1NU7B 2Q6FA 1K1NA 2A2XH 2L74A 4TPIZ 1O2ZA 1SG8B 1GI7B 1GGDC 3BIUH 3PWBA 1YY3A 4HI3A 1H9IE 2P93A 1NC6A 3LGIA 3BTQE 3LH1A 4O3UA 2A1DB 1LTOA 3GS9A 4INHA 4K1TA 2WYGA 2BVRH 5HIZA 1YP9A 1YPJH 4J1YA 2HNTC 1C1QA 1BRCE 4UE7H 2G00A 3P92A 5BRRE 4ZCNA 2J2UA 4ABFA 3MU5A 1FY3A 4WXIA 1FAKH 2KX4A 1XUGA 2ZU1A 5HIYA 5C3NA 2G55A 3MNXA 1C5ZB 4A6LA 1HUTH 1EB2A 3LJOA 1D6RA 1MKWH 2A5AA 1FIZA 3TJUA 1AKSB 4FUDA 5EXNA 3ENSB 5FBEA 2H6MA 2JETC 1GBLA 3UOUA 4IN1A 2KAIB 1KMHB 1ZRKA 2P94A 2AERH 2VJ1A 2QA9E 2KCAA 4WY3A 2Q1JA 2ULLA 2VIDA 4CR9A 2AGGX 1O3GA 2A5IA 2A4GA 1GDUA 2I6QA 3M5NA 1GMDG 2WPLS 5DN6D 2F9PA 1GJ6A 1TABE 1OP2A 4WWYA 1P2JA 5A2MH 3UR6A 2SGDE 2ZDVH 2GCTC 1C5MD 1LHGH 1NTPA 3K6YA 1F0TA 1ELGA 3PMBB 4NG9H 3TITA 1NRPH 3RUOA 1ZJDA 1UVUH 1O2RA 1LMWB 4X2YA 4KKDA 4ISOA 2GGVB 3SJ8A 9LPRA 1EOLA 1WBGB 2D1JA 1KLTA 1C5QA 2JH6D 1GBAA 2CF9H 5GPIB 1F5LA 4B71A 4D7FA 2ZG0H 3FO8D 2GT8A 1GHAF 2UWLA 1FPHH 1LKAA 4HZHA 3FVFB 1NPMA 1WOFA 1W2KH 1YCPK 1HGTH 3GCOA 4X2XA 5JB8S 3UWIA 1NFXA 2QXJA 1CT4E 4R8TB 4IMZA 5F8XA 2V3MA 5EQSA 3RXIA 5AFZH 1ANBA 1FY4A 2OBOA 3GCTG 1EB1H 3SUEA 4TPYA 4KGAA 2L6OA 1EFRD 3ZVFA 1AKSA 4Q7YA 3CP7A 1O0DH 1O2LA 1FJSA 1RRKA 3A8CA 3EA7A 1PPHE 1ANEA 3A7ZA 2LNCA 3RU4T 3NZIA 2EQNA 2WHXA 2ZPQA 3QX5H 3V7TA 3K9XB 1ZR0A 2O8MA 1THSH 3MNBA 1YPEH 4JMYA 1TX8A 1M9UA 5DP7A 2DE8A 5GIBA 1GCTB 3R3GB 1TRYA 5EW2H 5EG4A 1DT2A 1FX0B 2F3CE 1KXDA 1SLXB 1SFIA 1DSTA 1O32A 3LH3A 3ZYEA 1WQSA 1XUIA 5ABWA 3OY5U 5IDKA 4ISLA 6GCHG 4MPXA 2ZFTA 3DUXH 3SBKA 4CH8B 5F53A 3P6ZB 5DP4A 1GHYH 1QNJA 5JBAS 3ITIA 3TJOA 1O5AB 3D62A 1NT1A 3OU0A 1F5KU 4AFZA 1IQKA 3GDSA 4SGAE 1ZTJA 5LPRA 3L33A 2CJIA 5H4IB 1P05A 2PR3A 1K1PA 5C67A 1W7GH 1HJAC 1O3LA 2K0QA 1KXCA 5FHTA 4ZHAA 4B74A 1T32A 8GCHF 3GY3A 2FOHA 1MTWA 5FPYA 2JETB 3MHWU 4NIYA 1NRRH 1GG6B 1SQRA 2Z94A 3U28C 1IAUA 4TT3D 2GZ7A 1ELFA 1O3MA 3E90B 4GSOA 1JRSA 2BD9A 4OM9A 2FOEA 4JZEH 2P8OC 1YPHE 1G2MA 1GBBA 2QXHA 8KME2 3IITA 1S6LA 4MNWA 1AVWA 2BDGA 3TH4H 1S5SA 1BCUH 2CF8H 2AHME 4B2CA 1MKXK 1TYNA 2YOLA 4WMFA 2XC4A 3HK3B 1QB6A 1GHXH 3BN9A 4IS5A 2THFB 1KXAA 1Z71A 2VWLA 1Y3WA 2ASUB 4YESB 4VGCC 4NIXA 5C20A 1P06A 1UVTH 3STIA 1UVPA 4JZIA 3UNSA 4LZ4B 3PRDA 2WPKS 2H9TH 1YLDA 2IN2A 8LPRA 1GDNA 2ZKSA 3SGAE 2OC1A 3E8LA 3ZZ8A 4NA9H 5T1VA 1Z8IB 2RFKC 1O2XA 3F9HA 3UOPA 5JBTA 1BB0B 1JWTA 1MABB 4U01A 3KCGH 2AMDA 5FPSA 1D3DB 2H9HA 4B2BA 4Q4LA 1OP8A 4LOYH 5T6GA 3W95A 1AU8A 5L2YH 4NSVA 2WYJA 2KM0A 1P2MA 4FUIA 3UTUH 4IBLH 2PSXA 1W0YH 2XBYA 4X6MA 3RMMH 4LZ1H 5A0AE 1TPOA 4OS2A 1KXFA 2R0KA 1GI1A 3BSQA 2PUXB 2ZDAH 2GV6A 1G3EA 3P8NA 2PGQB 4Y8XA 1CBWB 6GCHF 3TJVA 3OTPA 1BBRK 2HPQH 2WSSD 2GVFA 5GJ4B 4TYDA 2CV3A 2SNWA 4Y8YA 1NESE 2ZCKP 1IQFA 3GOVB 3S9BA 1C5YB 1C4U2 1GBKA 3MOCA 2CMYA 4YOIA 1LQEA 2I6SA 2ZGJA 3QDZB 5FX5A 4YXWD 1QZ8A 2D2DA 1Y3XA 3M3SA 1YPKH 4INLA 4A1XA 4JZFH 1GBFA 2F9VA 2IOTA 1GHBG 2XCFA 3BTDE 4ABIA 1VITG 5DP6A 3GY6A 4X1RU 4ZH8A 1GMHG 5FCKA 1O36A 1PPBH 1E35B 2O9QA 4AX9H 2BXTH 1MKXH 1NBMD 2J92A 1UHBA 1EATA 2TPIZ 1BMAA 4AC9A 4B6EA 2VNTA 4I8GA 1P2QA 1V2TT 1V2LT 2ZC9H 1OX1A 1WQVH 1O3BA 1AHTH 1Y3YA 2DE9A 3M5MA 1OHHD 1UTKA 1C5WB 3C27B 4CBNA 3DCLA 3PMAB 1C5RA 1Y3UA 3P70B 3S9AA 1SQTA 1VKYA 3MO3A 3TVJB 1A5GH 1D4PB 2BDCA 1V2KT 3FP8E 2FWWA 1NS3A 2VIPA 3RMOH 3SORA 1XUHA 1T4VH 2ZEBA 1PPCE 2B8OH 2PTCE 1GMCG 2GMTB 1DXPA 1V2VT 3LGVA 4YOJA 3ATWA 4FUHA 3RXRA 2R9PA 5DP3A 2QCYA 3F2FA 1YPLH 2QAAA 2STAE 3N7OA 5EU8A 2HGTH 3T62A 2XBWA 1SI5H 1BTYA 4BAKB 3SZEA 2Z9GA 4FUFA 2RA3A 1GBJA 1UTJA 1FY5A 3SQHE 1IOEA 3ATLA 2VWMA 4BNRA 1OPHB 1SLWB 2BOHB 1P2IA 2A32A 2H5CA 5A8XA 2WZQA 4Y0YE 4ZKNU 3OTJE 4GAWA 3GDVA 3I77A 1IQLA 3UNQA 1TOCB 2ALPA 4YTAA 3ZZ6A 1WXRA 1QBNA 2AS9A 1SGEE 3S9CA 1HNEE 1C5UA 3PROA 1SGIB 5E0JA 2ZGXH 1C5XB 4BTIB 1QB1A 3SUGA 1Z6EA 2SGAA 1ZSLA 4SGBE 1FZZA 1VCPA 3QN7A 1P2OA 2HLCA 4HFPB 1Z8GA 1OWEA 2ZDKA 3RXCA 1ELBA 1TALA 4AORA 5L2ZH 3RXFA 3RXAA 1V2MT 1MCVA 1SC8U 5AF9H 1DLKB 2VIVA 2XC0A 4DT4A 4ABHA 3OE7D 3VXEH 1IQEA 3L3TA 3W1EA 1BJVA 1KDQA 1GHAG 2G5NA 1VCWA 3BEFB 8GCHG 4UFFH 2ZWLH 2VIOA 4F4OC 2ZU3A 3CS0A 3NPSA 4X1QU 4ZMAH 3SHCH 2ZDLA 1T8OA 3CS7A 1C5PA 1GI2A 3WY8A 1GPZA 2QF0A 1Y5AT 3UAIC 3PO1C 2FS8A 5JB9S 3DSOA 1P9UA 5DGJA 3BTTE 3Q3YA 1JOUB 1ZPCA 4AB8A 2XW9A 3MI4A 4ZXYH 1C9TA 1P57B 4E05H 3M37A 2NU0E 2BLOA 3ZIAD 3OX7U 1W8BH 1C1MA 3OYPA 3SHAH 1XVOA 2YNBA 3H7OA 4CRGA 1QBVH 1P09A 3T27A 4JZ1A 1T31A 3C1KA 2J9NA 1C2KA 1CU1A 1LVOA 3RMNH 1TGCA 4D9RA 1SPJA 4OS7A 2ZFPH 1E36B 5A8ZA 3DSGA 2VINA 1DUEA 1HBTH 1SR5C 3I78A 4ASHA 2K1QA 4UFDH 4Y8ZA 4K60A 3SI3H 1SOZA 1TGNA 1HXFH 3DA9B 4NIVA 1K2I1 2EY4C 1VCQA 4Q63A 1CVWH 1N8OC 2BD4A 4ACBA 1AUTC 1GCTC 2PKAB 2A31A 5J4SA 4JZDH 2TBSA 4H6TA 4PROA 3LKWA 1ETRH 2ZECA 2FTMA 3F9FA 2Y80A 1TBZH 1Y8TA 5DKMA 4Y7AA 1J9CH 1Z6JH 1LO6A 3ZVEA 1O33A 2BHGA 4ZKRU 1KDQB 1ZJKA 3BIVH 2W3IA 2UUKB 1F7ZA 2TIOA 4FU9A 1MAYA 3DFLA 1C2IA 1J15A 1O5CB 2KR7A 1DICA 3QZRA 4X6PA 1GJ7B 5DG6A 1F0UA 1UTPA 1YPGH 1MH0A 2ZCHP 1T8MA 4BAQB 1OWDA 4J2YB 1LVMA 1CGHA 3SJ9A 2BXUH 1MTUA 1BHXB 4AYVB 1MTNC 2FOCA 2CHAC 3BF6H 2H9EH 2AMPA 1KY9A 1UCYE 1NFYA 3SU5A 1O2SA 4UEHH 3BTEE 5JBBS 3T5FH 2BX3A 2C8WB 2IPQX 3S7HB 2ZNKH 2ALVA 1P04A 1AZZA 1TPPA 2FM2A 1A5IA 2A0QB 1QBOA 2BTCE 1SGTA 1MTSA 1VITF 5DK1A 2VBCA 4UFGH 1MMJN 2Y5FA 3GYMA 5KECA 2R2MB 4F49A 1GBTA 1BQYA 4X8UH 1DM4B 1O2QA 4GLYA 4O9VA 1ZHPA 4AG2A 3RLWH 3ZVBA 3H5CB 1GVZA 4D76A 1ANDA 3KYFA 3LGWA 3SGBE 1XKBC 3TK9A 2J95A 2BY7X 4GHQA 6LPRA 3BG4C 5JPMH 1O3CA 1DFPA 1CHOG 4JYVH 2GDDA 1AI8H 1UHBB 5CHAC 1C2MA 1QHRB 1A3EH 2PP6A 2BQ7B 4MPVA 4CRBA 4I8HA 2QN5T 4GVUA 3A81A 1NRQH 2AYWA 3MNCA 1A46H 3S69A 1V3XA 1EUFA 4X6NA 2OK5A 2Z6BD 5AFYH 4ZROA 4TY7A 1C9PA 1DOJA 2TGTA 4WMDA 3RXDA 1XXDA 3QLPH 1EAUA 2Z3CA 1GGDB 1SVPA 2VVVA 4GCHG 4RKJB 3RC6A 1FN8A 3P8GA 1AFQC 1C1RA 1H8ED 5HYOA 1NY22 2F9UA 2Q6GA 2JJ2D 3OEED 2VIQA 3MU8A 4IC6A 2Y6TA 3U1IB 4D7GA 1O35A 1W10U 1T8NA 2G4TA 1EP6A 2FPZA 2ZGHA 1EPTB 4DVAU 4F48B 2J97A 4BOHA 5EJ1A 2ZP0H 1FN6A 1O2MA 1FXYA 3F2HA 2ILNA 5JBCS 3RC4A 1G3DA 3SU4A 2EI7A 1SQOA 1Y5BT 1SKYE 2OC7A 2NWNA 4KELA 1UK2A 2BQWB 3GCHC 5HMAA 4FU7A 3T2NA 3A89A 3B23B 5HM2A 3SU6A 4UFEH 2D8WA 1J14A 4FUEA 1EPTA 1SL3A 2RDEA 1HAGE 2VB0A 1UTOA 3H7TA 2Y82A 1GL1A 2OP9A 1BDAA 1UTLM 3PLPA 3SUFA 1TGTA 1FMGA 5AVDA 3RU4E 1TFXA 1AFEH 3A8DA 2J98B 2OXSA 2P3FH 7ESTE 3BTKE 1EP5A 1K1LA 3SUDA 1SGPE 3QTOH 2WPHS 1O31A 2OUAA 1C5OH 3F9GA 5K7RA 5DPAA 2RG3A 2XWAA 1AVGH 1HB0B 3N99A 2BLQA 2BYAX 3RXPA 1FPCH 1FQ3A 4FOUC 1SGDE 5E0HA 4Y79A 4WXVA 4NA7A 3TPIZ 2FOFA 2Z7FE 3AASA 2M2AA 1TAWA 2ZU4A 5C1YA 3SNCA 1AO5A 2BY8X 1ARCA 3NCLA 3RLYH 1BMMH 4X0WU 4XOJA 1S6HA 1SGQE 3SV6A 2V0BA 5L30H 1IHTH 1P02A 5TCCA 4A92A 5C5NA 1GBIA 3QUMP 2BMGB 4DW2U 2YMSB 2O8WA 2ZDNA 4HGCA 3MO9A 5DO4H 3BEIB 3QTVH 2XC5A 1FDPA 3BG4B 2JDID 3Q3XA 4BANB 3RXVA 2Y81A 1GCDA 1SGFA 4BXWA 1B0FA 4P02A 2GTBA 1FIWA 3M5LA 1GI3A 4CR5A 1QTFA 2ZA5A 1B5GH 2EA3A 1GWAA 2PW8H 2FYQA 3AAUA 1IQIA 1PPFE 1O2HA 3JZ1B 1O5BB 2BX4A 1ZHRA 1H4WA 1F0SA 4MPUA 1ZPBA 3OEHD 2UWOA 2FP7B 3SJOA 1C1WH 2O8TA 4ISNA 1NM6A 3F68H 3M7TA 1HAVA 1PYTD 1DXWA 1K1OA 3DD2H 1HXEH 3ZZ7A 4AFUA 1F92A 3STJA 1Y5UT 2AFQB 2PGBB 3ESTA 1ZYOA 2FEQH 1XXFA 1DPOA 1G9IE 4FUCA 1S83A 2HWLB 2YNAA 4AGKA 1ESAA 1V2WT 3VB6A 3TJNA 1L4DA 2QYIA 1OP0A 5J4QA 2XWBI 1HJAB 2PFEA 2WUCA 2Y7XA 3W94A 2KFWA 1O30A 3ZYDA 1YCPH 3F9EA 1SHYA 4YO9A 5FPTA 3TNTA 1ZMNA 2QF4A 1MTVA 2LP6A 1GBMA 2BDIA 1H9HE 2Y5HA 5B6LA 4MNXA 4ZHMU 1HAHH 4I32A 2SGFE 4RI0A 1SMFE 3UQVA 3WWFA 3OAAD 1SGRE 1C4V2 3E1XB 1UK3A 2SFAA 3SU0A 5CHBA 1BTHH 2W6JD 5L6NH 1SGCA 4DT7B 1NRSH 2XRCA 1KSNA 2FYRA 2PKSC 2P95A 1TPAE 2EI8A 2Y7ZA 3B9FH 1P2KA 1KLJH 2XNDD 5F03A 1TMBH 1H8DH 2Y5GA 3ATKA 1C5NH 2W7SA 3ZV9A 1HIAB 1LVBA 5FX6A 3GDUA 2ZDMA 1H1BA 2QF5A 1KLIH 5K0HA 4MNVA 3SV9A 3V12A 3DT0H 1YYY1 4I31A 1SGFG 3TU7H 2LPRA 5DSFA 5EQQA 3JZ2B 2FZZA 4LXBH 3A88A 3QGNB 1W13U 3GCNA 4Q7ZA 4ZHLU 2FO9A 1TNGA 5KGOA 3N7EA 1QRZA 4ZAEA 1GBHA 1SHHB 1B7XB 4DIIH 1ELTA 3SU2A 2HALA 5C0UA 4OGXA 3MU1A 4MQAA 1A61H 1ZTKA 3A80A 1W0ZU 3BTHE 4WH6A 1ORFA 1QRWA 1P3EA 1SSXA 1AUJA 2CN0H 2Z9LA 3VB4A 3GCTF 3MH7A 5C5OA 4CH2B 4BXSA 1MUEB 1O2UA 4QT8C 1CGJE 2KZ4A 1DS2E 2SGPE 2C93B 5DP8A 2VGCC 1UJ1A 4I86A 3PO1B 3KYGA 3U8OH 1ZMLA 2QV1A 1X7AC 3RXQA 3E0NB 4K2YA 5A0BA 1K1IA 3RXSA 2GZ9A 4ZXXH 4GCHF 1CHGA 3K2UA 1DWBH 1P0SH 2GJGA 3SYJA 3VEQB 2PKSB 3FKSD 3GICB 3ZVAA 1YF4A 3RDZA 1AN1E 1K22H 1O5FH 4ABEA 1BMFD 3AW1A 1MZAA 2ZFFH 3NRLA 4AGJA 1BA8B 1EKBB 3VG8A 1ZOMA 1AB9B 4MTBA 5E0GA 3QGJA 1IHSH 3KQDA 1HFDA 1O3NA 4D8NA 1Y59T 5DP5A 1EQ9A 1XMNB 3D23A 3UREA 1PJPA 1CA8B 2P3TB 4XSKU 1BTWA 3LU9B 1E1QD 3URCA 1TNHA 3SV7A 2J94A 2FX4A 3A7YA 3PV4A 4YZUA 2NU3E 1MBQA 1UCYK 1ELAA 2FOBA 1ELVA 5TCAA 2ZQ1A 4KP0A 5IK2D 4ABAA 3SV2H 1CQQA 1MAXA 1O2YA 3EE0B 3FFGA 4FETA 3SV8A 4AFQA 1N6YA 1MZDA 1B0EA 3SU1A 4B73A 3KEEA 1C2LA 3KGPA 2ZCLP 3A85A 1XVMA 4WF8A 4O3TA 4CHAC 1O2KA 1V2JT 3CENA 4ZKOU 5HGGA 3PV5A 2GMTC 2P3UB 5F8TA 4F55A 5EXMA 2O8UA 4NIWA 4X6OA 1DWEH 1CHOF 2J5UA 2JJ1D 1GJDB 1FAXA 2ZPSA 2PTNA 1C5LH 4GUXA 6ESTA 4TWYA 3A82A 2B7DH 1CA0B 4K1SA 3UUZA 2CGAA 3RXHA 1ESTA 4B6FA 2G4UA 1SLVB 1T8LA 1D9IA 3RXOA 5LPFA 3N7DA 1UTQA 1OS8A 2BD7A 1HRTH 3KQBA 5BPEA 1BIOA 4Y71A 3ZVCA 1ABIH 1EZUC 4NA8A 1A0JA 1YLNA 1C1SA 1S84A 2ZFRH 1O3DA 3F1SB 3MYWA 3LGYA 1GBCA 4X8SH 4E06H 2PKAA 1BTXA 3SNAA 2VWNA 1HAXB 1Y3VA 5PTPA 3M7UA 1YM0A 1TRNA 1W12U 3A83A 2R3UA 3AVZA 3IG6B 1GBEA 1FV9A 5LPEA 1J16A 5TJXA 1RD3B 2FTLE 3H09A 1ZGIA 1EZXC 2CXVA 1MBMA 1FUJA 2H2ZA 2YMSC 3Q3KA 1W0KD 1C2EA 1WDIA 1QA0A 2AGIX 2OC0A 1VGCB 3O8DA 1XUFA 4TSFD 3UY9A 3VB7A 2BVXH 5FAHA 1W11U 4XBDA 1EOJA 1C1VH 2P16A 3P8FA 1GBDA 3LC5A 2VU8E 2TRMA 4ISIH 2PHBA 1GDQA 4NCYA 1TNJA 1A5HA 4BAOB 1EX3A 8ESTE 1LQDB 1KIGH 4MNYA 3RXLA 1O3KA 1QRXA 3K6ZA 4I8JA 1K21H 1LPKB 1AWFH 4Y6DA 4H6SB 1OXGA 1SB1H 1GI8B 1GI6A 4CREA 1BT7A 1TIOA 2A7CA 1S0RA 2FI4E 1ZSJA 1AIXH 1V2OT 2J38A 3M36A 1EPTC 3PMJA 5HM9A 1QR3E 3SN8A 4WH8A 4DIHH 2FI5E 2ZFQH 3EAJA 4I8KA 1V2NT 4INKA 5GCHF 1WAYB 2LELA 5FL7D 3SNDA 1OKXA 4R0IA 2STBE 1O5DH 1P3CA 1NO9H 2BQ6B 1P8VC 1T7CA 1WCZA 2KCYA 4AFSA 4DGJA 1O2TA 2WUBA 5A8YA 1ZLRA 1O2WA 1THPB 3QK1A 5EPNA 4YM9A 1QB9A 1BRBE 3QO6A 1QJ7B 2SGQE 4FVDA 2C8XB 3HK6B 4ACAA 1S81A 2HVXA 3BTFE 4ASUD 4VGCB 5EJZA 5FXLA 4B1TA 1QL9A 2DUCA 1HLTH 2C8YB 1BTUA 2Z9IA 2FODA 1O3OA 2QGRA 4I7YH 1CO7E 2KAIA 1HPGA 2C4FH 2W5EA 3ZV8A 3RM2H 5E2PA 3MMGA 3GY4A 1E79D 1NZQH 1P03A 1CGIE 5E8EH 1AZ8A 1V2UT 2HVYB 2GZ8A 2P8OB 1T4UH 1EXFA 3GY2A 1P01A 5EPYA 3DHKH 4FVBA 3EYDA 3ZZ5A 2Z9KA 4H42U 1TX7A 2EEKA 4XBCA 5KEDA 2TGDA 1EZQA 1E34B 1KXBA 2EI6A 3L6PA 3ZZAA 3P17H 1AFQB 3ATMA 1A0LA 4RN6A 1TB6H 2OLGA 1WSSH 1AB9C 1RXPA 3SJKA 3PM3A 2AIQA 1BHXF 2F9OA 3TK5A 1TQ0B 1TBRH 4AOQA 1VJ9U 1AGJA 3OFND 4UONA 1YKTA 2ZHDA 3TLOA 4Y10E 1L1JA 1O3IA 5GDSH 4WJG2 1GI0A 1XKAC 1GI4A 3VFEA 1BMLA 2XXLA 2UWPA 3IWMA 3QZQA 2RA0A 1O3JA 3A7TA 1PPGE 4K8YA 1UVSH 1BITA 3EE7A 2C3SA 2G5VA 3I29A 4Z6AH 2B5TB 2F83A 2W7UA 3FN8A 4CHAB 2RDLA 1C5VA 1UCYH 2VGCB 4Z1MD 3GISB 4TWWA 2BLVA 3TIUA 4Q80A 1QQUA 3P8OA 4AN7A 1AE8H 1TNKA 1XUJA 1UTNA 3A86A 4XD7D 1O38A 1TBQH 4NWKA 1C5SA 2AMQA 1N8OB 2V7QD 1BTPA 3NK8A 2OD3B 2A45B 1HIAA 2ZHEH 3SNBA 3K65B 2TGPZ 1TE0A 1O3EA 3KHVA 5SGAE 3TGIE 2ODQA 2WPMS 1Z1IA 1RJXB 3RXTA 1JMOH 5C2ZA 2QXIA 2AEIH 3G01A 1FY1A 2Z3DA 1TWXB 3MH5A 4XBBA 1NROH 2BD5A 4YLUA 4OS1A 1EZSC 1H9LB 4LK4A 3EQ0H 3U8RH 3F0PA 4NZQA 1O5GH 2HPPH 4X1SU 2GCHG 3Q00A 4CBOA 4MDSA 3V13A 1YCPM 1ZPZA 4X1PU 2HNTF 5B6OA 3ATIA 1AWHB 2WV4A 1FLEE 3GYLB 1DLEA 1K9OE 1LPZB 2PWXA 1XM1A 1HCGA 1DWDH 4DOQA 2GV7A 3KQEA 4AB9A 1MD7A 2IPHA 1C1PA 1O2GH 3ZZBA 1VZQH 1Q31A 1UTMA 2GT7A 4JCNA 3MO6A 1ELCA 1OYTH 1W0JD 2GD4B 4ISHH 4O03A
chains in the Genus database with same CATH topology
3SNEA 2FX6A 3M35A 3AW0A 1VJAU 3TGJE 1P12E 4AG1A 2FOAA 5EGMA 1BMNH 1E38B 1TPSA 2UUYA 4XDEA 3MU0A 1MQ6A 3O8CA 3BEUA 4BTTB 2BD3A 1LCYA 3A8AA 1QIXB 4FUBA 1LDTT 1ZZZA 6CHAB 3HKJB 1YC0A 3O8BA 2F91A 3MFJA 1IQGA 2BDYA 4NWLA 3T25A 1TGSZ 4X2VA 1KXEA 3D65E 1F0RA 4MPWA 4JYUH 1EAIA 3FP6E 2UUFB 1ABJH 2SNVA 3V3MA 1NN6A 2A4RA 3RXGA 1LHFH 4BTUB 1JIMA 2OQ5A 2VH6A 1INCA 3TH2H 1RTFB 3SO3A 1PPZA 1DSUA 2BZ6H 3V0XA 1GI9B 1DVAH 2PV9B 1GVLA 1TOMH 1O3AA 2A4OA 2AIPA 2ZHWH 3RMLH 1OWIA 2ANKH 2SGEE 1O37A 2EC9H 3E91A 1O3FA 4THNH 5DP9A 1TA6A 1O3HA 1PPEE 1ETSH 1S6FA 4ABDA 2FDAA 3AK5A 2OCVB 1GVKB 3T26A 3OSYA 2HLDD 1QJ1B 1A4WH 1BBRE 2ZF0H 5CMXH 2J34A 1U6QA 1C4Y2 2F4LA 2ZO3H 1TONA 3TNSA 3U9AH 2ESTE 3KQCA 5F8ZA 1KYNA 4OS5A 1JXPA 1K1MA 3ELAH 1UVOA 1ZRBA 4OS6A 1GI5A 1G3BA 4KTUA 3U8TH 5DJ7A 1AE5A 1P9SA 2G8TA 1GJ9B 4AZ2B 3MTYA 4UDWH 1E1RD 2BY5X 2ZU2A 2JKHA 2OC8A 1QURH 2WV9A 1J8AA 1PYTC 2G52A 1F5RA 1H8IH 1XX9A 2QF3A 3PWCA 3OY6U 1G32B 4JK5A 1C2HA 1LVYA 3PYHA 1GJCB 5GWZA 1MU8B 3KNXA 4MG3A 4RSPA 2VWOA 4H4FA 3A8BA 1EAXA 1Z1JA 2WINI 2WPIS 2ODPA 3HPTB 1LPGB 2QC2A 1IQJA 4NSYA 1TNIA 4FXGH 1G37A 2HRVA 1G3CA 2FI3E 1PQAA 3RXJA 1HAYB 2AH4X 5CDFE 4NZLA 9ESTA 1AMHA 2ZU5A 5ETXA 3TK6A 4I8LA 3LC3A 4NFEA 3VB3A 4NGAH 3M3TA 1SGNE 5C17A 1ANCA 2Z9JA 4XE4A 1O2VA 2BM2A 2H1UA 3LIWA 4K5ZA 4XFQA 1QL8A 4HTCH 1L4ZA 2VVCA 3LPRA 5FCRA 1Z8RA 1KTTB 2ZTZA 4BAMB 1TMTH 1YPMH 1QQ4A 4E7RG 1W3CA 4E7NA 2FOGA 2HNTE 2A7JA 3F2GA 1FI8A 1D6WA 1HAZB 1MCTA 2IJOB 1Z8JB 2BY6X 3A7XA 3QWCH 1UO6A 3EGKH 1A3BH 4GHTA 1TLDA 4M7GA 5CHAB 3P95A 5GNDA 4TY6A 4ABJA 1HV7A 3PTNA 4UD9H 7GCHF 3LONA 2XOKD 1FY8E 1UMAH 4X8VH 3ODFA 3Q76A 3SI4H 3S7KB 3FZDA 5AHGH 4O97A 1E0FD 1THRH 3ZVDA 4I33A 3ZZDA 1S85A 5A09A 4X2WA 1C2DA 2VIWA 1W7XH 1H8HD 1SQAA 3DSPA 3A7WA 1DY8A 4U32A 1L2EA 4U2WA 2GDEH 1EJNA 1LHDH 5ESBA 3PTBA 1BRUP 1P10A 3PRBA 1J17T 3A87A 1NRNH 3SOSA 1JBUH 3NKKA 2D26C 3LOXA 3RP2A 1ARBA 1WYKA 1FONA 2FLRH 2ANYA 4ABBA 2A2QH 1BOQA 1A7SA 4K3JA 1JIRA 1BJUA 1GL0E 2ZIQH 3UQOA 3EDXB 2CHAB 2W6ID 3FAOA 2J4IA 3RXKA 4DJZB 1G30B 2NU1E 2C90B 5I46H 2G51A 1O3PB 1HDTH 1SGYE 4JK6A 4A7IB 1F2SE 1A1RA 3ZZ3A 2R3YA 2BY9X 3SZNA 1L0ZA 2CK3D 3KN2A 1LHEH 2VH0A 3MH4A 5C1UA 1CE5A 3B8JA 3TH3H 5JDUB 1O2PA 2V3OH 3E0PB 1RS0A 2B9LA 4MVNA 3T28A 4M9FA 1CT2E 1OWKA 2F9NA 1E37B 2XYAA 1YGCH 2BD8A 5E2OA 1GG6C 1P11E 1CSOE 5LGOA 1HAVB 3UWJH 2YMSD 1ETTH 2Q6DA 1AY6H 1QL7A 2V6NA 2K8IA 1O39A 1SOTA 1WTHD 2O8LA 2ZTYA 3BTME 4YLQH 3SW2B 3VGCB 4MLFB 2ZPRA 2F9BH 4KTSA 1A2CH 2QE7D 2WPJS 2PUQH 3AAVA 4FUGA 3VB5A 1COWD 1OSSA 2KCPA 1DDJA 1GJAB 3EA8A 1D3TB 1GJ8B 1NFUA 3UB0A 1TNLA 3GY5A 2ZHFH 3ZZCA 1DX5M 1L1NA 1IQHA 2A4QA 3MNSA 1MTNB 3RM0H 5I25A 1C1OA 4DCDA 2G81E 1C2GA 3UPEA 1VITH 2W3KA 1QJ6B 2GCTB 2R2WU 1O34A 2BDHA 3LDXH 3RC5A 3LT3A 1C1NA 4YOGA 3KL6A 4B2AA 4K69A 5GXPA 2ZZUH 4WMEA 1UK4A 3RU4D 3SU3A 4Y76A 4Q2KA 3VGCC 4RKOB 1TGBA 5EOKA 5EQRA 2TGAA 6CHAC 1GHBF 1ZTLA 3UIRA 1WV7H 3LGTA 1S0QA 4IGDA 2FS9A 1MQ5A 1WTGH 1AD8H 2BB4A 3M5OA 4FUJA 1Q2WA 1ELEE 3R0FA 2ZQ2A 3E6PH 3M3VA 5HKKD 1PFXC 3SJIA 1LHCH 2HOBA 1TA2A 4Y7BA 2IJD1 2A5KA 4CRDA 4DG4A 3HGNA 1BTZA 2W26A 3BV9B 3WWBA 4KTCA 2ANMH 3RXEA 3URDA 1NBME 5GCHG 1D3PB 3F6UH 1DITH 4ABGA 1FNIA 1PQ5A 1HJ9A 3ZZ9A 2B0FA 2Z3EA 3BTWE 1BBRH 5JYIA 3RXBA 3GY8A 4IMQA 2QXGA 3PLKA 7LPRA 1ID5H 1TX6A 1ZSKA 1ACBE 3FZZA 3MH6A 1QFKH 1ZHMA 1WU1A 3E16B 1RTKA 5A0CA 1PQ8A 1GHWH 3U98H 4DURA 4AYYB 3NWUA 5C1XA 3LJJA 3KF2A 3PMHB 1DY9A 3BG8A 1HJ8A 2PLXA 3E3TA 1HAPH 3LGUA 1ZMJA 1QY6A 1MU6B 3KIDU 3U1JB 3HGPA 3HKIB 5T6DA 2A7HA 1GMDF 7KMEH 3A84A 4A1VA 1RGQA 4BAHB 1EAWA 1DE7H 1GMCF 4ZKSU 2JH0D 2GX4A 3M7QA 1HAOH 5LH8A 2F43B 1MD8A 1RFNA 1ELDE 3FP7E 2OBQA 3RXMA 1QGFA 3RXUA 1DANH 3WW7A 1C1TA 4JYTA 1EASA 2JH5D 3HATH 4YT6H 1TQ7B 2V35A 1O2NA 2H5DA 5T3HA 1V2QT 4IN2A 4K1EA 2WV5A 2QY0B 2RCEA 2NU4E 3ODDA 1VGCC 4D9QA 1EJAA 2UUJB 4OGYA 2V3HH 5EODA 3F3BA 2XCNA 1GHVH 2FXRA 1AVXA 1W14U 2VVUA 2GP9B 4A1TA 1O5EH 1O2JA 3S0NA 1BRAA 5IYTA 5CE1A 1HAIH 1V2PT 1LKBA 1SFQB 3GY7A 2NU2E 2M5TA 2BZAA 1SLUB 1C1UH 3VXFH 4X1NU 3O8RA 2WPDD 2ZI2H 1A0HB 1K1JA 1GJBB 3F0OA 1EJMA 5F6MA 1RIWB 2ZGCA 4B75A 3UNRA 4U30A 3Q77A 1OWJA 2ZHQH 3MU4A 4CRAA 2JIZD 4X8TH 2XTTB 7GCHG 4ESTE 2BDBA 4DY7B 4ZUHA 4YT7H 1DWCH 4Q7XA 1OOKB 4WVPE 1O2OA 1G36A 1S82A 3UR9A 2PSYA 1DUAA 1MKWK 3FANA 2QIQA 3MWIU 4CRCA 1G2LA 1IQMA 4IC5A 1QA7A 3SGQE 1C2FA 1C5TA 3M61U 2BDAA 2R0LA 1YBWA 4NFFA 1XUKA 2P59A 1CA0C 3A7VA 1D3QB 1NU9A 1SBWA 1P2NA 1TMUH 2OQUA 3ZVGA 4GPGA 1VR1H 1ZGVA 5ESTE 4Y11E 1TRMA 1C2JA 2ZTXA 3D49H 3EA9A 2GKVE 4K8BA 3VPKA 1BZXE 5C0TA 1N1LA 1Z7KA 5FBIA 1IQNA 1GMHF 1RTLA 5EXLA 2C8ZB 1V2ST 1O2IA 2OINA 3U69H 1JRTA 1KTSB 3SQEE 3ZZ4A 1ESBA 3PV2A 1RIWC 2XNIA 3PB1E 1CBWC 1GJ4H 2AGEX 3T29A 4B76A 4Y0ZE 2KCOA 1YLCA 2FIRH 1K28D 4Z0KA 5T6FA 2FOMB 1PQ7A 1Q3XA 2ZFSA 1OWHA 4A5TS 2ANWA 3FOAA 1CT0E 1GHZA 2ODYB 2GCHF 3DFJA 3NXPA 3TGKE 1N6XA 4CRFA 2FESH 2BVSH 1YPHC 3GCHB 3UFAA 2XBVA 1WUNH 3BTGE 5G4BA 1OYQA 2BOKA 1L1GA 1V6DA 2BLWA 2FLBH 1GJ5H 1NFWA 2BD2A 3PLBA 3NUMA 2FMJA 5HXFA 1QCPA 4FU8A 2OTVA 2XBXA 5EW1H 1HYLA 1V2RT 2ZGBH 4IW4E 1AQ7A 1BUIA 4OS4A 1NU7B 2Q6FA 1K1NA 2A2XH 4TPIZ 1O2ZA 1SG8B 1GI7B 1GGDC 3BIUH 3PWBA 4HI3A 1H9IE 2P93A 1NC6A 3LGIA 3BTQE 3LH1A 4O3UA 2A1DB 1LTOA 4INHA 3GS9A 4K1TA 2WYGA 2BVRH 1YP9A 1YPJH 4J1YA 2HNTC 1C1QA 1BRCE 4UE7H 2G00A 3P92A 5BRRE 4ZCNA 2J2UA 4ABFA 3MU5A 1FY3A 4WXIA 1FAKH 1XUGA 2ZU1A 5C3NA 2G55A 3MNXA 1C5ZB 4A6LA 1HUTH 1EB2A 3LJOA 1D6RA 1MKWH 2A5AA 1FIZA 3TJUA 1AKSB 4FUDA 5EXNA 3ENSB 5FBEA 2H6MA 2JETC 1GBLA 3UOUA 4IN1A 2KAIB 1ZRKA 2P94A 1KMHB 2AERH 2VJ1A 2QA9E 2KCAA 4WY3A 2Q1JA 2ULLA 2VIDA 4CR9A 2AGGX 1O3GA 2A5IA 2A4GA 1GDUA 2I6QA 3M5NA 1GMDG 2WPLS 5DN6D 2F9PA 1GJ6A 1TABE 1OP2A 4WWYA 1P2JA 5A2MH 3UR6A 2SGDE 2ZDVH 2GCTC 1C5MD 1LHGH 1NTPA 3K6YA 1F0TA 1ELGA 3PMBB 4NG9H 3TITA 1NRPH 3RUOA 1ZJDA 1UVUH 1O2RA 1LMWB 4X2YA 4KKDA 4ISOA 2GGVB 3SJ8A 9LPRA 1EOLA 1WBGB 2D1JA 1KLTA 1C5QA 2JH6D 1GBAA 2CF9H 5GPIB 1F5LA 4B71A 4D7FA 2ZG0H 3FO8D 2GT8A 1GHAF 2UWLA 1FPHH 1LKAA 4HZHA 3FVFB 1NPMA 1WOFA 1W2KH 1YCPK 1HGTH 3GCOA 4X2XA 5JB8S 3UWIA 1NFXA 2QXJA 1CT4E 4R8TB 4IMZA 5F8XA 3RXIA 5EQSA 5AFZH 1ANBA 1FY4A 2OBOA 3GCTG 1EB1H 3SUEA 4TPYA 4KGAA 2L6OA 1EFRD 3ZVFA 1AKSA 4Q7YA 3CP7A 1O0DH 1O2LA 1FJSA 1RRKA 3A8CA 3EA7A 1PPHE 1ANEA 3A7ZA 2LNCA 3RU4T 3NZIA 3QX5H 2WHXA 2ZPQA 3V7TA 3K9XB 1ZR0A 2O8MA 1THSH 3MNBA 1YPEH 4JMYA 1TX8A 1M9UA 5DP7A 2DE8A 5GIBA 1GCTB 3R3GB 1TRYA 5EW2H 5EG4A 1DT2A 1FX0B 2F3CE 1KXDA 1SLXB 1SFIA 1DSTA 1O32A 3LH3A 3ZYEA 1WQSA 1XUIA 5ABWA 3OY5U 5IDKA 4ISLA 6GCHG 4MPXA 2ZFTA 3DUXH 3SBKA 4CH8B 5F53A 3P6ZB 5DP4A 1GHYH 1QNJA 5JBAS 3ITIA 3TJOA 1O5AB 3D62A 1NT1A 3OU0A 1F5KU 4AFZA 1IQKA 3GDSA 4SGAE 1ZTJA 5LPRA 3L33A 2CJIA 5H4IB 1P05A 2PR3A 1K1PA 5C67A 1W7GH 1HJAC 1O3LA 4ZHAA 1KXCA 5FHTA 4B74A 2K0QA 1T32A 8GCHF 3GY3A 2FOHA 1MTWA 5FPYA 2JETB 3MHWU 4NIYA 1NRRH 1GG6B 2Z94A 1IAUA 4TT3D 2GZ7A 1ELFA 1O3MA 3E90B 4GSOA 1JRSA 2BD9A 4OM9A 2FOEA 4JZEH 2P8OC 1YPHE 1G2MA 1GBBA 2QXHA 8KME2 3IITA 1S6LA 4MNWA 1AVWA 2BDGA 3TH4H 1S5SA 1BCUH 2CF8H 2AHME 4B2CA 1MKXK 1TYNA 2YOLA 4WMFA 2XC4A 3HK3B 1QB6A 1GHXH 3BN9A 4IS5A 2THFB 1KXAA 1Z71A 2VWLA 1Y3WA 2ASUB 4YESB 4VGCC 4NIXA 5C20A 1P06A 1UVTH 3STIA 1UVPA 4JZIA 3UNSA 4LZ4B 3PRDA 2WPKS 2H9TH 1YLDA 2IN2A 8LPRA 1GDNA 2ZKSA 3SGAE 2OC1A 3E8LA 3ZZ8A 4NA9H 5T1VA 1Z8IB 1O2XA 3F9HA 3UOPA 5JBTA 1BB0B 1JWTA 4U01A 1MABB 3KCGH 2AMDA 5FPSA 1D3DB 2H9HA 4B2BA 4Q4LA 1OP8A 4LOYH 5T6GA 3W95A 1AU8A 5L2YH 4NSVA 2WYJA 2KM0A 1P2MA 4FUIA 3UTUH 4IBLH 2PSXA 1W0YH 2XBYA 4X6MA 3RMMH 4LZ1H 5A0AE 1TPOA 4OS2A 1KXFA 2R0KA 1GI1A 3BSQA 2PUXB 2ZDAH 2GV6A 1G3EA 3P8NA 2PGQB 4Y8XA 1CBWB 6GCHF 3TJVA 3OTPA 1BBRK 2HPQH 2WSSD 2GVFA 5GJ4B 4TYDA 2CV3A 2SNWA 4Y8YA 1NESE 2ZCKP 1IQFA 3GOVB 3S9BA 1C5YB 1C4U2 1GBKA 3MOCA 2CMYA 4YOIA 1LQEA 2I6SA 2ZGJA 3QDZB