4U09A

Structure of leptospira interrogans lrr protein lic12759
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
392
structure length
392
Chain Sequence
b'IQKPYKNLAKALQNPADVRNLDLSFQGLKTLPNKIGQLKNLQKLDLGGNEPTILSKEIWQLKDLQKLNLNNNKLTVLPKEIGQLQNLQELSLHSNELVNLPKEIGQFKNLQKLNLDNNKLTVLPKEIGQLQNLQELSLLSNKLISLPTEIEQLKSLKNLDLNHNEFTTVSKEVMLLETLENLDLRSNKLKTIPKEIRQLKSLKVLMLTGNQLTSLPKEIEQLQNLKTLNLGENRFQIFPVEILELKNLLELNLYYNQLVEFPKEVGQLKSLKYLSLYHNQITTLPVEVTQLPDLQELHLSGNKITILPKEILQLKNLEWLSLSNNKLNALPKEIGQLKKLQRLELGNNQLTTLPKEIEQLKNLQRLELDSNPISPKEKERIRKLLPKCEIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIC12759
publication title Structural characterization of a novel subfamily of leucine-rich repeat proteins from the human pathogen Leptospira interrogans.
pubmed doi rcsb
source organism Leptospira interrogans serovar copenhageni str. fiocruz l1-130
molecule tags Unknown function
total genus 145
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4u09A00
1Z7XW 3G39A 4BSUA 1DCEA 4FS7A 2WQUA 3VQ1A 5IJBA 4Z8GA 4TZHA 3G04C 3RGXA 1P8VA 4Z61C 3PMHG 3VQ2A 5HZLB 3W3NA 4M7EA 4G8AA 3RFSA 3WPHA 3C6PB 4FHOA 3E4GA 4NKHA 1OZNA 1H6UA 3DZEA 1P9AG 3W3LA 4J0MA 5AWDA 1OGQA 1JL5A 4V2CA 1PGVA 4PERA 3A79B 4C2BB 3FXIA 4PQ8A 4CNCA 3UL8A 4U09A 4U06A 4R5CA 2JE1A 3RJ0A 2Y5QA 1XCDA 1W8AA 4C2AB 1K5DC 4XGOA 1U0ND 3C6NB 4QC0A 2UZXA 4Q62A 4R6JA 3KJ4A 2R9UA 3W3MA 2V70A 3ULVA 3ZYIA 4FCGA 5IJCA 4LI2A 4LSXA 2Q4GW 1XEUA 2Z64A 3O6NA 2OMYA 4Z64C 2O6SA 1P8TA 5AWBA 4WYKA 4NKGA 3G3AA 4ARRA 4GT6A 3OGKB 4HQ1A 1M9SA 4LSAA 3WPGA 4RCWA 3M18A 3WN4A 1M9LA 4YEBB 4I6JB 1DFJI 2BNHA 2CA6A 3WPBA 2P1NB 1A9NA 5AZ5A 4M7EC 4K17A 4XSQA 3UL9A 4L3FA 4QBZA 5B0NA 4QXEA 4U08A 4J4LA 4KT1A 3RFJA 5CMNA 4R07A 5FTTB 3ULUA 2O6QA 3ZYNA 2ASSB 1XKUA 1FO1A 4Y61B 3W3GA 3ZYJA 3WPEA 4B8CD 3OJAA 3REZA 3ULAA 4EZGA 3WPCA 4LSCA 1DS9A 5B0TA 4XOSA 2XWTC 4GLPA 2P1PB 3GOZA 2OMXA 3CVRA 5D3IA 5A5CA 3JB9j 3BZ5A 1FT8A 5GS2B 2Z62A 2JQDA 2UZYA 4CC4C 3WPFA 3OJAB 4CNMA 3C6OB 1KOOA 1M10B 3RW7A 1FS2A 4PSJA 4BSRA 2V9TB 4KXFB 4LXSA 4U7LA 5AWCA 3RIZA 3SB4A 3O53A 2WQWA 1FQVA 4AW4A 3G3BA 5LFNA 3W3KA 4MQWX 4RWTC 1OTNA 4AY9X 1O6TA 2FT3A 1XWDC 1G9UA 2ASTB 4R0AA 5HDHA 2WQVA 2V9SA 3W3JA 1M0ZA 1D0BA 4ARNA 4KNGA 4Z94G 4R58A 5IYXC 1SQ0B 3UN9A 5AWAA 2Z65A 3P72A 4V2DA 4Q3GA 4FMZA 5GMGA 4P91A 1WWLA 1O6VA 1YRGA 2Z66A 1XECA 4OQTA 4UFRA 2P1MB 3RFEA 2WFHA 2BEXA 5GQRK 4Q3IA 4FD0A 5B4PA 3E2JA 1ZIWA 4CP6A 1OOKG 3ZYOA 2Z7XA 4R6FA 2O6RA 3OGMB 4R08A 5GS0A 1QYYA 3RW6A 4BV4R 3UL7A 4WP6A 4PEQB 2P1QB 2OMZA 2Z63A 2ELLA 1OTOA 3CIYA 3E6JA 4P8SA 2Z7XB 4RCAB 3CIGA 4BSSA 4FDWA 2OMUA 2Z82A 4CILA 4H09A 1H6TA 2RR6A 2IFGA 4R6AA 2XOTA 5GMFA 3RGZA 3G06A 3TSRE 3WPIA 5CMPA 4LSXC 4R5DA 4Z79A 4PKIG 4V2EA 4MN8B 5IJDA 1A4YA 2OMTA 2OMVA 1LTXA 4CC4A 2JE0A 1KOHA 1IO0A 4IM6A 2A0ZA 5GMHA 3OGLB 4R6GA 4LXRA 2Z81A 2OMWA 3WPDA 4L3AA 3M19A 2P1OB 4R09A 2ID5A 4ECOA 4ECNA 1GWBA 1OTMA 1O6SA 4LI1A 2WQXA 3E3ZA 1K5GC 2RA8A
chains in the Genus database with same CATH superfamily
1Z7XW 3G39A 4BSUA 1DCEA 4FS7A 2WQUA 3VQ1A 5IJBA 4Z8GA 4TZHA 3G04C 3RGXA 1P8VA 4Z61C 3PMHG 3VQ2A 5HZLB 3W3NA 4M7EA 4G8AA 3RFSA 3WPHA 3C6PB 4FHOA 3E4GA 4NKHA 1OZNA 1H6UA 3DZEA 1P9AG 3W3LA 4J0MA 5AWDA 1OGQA 1JL5A 4V2CA 1PGVA 4PERA 3A79B 4C2BB 3FXIA 4PQ8A 4CNCA 3UL8A 4U09A 4U06A 4R5CA 2JE1A 3RJ0A 2Y5QA 1XCDA 1W8AA 4C2AB 1K5DC 4XGOA 1U0ND 3C6NB 4QC0A 2UZXA 4Q62A 4R6JA 3KJ4A 2R9UA 3W3MA 2V70A 3ULVA 3ZYIA 4FCGA 5IJCA 4LI2A 4LSXA 2Q4GW 1XEUA 2Z64A 3O6NA 2OMYA 4Z64C 2O6SA 1P8TA 5AWBA 4WYKA 4NKGA 3G3AA 4ARRA 4GT6A 3OGKB 4HQ1A 1M9SA 4LSAA 3WPGA 4RCWA 3M18A 3WN4A 1M9LA 4YEBB 4I6JB 1DFJI 2BNHA 2CA6A 3WPBA 2P1NB 1A9NA 5AZ5A 4M7EC 4K17A 4XSQA 3UL9A 4L3FA 4QBZA 5B0NA 4QXEA 4U08A 4J4LA 4KT1A 3RFJA 5CMNA 4R07A 5FTTB 3ULUA 2O6QA 3ZYNA 2ASSB 1XKUA 1FO1A 4Y61B 3W3GA 3ZYJA 3WPEA 4B8CD 3OJAA 3REZA 3ULAA 4EZGA 3WPCA 4LSCA 1DS9A 5B0TA 4XOSA 2XWTC 4GLPA 2P1PB 3GOZA 2OMXA 3CVRA 5D3IA 5A5CA 3JB9j 3BZ5A 1FT8A 5GS2B 2Z62A 2JQDA 2UZYA 4CC4C 3WPFA 3OJAB 4CNMA 3C6OB 4NZTM 1KOOA 1M10B 3RW7A 1FS2A 4PSJA 4BSRA 2V9TB 4KXFB 4LXSA 4U7LA 5AWCA 3RIZA 3SB4A 3O53A 2WQWA 1FQVA 4AW4A 3G3BA 5LFNA 3W3KA 4MQWX 4RWTC 1OTNA 4AY9X 1O6TA 2FT3A 1XWDC 1G9UA 2ASTB 4R0AA 5HDHA 2WQVA 2V9SA 3W3JA 1M0ZA 1D0BA 4ARNA 4KNGA 4Z94G 4R58A 5IYXC 1SQ0B 3UN9A 5AWAA 2Z65A 3P72A 4V2DA 4Q3GA 4FMZA 5GMGA 4P91A 1WWLA 1O6VA 1YRGA 2Z66A 1XECA 4OQTA 4UFRA 2P1MB 3RFEA 2WFHA 2BEXA 5GQRK 4Q3IA 4FD0A 5B4PA 3E2JA 1ZIWA 4CP6A 1OOKG 3ZYOA 2Z7XA 4R6FA 2O6RA 3OGMB 4R08A 5GS0A 1QYYA 3RW6A 4BV4R 3UL7A 4WP6A 4PEQB 2P1QB 2OMZA 2Z63A 2ELLA 1OTOA 3CIYA 3E6JA 4P8SA 2Z7XB 4RCAB 3CIGA 4BSSA 4FDWA 2OMUA 2Z82A 4CILA 4H09A 1H6TA 2RR6A 2IFGA 4R6AA 2XOTA 5GMFA 3RGZA 3G06A 3TSRE 3WPIA 5CMPA 4LSXC 4R5DA 4Z79A 4PKIG 4V2EA 4MN8B 5IJDA 1A4YA 2OMTA 2OMVA 1LTXA 4CC4A 2JE0A 1KOHA 1IO0A 4IM6A 2A0ZA 5GMHA 3OGLB 4R6GA 4NZRM 4LXRA 2Z81A 2OMWA 3WPDA 4L3AA 3M19A 2P1OB 4R09A 2ID5A 4ECOA 4ECNA 1GWBA 1OTMA 1O6SA 4LI1A 2WQXA 3E3ZA 1K5GC 2RA8A
chains in the Genus database with same CATH topology
1Z7XW 3G39A 4BSUA 1DCEA 4FS7A 2WQUA 3VQ1A 5IJBA 4Z8GA 4TZHA 3G04C 3RGXA 1P8VA 4Z61C 3PMHG 3VQ2A 5HZLB 3W3NA 4M7EA 4G8AA 3RFSA 3WPHA 3C6PB 4FHOA 3E4GA 4NKHA 1OZNA 1H6UA 3DZEA 1P9AG 3W3LA 4J0MA 5AWDA 1OGQA 1JL5A 4V2CA 1PGVA 4PERA 3A79B 4C2BB 3FXIA 4PQ8A 4CNCA 3UL8A 4U09A 4U06A 4R5CA 2JE1A 3RJ0A 2Y5QA 1XCDA 1W8AA 4C2AB 1K5DC 4XGOA 1U0ND 3C6NB 4QC0A 2UZXA 4Q62A 4R6JA 3KJ4A 2R9UA 3W3MA 2V70A 3ULVA 3ZYIA 4FCGA 5IJCA 4LI2A 4LSXA 2Q4GW 1XEUA 2Z64A 3O6NA 2OMYA 4Z64C 2O6SA 1P8TA 5AWBA 4WYKA 4NKGA 3G3AA 4ARRA 4GT6A 3OGKB 4HQ1A 1M9SA 4LSAA 3WPGA 4RCWA 3M18A 3WN4A 1M9LA 4YEBB 4I6JB 1DFJI 2BNHA 2CA6A 3WPBA 2P1NB 1A9NA 5AZ5A 4M7EC 4K17A 4XSQA 3UL9A 4L3FA 4QBZA 5B0NA 4QXEA 4U08A 4J4LA 4KT1A 3RFJA 5CMNA 4R07A 5FTTB 3ULUA 2O6QA 3ZYNA 2ASSB 1XKUA 1FO1A 4Y61B 3W3GA 3ZYJA 3WPEA 4B8CD 3OJAA 3REZA 3ULAA 4EZGA 3WPCA 4LSCA 1DS9A 5B0TA 4XOSA 2XWTC 4GLPA 2P1PB 3GOZA 2OMXA 3CVRA 5D3IA 5A5CA 3JB9j 3BZ5A 1FT8A 5GS2B 2Z62A 2JQDA 2UZYA 4CC4C 3WPFA 3OJAB 4CNMA 3C6OB 1KOOA 1M10B 3RW7A 1FS2A 4PSJA 4BSRA 2V9TB 4KXFB 4LXSA 4U7LA 5AWCA 3RIZA 3SB4A 3O53A 2WQWA 1FQVA 4AW4A 3G3BA 5LFNA 3W3KA 4MQWX 4RWTC 1OTNA 4AY9X 1O6TA 2FT3A 1XWDC 1G9UA 2ASTB 4R0AA 5HDHA 2WQVA 2V9SA 3W3JA 1M0ZA 1D0BA 4ARNA 4KNGA 4Z94G 4R58A 5IYXC 1SQ0B 3UN9A 5AWAA 2Z65A 3P72A 4V2DA 4Q3GA 4FMZA 5GMGA 4P91A 1WWLA 1O6VA 1YRGA 2Z66A 1XECA 4OQTA 4UFRA 2P1MB 3RFEA 2WFHA 2BEXA 5GQRK 4Q3IA 4FD0A 5B4PA 3E2JA 1ZIWA 4CP6A 1OOKG 3ZYOA 2Z7XA 4R6FA 2O6RA 3OGMB 4R08A 5GS0A 1QYYA 3RW6A 4BV4R 3UL7A 4WP6A 4PEQB 2P1QB 2OMZA 2Z63A 2ELLA 1OTOA 3CIYA 3E6JA 4P8SA 2Z7XB 4RCAB 3CIGA 4BSSA 4FDWA 2OMUA 2Z82A 4CILA 4H09A 1H6TA 2RR6A 2IFGA 4R6AA 2XOTA 5GMFA 3RGZA 3G06A 3TSRE 3WPIA 5CMPA 4LSXC 4R5DA 4Z79A 4PKIG 4V2EA 4MN8B 5IJDA 1A4YA 2OMTA 2OMVA 1LTXA 4CC4A 2JE0A 1KOHA 1IO0A 4IM6A 2A0ZA 5GMHA 3OGLB 4R6GA 4LXRA 2Z81A 2OMWA 3WPDA 4L3AA 3M19A 2P1OB 4R09A 2ID5A 4ECOA 4ECNA 1GWBA 1OTMA 1O6SA 4LI1A 2WQXA 3E3ZA 1K5GC 2RA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7X W;  3G39 A;  4BSU A;  1DCE A;  4FS7 A;  2WQU A;  3VQ1 A;  5IJB A;  4Z8G A;  4TZH A;  3G04 C;  3RGX A;  1P8V A;  4Z61 C;  3PMH G;  3VQ2 A;  5HZL B;  3W3N A;  4M7E A;  4G8A A;  3RFS A;  3WPH A;  3C6P B;  4FHO A;  3E4G A;  4NKH A;  1OZN A;  1H6U A;  3DZE A;  1P9A G;  3W3L A;  4J0M A;  5AWD A;  1OGQ A;  1JL5 A;  4V2C A;  1PGV A;  4PER A;  3A79 B;  4C2B B;  3FXI A;  4PQ8 A;  4CNC A;  3UL8 A;  4U09 A;  4U06 A;  4R5C A;  2JE1 A;  3RJ0 A;  2Y5Q A;  1XCD A;  1W8A A;  4C2A B;  1K5D C;  4XGO A;  1U0N D;  3C6N B;  4QC0 A;  2UZX A;  4Q62 A;  4R6J A;  3KJ4 A;  2R9U A;  3W3M A;  2V70 A;  3ULV A;  3ZYI A;  4FCG A;  5IJC A;  4LI2 A;  4LSX A;  2Q4G W;  1XEU A;  2Z64 A;  3O6N A;  2OMY A;  4Z64 C;  2O6S A;  1P8T A;  5AWB A;  4WYK A;  4NKG A;  3G3A A;  4ARR A;  4GT6 A;  3OGK B;  4HQ1 A;  1M9S A;  4LSA A;  3WPG A;  4RCW A;  3M18 A;  3WN4 A;  1M9L A;  4YEB B;  4I6J B;  1DFJ I;  2BNH A;  2CA6 A;  3WPB A;  2P1N B;  1A9N A;  5AZ5 A;  4M7E C;  4K17 A;  4XSQ A;  3UL9 A;  4L3F A;  4QBZ A;  5B0N A;  4QXE A;  4U08 A;  4J4L A;  4KT1 A;  3RFJ A;  5CMN A;  4R07 A;  5FTT B;  3ULU A;  2O6Q A;  3ZYN A;  2ASS B;  1XKU A;  1FO1 A;  4Y61 B;  3W3G A;  3ZYJ A;  3WPE A;  4B8C D;  3OJA A;  3REZ A;  3ULA A;  4EZG A;  3WPC A;  4LSC A;  1DS9 A;  5B0T A;  4XOS A;  2XWT C;  4GLP A;  2P1P B;  3GOZ A;  2OMX A;  3CVR A;  5D3I A;  5A5C A;  3JB9 j;  3BZ5 A;  1FT8 A;  5GS2 B;  2Z62 A;  2JQD A;  2UZY A;  4CC4 C;  3WPF A;  3OJA B;  4CNM A;  3C6O B;  1KOO A;  1M10 B;  3RW7 A;  1FS2 A;  4PSJ A;  4BSR A;  2V9T B;  4KXF B;  4LXS A;  4U7L A;  5AWC A;  3RIZ A;  3SB4 A;  3O53 A;  2WQW A;  1FQV A;  4AW4 A;  3G3B A;  5LFN A;  3W3K A;  4MQW X;  4RWT C;  1OTN A;  4AY9 X;  1O6T A;  2FT3 A;  1XWD C;  1G9U A;  2AST B;  4R0A A;  5HDH A;  2WQV A;  2V9S A;  3W3J A;  1M0Z A;  1D0B A;  4ARN A;  4KNG A;  4Z94 G;  4R58 A;  5IYX C;  1SQ0 B;  3UN9 A;  5AWA A;  2Z65 A;  3P72 A;  4V2D A;  4Q3G A;  4FMZ A;  5GMG A;  4P91 A;  1WWL A;  1O6V A;  1YRG A;  2Z66 A;  1XEC A;  4OQT A;  4UFR A;  2P1M B;  3RFE A;  2WFH A;  2BEX A;  5GQR K;  4Q3I A;  4FD0 A;  5B4P A;  3E2J A;  1ZIW A;  4CP6 A;  1OOK G;  3ZYO A;  2Z7X A;  4R6F A;  2O6R A;  3OGM B;  4R08 A;  5GS0 A;  1QYY A;  3RW6 A;  4BV4 R;  3UL7 A;  4WP6 A;  4PEQ B;  2P1Q B;  2OMZ A;  2Z63 A;  2ELL A;  1OTO A;  3CIY A;  3E6J A;  4P8S A;  2Z7X B;  4RCA B;  3CIG A;  4BSS A;  4FDW A;  2OMU A;  2Z82 A;  4CIL A;  4H09 A;  1H6T A;  2RR6 A;  2IFG A;  4R6A A;  2XOT A;  5GMF A;  3RGZ A;  3G06 A;  3TSR E;  3WPI A;  5CMP A;  4LSX C;  4R5D A;  4Z79 A;  4PKI G;  4V2E A;  4MN8 B;  5IJD A;  1A4Y A;  2OMT A;  2OMV A;  1LTX A;  4CC4 A;  2JE0 A;  1KOH A;  1IO0 A;  4IM6 A;  2A0Z A;  5GMH A;  3OGL B;  4R6G A;  4LXR A;  2Z81 A;  2OMW A;  3WPD A;  4L3A A;  3M19 A;  2P1O B;  4R09 A;  2ID5 A;  4ECO A;  4ECN A;  1GWB A;  1OTM A;  1O6S A;  4LI1 A;  2WQX A;  3E3Z A;  1K5G C;  2RA8 A; 
#chains in the Genus database with same CATH topology
 1Z7X W;  3G39 A;  4BSU A;  1DCE A;  4FS7 A;  2WQU A;  3VQ1 A;  5IJB A;  4Z8G A;  4TZH A;  3G04 C;  3RGX A;  1P8V A;  4Z61 C;  3PMH G;  3VQ2 A;  5HZL B;  3W3N A;  4M7E A;  4G8A A;  3RFS A;  3WPH A;  3C6P B;  4FHO A;  3E4G A;  4NKH A;  1OZN A;  1H6U A;  3DZE A;  1P9A G;  3W3L A;  4J0M A;  5AWD A;  1OGQ A;  1JL5 A;  4V2C A;  1PGV A;  4PER A;  3A79 B;  4C2B B;  3FXI A;  4PQ8 A;  4CNC A;  3UL8 A;  4U09 A;  4U06 A;  4R5C A;  2JE1 A;  3RJ0 A;  2Y5Q A;  1XCD A;  1W8A A;  4C2A B;  1K5D C;  4XGO A;  1U0N D;  3C6N B;  4QC0 A;  2UZX A;  4Q62 A;  4R6J A;  3KJ4 A;  2R9U A;  3W3M A;  2V70 A;  3ULV A;  3ZYI A;  4FCG A;  5IJC A;  4LI2 A;  4LSX A;  2Q4G W;  1XEU A;  2Z64 A;  3O6N A;  2OMY A;  4Z64 C;  2O6S A;  1P8T A;  5AWB A;  4WYK A;  4NKG A;  3G3A A;  4ARR A;  4GT6 A;  3OGK B;  4HQ1 A;  1M9S A;  4LSA A;  3WPG A;  4RCW A;  3M18 A;  3WN4 A;  1M9L A;  4YEB B;  4I6J B;  1DFJ I;  2BNH A;  2CA6 A;  3WPB A;  2P1N B;  1A9N A;  5AZ5 A;  4M7E C;  4K17 A;  4XSQ A;  3UL9 A;  4L3F A;  4QBZ A;  5B0N A;  4QXE A;  4U08 A;  4J4L A;  4KT1 A;  3RFJ A;  5CMN A;  4R07 A;  5FTT B;  3ULU A;  2O6Q A;  3ZYN A;  2ASS B;  1XKU A;  1FO1 A;  4Y61 B;  3W3G A;  3ZYJ A;  3WPE A;  4B8C D;  3OJA A;  3REZ A;  3ULA A;  4EZG A;  3WPC A;  4LSC A;  1DS9 A;  5B0T A;  4XOS A;  2XWT C;  4GLP A;  2P1P B;  3GOZ A;  2OMX A;  3CVR A;  5D3I A;  5A5C A;  3JB9 j;  3BZ5 A;  1FT8 A;  5GS2 B;  2Z62 A;  2JQD A;  2UZY A;  4CC4 C;  3WPF A;  3OJA B;  4CNM A;  3C6O B;  4NZT M;  1KOO A;  1M10 B;  3RW7 A;  1FS2 A;  4PSJ A;  4BSR A;  2V9T B;  4KXF B;  4LXS A;  4U7L A;  5AWC A;  3RIZ A;  3SB4 A;  3O53 A;  2WQW A;  1FQV A;  4AW4 A;  3G3B A;  5LFN A;  3W3K A;  4MQW X;  4RWT C;  1OTN A;  4AY9 X;  1O6T A;  2FT3 A;  1XWD C;  1G9U A;  2AST B;  4R0A A;  5HDH A;  2WQV A;  2V9S A;  3W3J A;  1M0Z A;  1D0B A;  4ARN A;  4KNG A;  4Z94 G;  4R58 A;  5IYX C;  1SQ0 B;  3UN9 A;  5AWA A;  2Z65 A;  3P72 A;  4V2D A;  4Q3G A;  4FMZ A;  5GMG A;  4P91 A;  1WWL A;  1O6V A;  1YRG A;  2Z66 A;  1XEC A;  4OQT A;  4UFR A;  2P1M B;  3RFE A;  2WFH A;  2BEX A;  5GQR K;  4Q3I A;  4FD0 A;  5B4P A;  3E2J A;  1ZIW A;  4CP6 A;  1OOK G;  3ZYO A;  2Z7X A;  4R6F A;  2O6R A;  3OGM B;  4R08 A;  5GS0 A;  1QYY A;  3RW6 A;  4BV4 R;  3UL7 A;  4WP6 A;  4PEQ B;  2P1Q B;  2OMZ A;  2Z63 A;  2ELL A;  1OTO A;  3CIY A;  3E6J A;  4P8S A;  2Z7X B;  4RCA B;  3CIG A;  4BSS A;  4FDW A;  2OMU A;  2Z82 A;  4CIL A;  4H09 A;  1H6T A;  2RR6 A;  2IFG A;  4R6A A;  2XOT A;  5GMF A;  3RGZ A;  3G06 A;  3TSR E;  3WPI A;  5CMP A;  4LSX C;  4R5D A;  4Z79 A;  4PKI G;  4V2E A;  4MN8 B;  5IJD A;  1A4Y A;  2OMT A;  2OMV A;  1LTX A;  4CC4 A;  2JE0 A;  1KOH A;  1IO0 A;  4IM6 A;  2A0Z A;  5GMH A;  3OGL B;  4R6G A;  4NZR M;  4LXR A;  2Z81 A;  2OMW A;  3WPD A;  4L3A A;  3M19 A;  2P1O B;  4R09 A;  2ID5 A;  4ECO A;  4ECN A;  1GWB A;  1OTM A;  1O6S A;  4LI1 A;  2WQX A;  3E3Z A;  1K5G C;  2RA8 A; 
#chains in the Genus database with same CATH homology
 1Z7X W;  3G39 A;  4BSU A;  1DCE A;  4FS7 A;  2WQU A;  3VQ1 A;  5IJB A;  4Z8G A;  4TZH A;  3G04 C;  3RGX A;  1P8V A;  4Z61 C;  3PMH G;  3VQ2 A;  5HZL B;  3W3N A;  4M7E A;  4G8A A;  3RFS A;  3WPH A;  3C6P B;  4FHO A;  3E4G A;  4NKH A;  1OZN A;  1H6U A;  3DZE A;  1P9A G;  3W3L A;  4J0M A;  5AWD A;  1OGQ A;  1JL5 A;  4V2C A;  1PGV A;  4PER A;  3A79 B;  4C2B B;  3FXI A;  4PQ8 A;  4CNC A;  3UL8 A;  4U09 A;  4U06 A;  4R5C A;  2JE1 A;  3RJ0 A;  2Y5Q A;  1XCD A;  1W8A A;  4C2A B;  1K5D C;  4XGO A;  1U0N D;  3C6N B;  4QC0 A;  2UZX A;  4Q62 A;  4R6J A;  3KJ4 A;  2R9U A;  3W3M A;  2V70 A;  3ULV A;  3ZYI A;  4FCG A;  5IJC A;  4LI2 A;  4LSX A;  2Q4G W;  1XEU A;  2Z64 A;  3O6N A;  2OMY A;  4Z64 C;  2O6S A;  1P8T A;  5AWB A;  4WYK A;  4NKG A;  3G3A A;  4ARR A;  4GT6 A;  3OGK B;  4HQ1 A;  1M9S A;  4LSA A;  3WPG A;  4RCW A;  3M18 A;  3WN4 A;  1M9L A;  4YEB B;  4I6J B;  1DFJ I;  2BNH A;  2CA6 A;  3WPB A;  2P1N B;  1A9N A;  5AZ5 A;  4M7E C;  4K17 A;  4XSQ A;  3UL9 A;  4L3F A;  4QBZ A;  5B0N A;  4QXE A;  4U08 A;  4J4L A;  4KT1 A;  3RFJ A;  5CMN A;  4R07 A;  5FTT B;  3ULU A;  2O6Q A;  3ZYN A;  2ASS B;  1XKU A;  1FO1 A;  4Y61 B;  3W3G A;  3ZYJ A;  3WPE A;  4B8C D;  3OJA A;  3REZ A;  3ULA A;  4EZG A;  3WPC A;  4LSC A;  1DS9 A;  5B0T A;  4XOS A;  2XWT C;  4GLP A;  2P1P B;  3GOZ A;  2OMX A;  3CVR A;  5D3I A;  5A5C A;  3JB9 j;  3BZ5 A;  1FT8 A;  5GS2 B;  2Z62 A;  2JQD A;  2UZY A;  4CC4 C;  3WPF A;  3OJA B;  4CNM A;  3C6O B;  1KOO A;  1M10 B;  3RW7 A;  1FS2 A;  4PSJ A;  4BSR A;  2V9T B;  4KXF B;  4LXS A;  4U7L A;  5AWC A;  3RIZ A;  3SB4 A;  3O53 A;  2WQW A;  1FQV A;  4AW4 A;  3G3B A;  5LFN A;  3W3K A;  4MQW X;  4RWT C;  1OTN A;  4AY9 X;  1O6T A;  2FT3 A;  1XWD C;  1G9U A;  2AST B;  4R0A A;  5HDH A;  2WQV A;  2V9S A;  3W3J A;  1M0Z A;  1D0B A;  4ARN A;  4KNG A;  4Z94 G;  4R58 A;  5IYX C;  1SQ0 B;  3UN9 A;  5AWA A;  2Z65 A;  3P72 A;  4V2D A;  4Q3G A;  4FMZ A;  5GMG A;  4P91 A;  1WWL A;  1O6V A;  1YRG A;  2Z66 A;  1XEC A;  4OQT A;  4UFR A;  2P1M B;  3RFE A;  2WFH A;  2BEX A;  5GQR K;  4Q3I A;  4FD0 A;  5B4P A;  3E2J A;  1ZIW A;  4CP6 A;  1OOK G;  3ZYO A;  2Z7X A;  4R6F A;  2O6R A;  3OGM B;  4R08 A;  5GS0 A;  1QYY A;  3RW6 A;  4BV4 R;  3UL7 A;  4WP6 A;  4PEQ B;  2P1Q B;  2OMZ A;  2Z63 A;  2ELL A;  1OTO A;  3CIY A;  3E6J A;  4P8S A;  2Z7X B;  4RCA B;  3CIG A;  4BSS A;  4FDW A;  2OMU A;  2Z82 A;  4CIL A;  4H09 A;  1H6T A;  2RR6 A;  2IFG A;  4R6A A;  2XOT A;  5GMF A;  3RGZ A;  3G06 A;  3TSR E;  3WPI A;  5CMP A;  4LSX C;  4R5D A;  4Z79 A;  4PKI G;  4V2E A;  4MN8 B;  5IJD A;  1A4Y A;  2OMT A;  2OMV A;  1LTX A;  4CC4 A;  2JE0 A;  1KOH A;  1IO0 A;  4IM6 A;  2A0Z A;  5GMH A;  3OGL B;  4R6G A;  4LXR A;  2Z81 A;  2OMW A;  3WPD A;  4L3A A;  3M19 A;  2P1O B;  4R09 A;  2ID5 A;  4ECO A;  4ECN A;  1GWB A;  1OTM A;  1O6S A;  4LI1 A;  2WQX A;  3E3Z A;  1K5G C;  2RA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...