4U09A

Structure of leptospira interrogans lrr protein lic12759
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
392
structure length
392
Chain Sequence
IQKPYKNLAKALQNPADVRNLDLSFQGLKTLPNKIGQLKNLQKLDLGGNEPTILSKEIWQLKDLQKLNLNNNKLTVLPKEIGQLQNLQELSLHSNELVNLPKEIGQFKNLQKLNLDNNKLTVLPKEIGQLQNLQELSLLSNKLISLPTEIEQLKSLKNLDLNHNEFTTVSKEVMLLETLENLDLRSNKLKTIPKEIRQLKSLKVLMLTGNQLTSLPKEIEQLQNLKTLNLGENRFQIFPVEILELKNLLELNLYYNQLVEFPKEVGQLKSLKYLSLYHNQITTLPVEVTQLPDLQELHLSGNKITILPKEILQLKNLEWLSLSNNKLNALPKEIGQLKKLQRLELGNNQLTTLPKEIEQLKNLQRLELDSNPISPKEKERIRKLLPKCEIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIC12759
publication title Structural characterization of a novel subfamily of leucine-rich repeat proteins from the human pathogen Leptospira interrogans.
pubmed doi rcsb
source organism Leptospira interrogans serovar copenhageni str. fiocruz l1-130
molecule tags Unknown function
total genus 145
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4u09A00
2OMVA 4PKIG 3ULVA 3ZYJA 1WWLA 2ID5A 5B4PA 3WPIA 3REZA 1Z7XW 5IYXC 4YEBB 2Q4GW 3RJ0A 2JQDA 2BEXA 4NKGA 4CILA 4LI1A 3RIZA 3G04C 1LTXA 3RFSA 3UL9A 1P8TA 3RW6A 1FS2A 1OTNA 2WQUA 4LXRA 5GMFA 4V2CA 3OJAB 4LSAA 3A79B 5CMPA 3WPFA 4Y61B 3WPHA 4V2DA 4LXSA 4XGOA 1P9AG 1IO0A 5AWBA 1K5GC 5CMNA 3RFEA 5AWCA 4KXFB 3O53A 4FD0A 1YRGA 4RWTC 5GS2B 2Z81A 4GLPA 1KOHA 2OMTA 3PMHG 4R5CA 3WPDA 4CNCA 4P8SA 4FDWA 1P8VA 1DS9A 2Z66A 3RFJA 4C2BB 2OMUA 2XOTA 4GT6A 4M7EA 2RA8A 4G8AA 3RGZA 4AY9X 3E3ZA 5GMHA 1O6VA 1XKUA 5D3IA 2O6QA 3G39A 4PSJA 3WPCA 3E2JA 3UL7A 3UN9A 3DZEA 4R58A 1JL5A 3G06A 4B8CD 4K17A 4LSXC 2Z64A 4Q3IA 3C6OB 4I6JB 4Q62A 4ARNA 4ECOA 2IFGA 1PGVA 1FQVA 3UL8A 5A5CA 1OTOA 4FHOA 3M18A 1H6UA 3KJ4A 2ELLA 3SB4A 4IM6A 4BSUA 2Z65A 1A4YA 2OMWA 5GS0A 3WPBA 3WPEA 4M7EC 3O6NA 4Z79A 5IJBA 3CIGA 3TSRE 4CNMA 4RCAB 4WP6A 5AWAA 3WN4A 1QYYA 4PEQB 2Z82A 3W3GA 1OTMA 4MN8B 2P1NB 4H09A 4TZHA 5GQRK 3OGKB 3M19A 4LSXA 3ZYIA 2WQXA 2UZYA 2A0ZA 4QXEA 3G3AA 5AWDA 2Z62A 4UFRA 4FMZA 2WFHA 1M0ZA 1FT8A 3E4GA 4U08A 2XWTC 4R6FA 3ZYOA 4J4LA 3OGLB 1K5DC 4C2AB 4U06A 4Z94G 2WQWA 2P1QB 3OGMB 5HDHA 3W3NA 4KT1A 1A9NA 2FT3A 1XCDA 2V9SA 4Q3GA 4Z64C 4U7LA 1XWDC 4R6GA 3W3MA 1DCEA 4L3AA 4HQ1A 3W3JA 2BNHA 1M9LA 2WQVA 3WPGA 4R08A 4RCWA 1O6SA 1U0ND 4KNGA 5IJCA 2CA6A 3W3KA 3VQ1A 1SQ0B 1M9SA 2UZXA 4EZGA 2V70A 2O6SA 4R6AA 2ASSB 3RW7A 1ZIWA 4L3FA 3RGXA 1XEUA 2ASTB 4R07A 2OMYA 3C6PB 1O6TA 1OOKG 2V9TB 4ARRA 4R5DA 3GOZA 4PERA 4CC4A 2P1OB 5FTTB 3CVRA 3P72A 5GMGA 3CIYA 4LSCA 2Z7XA 5B0NA 4WYKA 5AZ5A 4BV4R 5HZLB 4QBZA 4R6JA 4XOSA 3C6NB 2P1PB 1G9UA 3VQ2A 3E6JA 2P1MB 1XECA 5IJDA 3ZYNA 4BSRA 4P91A 2Z63A 2OMXA 2JE1A 3G3BA 3BZ5A 4V2EA 4R09A 4Z61C 1M10B 1GWBA 4NKHA 2Z7XB 1DFJI 1OZNA 4PQ8A 1W8AA 4LI2A 4CC4C 5LFNA 3ULAA 2R9UA 3FXIA 2Y5QA 2JE0A 4Z8GA 1FO1A 3W3LA 4XSQA 4U09A 4BSSA 3ULUA 2O6RA 4FCGA 3JB9j 5B0TA 4FS7A 4MQWX 4ECNA 1OGQA 4AW4A 4CP6A 1H6TA 2RR6A 3OJAA 4QC0A 4J0MA 1D0BA 1KOOA 2OMZA 4R0AA 4OQTA
chains in the Genus database with same CATH superfamily
2OMVA 4PKIG 3ULVA 3ZYJA 1WWLA 2ID5A 5B4PA 3WPIA 3REZA 1Z7XW 5IYXC 4YEBB 2Q4GW 3RJ0A 2JQDA 2BEXA 4NKGA 4CILA 4LI1A 3RIZA 3G04C 1LTXA 3RFSA 3UL9A 1P8TA 3RW6A 1FS2A 1OTNA 2WQUA 4LXRA 5GMFA 4V2CA 3OJAB 4LSAA 3A79B 5CMPA 3WPFA 4Y61B 3WPHA 4V2DA 4LXSA 4XGOA 1P9AG 1IO0A 5AWBA 1K5GC 5CMNA 3RFEA 5AWCA 4KXFB 3O53A 4FD0A 1YRGA 4RWTC 5GS2B 2Z81A 4GLPA 1KOHA 4NZRM 2OMTA 3PMHG 4R5CA 3WPDA 4CNCA 4P8SA 4FDWA 1P8VA 1DS9A 2Z66A 3RFJA 4C2BB 2OMUA 2XOTA 4GT6A 4M7EA 2RA8A 4G8AA 3RGZA 4AY9X 3E3ZA 5GMHA 1O6VA 1XKUA 4NZTM 5D3IA 2O6QA 3G39A 4PSJA 3WPCA 3E2JA 3UL7A 3UN9A 3DZEA 4R58A 1JL5A 3G06A 4B8CD 4K17A 4LSXC 2Z64A 4Q3IA 3C6OB 4I6JB 4Q62A 4ARNA 4ECOA 2IFGA 1PGVA 1FQVA 3UL8A 5A5CA 1OTOA 4FHOA 3M18A 1H6UA 3KJ4A 2ELLA 3SB4A 4IM6A 4BSUA 2Z65A 1A4YA 2OMWA 5GS0A 3WPBA 3WPEA 4M7EC 3O6NA 4Z79A 5IJBA 3CIGA 3TSRE 4CNMA 4RCAB 4WP6A 5AWAA 3WN4A 1QYYA 4PEQB 2Z82A 3W3GA 1OTMA 4MN8B 2P1NB 4H09A 4TZHA 5GQRK 3OGKB 3M19A 4LSXA 3ZYIA 2WQXA 2UZYA 2A0ZA 4QXEA 3G3AA 5AWDA 2Z62A 4UFRA 4FMZA 2WFHA 1M0ZA 1FT8A 3E4GA 4U08A 2XWTC 4R6FA 3ZYOA 4J4LA 3OGLB 1K5DC 4C2AB 4U06A 4Z94G 2WQWA 2P1QB 3OGMB 5HDHA 3W3NA 4KT1A 1A9NA 2FT3A 1XCDA 2V9SA 4Q3GA 4Z64C 4U7LA 1XWDC 4R6GA 3W3MA 1DCEA 4L3AA 4HQ1A 3W3JA 2BNHA 1M9LA 2WQVA 3WPGA 4R08A 4RCWA 1O6SA 1U0ND 4KNGA 5IJCA 2CA6A 3W3KA 3VQ1A 1SQ0B 1M9SA 2UZXA 4EZGA 2V70A 2O6SA 4R6AA 2ASSB 3RW7A 1ZIWA 4L3FA 3RGXA 1XEUA 2ASTB 4R07A 2OMYA 3C6PB 1O6TA 1OOKG 2V9TB 4ARRA 4R5DA 3GOZA 4PERA 4CC4A 2P1OB 5FTTB 3CVRA 3P72A 5GMGA 3CIYA 4LSCA 2Z7XA 5B0NA 4WYKA 5AZ5A 4BV4R 5HZLB 4QBZA 4R6JA 4XOSA 3C6NB 2P1PB 1G9UA 3VQ2A 3E6JA 2P1MB 1XECA 5IJDA 3ZYNA 4BSRA 4P91A 2Z63A 2OMXA 2JE1A 3G3BA 3BZ5A 4V2EA 4R09A 4Z61C 1M10B 1GWBA 4NKHA 2Z7XB 1DFJI 1OZNA 4PQ8A 1W8AA 4LI2A 4CC4C 5LFNA 3ULAA 2R9UA 3FXIA 2Y5QA 2JE0A 4Z8GA 1FO1A 3W3LA 4XSQA 4U09A 4BSSA 3ULUA 2O6RA 4FCGA 3JB9j 5B0TA 4FS7A 4MQWX 4ECNA 1OGQA 4AW4A 4CP6A 1H6TA 2RR6A 3OJAA 4QC0A 4J0MA 1D0BA 1KOOA 2OMZA 4R0AA 4OQTA
chains in the Genus database with same CATH topology
2OMVA 4PKIG 3ULVA 3ZYJA 1WWLA 2ID5A 5B4PA 3WPIA 3REZA 1Z7XW 5IYXC 4YEBB 2Q4GW 3RJ0A 2JQDA 2BEXA 4NKGA 4CILA 4LI1A 3RIZA 3G04C 1LTXA 3RFSA 3UL9A 1P8TA 3RW6A 1FS2A 1OTNA 2WQUA 4LXRA 5GMFA 4V2CA 3OJAB 4LSAA 3A79B 5CMPA 3WPFA 4Y61B 3WPHA 4V2DA 4LXSA 4XGOA 1P9AG 1IO0A 5AWBA 1K5GC 5CMNA 3RFEA 5AWCA 4KXFB 3O53A 4FD0A 1YRGA 4RWTC 5GS2B 2Z81A 4GLPA 1KOHA 2OMTA 3PMHG 4R5CA 3WPDA 4CNCA 4P8SA 4FDWA 1P8VA 1DS9A 2Z66A 3RFJA 4C2BB 2OMUA 2XOTA 4GT6A 4M7EA 2RA8A 4G8AA 3RGZA 4AY9X 3E3ZA 5GMHA 1O6VA 1XKUA 5D3IA 2O6QA 3G39A 4PSJA 3WPCA 3E2JA 3UL7A 3UN9A 3DZEA 4R58A 1JL5A 3G06A 4B8CD 4K17A 4LSXC 2Z64A 4Q3IA 3C6OB 4I6JB 4Q62A 4ARNA 4ECOA 2IFGA 1PGVA 1FQVA 3UL8A 5A5CA 1OTOA 4FHOA 3M18A 1H6UA 3KJ4A 2ELLA 3SB4A 4IM6A 4BSUA 2Z65A 1A4YA 2OMWA 5GS0A 3WPBA 3WPEA 4M7EC 3O6NA 4Z79A 5IJBA 3CIGA 3TSRE 4CNMA 4RCAB 4WP6A 5AWAA 3WN4A 1QYYA 4PEQB 2Z82A 3W3GA 1OTMA 4MN8B 2P1NB 4H09A 4TZHA 5GQRK 3OGKB 3M19A 4LSXA 3ZYIA 2WQXA 2UZYA 2A0ZA 4QXEA 3G3AA 5AWDA 2Z62A 4UFRA 4FMZA 2WFHA 1M0ZA 1FT8A 3E4GA 4U08A 2XWTC 4R6FA 3ZYOA 4J4LA 3OGLB 1K5DC 4C2AB 4U06A 4Z94G 2WQWA 2P1QB 3OGMB 5HDHA 3W3NA 4KT1A 1A9NA 2FT3A 1XCDA 2V9SA 4Q3GA 4Z64C 4U7LA 1XWDC 4R6GA 3W3MA 1DCEA 4L3AA 4HQ1A 3W3JA 2BNHA 1M9LA 2WQVA 3WPGA 4R08A 4RCWA 1O6SA 1U0ND 4KNGA 5IJCA 2CA6A 3W3KA 3VQ1A 1SQ0B 1M9SA 2UZXA 4EZGA 2V70A 2O6SA 4R6AA 2ASSB 3RW7A 1ZIWA 4L3FA 3RGXA 1XEUA 2ASTB 4R07A 2OMYA 3C6PB 1O6TA 1OOKG 2V9TB 4ARRA 4R5DA 3GOZA 4PERA 4CC4A 2P1OB 5FTTB 3CVRA 3P72A 5GMGA 3CIYA 4LSCA 2Z7XA 5B0NA 4WYKA 5AZ5A 4BV4R 5HZLB 4QBZA 4R6JA 4XOSA 3C6NB 2P1PB 1G9UA 3VQ2A 3E6JA 2P1MB 1XECA 5IJDA 3ZYNA 4BSRA 4P91A 2Z63A 2OMXA 2JE1A 3G3BA 3BZ5A 4V2EA 4R09A 4Z61C 1M10B 1GWBA 4NKHA 2Z7XB 1DFJI 1OZNA 4PQ8A 1W8AA 4LI2A 4CC4C 5LFNA 3ULAA 2R9UA 3FXIA 2Y5QA 2JE0A 4Z8GA 1FO1A 3W3LA 4XSQA 4U09A 4BSSA 3ULUA 2O6RA 4FCGA 3JB9j 5B0TA 4FS7A 4MQWX 4ECNA 1OGQA 4AW4A 4CP6A 1H6TA 2RR6A 3OJAA 4QC0A 4J0MA 1D0BA 1KOOA 2OMZA 4R0AA 4OQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMV A;  4PKI G;  3ULV A;  3ZYJ A;  1WWL A;  2ID5 A;  5B4P A;  3WPI A;  3REZ A;  1Z7X W;  5IYX C;  4YEB B;  2Q4G W;  3RJ0 A;  2JQD A;  2BEX A;  4NKG A;  4CIL A;  4LI1 A;  3RIZ A;  3G04 C;  1LTX A;  3RFS A;  3UL9 A;  1P8T A;  3RW6 A;  1FS2 A;  1OTN A;  2WQU A;  4LXR A;  5GMF A;  4V2C A;  3OJA B;  4LSA A;  3A79 B;  5CMP A;  3WPF A;  4Y61 B;  3WPH A;  4V2D A;  4LXS A;  4XGO A;  1P9A G;  1IO0 A;  5AWB A;  1K5G C;  5CMN A;  3RFE A;  5AWC A;  4KXF B;  3O53 A;  4FD0 A;  1YRG A;  4RWT C;  5GS2 B;  2Z81 A;  4GLP A;  1KOH A;  2OMT A;  3PMH G;  4R5C A;  3WPD A;  4CNC A;  4P8S A;  4FDW A;  1P8V A;  1DS9 A;  2Z66 A;  3RFJ A;  4C2B B;  2OMU A;  2XOT A;  4GT6 A;  4M7E A;  2RA8 A;  4G8A A;  3RGZ A;  4AY9 X;  3E3Z A;  5GMH A;  1O6V A;  1XKU A;  5D3I A;  2O6Q A;  3G39 A;  4PSJ A;  3WPC A;  3E2J A;  3UL7 A;  3UN9 A;  3DZE A;  4R58 A;  1JL5 A;  3G06 A;  4B8C D;  4K17 A;  4LSX C;  2Z64 A;  4Q3I A;  3C6O B;  4I6J B;  4Q62 A;  4ARN A;  4ECO A;  2IFG A;  1PGV A;  1FQV A;  3UL8 A;  5A5C A;  1OTO A;  4FHO A;  3M18 A;  1H6U A;  3KJ4 A;  2ELL A;  3SB4 A;  4IM6 A;  4BSU A;  2Z65 A;  1A4Y A;  2OMW A;  5GS0 A;  3WPB A;  3WPE A;  4M7E C;  3O6N A;  4Z79 A;  5IJB A;  3CIG A;  3TSR E;  4CNM A;  4RCA B;  4WP6 A;  5AWA A;  3WN4 A;  1QYY A;  4PEQ B;  2Z82 A;  3W3G A;  1OTM A;  4MN8 B;  2P1N B;  4H09 A;  4TZH A;  5GQR K;  3OGK B;  3M19 A;  4LSX A;  3ZYI A;  2WQX A;  2UZY A;  2A0Z A;  4QXE A;  3G3A A;  5AWD A;  2Z62 A;  4UFR A;  4FMZ A;  2WFH A;  1M0Z A;  1FT8 A;  3E4G A;  4U08 A;  2XWT C;  4R6F A;  3ZYO A;  4J4L A;  3OGL B;  1K5D C;  4C2A B;  4U06 A;  4Z94 G;  2WQW A;  2P1Q B;  3OGM B;  5HDH A;  3W3N A;  4KT1 A;  1A9N A;  2FT3 A;  1XCD A;  2V9S A;  4Q3G A;  4Z64 C;  4U7L A;  1XWD C;  4R6G A;  3W3M A;  1DCE A;  4L3A A;  4HQ1 A;  3W3J A;  2BNH A;  1M9L A;  2WQV A;  3WPG A;  4R08 A;  4RCW A;  1O6S A;  1U0N D;  4KNG A;  5IJC A;  2CA6 A;  3W3K A;  3VQ1 A;  1SQ0 B;  1M9S A;  2UZX A;  4EZG A;  2V70 A;  2O6S A;  4R6A A;  2ASS B;  3RW7 A;  1ZIW A;  4L3F A;  3RGX A;  1XEU A;  2AST B;  4R07 A;  2OMY A;  3C6P B;  1O6T A;  1OOK G;  2V9T B;  4ARR A;  4R5D A;  3GOZ A;  4PER A;  4CC4 A;  2P1O B;  5FTT B;  3CVR A;  3P72 A;  5GMG A;  3CIY A;  4LSC A;  2Z7X A;  5B0N A;  4WYK A;  5AZ5 A;  4BV4 R;  5HZL B;  4QBZ A;  4R6J A;  4XOS A;  3C6N B;  2P1P B;  1G9U A;  3VQ2 A;  3E6J A;  2P1M B;  1XEC A;  5IJD A;  3ZYN A;  4BSR A;  4P91 A;  2Z63 A;  2OMX A;  2JE1 A;  3G3B A;  3BZ5 A;  4V2E A;  4R09 A;  4Z61 C;  1M10 B;  1GWB A;  4NKH A;  2Z7X B;  1DFJ I;  1OZN A;  4PQ8 A;  1W8A A;  4LI2 A;  4CC4 C;  5LFN A;  3ULA A;  2R9U A;  3FXI A;  2Y5Q A;  2JE0 A;  4Z8G A;  1FO1 A;  3W3L A;  4XSQ A;  4U09 A;  4BSS A;  3ULU A;  2O6R A;  4FCG A;  3JB9 j;  5B0T A;  4FS7 A;  4MQW X;  4ECN A;  1OGQ A;  4AW4 A;  4CP6 A;  1H6T A;  2RR6 A;  3OJA A;  4QC0 A;  4J0M A;  1D0B A;  1KOO A;  2OMZ A;  4R0A A;  4OQT A; 
#chains in the Genus database with same CATH topology
 2OMV A;  4PKI G;  3ULV A;  3ZYJ A;  1WWL A;  2ID5 A;  5B4P A;  3WPI A;  3REZ A;  1Z7X W;  5IYX C;  4YEB B;  2Q4G W;  3RJ0 A;  2JQD A;  2BEX A;  4NKG A;  4CIL A;  4LI1 A;  3RIZ A;  3G04 C;  1LTX A;  3RFS A;  3UL9 A;  1P8T A;  3RW6 A;  1FS2 A;  1OTN A;  2WQU A;  4LXR A;  5GMF A;  4V2C A;  3OJA B;  4LSA A;  3A79 B;  5CMP A;  3WPF A;  4Y61 B;  3WPH A;  4V2D A;  4LXS A;  4XGO A;  1P9A G;  1IO0 A;  5AWB A;  1K5G C;  5CMN A;  3RFE A;  5AWC A;  4KXF B;  3O53 A;  4FD0 A;  1YRG A;  4RWT C;  5GS2 B;  2Z81 A;  4GLP A;  1KOH A;  4NZR M;  2OMT A;  3PMH G;  4R5C A;  3WPD A;  4CNC A;  4P8S A;  4FDW A;  1P8V A;  1DS9 A;  2Z66 A;  3RFJ A;  4C2B B;  2OMU A;  2XOT A;  4GT6 A;  4M7E A;  2RA8 A;  4G8A A;  3RGZ A;  4AY9 X;  3E3Z A;  5GMH A;  1O6V A;  1XKU A;  4NZT M;  5D3I A;  2O6Q A;  3G39 A;  4PSJ A;  3WPC A;  3E2J A;  3UL7 A;  3UN9 A;  3DZE A;  4R58 A;  1JL5 A;  3G06 A;  4B8C D;  4K17 A;  4LSX C;  2Z64 A;  4Q3I A;  3C6O B;  4I6J B;  4Q62 A;  4ARN A;  4ECO A;  2IFG A;  1PGV A;  1FQV A;  3UL8 A;  5A5C A;  1OTO A;  4FHO A;  3M18 A;  1H6U A;  3KJ4 A;  2ELL A;  3SB4 A;  4IM6 A;  4BSU A;  2Z65 A;  1A4Y A;  2OMW A;  5GS0 A;  3WPB A;  3WPE A;  4M7E C;  3O6N A;  4Z79 A;  5IJB A;  3CIG A;  3TSR E;  4CNM A;  4RCA B;  4WP6 A;  5AWA A;  3WN4 A;  1QYY A;  4PEQ B;  2Z82 A;  3W3G A;  1OTM A;  4MN8 B;  2P1N B;  4H09 A;  4TZH A;  5GQR K;  3OGK B;  3M19 A;  4LSX A;  3ZYI A;  2WQX A;  2UZY A;  2A0Z A;  4QXE A;  3G3A A;  5AWD A;  2Z62 A;  4UFR A;  4FMZ A;  2WFH A;  1M0Z A;  1FT8 A;  3E4G A;  4U08 A;  2XWT C;  4R6F A;  3ZYO A;  4J4L A;  3OGL B;  1K5D C;  4C2A B;  4U06 A;  4Z94 G;  2WQW A;  2P1Q B;  3OGM B;  5HDH A;  3W3N A;  4KT1 A;  1A9N A;  2FT3 A;  1XCD A;  2V9S A;  4Q3G A;  4Z64 C;  4U7L A;  1XWD C;  4R6G A;  3W3M A;  1DCE A;  4L3A A;  4HQ1 A;  3W3J A;  2BNH A;  1M9L A;  2WQV A;  3WPG A;  4R08 A;  4RCW A;  1O6S A;  1U0N D;  4KNG A;  5IJC A;  2CA6 A;  3W3K A;  3VQ1 A;  1SQ0 B;  1M9S A;  2UZX A;  4EZG A;  2V70 A;  2O6S A;  4R6A A;  2ASS B;  3RW7 A;  1ZIW A;  4L3F A;  3RGX A;  1XEU A;  2AST B;  4R07 A;  2OMY A;  3C6P B;  1O6T A;  1OOK G;  2V9T B;  4ARR A;  4R5D A;  3GOZ A;  4PER A;  4CC4 A;  2P1O B;  5FTT B;  3CVR A;  3P72 A;  5GMG A;  3CIY A;  4LSC A;  2Z7X A;  5B0N A;  4WYK A;  5AZ5 A;  4BV4 R;  5HZL B;  4QBZ A;  4R6J A;  4XOS A;  3C6N B;  2P1P B;  1G9U A;  3VQ2 A;  3E6J A;  2P1M B;  1XEC A;  5IJD A;  3ZYN A;  4BSR A;  4P91 A;  2Z63 A;  2OMX A;  2JE1 A;  3G3B A;  3BZ5 A;  4V2E A;  4R09 A;  4Z61 C;  1M10 B;  1GWB A;  4NKH A;  2Z7X B;  1DFJ I;  1OZN A;  4PQ8 A;  1W8A A;  4LI2 A;  4CC4 C;  5LFN A;  3ULA A;  2R9U A;  3FXI A;  2Y5Q A;  2JE0 A;  4Z8G A;  1FO1 A;  3W3L A;  4XSQ A;  4U09 A;  4BSS A;  3ULU A;  2O6R A;  4FCG A;  3JB9 j;  5B0T A;  4FS7 A;  4MQW X;  4ECN A;  1OGQ A;  4AW4 A;  4CP6 A;  1H6T A;  2RR6 A;  3OJA A;  4QC0 A;  4J0M A;  1D0B A;  1KOO A;  2OMZ A;  4R0A A;  4OQT A; 
#chains in the Genus database with same CATH homology
 2OMV A;  4PKI G;  3ULV A;  3ZYJ A;  1WWL A;  2ID5 A;  5B4P A;  3WPI A;  3REZ A;  1Z7X W;  5IYX C;  4YEB B;  2Q4G W;  3RJ0 A;  2JQD A;  2BEX A;  4NKG A;  4CIL A;  4LI1 A;  3RIZ A;  3G04 C;  1LTX A;  3RFS A;  3UL9 A;  1P8T A;  3RW6 A;  1FS2 A;  1OTN A;  2WQU A;  4LXR A;  5GMF A;  4V2C A;  3OJA B;  4LSA A;  3A79 B;  5CMP A;  3WPF A;  4Y61 B;  3WPH A;  4V2D A;  4LXS A;  4XGO A;  1P9A G;  1IO0 A;  5AWB A;  1K5G C;  5CMN A;  3RFE A;  5AWC A;  4KXF B;  3O53 A;  4FD0 A;  1YRG A;  4RWT C;  5GS2 B;  2Z81 A;  4GLP A;  1KOH A;  2OMT A;  3PMH G;  4R5C A;  3WPD A;  4CNC A;  4P8S A;  4FDW A;  1P8V A;  1DS9 A;  2Z66 A;  3RFJ A;  4C2B B;  2OMU A;  2XOT A;  4GT6 A;  4M7E A;  2RA8 A;  4G8A A;  3RGZ A;  4AY9 X;  3E3Z A;  5GMH A;  1O6V A;  1XKU A;  5D3I A;  2O6Q A;  3G39 A;  4PSJ A;  3WPC A;  3E2J A;  3UL7 A;  3UN9 A;  3DZE A;  4R58 A;  1JL5 A;  3G06 A;  4B8C D;  4K17 A;  4LSX C;  2Z64 A;  4Q3I A;  3C6O B;  4I6J B;  4Q62 A;  4ARN A;  4ECO A;  2IFG A;  1PGV A;  1FQV A;  3UL8 A;  5A5C A;  1OTO A;  4FHO A;  3M18 A;  1H6U A;  3KJ4 A;  2ELL A;  3SB4 A;  4IM6 A;  4BSU A;  2Z65 A;  1A4Y A;  2OMW A;  5GS0 A;  3WPB A;  3WPE A;  4M7E C;  3O6N A;  4Z79 A;  5IJB A;  3CIG A;  3TSR E;  4CNM A;  4RCA B;  4WP6 A;  5AWA A;  3WN4 A;  1QYY A;  4PEQ B;  2Z82 A;  3W3G A;  1OTM A;  4MN8 B;  2P1N B;  4H09 A;  4TZH A;  5GQR K;  3OGK B;  3M19 A;  4LSX A;  3ZYI A;  2WQX A;  2UZY A;  2A0Z A;  4QXE A;  3G3A A;  5AWD A;  2Z62 A;  4UFR A;  4FMZ A;  2WFH A;  1M0Z A;  1FT8 A;  3E4G A;  4U08 A;  2XWT C;  4R6F A;  3ZYO A;  4J4L A;  3OGL B;  1K5D C;  4C2A B;  4U06 A;  4Z94 G;  2WQW A;  2P1Q B;  3OGM B;  5HDH A;  3W3N A;  4KT1 A;  1A9N A;  2FT3 A;  1XCD A;  2V9S A;  4Q3G A;  4Z64 C;  4U7L A;  1XWD C;  4R6G A;  3W3M A;  1DCE A;  4L3A A;  4HQ1 A;  3W3J A;  2BNH A;  1M9L A;  2WQV A;  3WPG A;  4R08 A;  4RCW A;  1O6S A;  1U0N D;  4KNG A;  5IJC A;  2CA6 A;  3W3K A;  3VQ1 A;  1SQ0 B;  1M9S A;  2UZX A;  4EZG A;  2V70 A;  2O6S A;  4R6A A;  2ASS B;  3RW7 A;  1ZIW A;  4L3F A;  3RGX A;  1XEU A;  2AST B;  4R07 A;  2OMY A;  3C6P B;  1O6T A;  1OOK G;  2V9T B;  4ARR A;  4R5D A;  3GOZ A;  4PER A;  4CC4 A;  2P1O B;  5FTT B;  3CVR A;  3P72 A;  5GMG A;  3CIY A;  4LSC A;  2Z7X A;  5B0N A;  4WYK A;  5AZ5 A;  4BV4 R;  5HZL B;  4QBZ A;  4R6J A;  4XOS A;  3C6N B;  2P1P B;  1G9U A;  3VQ2 A;  3E6J A;  2P1M B;  1XEC A;  5IJD A;  3ZYN A;  4BSR A;  4P91 A;  2Z63 A;  2OMX A;  2JE1 A;  3G3B A;  3BZ5 A;  4V2E A;  4R09 A;  4Z61 C;  1M10 B;  1GWB A;  4NKH A;  2Z7X B;  1DFJ I;  1OZN A;  4PQ8 A;  1W8A A;  4LI2 A;  4CC4 C;  5LFN A;  3ULA A;  2R9U A;  3FXI A;  2Y5Q A;  2JE0 A;  4Z8G A;  1FO1 A;  3W3L A;  4XSQ A;  4U09 A;  4BSS A;  3ULU A;  2O6R A;  4FCG A;  3JB9 j;  5B0T A;  4FS7 A;  4MQW X;  4ECN A;  1OGQ A;  4AW4 A;  4CP6 A;  1H6T A;  2RR6 A;  3OJA A;  4QC0 A;  4J0M A;  1D0B A;  1KOO A;  2OMZ A;  4R0A A;  4OQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...