4U0HA

Crystal structure of m. tuberculosis clpp1p1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
180
structure length
178
Chain Sequence
LSLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis ClpP1P2 suggests a model for peptidase activation by AAA+ partner binding and substrate delivery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit 1
total genus 54
structure length 178
sequence length 180
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4u0hA00
4B3JA 4B3IA 4ZDCA 1SG4A 3QWDA 2F9IA 4GM2A 3QREA 5KJPA 1N6DA 4KNPA 1EF8A 4JFCA 3GF7A 4HC8A 4U0HA 1W2XA 4DI1A 1TG6A 3PEAA 3R9TA 1ON9A 4QIJA 3SWXA 3QKAA 3MFMA 4ZDFA 4WCZA 2J5IB 3KTKA 4U19A 3H02A 2F9YB 3PGQA 3QYRA 4Z0MA 3RSTA 2DEOA 4FN7A 5FUSA 5G1RA 5DU8A 5CTBA 2VSUA 5FIFA 3V5EA 1Y7OA 2FZSA 3R0OA 2NP9A 3T89A 1PJHA 3QXIA 4I42A 3VIVA 3QK8A 2F9YA 3R9QA 4JYLA 4NEKA 2ZL3A 2FBMA 5DTPA 4EMPA 1ON3A 2IEXA 2FW2A 3ZW9A 3V5IA 3H81A 1WDMA 5KDRB 4ELSA 2VSSE 3TT6A 1X0UA 4ZU2A 3TRRA 2GTRA 2EJ5A 1RJMA 3U9RB 3GF3A 5INGA 3HRXA 2ZL0A 3M6MA 5DZKA 3DORA 1UIYA 4I4ZA 4FNBA 1HNOA 4G2RA 1YG6A 5DUCA 2VREA 4ELWA 4Q0GA 2ZQRA 3ST9A 3PE8A 5C90A 1UYRA 4RYFH 4JCSA 4B3HA 3ZWBA 3TLFA 4ZDDA 4U18A 3IBBA 4KWBA 4JCQA 1N6FA 1VRGA 3KQFA 2PG8A 3M6NA 4MOUA 2ZQQA 2J5II 2A81A 2Q35A 3OMEA 4K29A 2A7SA 4EMMA 2PBPA 4KPKA 2X58A 4ASIA 1YG8A 2BZRA 4NNQA 2VX2A 4U0GH 5DUFA 4JCTA 3T3WA 4FB8A 3KTGA 1NZYB 3TDCA 3ZWAA 2Q34A 5C9GA 3ZW8A 4FN8A 4FJWD 3SLLA 3TV5A 3Q1TA 1OD4A 3NJBA 1DUBA 5IKLB 5DTWA 5JBWA 3T8BA 3DJAA 4KD6A 4I52A 4RYFA 5G1SA 1EF9A 3K8XA 1J7XA 3I47A 2CE3A 3QMJA 3OT6A 3H0QA 3QXZA 3TVWA 3Q0GA 4K2NA 1JXZA 2J5IA 4JSBA 3GLMA 4JOTA 3BPPA 4JWVA 3LKEA 3KTIA 4L6WA 2C8TA 1HZDA 4FZWC 1WDLA 2F9IB 3OC7A 2J5GA 1FCFA 3R6HA 3GMAA 4F47A 3KTJA 2X24A 3H0UA 5JBXA 1PIXA 4ZDEA 3MT6A 4MI2A 5DZKH 4JVTA 2VSUC 3FDUA 1Q52A 3HE2A 3JU1A 1UYVA 3Q7HA 2Q2XA 2CBYA 4OMRA 1RJNA 3STAA 3NJDA 4YLHA 4U0GA 1EY3A 3H0SA 4IZDA 3U9SB 3TZ3A 5CTCA 2W3PA 4FNDA 1FC6A 4WYOB 1FC7A 2J5SA 4RCNA 3PZKA 2VSUF 1XX4A 1HNUA 1WZ8A 1K39A 1K32A 3P85A 4JCRA 3L3SA 2VSSA 3T8AA 4WZ8B 3ZWCA 2UZFA 5DKPA 2F6QA 3HP0A 4LK5A 5INIA 1OD2A 4QIIA 2D3TA 4ZDBA 3N6RB 2ZL2A 2HW5A 3HINA 2DUBA 4ELXA 4K3WA 5KDRA 4Q1IA 1SZOA 1DCIA 1TYFA 1UYSA 5MGBA 1MJ3A 1Q51A 3K50A 1WDKA 3KTHA 4MXIA 4HNKA 2WTBA 4QFEA 4OLQA 1UYTA 3LAOA 1FC9A 2A7KA 3RSIA 1XNYA 3P5MA 2F6IA 3IAVA 1XO6A 5E0SH 3RRVA 5DL1A 3R9SA 3GKBA 4IZCA 4OG1A 1XNWA 4JJTA 4L8KA 5DU6A 3IB9A 5INFA 5G1QA 3T88A 4EMLA 3P2LA 4JYJA 3H0JA 5E0SA 3MOYA 2VSUE 3BEZA 2ZL4A 3WG5A 1XNVA 3Q0JA 5DU4A 3ISAA 4GHNA 1O8UA 4FZWA 3BF0A 2QQ3A 2VSSF 3FF6A 1NZYA 2PPYA 3TVUA 3G64A 4U1AA 5E0NX 3MYBA 3TT7A 3U9TB 4IZBA 3HLN1 2J5GD 1N6EA
chains in the Genus database with same CATH superfamily
4B3JA 4B3IA 4ZDCA 1SG4A 3QWDA 2F9IA 4GM2A 3QREA 5KJPA 1N6DA 4KNPA 1EF8A 4JFCA 3GF7A 4HC8A 4U0HA 1W2XA 4DI1A 1TG6A 3PEAA 3R9TA 1ON9A 4QIJA 3SWXA 3QKAA 3MFMA 4ZDFA 4WCZA 2J5IB 3KTKA 4U19A 3H02A 2F9YB 3PGQA 3QYRA 4Z0MA 3RSTA 2DEOA 4FN7A 5FUSA 5G1RA 5DU8A 5CTBA 2VSUA 5FIFA 3V5EA 1Y7OA 2FZSA 3R0OA 2NP9A 3T89A 1PJHA 3QXIA 4I42A 3VIVA 3QK8A 2F9YA 3R9QA 4JYLA 4NEKA 2ZL3A 2FBMA 5DTPA 4EMPA 1ON3A 2IEXA 2FW2A 3ZW9A 3V5IA 3H81A 1WDMA 5KDRB 4ELSA 2VSSE 3TT6A 1X0UA 4ZU2A 3TRRA 2GTRA 2EJ5A 1RJMA 3U9RB 3GF3A 5INGA 3HRXA 2ZL0A 3M6MA 5DZKA 3DORA 1UIYA 4I4ZA 4FNBA 1HNOA 4G2RA 1YG6A 3BPTA 5DUCA 2VREA 4ELWA 4Q0GA 2ZQRA 3ST9A 3PE8A 5C90A 1UYRA 4RYFH 4JCSA 4B3HA 3ZWBA 3TLFA 4ZDDA 4U18A 3IBBA 4KWBA 4JCQA 1N6FA 1VRGA 3KQFA 2PG8A 3M6NA 4MOUA 2ZQQA 2J5II 2A81A 2Q35A 3OMEA 4K29A 2A7SA 4EMMA 2PBPA 4KPKA 2X58A 4ASIA 1YG8A 2BZRA 4NNQA 4NARA 2VX2A 4U0GH 5DUFA 4JCTA 3T3WA 4FB8A 3KTGA 1NZYB 2YJGA 3TDCA 3ZWAA 2Q34A 5C9GA 3ZW8A 4FN8A 4FJWD 3SLLA 3TV5A 3Q1TA 1OD4A 3NJBA 1DUBA 5IKLB 5DTWA 5JBWA 4J2UA 3T8BA 3DJAA 4KD6A 4I52A 4RYFA 5G1SA 1EF9A 3K8XA 1J7XA 3I47A 2CE3A 3QMJA 3OT6A 3H0QA 3QXZA 3TVWA 3Q0GA 4K2NA 1JXZA 2J5IA 4JSBA 3GLMA 4JOTA 3BPPA 4JWVA 3LKEA 3KTIA 4L6WA 2C8TA 1HZDA 4FZWC 1WDLA 2F9IB 3OC7A 2J5GA 1FCFA 3R6HA 3GMAA 4F47A 3KTJA 2X24A 3H0UA 5JBXA 1PIXA 4ZDEA 3MT6A 4MI2A 5DZKH 4JVTA 2VSUC 3FDUA 1Q52A 3HE2A 3JU1A 1UYVA 3Q7HA 2Q2XA 2CBYA 4OMRA 1RJNA 3STAA 3NJDA 4YLHA 4U0GA 1EY3A 3H0SA 4IZDA 3U9SB 3TZ3A 5CTCA 2W3PA 4FNDA 1FC6A 4WYOB 1FC7A 2J5SA 4RCNA 3PZKA 2VSUF 1XX4A 1HNUA 1WZ8A 1K39A 1K32A 3P85A 4JCRA 3L3SA 4HDTA 2VSSA 3T8AA 4WZ8B 3ZWCA 2UZFA 5DKPA 2F6QA 3HP0A 4LK5A 5INIA 1OD2A 4QIIA 2D3TA 4ZDBA 3N6RB 2ZL2A 2HW5A 3HINA 2DUBA 4ELXA 4K3WA 5KDRA 4Q1IA 5HUQA 1SZOA 1DCIA 1TYFA 1UYSA 5MGBA 1MJ3A 1Q51A 3K50A 1WDKA 3KTHA 4MXIA 4HNKA 2WTBA 4QFEA 4OLQA 1UYTA 3LAOA 1FC9A 2A7KA 3RSIA 1XNYA 3P5MA 2F6IA 3IAVA 1XO6A 5E0SH 3RRVA 5DL1A 3R9SA 3GKBA 4IZCA 4OG1A 1XNWA 4JJTA 4L8KA 5DU6A 3IB9A 5INFA 5G1QA 3T88A 4EMLA 3P2LA 4JYJA 3H0JA 5E0SA 3MOYA 2VSUE 3BEZA 2ZL4A 3WG5A 1XNVA 3Q0JA 5DU4A 3ISAA 4GHNA 1O8UA 4FZWA 3BF0A 2QQ3A 2VSSF 3FF6A 1NZYA 2PPYA 3TVUA 3G64A 4U1AA 5E0NX 3MYBA 3TT7A 3U9TB 4IZBA 3HLN1 2J5GD 1N6EA
chains in the Genus database with same CATH topology
4B3JA 4B3IA 4ZDCA 1SG4A 3QWDA 2F9IA 4GM2A 3QREA 5KJPA 1N6DA 4KNPA 1EF8A 4JFCA 3GF7A 4HC8A 4U0HA 1W2XA 4DI1A 1TG6A 3PEAA 3R9TA 1ON9A 4QIJA 3SWXA 3QKAA 3MFMA 4ZDFA 4WCZA 2J5IB 3KTKA 4U19A 3H02A 2F9YB 3PGQA 3QYRA 4Z0MA 3RSTA 2DEOA 4FN7A 5FUSA 5G1RA 5DU8A 5CTBA 2VSUA 5FIFA 3V5EA 1Y7OA 2FZSA 3R0OA 2NP9A 3T89A 1PJHA 3QXIA 4I42A 3VIVA 3QK8A 2F9YA 3R9QA 4JYLA 4NEKA 2ZL3A 2FBMA 5DTPA 4EMPA 1ON3A 2IEXA 2FW2A 3ZW9A 3V5IA 3H81A 1WDMA 5KDRB 4ELSA 2VSSE 3TT6A 1X0UA 4ZU2A 3TRRA 2GTRA 2EJ5A 1RJMA 3U9RB 3GF3A 5INGA 3HRXA 2ZL0A 3M6MA 5DZKA 3DORA 1UIYA 4I4ZA 4FNBA 1HNOA 4G2RA 1YG6A 3BPTA 5DUCA 2VREA 4ELWA 4Q0GA 2ZQRA 3ST9A 3PE8A 5C90A 1UYRA 4RYFH 4JCSA 4B3HA 3ZWBA 3TLFA 4ZDDA 4U18A 3IBBA 4KWBA 4JCQA 1N6FA 1VRGA 3KQFA 2PG8A 3M6NA 4MOUA 2ZQQA 2J5II 2A81A 2Q35A 3OMEA 4K29A 2A7SA 4EMMA 2PBPA 4KPKA 2X58A 4ASIA 1YG8A 2BZRA 4NNQA 4NARA 2VX2A 4U0GH 5DUFA 4JCTA 3T3WA 4FB8A 3KTGA 1NZYB 2YJGA 3TDCA 3ZWAA 2Q34A 5C9GA 3ZW8A 4FN8A 4FJWD 3SLLA 3TV5A 3Q1TA 1OD4A 3NJBA 1DUBA 5IKLB 5DTWA 5JBWA 4J2UA 3T8BA 3DJAA 4KD6A 4I52A 4RYFA 5G1SA 1EF9A 3K8XA 1J7XA 3I47A 2CE3A 3QMJA 3OT6A 3H0QA 3QXZA 3TVWA 3Q0GA 4K2NA 1JXZA 2J5IA 4JSBA 3GLMA 4JOTA 3BPPA 4JWVA 3LKEA 3KTIA 4L6WA 2C8TA 1HZDA 4FZWC 1WDLA 2F9IB 3OC7A 2J5GA 1FCFA 3R6HA 3GMAA 4F47A 3KTJA 2X24A 3H0UA 5JBXA 1PIXA 4ZDEA 3MT6A 4MI2A 5DZKH 4JVTA 2VSUC 3FDUA 1Q52A 3HE2A 3JU1A 1UYVA 3Q7HA 2Q2XA 2CBYA 4OMRA 1RJNA 3STAA 3NJDA 4YLHA 4U0GA 1EY3A 3H0SA 4IZDA 3U9SB 3TZ3A 5CTCA 2W3PA 4FNDA 1FC6A 4WYOB 1FC7A 2J5SA 4RCNA 3PZKA 2VSUF 1XX4A 1HNUA 1WZ8A 1K39A 1K32A 3P85A 4JCRA 3L3SA 4HDTA 2VSSA 3T8AA 4WZ8B 3ZWCA 2UZFA 5DKPA 2F6QA 3HP0A 4LK5A 5INIA 1OD2A 4QIIA 2D3TA 4ZDBA 3N6RB 2ZL2A 2HW5A 3HINA 2DUBA 4ELXA 4K3WA 5KDRA 4Q1IA 5HUQA 1SZOA 1DCIA 1TYFA 1UYSA 5MGBA 1MJ3A 1Q51A 3K50A 1WDKA 3KTHA 4MXIA 4HNKA 2WTBA 4QFEA 4OLQA 1UYTA 3LAOA 1FC9A 2A7KA 3RSIA 1XNYA 3P5MA 2F6IA 3IAVA 1XO6A 5E0SH 3RRVA 5DL1A 3R9SA 3GKBA 4IZCA 4OG1A 1XNWA 4JJTA 4L8KA 5DU6A 3IB9A 5INFA 5G1QA 3T88A 4EMLA 3P2LA 4JYJA 3H0JA 5E0SA 3MOYA 2VSUE 3BEZA 2ZL4A 3WG5A 1XNVA 3Q0JA 5DU4A 3ISAA 4GHNA 1O8UA 4FZWA 3BF0A 2QQ3A 2VSSF 3FF6A 1NZYA 2PPYA 3TVUA 3G64A 4U1AA 5E0NX 3MYBA 3TT7A 3U9TB 4IZBA 3HLN1 2J5GD 1N6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3J A;  4B3I A;  4ZDC A;  1SG4 A;  3QWD A;  2F9I A;  4GM2 A;  3QRE A;  5KJP A;  1N6D A;  4KNP A;  1EF8 A;  4JFC A;  3GF7 A;  4HC8 A;  4U0H A;  1W2X A;  4DI1 A;  1TG6 A;  3PEA A;  3R9T A;  1ON9 A;  4QIJ A;  3SWX A;  3QKA A;  3MFM A;  4ZDF A;  4WCZ A;  2J5I B;  3KTK A;  4U19 A;  3H02 A;  2F9Y B;  3PGQ A;  3QYR A;  4Z0M A;  3RST A;  2DEO A;  4FN7 A;  5FUS A;  5G1R A;  5DU8 A;  5CTB A;  2VSU A;  5FIF A;  3V5E A;  1Y7O A;  2FZS A;  3R0O A;  2NP9 A;  3T89 A;  1PJH A;  3QXI A;  4I42 A;  3VIV A;  3QK8 A;  2F9Y A;  3R9Q A;  4JYL A;  4NEK A;  2ZL3 A;  2FBM A;  5DTP A;  4EMP A;  1ON3 A;  2IEX A;  2FW2 A;  3ZW9 A;  3V5I A;  3H81 A;  1WDM A;  5KDR B;  4ELS A;  2VSS E;  3TT6 A;  1X0U A;  4ZU2 A;  3TRR A;  2GTR A;  2EJ5 A;  1RJM A;  3U9R B;  3GF3 A;  5ING A;  3HRX A;  2ZL0 A;  3M6M A;  5DZK A;  3DOR A;  1UIY A;  4I4Z A;  4FNB A;  1HNO A;  4G2R A;  1YG6 A;  5DUC A;  2VRE A;  4ELW A;  4Q0G A;  2ZQR A;  3ST9 A;  3PE8 A;  5C90 A;  1UYR A;  4RYF H;  4JCS A;  4B3H A;  3ZWB A;  3TLF A;  4ZDD A;  4U18 A;  3IBB A;  4KWB A;  4JCQ A;  1N6F A;  1VRG A;  3KQF A;  2PG8 A;  3M6N A;  4MOU A;  2ZQQ A;  2J5I I;  2A81 A;  2Q35 A;  3OME A;  4K29 A;  2A7S A;  4EMM A;  2PBP A;  4KPK A;  2X58 A;  4ASI A;  1YG8 A;  2BZR A;  4NNQ A;  2VX2 A;  4U0G H;  5DUF A;  4JCT A;  3T3W A;  4FB8 A;  3KTG A;  1NZY B;  3TDC A;  3ZWA A;  2Q34 A;  5C9G A;  3ZW8 A;  4FN8 A;  4FJW D;  3SLL A;  3TV5 A;  3Q1T A;  1OD4 A;  3NJB A;  1DUB A;  5IKL B;  5DTW A;  5JBW A;  3T8B A;  3DJA A;  4KD6 A;  4I52 A;  4RYF A;  5G1S A;  1EF9 A;  3K8X A;  1J7X A;  3I47 A;  2CE3 A;  3QMJ A;  3OT6 A;  3H0Q A;  3QXZ A;  3TVW A;  3Q0G A;  4K2N A;  1JXZ A;  2J5I A;  4JSB A;  3GLM A;  4JOT A;  3BPP A;  4JWV A;  3LKE A;  3KTI A;  4L6W A;  2C8T A;  1HZD A;  4FZW C;  1WDL A;  2F9I B;  3OC7 A;  2J5G A;  1FCF A;  3R6H A;  3GMA A;  4F47 A;  3KTJ A;  2X24 A;  3H0U A;  5JBX A;  1PIX A;  4ZDE A;  3MT6 A;  4MI2 A;  5DZK H;  4JVT A;  2VSU C;  3FDU A;  1Q52 A;  3HE2 A;  3JU1 A;  1UYV A;  3Q7H A;  2Q2X A;  2CBY A;  4OMR A;  1RJN A;  3STA A;  3NJD A;  4YLH A;  4U0G A;  1EY3 A;  3H0S A;  4IZD A;  3U9S B;  3TZ3 A;  5CTC A;  2W3P A;  4FND A;  1FC6 A;  4WYO B;  1FC7 A;  2J5S A;  4RCN A;  3PZK A;  2VSU F;  1XX4 A;  1HNU A;  1WZ8 A;  1K39 A;  1K32 A;  3P85 A;  4JCR A;  3L3S A;  2VSS A;  3T8A A;  4WZ8 B;  3ZWC A;  2UZF A;  5DKP A;  2F6Q A;  3HP0 A;  4LK5 A;  5INI A;  1OD2 A;  4QII A;  2D3T A;  4ZDB A;  3N6R B;  2ZL2 A;  2HW5 A;  3HIN A;  2DUB A;  4ELX A;  4K3W A;  5KDR A;  4Q1I A;  1SZO A;  1DCI A;  1TYF A;  1UYS A;  5MGB A;  1MJ3 A;  1Q51 A;  3K50 A;  1WDK A;  3KTH A;  4MXI A;  4HNK A;  2WTB A;  4QFE A;  4OLQ A;  1UYT A;  3LAO A;  1FC9 A;  2A7K A;  3RSI A;  1XNY A;  3P5M A;  2F6I A;  3IAV A;  1XO6 A;  5E0S H;  3RRV A;  5DL1 A;  3R9S A;  3GKB A;  4IZC A;  4OG1 A;  1XNW A;  4JJT A;  4L8K A;  5DU6 A;  3IB9 A;  5INF A;  5G1Q A;  3T88 A;  4EML A;  3P2L A;  4JYJ A;  3H0J A;  5E0S A;  3MOY A;  2VSU E;  3BEZ A;  2ZL4 A;  3WG5 A;  1XNV A;  3Q0J A;  5DU4 A;  3ISA A;  4GHN A;  1O8U A;  4FZW A;  3BF0 A;  2QQ3 A;  2VSS F;  3FF6 A;  1NZY A;  2PPY A;  3TVU A;  3G64 A;  4U1A A;  5E0N X;  3MYB A;  3TT7 A;  3U9T B;  4IZB A;  3HLN 1;  2J5G D;  1N6E A; 
#chains in the Genus database with same CATH topology
 4B3J A;  4B3I A;  4ZDC A;  1SG4 A;  3QWD A;  2F9I A;  4GM2 A;  3QRE A;  5KJP A;  1N6D A;  4KNP A;  1EF8 A;  4JFC A;  3GF7 A;  4HC8 A;  4U0H A;  1W2X A;  4DI1 A;  1TG6 A;  3PEA A;  3R9T A;  1ON9 A;  4QIJ A;  3SWX A;  3QKA A;  3MFM A;  4ZDF A;  4WCZ A;  2J5I B;  3KTK A;  4U19 A;  3H02 A;  2F9Y B;  3PGQ A;  3QYR A;  4Z0M A;  3RST A;  2DEO A;  4FN7 A;  5FUS A;  5G1R A;  5DU8 A;  5CTB A;  2VSU A;  5FIF A;  3V5E A;  1Y7O A;  2FZS A;  3R0O A;  2NP9 A;  3T89 A;  1PJH A;  3QXI A;  4I42 A;  3VIV A;  3QK8 A;  2F9Y A;  3R9Q A;  4JYL A;  4NEK A;  2ZL3 A;  2FBM A;  5DTP A;  4EMP A;  1ON3 A;  2IEX A;  2FW2 A;  3ZW9 A;  3V5I A;  3H81 A;  1WDM A;  5KDR B;  4ELS A;  2VSS E;  3TT6 A;  1X0U A;  4ZU2 A;  3TRR A;  2GTR A;  2EJ5 A;  1RJM A;  3U9R B;  3GF3 A;  5ING A;  3HRX A;  2ZL0 A;  3M6M A;  5DZK A;  3DOR A;  1UIY A;  4I4Z A;  4FNB A;  1HNO A;  4G2R A;  1YG6 A;  3BPT A;  5DUC A;  2VRE A;  4ELW A;  4Q0G A;  2ZQR A;  3ST9 A;  3PE8 A;  5C90 A;  1UYR A;  4RYF H;  4JCS A;  4B3H A;  3ZWB A;  3TLF A;  4ZDD A;  4U18 A;  3IBB A;  4KWB A;  4JCQ A;  1N6F A;  1VRG A;  3KQF A;  2PG8 A;  3M6N A;  4MOU A;  2ZQQ A;  2J5I I;  2A81 A;  2Q35 A;  3OME A;  4K29 A;  2A7S A;  4EMM A;  2PBP A;  4KPK A;  2X58 A;  4ASI A;  1YG8 A;  2BZR A;  4NNQ A;  4NAR A;  2VX2 A;  4U0G H;  5DUF A;  4JCT A;  3T3W A;  4FB8 A;  3KTG A;  1NZY B;  2YJG A;  3TDC A;  3ZWA A;  2Q34 A;  5C9G A;  3ZW8 A;  4FN8 A;  4FJW D;  3SLL A;  3TV5 A;  3Q1T A;  1OD4 A;  3NJB A;  1DUB A;  5IKL B;  5DTW A;  5JBW A;  4J2U A;  3T8B A;  3DJA A;  4KD6 A;  4I52 A;  4RYF A;  5G1S A;  1EF9 A;  3K8X A;  1J7X A;  3I47 A;  2CE3 A;  3QMJ A;  3OT6 A;  3H0Q A;  3QXZ A;  3TVW A;  3Q0G A;  4K2N A;  1JXZ A;  2J5I A;  4JSB A;  3GLM A;  4JOT A;  3BPP A;  4JWV A;  3LKE A;  3KTI A;  4L6W A;  2C8T A;  1HZD A;  4FZW C;  1WDL A;  2F9I B;  3OC7 A;  2J5G A;  1FCF A;  3R6H A;  3GMA A;  4F47 A;  3KTJ A;  2X24 A;  3H0U A;  5JBX A;  1PIX A;  4ZDE A;  3MT6 A;  4MI2 A;  5DZK H;  4JVT A;  2VSU C;  3FDU A;  1Q52 A;  3HE2 A;  3JU1 A;  1UYV A;  3Q7H A;  2Q2X A;  2CBY A;  4OMR A;  1RJN A;  3STA A;  3NJD A;  4YLH A;  4U0G A;  1EY3 A;  3H0S A;  4IZD A;  3U9S B;  3TZ3 A;  5CTC A;  2W3P A;  4FND A;  1FC6 A;  4WYO B;  1FC7 A;  2J5S A;  4RCN A;  3PZK A;  2VSU F;  1XX4 A;  1HNU A;  1WZ8 A;  1K39 A;  1K32 A;  3P85 A;  4JCR A;  3L3S A;  4HDT A;  2VSS A;  3T8A A;  4WZ8 B;  3ZWC A;  2UZF A;  5DKP A;  2F6Q A;  3HP0 A;  4LK5 A;  5INI A;  1OD2 A;  4QII A;  2D3T A;  4ZDB A;  3N6R B;  2ZL2 A;  2HW5 A;  3HIN A;  2DUB A;  4ELX A;  4K3W A;  5KDR A;  4Q1I A;  5HUQ A;  1SZO A;  1DCI A;  1TYF A;  1UYS A;  5MGB A;  1MJ3 A;  1Q51 A;  3K50 A;  1WDK A;  3KTH A;  4MXI A;  4HNK A;  2WTB A;  4QFE A;  4OLQ A;  1UYT A;  3LAO A;  1FC9 A;  2A7K A;  3RSI A;  1XNY A;  3P5M A;  2F6I A;  3IAV A;  1XO6 A;  5E0S H;  3RRV A;  5DL1 A;  3R9S A;  3GKB A;  4IZC A;  4OG1 A;  1XNW A;  4JJT A;  4L8K A;  5DU6 A;  3IB9 A;  5INF A;  5G1Q A;  3T88 A;  4EML A;  3P2L A;  4JYJ A;  3H0J A;  5E0S A;  3MOY A;  2VSU E;  3BEZ A;  2ZL4 A;  3WG5 A;  1XNV A;  3Q0J A;  5DU4 A;  3ISA A;  4GHN A;  1O8U A;  4FZW A;  3BF0 A;  2QQ3 A;  2VSS F;  3FF6 A;  1NZY A;  2PPY A;  3TVU A;  3G64 A;  4U1A A;  5E0N X;  3MYB A;  3TT7 A;  3U9T B;  4IZB A;  3HLN 1;  2J5G D;  1N6E A; 
#chains in the Genus database with same CATH homology
 4B3J A;  4B3I A;  4ZDC A;  1SG4 A;  3QWD A;  2F9I A;  4GM2 A;  3QRE A;  5KJP A;  1N6D A;  4KNP A;  1EF8 A;  4JFC A;  3GF7 A;  4HC8 A;  4U0H A;  1W2X A;  4DI1 A;  1TG6 A;  3PEA A;  3R9T A;  1ON9 A;  4QIJ A;  3SWX A;  3QKA A;  3MFM A;  4ZDF A;  4WCZ A;  2J5I B;  3KTK A;  4U19 A;  3H02 A;  2F9Y B;  3PGQ A;  3QYR A;  4Z0M A;  3RST A;  2DEO A;  4FN7 A;  5FUS A;  5G1R A;  5DU8 A;  5CTB A;  2VSU A;  5FIF A;  3V5E A;  1Y7O A;  2FZS A;  3R0O A;  2NP9 A;  3T89 A;  1PJH A;  3QXI A;  4I42 A;  3VIV A;  3QK8 A;  2F9Y A;  3R9Q A;  4JYL A;  4NEK A;  2ZL3 A;  2FBM A;  5DTP A;  4EMP A;  1ON3 A;  2IEX A;  2FW2 A;  3ZW9 A;  3V5I A;  3H81 A;  1WDM A;  5KDR B;  4ELS A;  2VSS E;  3TT6 A;  1X0U A;  4ZU2 A;  3TRR A;  2GTR A;  2EJ5 A;  1RJM A;  3U9R B;  3GF3 A;  5ING A;  3HRX A;  2ZL0 A;  3M6M A;  5DZK A;  3DOR A;  1UIY A;  4I4Z A;  4FNB A;  1HNO A;  4G2R A;  1YG6 A;  3BPT A;  5DUC A;  2VRE A;  4ELW A;  4Q0G A;  2ZQR A;  3ST9 A;  3PE8 A;  5C90 A;  1UYR A;  4RYF H;  4JCS A;  4B3H A;  3ZWB A;  3TLF A;  4ZDD A;  4U18 A;  3IBB A;  4KWB A;  4JCQ A;  1N6F A;  1VRG A;  3KQF A;  2PG8 A;  3M6N A;  4MOU A;  2ZQQ A;  2J5I I;  2A81 A;  2Q35 A;  3OME A;  4K29 A;  2A7S A;  4EMM A;  2PBP A;  4KPK A;  2X58 A;  4ASI A;  1YG8 A;  2BZR A;  4NNQ A;  4NAR A;  2VX2 A;  4U0G H;  5DUF A;  4JCT A;  3T3W A;  4FB8 A;  3KTG A;  1NZY B;  2YJG A;  3TDC A;  3ZWA A;  2Q34 A;  5C9G A;  3ZW8 A;  4FN8 A;  4FJW D;  3SLL A;  3TV5 A;  3Q1T A;  1OD4 A;  3NJB A;  1DUB A;  5IKL B;  5DTW A;  5JBW A;  4J2U A;  3T8B A;  3DJA A;  4KD6 A;  4I52 A;  4RYF A;  5G1S A;  1EF9 A;  3K8X A;  1J7X A;  3I47 A;  2CE3 A;  3QMJ A;  3OT6 A;  3H0Q A;  3QXZ A;  3TVW A;  3Q0G A;  4K2N A;  1JXZ A;  2J5I A;  4JSB A;  3GLM A;  4JOT A;  3BPP A;  4JWV A;  3LKE A;  3KTI A;  4L6W A;  2C8T A;  1HZD A;  4FZW C;  1WDL A;  2F9I B;  3OC7 A;  2J5G A;  1FCF A;  3R6H A;  3GMA A;  4F47 A;  3KTJ A;  2X24 A;  3H0U A;  5JBX A;  1PIX A;  4ZDE A;  3MT6 A;  4MI2 A;  5DZK H;  4JVT A;  2VSU C;  3FDU A;  1Q52 A;  3HE2 A;  3JU1 A;  1UYV A;  3Q7H A;  2Q2X A;  2CBY A;  4OMR A;  1RJN A;  3STA A;  3NJD A;  4YLH A;  4U0G A;  1EY3 A;  3H0S A;  4IZD A;  3U9S B;  3TZ3 A;  5CTC A;  2W3P A;  4FND A;  1FC6 A;  4WYO B;  1FC7 A;  2J5S A;  4RCN A;  3PZK A;  2VSU F;  1XX4 A;  1HNU A;  1WZ8 A;  1K39 A;  1K32 A;  3P85 A;  4JCR A;  3L3S A;  4HDT A;  2VSS A;  3T8A A;  4WZ8 B;  3ZWC A;  2UZF A;  5DKP A;  2F6Q A;  3HP0 A;  4LK5 A;  5INI A;  1OD2 A;  4QII A;  2D3T A;  4ZDB A;  3N6R B;  2ZL2 A;  2HW5 A;  3HIN A;  2DUB A;  4ELX A;  4K3W A;  5KDR A;  4Q1I A;  5HUQ A;  1SZO A;  1DCI A;  1TYF A;  1UYS A;  5MGB A;  1MJ3 A;  1Q51 A;  3K50 A;  1WDK A;  3KTH A;  4MXI A;  4HNK A;  2WTB A;  4QFE A;  4OLQ A;  1UYT A;  3LAO A;  1FC9 A;  2A7K A;  3RSI A;  1XNY A;  3P5M A;  2F6I A;  3IAV A;  1XO6 A;  5E0S H;  3RRV A;  5DL1 A;  3R9S A;  3GKB A;  4IZC A;  4OG1 A;  1XNW A;  4JJT A;  4L8K A;  5DU6 A;  3IB9 A;  5INF A;  5G1Q A;  3T88 A;  4EML A;  3P2L A;  4JYJ A;  3H0J A;  5E0S A;  3MOY A;  2VSU E;  3BEZ A;  2ZL4 A;  3WG5 A;  1XNV A;  3Q0J A;  5DU4 A;  3ISA A;  4GHN A;  1O8U A;  4FZW A;  3BF0 A;  2QQ3 A;  2VSS F;  3FF6 A;  1NZY A;  2PPY A;  3TVU A;  3G64 A;  4U1A A;  5E0N X;  3MYB A;  3TT7 A;  3U9T B;  4IZB A;  3HLN 1;  2J5G D;  1N6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...