4U0SA

Structure of eukaryotic fic domain containing protein with adp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
326
structure length
323
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSINSALRRVMEETYYHHIYHTVAIGGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
total genus 127
structure length 323
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u0sA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u0sA01
2XPIA 4H7XA 3ESKA 5LCWC 3K9IA 4F3VA 4BT8A 2C2LA 4O6FA 5FZRA 3MKRA 4UI9C 3RO3A 4GPKA 3Q49B 4NPSA 5JFFA 4I9CA 3SF4A 2XGOA 4Y6WA 1HXIA 3FWVA 4LU4A 2L6JA 1HH8A 3LPZA 1ZU2A 3CKBA 4XIFA 5EKQD 2Q7FA 4WNDA 5ARFA 5M72A 3CVQA 3TAXA 2FO7A 4AY5A 1YA0A 1NA0A 3WXXA 2IFUA 4RG9A 1B89A 2WQHA 4ME2A 1E96B 3FP3A 4LEUA 2MHKA 3RIBA 4N39A 5HI7A 3CEQA 4AM9A 3ASGA 3S7FA 2HYZA 3ZN3A 5A6CA 4N3BA 1ZBPA 3S7JA 1KT1A 3OXLA 4X2DA 1KT0A 4J8DA 5AYWD 4APOA 3LETA 3CVNA 4CGWA 2R5SA 3CK9A 5CCMA 2VYIA 2ONDA 2KCKA 3MA5A 3AS5A 1WAO1 2VY3A 4U07A 2VGXB 3QOUA 4G24A 4I1AA 3SN9A 3RO2A 2Y4TA 3LY7A 5BT1A 5FT9A 2DBAA 3QKYA 3AS8A 4XI0A 1ELWA 5CKLA 4AIFA 3EDTB 3S7BA 3AS4A 3FFLA 5EX3A 2JK8A 2BUGA 3ZHEB 4EQFA 5D0OD 5BNWA 3ZCBA 3U4TA 2JLBA 4BTAA 3Q15A 4GA1A 1WM5A 2G03A 3RU0A 5JJ6A 3SZ7A 4AY6A 2VGYA 4JA9A 2WPVA 4UQXA 4B94A 4J8FA 3PE3A 4YVQC 3ZPJA 3ASHA 3UUXA 4J8EA 3ZLMA 3PE4A 5A7DB 4WNEA 5ARGA 3CUCA 4I17A 4WGJA 2LSUA 3KAEA 4YNDA 2FBNA 5KJKA 2KCVA 3QWVA 1ELRA 1IHGA 4H7YA 5G04J 4UQZA 4NQ0A 4N2QA 4IN3B 3GYZA 4N3CA 2XCBA 3KD7A 3Q4AB 4GZ6A 3LKUA 2PQRA 4X2EA 4GCOA 5CHEE 2LNIA 3S6AA 2C0LA 2YHCA 1P5QA 2HR2A 1Y8MA 5CGLA 3CK7A 3U3WA 2E2EA 4G2VA 1NZNA 4HOSA 3SHGA 1NA3A 3IEGA 4HORA 2KC7A 2VSNA 2XGSA 4CGVA 3ZC7A 2UY1B 1OUVA 3GZ1A 3TG5A 1FCHA 1KLXA 4M16A 5JJTA 5FJYA 3HYMB 3ZFWA 4WNGA 2Y4UA 4JA7A 2PQNA 5G05C 1W3BA 2V5FA 4U04A 4U0SA 2YQ8A 3ASDA 4JHRA 3QDNA 3N3UA 3N71A 3CV0A 1IYGA 4GZ3A 4XI8A 3SE5A 5DIZA 4XI9A 4GZ5A 4UQYA 3LY9A 3QWPA 4I9EA 4I2ZA 2UY1A 4WNFA 4JL0A 1HZ4A 3LYAA 3VTXA 4KBQA 3GZ2A 4BWRA 4N5CA 3PDNA 4HOTA 1PC2A 5EX0A 2F6SA 2PL2A 3UPVA 1XNFA 2AVPA 4X2CA 3CKCA 4GYWA 3CVPA 4UI9K 2C0MA 2UWJG 3MV2B 3JYSA 2GW1A 4N2SA 4BTBA 4KYOB 4GYOA 4J0UA 5JFZA 3QWWA 5G04C 3UQ3A 2VZAA 5KJLA 2KCLA 3OXGA 3OXFA 3R9AB 2XEVA 2XCCA 5FZQA 4U0UA 4HOQA 3ULQA 3Q5MA 4W9RA 4G23A 5JJ7A 3LY8A 5C1DA 4G1TA 3ZGQA 2HO1A 5LCWJ 2FEZA 2IF4A 5BW8C 5KJMA 3LCAA 3RJVA 4GA0A 4ABNA 3VTYA 3URZA 4YVOA 2I6HA 4GA2A 4RG6A 4N67A 2VSYA 5EU0A 3E4BA 4HOUA 3GW4A 5DBKA 2FF4A 4UI9J 2FI7A 2OOEA 4N3AA 5G05J 3MEKA 1QZ2A 3TGOA 4NRHB 4U0ZA 4G25A 4KXKB 2LSVA 4BT9A 3BEEA 5HQ8A 1A17A 4CDRA 2J9QA 5KJNA 1QQEA 1TJCA 4Y6CA 3TG4A 3Q47B 3RKVA 5CMTA 2VGXA 2PZIA 3CK8A 3O48A 4GYYA 4WUYA 4ITRA 3MV3B 4GCNA 4I2WA 3ASFA 3KS2A 2P58C 2VQ2A 3S7DA 2QFCA 2NC9A 3NF1A 5CCLA 3CVLA 5D0QD 2KATA 4G26A 5FTPA 4PY3A 4A1SA 3ZHEA 2XGMA 5FZSA
chains in the Genus database with same CATH superfamily
1OWNA 3G2TA 3ZYKA 3MKQA 4H7XA 1TNYA 3FH7A 5CRVA 2WVIA 2H6IA 3L6AA 3BUAA 2NYJA 1BLXB 4C0EA 3I4RB 4DUIA 2Y0BG 4EZKA 4GPKA 3RRNB 1D8EA 5J90A 5ENPD 4I43A 4KVMA 1ZB1A 2XGOA 3Q78A 5T4YA 2WXLA 3VLEA 1IXVA 3FWVA 4ANWA 3QAQA 2H6GA 1RW2A 4XIFA 2Q7FA 3B7TA 4WNDA 5ARFA 4ANVA 5M72A 3EUVA 1N4SA 2WXGA 4FHKA 2AXZA 4G8KA 3O4ZA 4U8YD 3WXXA 4RG9A 1B89A 2R02A 2KZTA 1NL4A 1E96B 2MHKA 5HI7A 1TJFA 2QYUA 1U3CA 2ETBA 3DPYA 3S7FA 4KZ0A 4I1OB 4A3VA 3PZ2A 1NH1A 4N3BA 1ZBPA 3D9OA 1V55E 3FU5A 5KNHD 1KT1A 5LFAA 4X2DA 4HXIA 1KT0A 3JUEA 3QK0A 2R5SA 5E76A 3PUJA 2VYIA 4ILHB 3MA5A 2A5EA 3DRAA 2VY3A 1BI7B 2Y3AA 5CBOA 3QOUA 1TNZA 2L0IA 3RO2A 1SVXA 3FUDA 4FLBA 3HDXA 2P9UG 5BT1A 2A5UA 4R7LA 3NZUA 2CFUA 3V30A 3EU9A 4XI0A 3FFLA 4NIKA 3FH8A 2JK8A 4GTTA 3D9HA 2DIWA 3SGHA 3FUFA 3FUKA 1OCCE 4BTAA 4GTRA 3Q15A 4A1GA 3CHOA 5ENRD 3SZ7A 4AY6A 3UMVA 4B0ZA 2VGYA 5FQ7A 2WPVA 2F8YA 3FY4A 4UQXA 3GZSA 3PEUB 4O1OA 3FUJA 4IULA 1KZOA 3ZLMA 4AOFA 2OCCE 1A5EA 4MRUA 2L9BA 3UKRG 2P2CP 2OEWA 4WGJA 3APDA 4K5AB 2JABA 1V54E 3UINC 1RZ4A 4KT6B 3CGHA 2KCVA 1ELRA 3KSLA 3LEWA 3NOCD 4GTVA 2XPYA 4U8VD 3T8MA 2J49A 4TV3A 2OVFA 2IU1A 2XRYA 3D9MA 4JXTA 4OYSA 1OCRE 3KEZA 4D10C 1O5MA 2XCBA 1UW4B 1FPPA 4EHMA 5D2MC 3DXMG 2PQRA 4GCOA 3ABKE 2C0LA 3UI2A 1WY6A 3U64A 5B1AE 4UWHA 1K8KG 1Y8MA 1N94A 3LS8A 2RD0A 3SHGA 1NA3A 2XQ0A 1NFIE 2UY1B 3GZ1A 1KLXA 4M16A 5JJTA 2F0YA 1TR4A 5AIJA 2V8SE 3T5XA 3B7UX 4JA7A 1NP7A 2PQNA 4U04A 2BF0X 4JHRA 2I2OA 2QY7A 3CV0A 3C72A 3VLDA 4GZ3A 4XI8A 1OXJA 3J5QB 2P9NG 2WXMA 4GMRA 3LY9A 4I2ZA 5AAOA 3T8KA 4FP7A 1HZ4A 3LYAA 1N4RA 4HLLA 3S2AA 3Q7AA 3GZ2A 3FHEA 1OWPA 4CYMD 3L82A 1D8DA 1YCSB 4N5CA 3PDNA 4EPZA 4UWFA 1Z3YA 2PL2A 2IO3C 2AVPA 2C0MA 3NBNB 4BTBA 4J0UA 3FU3A 3TWUA 2VZAA 2R2LA 4C0MA 3B7BA 4UWKA 1DC2A 3VLFA 1S70B 1MX6A 2XCCA 4FC8A 3KSQA 3JXJA 2WB2A 1H2TC 3W9GA 3TWTA 1TN8A 4FLHA 2LXMA 3HRAA 4BY6A 5JJ7A 3FUMA 4ACKA 2AWIA 5CRUA 3CIAA 2FEZA 1N11A 3AJIA 2VTBB 5BW8C 3V2XA 5HRYA 2E0IA 2ZGGA 2ETAA 3VTYA 3R9MA 2V4HC 4GA2A 4B8CB 5EU0A 3UT8A 3DEPA 3GW4A 4LG6A 4ZFHA 4L9PA 2FF4A 4UI9J 1N0QA 2RFAA 3I4GA 3PZ4A 3MGBA 2XPZA 3HG0D 3HVEA 1S0PA 3ONLA 1HG2A 3FTSA 3C3OA 2VTBA 1X5BA 1JUQA 4HFGA 2WXNA 4DX7D 4AJWA 2XHEA 4C48B 3ULYA 1AWCB 4CDRA 2J9QA 4CDNA 2DVWA 4DPRA 3ONKA 3ML8A 2AXUA 2VGXA 1G3NB 3ZU7B 2PZIA 2F8XK 3HVEB 2IOLA 1H19A 3CVYA 1UJKA 1MZCA 3NAWA 4CT4A 4GTPA 4NACA 3ASFA 4ILGA 5T8IA 3KS2A 2P58C 2WXHA 1D9SA 2NC9A 1E8WA 3B7RL 3CVLA 2KATA 2IONA 4V3IA 3ZHEA 2XGMA 5FZSA 4Q94A 2LAIA 2XPIA 2EIKE 2GROB 2CFZA 2WXPA 3TWSA 5FZRA 2LXLA 1S64A 3RO3A 3Q49B 4L1BA 4PUCA 2ZU6B 4XX5A 3MYVA 1N54A 5JFFA 4BSXA 3SF4A 4AVXA 1HXIA 4LU4A 2L6JA 1WDYA 3CKBA 1L5JA 5EKQD 5FWQA 3TAXA 4Z68A 2WQ6A 1AP7A 2IFUA 1DCQA 3SQVA 2IQCA 3PZDA 3UM2A 4XEIG 2WMOA 1IHBA 3ESLA 3CEQA 2X3MA 3ZN3A 5A6CA 1TNBA 3S7JA 2WXRA 2OVBA 2J4DA 4DX5D 3B7SA 4MS6A 3LETA 3CVWA 2KXPC 4CGWA 5CCMA 2IY0C 2ONDA 1H2VC 4GAAA 1WAO1 4LERA 4U07A 3FU0A 4AEZC 4F6RD 4J7WA 2P9LG 3SN9A 2ZIRA 4K5BA 3APFA 2XRZA 3AS8A 3C5RA 4U8HA 1ELWA 4YDEA 1HG5A 3HXDA 3G2UA 3MJWA 3CVXA 2BUGA 5EYPF 2BTDA 4GTOA 1O1SA 3FTWA 4EQFA 4I6JA 5BNWA 3BG1B 3U4TA 4GTQA 3SFXA 4EBAA 3LDZA 1DCEA 4GA1A 2ZXWE 2I1JA 3FU6A 4JA9A 4JEHA 1UN9A 1HF8A 3PE3A 2GRNB 3ZPJA 5CMWA 4LSZE 2QC9A 3PE4A 2BKGA 2V4LA 3CUCA 1IKND 3ZRHA 1ELKA 3U66A 3IKOB 4NQ0A 3NZSA 3ZW3A 1BI8B 3IBEA 5CEAA 4IN3B 3GYZA 3KD7A 3PS6A 3ISMC 4GZ6A 5EYLA 5CHEE 4F7AA 2LNIA 2RKKA 2XZTG 4LNBA 4YDOA 2HR2A 1NI1A 5CGLA 4I6EA 3U3WA 4DX1A 2E2EA 4BEPA 1NZNA 3IEGA 4HORA 5FQ8A 2VSNA 4CGVA 3ZC7A 3ZXPA 3E37A 3MCXA 5IY5E 1HO8A 4DX2A 4KMOA 1SA5A 2Y4UA 4HI9A 5JA4D 2V5FA 3CHPA 3JQ0A 4HRLA 4U0SA 2YQ8A 3ASDA 3QDNA 3V31A 5FQ6A 2V0PA 4TXQA 3N71A 3TWRA 1IQRA 4GZDA 4U63A 3L08A 3SE5A 5DIZA 4U96D 4UQYA 2DYSE 3QWPA 4I9EA 4A3TA 3EHNA 5BXOA 2IO2C 4KBQA 3FUNA 3I5PA 3SFYA 4DK5A 4J6IA 5ENQD 3G2SA 4GB9A 3D9NA 4BWRA 1TYQG 5ENOD 3UPVA 1E7UA 3CKCA 4GYWA 3EIJA 1KPSB 3MV2B 1EDUA 3LVQE 3L22A 4KYOB 4PH4B 3D9KA 3RRMB 4EZJA 2VSOE 2Y69E 5KNGA 3DSSA 3OXFA 4JPSA 5CECB 3UX4A 1Z5SC 2R59A 4U95D 3EU5A 2ZGDA 1FVFA 1O1RA 1OCOE 2VGEA 3Q5MA 3DSWA 3ULQA 4W9RA 3IHVA 3FTUA 2H6HA 3CQGB 5J08A 4Q69A 5C1DA 4G1TA 3SBTB 5LCWJ 1UG3A 1HS6A 2IF4A 3AAAC 5KJMA 2JEKA 3URZA 2GGFA 3ZYQA 5LP0A 1N0RA 2XEHA 4ATZD 3FTZA 4YVOA 4ACLA 2DZNA 4RG6A 4N67A 2VSYA 4TUMA 1O1TA 3APCA 4NURA 1BU9A 3L13A 1QZ2A 1LD8A 1TN7A 1Q2ZA 3UT4A 5FINA 4OVVA 1TNOA 4ZHBA 3W9FA 3P1UA 4L2LA 3AG2E 2LSVA 3TWVA 1N4QA 2IJGX 5CEDB 5HQ8A 3HIZA 2L6BA 4K0RA 2GRMA 5KJNA 1QQEA 1TJCA 2X6KA 2AJAA 4Y6CA 3ZYLA 3D9PA 3G2VA 3AG3E 3SBSA 3ZKJA 4ITRA 4HVBA 1S63A 2A4ZA 4CZ2D 5G2NA 4GTMA 3NF1A 2WXJA 1E8ZA 3HXFA 3C3QA 3CLJA 3MZLB 1WG0A 2CG2A 4CEMA 2J09A 2XZDG 3K9IA 1UN8A 4BT8A 4CCAA 4P29A 3Q75A 4O6FA 1LF8A 3MKRA 4UI9C 2AXVA 1PAQA 2MOWA 2XENA 4JHKA 3DEOA 5B3SE 2PM6A 5FQ4A 4I9CA 3NB2A 1E90A 2YINA 1U3DA 4BERA 4JW1A 3TWXA 1E8XA 4GU5A 2ILRA 5JMND 3UKUG 1YYHA 3CHSA 3Q73A 5B1BE 4FHJA 4BSZB 3CVQA 3HXCA 4AY5A 1YA0A 1QNFA 4AV7A 2WQHA 3DBSA 2MRIA 3FP3A 4B93B 2J08A 2FULA 2NSZA 4AM9A 1UOHA 2HYZA 3L54A 3JCKC 4I6GA 3SNXA 5AQ9A 4J8DA 5AYWD 3FUIA 3V79K 4APOA 3I3NA 3BG0B 2LO6A 4BFRA 2KCKA 5ENNA 4J8YA 2KZTB 5G55A 2VGXB 4G24A 4I1AA 4HB5A 4FULA 2P9PG 2Y4TA 1HE8A 3LY7A 4HLEA 4IYPA 1H6PA 4DLOA 5AN8A 3D9JA 4AXHA 5FT9A 5EN5D 3AG4E 5CKLA 4AIFA 3EDTB 3RK6A 1SZ9A 3SI5A 1TEZA 2B6CA 1Z6TA 3ZHEB 2IOSA 4GMLA 3MX3A 1U2VG 2JLBA 1WM5A 3RU0A 3EHRA 2H6FA 3FTXA 5JJ6A 5E75A 3E34A 4TXPA 4B94A 4YVQC 3ENEA 1SQMA 5AJLA 3CQCB 5A7DB 3ZIMA 3IHYA 1OWOA 2M63A 4I17A 4J8SA 3KEAA 4O1PA 4X8QA 2NUDA 3KAEA 2F37A 4YNDA 2J8SD 3F6QA 5KJKA 2QYJA 3AU5A 4CRWA 1H6KA 4H7YA 5G04J 1JPLA 4XKCA 4FJYA 3FH5A 5CBNA 3IXEA 4N3CA 1E7VA 3RSEG 4DI4A 3ZUVB 3ABLE 1OWMA 3CHQA 3Q4AB 3ABME 4X2EA 3SO8A 1P5QA 2LAHA 1E8YA 2YNQA 2MYOA 4EZLA 3CK7A 2PM7A 4G2VA 3L9TA 3QARA 4HOSA 2KC7A 3FUHA 2XGSA 1MHQA 5AENA 3V2OA 2DCPA 2WXIA 3TG5A 1FCHA 4RVBA 4WWPA 2P9SG 3PVLA 3HYMB 3ZFWA 4WNGA 2WM9A 5G05C 3SD5A 1BPOA 1W3BA 4HBDA 5JHBA 4F1PA 3N3UA 2WXFA 1H0AA 2CHWA 4QQIA 1FVHA 2L0TB 1IYGA 1K1AA 3IV0A 5FIOA 3PREA 4XI9A 2EQXA 3D3MA 3OAWA 3PZ1A 2UY1A 1EPUA 4WNFA 3VTXA 2PNNA 4I1MA 4LNGA 3G2WA 3TXNA 3PUKA 3UIOC 5EX0A 2F6SA 2RFMA 1XNFA 2IEJA 4X2CA 3CR3A 1JCQA 3ASNE 3CHRA 2UWJG 2Y1LE 4PS8A 3CSTA 2BEDA 1INZA 4E6HA 4LRZA 1TNUA 1MX2A 2B0OE 4GYOA 3CHMA 5JFZA 5G04C 5C2YA 2AW6A 5KJLA 2KCLA 5EDSA 2R03A 2ETCA 1YMPA 1MQSA 4APFA 2FO1E 5BV1A 2XEVA 2OEVA 4HRMB 3DWLG 5H7PA 5ENTD 4CDMA 3TXMA 3TWQA 4HOQA 4C9BB 5CERB 5CMYA 2EIME 4WWOA 3RAUA 3ZGQA 4JB8P 3E33A 3EJNA 5BUZA 2P9KG 5KWDA 4GA0A 3T9KA 4BETA 2I6HA 3UXGA 4HOUA 5EILA 2EIJE 5DBKA 4B8AA 3E30A 2FI7A 4M3OA 2OOEA 3ASOE 4N3AA 5G05J 3MEKA 2KM4A 3LXUX 4DRXE 1K1BA 4G11A 2OV8A 2EINE 5T3RA 4G25A 4BX8A 1DVPA 2X6IA 4KXKB 2NXPA 1TN6A 4BT9A 3BEEA 3HHMA 4HQDA 1H6OA 5AQ7A 2VSXE 2VJ8A 3Q47B 1N95A 3FUEA 3D9LA 4YDWA 4XE0A 3O48A 4WUYA 3MV3B 4JEUA 4GCNA 4IRUA 4I2WA 2WXOA 3S7DA 3OTNA 2CHZA 3SY2A 4HS2A 3X2QE 4A55A 2QFCA 1MYOA 3ML9A 3HXBA 4G26A 5FTPA 4PY3A 5KBAA 2KBXA 2CHXA 4BX9A 4HI8A 3ESKA 5LCWC 4B89A 4F3VA 4O60A 2C2LA 3FDHA 4DI3A 3UIPC 4JVSA 2I1KA 3DSUA 3PRZA 3UT7A 2BKKB 2DWZA 4FJZA 3EIQC 2J07A 1DNPA 4NPSA 2CG3A 1UJJA 3AU4A 1SW6A 1FT1A 4Y6WA 5BPPA 1X81A 4UUCA 1HH8A 3LPZA 1ZU2A 4LUNU 3Q79A 3FTYA 3Q7FA 3NOGD 4QFVA 2GRRB 2FO7A 1NA0A 1MJ0A 4FADA 3ZEFA 4ME2A 4LEUA 4OVUA 3RIBA 4N39A 4ANUA 5BV0A 3TL5A 5EIBE 2WQ7A 5ITZF 3ASGA 5A23A 5AQAA 3OXLA 5ANLA 4HNAD 3CVNA 4M7CA 3CK9A 3WG7E 3CSFA 5ENSD 4G8LA 3AS5A 1K3ZD 2XEEA 3QC1A 3B95A 2WXQA 3LJNA 3UM0A 2RG8A 3TWWA 3BU8A 1SA4A 1N4PA 3CVUA 2DBAA 3QKYA 4DX6D 3S7BA 3PZ3A 3AS4A 3PH0C 5EX3A 1VDYA 4EBAG 1LTXA 4FU3A 2XS1A 5HS0A 5D0OD 4TRQA 2DYRE 3MKQB 3ZCBA 3T5VA 3QJZA 4TUUA 2NUNA 2G03A 3R7RA 4HRNA 4J8FA 3ASHA 3UUXA 4J8EA 4LCTA 4GTSA 4L23A 4WNEA 5ARGA 3ULEG 4WWNA 3DPDA 3Q9NC 1OY3D 1QYMA 4AP2A 4OAUC 4JZYA 3AG1E 1QBQA 2LSUA 2X6HA 2X6JA 4ILIA 2FBNA 3NQPA 1KZPA 3QWVA 2XS8A 2GRLA 1IHGA 4JC8A 3D9IA 4UQZA 1MX4A 4PS7A 3DSXA 3FEXA 4GPMA 4L7TA 4N2QA 1JCRA 3TJPA 5KCMA 4LNUD 5EIDA 3LKUA 4TXRA 1OWLA 3S6AA 1N52A 1LD7A 2YHCA 3CVVA 3P2BA 3JUIA 4EECA 3QB2A 2GRQB 1HFAA 3RRUA 1JWGA 3EHMA 2GRPB 3PEVB 1OUVA 2I9CA 2R17C 3HXEA 5FJYA 2HE0A 4PS3A 4RLYA 3C98A 1HX8A 3ZYMA 2WXKA 3B13A 1SZAA 4K5CA 4GZ5A 3L16A 4JL0A 3FULA 3U9WA 4WAFA 2EILE 4HOTA 4E85A 1IQUA 4UWGA 1PC2A 4KVOA 3E32A 3CVPA 4UI9K 1JWFA 4DLQA 3JYSA 2GW1A 4N2SA 4JHJA 2P9IG 4MKTA 2YHEA 3Q9UC 2R05A 4FA6A 3ZVVA 3QWWA 3UQ3A 4A63B 4BESA 2LUHA 3OXGA 3DSVA 5ANRA 3R9AB 3PNTB 2X38A 3J5PA 4MLPA 5FZQA 4ANXA 5D66A 3UTMA 1H2UA 4U0UA 1GW6A 4GZCA 3SHFA 1EF1C 4L2YA 4G23A 5AJDA 4YDYA 3LY8A 4PDXA 2HO1A 2QZAA 4Q96A 3BQOA 3UM3A 4XKBA 1HU3A 3L17A 2X6FA 3LCAA 3FEYA 3RJVA 1EYHA 4ABNA 4KZCA 5AQBA 4ATGA 3LVRE 3R7QA 1BD8A 4F1SA 3E4BA 2ZISA 1Z3XA 4U7EB 4F53A 3ZNGA 4RSYA 3QNKA 4UWLA 4GMJA 3C3RA 5BXUA 3TGOA 3DSTA 4NRHB 1OT8A 3JXIA 1JCSA 4U0ZA 1FT2A 3PNLB 5LX8A 3LJ3A 5HKPA 1N9AA 1A17A 4URKA 4K03A 4RQIA 4OAVB 4JD2G 1Y6IA 1OCZE 3SFZA 5LOZA 3TG4A 3UM1A 3RKVA 5CMTA 4XZ4A 4N5QA 3CK8A 4GYYA 2WMNA 4DJAA 2DZOA 5JHAA 3DXKG 3FTVA 2HM8A 2VQ2A 4CT0A 3JQ1A 2V5QC 5AARA 4MBGA 5CCLA 5D0QD 4A1SA 1PY1A 3EHQA 3ZXSA 1XGWA 2J4BA
chains in the Genus database with same CATH topology
1OWNA 4Q94A 3G2TA 4BX9A 2LAIA 2XPIA 3ESKA 3MKQA 4H7XA 3ZYKA 5LCWC 4B89A 3K9IA 1UN8A 4F3VA 3FH7A 4BT8A 4CCAA 2C2LA 4P29A 2WVIA 3FDHA 3L6AA 4DI3A 4JVSA 2CFZA 2I1KA 3PRZA 2WXPA 4O6FA 1LF8A 5FZRA 3UT7A 4C0EA 3MKRA 3I4RB 4UI9C 2AXVA 1PAQA 2MOWA 3EIQC 4FJZA 2J07A 3RO3A 4EZKA 1DNPA 4GPKA 3RRNB 3Q49B 4JHKA 4NPSA 4L1BA 5J90A 2CG3A 4PUCA 4I43A 4KVMA 2ZU6B 1UJJA 3AU4A 4XX5A 3MYVA 1N54A 2PM6A 5JFFA 5FQ4A 4BSXA 4I9CA 3SF4A 1E90A 2YINA 2XGOA 4AVXA 1U3DA 4Y6WA 5T4YA 2WXLA 5BPPA 1HXIA 4JW1A 3VLEA 3FWVA 1E8XA 4ANWA 4GU5A 2ILRA 4LU4A 2L6JA 3QAQA 1HH8A 3LPZA 1ZU2A 3CKBA 4LUNU 3CHSA 1L5JA 4XIFA 3FTYA 5EKQD 2Q7FA 3B7TA 4WNDA 4FHJA 5ARFA 4ANVA 5M72A 3CVQA 5FWQA 3TAXA 4QFVA 2WXGA 4FHKA 2FO7A 4AY5A 2AXZA 3O4ZA 1YA0A 1NA0A 2WQ6A 1QNFA 3WXXA 2IFUA 4FADA 4RG9A 4AV7A 3ZEFA 1B89A 2IQCA 3PZDA 2WQHA 2KZTA 3DBSA 2MRIA 4ME2A 2WMOA 1E96B 3FP3A 3ESLA 4LEUA 4OVUA 2MHKA 3RIBA 4N39A 2J08A 1TJFA 5HI7A 4ANUA 3CEQA 5BV0A 2FULA 2NSZA 3TL5A 1U3CA 4AM9A 2WQ7A 3ASGA 3S7FA 2HYZA 4KZ0A 3L54A 2X3MA 4I1OB 4A3VA 3JCKC 3ZN3A 5A6CA 4N3BA 5A23A 1ZBPA 3D9OA 3FU5A 3S7JA 1KT1A 3OXLA 4I6GA 5LFAA 3SNXA 5ANLA 4X2DA 4HXIA 1KT0A 4J8DA 5AYWD 2WXRA 3FUIA 2OVBA 2J4DA 3B7SA 4MS6A 4APOA 3LETA 3QK0A 3CVWA 3CVNA 4CGWA 3I3NA 3BG0B 2R5SA 3CK9A 5CCMA 5E76A 3PUJA 2VYIA 2LO6A 4ILHB 4BFRA 2ONDA 2KCKA 3CSFA 1H2VC 3MA5A 5ENNA 4GAAA 3AS5A 2KZTB 1WAO1 3QC1A 2VY3A 4LERA 5G55A 2Y3AA 4U07A 3FU0A 2VGXB 4AEZC 3QOUA 4G24A 2WXQA 4I1AA 3SN9A 2L0IA 4FULA 3RO2A 3FUDA 2Y4TA 3HDXA 4FLBA 1HE8A 3APFA 3LY7A 4HLEA 5BT1A 4IYPA 2A5UA 2RG8A 4R7LA 4DLOA 3D9JA 3NZUA 3CVUA 4AXHA 5FT9A 2XRZA 2CFUA 2DBAA 3QKYA 3AS8A 4U8HA 4XI0A 1ELWA 5CKLA 4AIFA 3EDTB 3S7BA 3AS4A 3RK6A 3PH0C 1HG5A 3FFLA 5EX3A 1VDYA 1SZ9A 3G2UA 3MJWA 3RRUA 3FH8A 3SI5A 4EBAG 3CVXA 1TEZA 2JK8A 2BUGA 4FU3A 1Z6TA 2BTDA 3ZHEB 3FTWA 2IOSA 4EQFA 4GMLA 5D0OD 2DIWA 4TRQA 3MX3A 4I6JA 3MKQB 5BNWA 3BG1B 3SGHA 3ZCBA 3FUFA 3FUKA 3U4TA 3T5VA 3QJZA 2JLBA 4EBAA 4TUUA 4BTAA 3LDZA 3Q15A 4GA1A 4A1GA 3CHOA 1WM5A 2G03A 3R7RA 3RU0A 2I1JA 3FTXA 3FU6A 5JJ6A 3SZ7A 4AY6A 5E75A 3UMVA 4B0ZA 2VGYA 4JA9A 5FQ7A 2WPVA 4JEHA 1UN9A 3FY4A 4UQXA 1HF8A 4B94A 3GZSA 4J8FA 3PEUB 3PE3A 4YVQC 3FUJA 3ZPJA 3ASHA 5CMWA 4IULA 4HORA 3ENEA 3UUXA 4J8EA 3ZLMA 4AOFA 4LCTA 3PE4A 4L23A 1SQMA 5AJLA 3CQCB 5A7DB 4WNEA 4MRUA 5ARGA 3ZIMA 2L9BA 3IHYA 2V4LA 4WWNA 3CUCA 1OWOA 2M63A 3DPDA 4I17A 4WGJA 3APDA 4J8SA 4AP2A 4JZYA 3ZRHA 1ELKA 2LSUA 2X6HA 3KAEA 4YNDA 4KT6B 2X6JA 3U66A 3CGHA 4ILIA 2FBNA 5KJKA 3NQPA 2KCVA 3QWVA 1ELRA 2GRLA 3LEWA 3AU5A 1IHGA 4JC8A 1H6KA 4H7YA 3D9IA 5G04J 4CRWA 4UQZA 2XPYA 3IKOB 3T8MA 1JPLA 2J49A 4NQ0A 4PS7A 4TV3A 3NZSA 4XKCA 3ZW3A 3FEXA 3FH5A 4FJYA 2OVFA 2IU1A 3IBEA 4L7TA 2XRYA 3D9MA 4N2QA 4JXTA 4OYSA 4IN3B 3KEZA 3GYZA 4N3CA 4D10C 2XCBA 1E7VA 3KD7A 4DI4A 3TJPA 1UW4B 3PS6A 5KCMA 1OWMA 3CHQA 3Q4AB 4GZ6A 3LKUA 2PQRA 4X2EA 1OWLA 4GCOA 5CHEE 4F7AA 2LNIA 3S6AA 2C0LA 1WY6A 3U64A 1N52A 2YHCA 1P5QA 4UWHA 2HR2A 2LAHA 3CVVA 1Y8MA 1E8YA 3P2BA 5CGLA 2YNQA 3JUIA 3LS8A 4EECA 3CK7A 4I6EA 4EZLA 3U3WA 2E2EA 2RD0A 2PM7A 3QB2A 4G2VA 1NZNA 3QARA 4HOSA 1HFAA 3SHGA 1NA3A 3IEGA 1JWGA 2XQ0A 2KC7A 2VSNA 3FUHA 2XGSA 3EHMA 1MHQA 5FQ8A 3ZC7A 4CGVA 5AENA 3PEVB 2UY1B 1OUVA 2DCPA 2WXIA 3GZ1A 2I9CA 1FCHA 1KLXA 3MCXA 2R17C 4RVBA 4M16A 3TG5A 5JJTA 4WWPA 5FJYA 1HO8A 3PVLA 3HYMB 5AIJA 2V8SE 3ZFWA 3T5XA 4PS3A 4KMOA 3B7UX 4WNGA 3C98A 2Y4UA 2WM9A 4JA7A 1NP7A 2PQNA 1HX8A 5G05C 3SD5A 1BPOA 1W3BA 2WXKA 3ZYMA 2V5FA 4U04A 3CHPA 3JQ0A 3B13A 5JHBA 4U0SA 2YQ8A 2BF0X 3ASDA 4JHRA 3QDNA 2I2OA 5FQ6A 3N3UA 2QY7A 2V0PA 2WXFA 3N71A 1H0AA 2CHWA 1IQRA 3CV0A 4GZDA 1FVHA 1SZAA 2L0TB 3VLDA 1IYGA 4U63A 4GZ3A 3IV0A 4XI8A 3L08A 3SE5A 2WXMA 5DIZA 3PREA 4XI9A 2EQXA 4GZ5A 4UQYA 3D3MA 3LY9A 3QWPA 4I9EA 4I2ZA 3L16A 3OAWA 2UY1A 1EPUA 4A3TA 4WNFA 4JL0A 4FP7A 1HZ4A 3FULA 3EHNA 3LYAA 3VTXA 4KBQA 3U9WA 3FUNA 3S2AA 3I5PA 3GZ2A 4WAFA 4DK5A 4I1MA 4J6IA 3FHEA 1OWPA 3G2SA 4GB9A 3G2WA 3D9NA 4BWRA 4N5CA 3PDNA 3TXNA 4HOTA 3PUKA 4E85A 1IQUA 4UWFA 4EPZA 4UWGA 1Z3YA 1PC2A 4KVOA 5EX0A 2F6SA 2PL2A 3UPVA 1XNFA 2AVPA 4X2CA 1E7UA 3CKCA 3CR3A 4GYWA 3CVPA 4UI9K 3CHRA 1JWFA 3EIJA 4DLQA 2C0MA 2UWJG 4PS8A 3CSTA 3MV2B 3JYSA 1INZA 2GW1A 1EDUA 3LVQE 4E6HA 4N2SA 4JHJA 4LRZA 4MKTA 3L22A 4BTBA 2YHEA 4KYOB 4FA6A 4GYOA 4PH4B 4J0UA 3D9KA 3CHMA 3ZVVA 5JFZA 3FU3A 3RRMB 3QWWA 5G04C 3UQ3A 2VZAA 4EZJA 4C0MA 2VSOE 4UWKA 5C2YA 2AW6A 5KJLA 3VLFA 2KCLA 3OXGA 5EDSA 3OXFA 4JPSA 5ANRA 3R9AB 3PNTB 1MQSA 2X38A 3UX4A 4APFA 5BV1A 2XEVA 2R59A 2XCCA 4MLPA 4FC8A 5FZQA 4ANXA 2WB2A 4CDMA 1H2TC 1FVFA 3TXMA 1H2UA 4U0UA 4FLHA 1GW6A 4HOQA 4BY6A 4GZCA 3Q5MA 3ULQA 4C9BB 3SHFA 4W9RA 1EF1C 3IHVA 4L2YA 3FTUA 5CMYA 4G23A 5AJDA 5JJ7A 3FUMA 3CQGB 3LY8A 5J08A 4ACKA 4Q69A 5C1DA 2AWIA 4G1TA 4PDXA 4WWOA 3SBTB 2HO1A 3ZGQA 3CIAA 5LCWJ 1UG3A 1HS6A 2FEZA 4Q96A 3EJNA 2VTBB 4XKBA 5BUZA 2IF4A 1HU3A 3L17A 5BW8C 5KJMA 2E0IA 2X6FA 3LCAA 3FEYA 3RJVA 1EYHA 4GA0A 4ABNA 2JEKA 4KZCA 3URZA 3VTYA 4ATGA 2GGFA 3ZYQA 5LP0A 3LVRE 4YVOA 4ACLA 3FTZA 2I6HA 3R7QA 4GA2A 4RG6A 4N67A 2VSYA 4F1SA 4B8CB 5EU0A 3UT8A 3E4BA 4HOUA 4F53A 1Z3XA 3GW4A 5DBKA 2FF4A 4UI9J 4B8AA 3APCA 4NURA 4RSYA 2FI7A 3QNKA 2OOEA 4M3OA 4N3AA 5G05J 3I4GA 4UWLA 4GMJA 3MGBA 2XPZA 3L13A 3MEKA 3HVEA 1S0PA 3ONLA 2KM4A 1HG2A 3FTSA 3LXUX 1QZ2A 3TGOA 3UT4A 2VTBA 4G11A 2OV8A 4NRHB 4OVVA 1X5BA 5T3RA 1JUQA 4HFGA 4U0ZA 2WXNA 3PNLB 4G25A 3LJ3A 5LX8A 4AJWA 3P1UA 2XHEA 4BX8A 4L2LA 1DVPA 2X6IA 4KXKB 2LSVA 2NXPA 2IJGX 4BT9A 3BEEA 3HHMA 1A17A 3HIZA 4CDRA 4URKA 5HQ8A 4K0RA 2GRMA 4K03A 2J9QA 5KJNA 1QQEA 3SFZA 1Y6IA 4CDNA 1TJCA 2X6KA 4Y6CA 2VSXE 5LOZA 3ZYLA 2VJ8A 3TG4A 4DPRA 3D9PA 3ONKA 3Q47B 3G2VA 3SBSA 3ML8A 3FUEA 5CMTA 3D9LA 3RKVA 2AXUA 2VGXA 4XZ4A 2PZIA 3CK8A 4XE0A 3HVEB 3O48A 4GYYA 2WMNA 2IOLA 4ITRA 4WUYA 4DJAA 1H19A 3MV3B 4JEUA 5JHAA 1UJKA 4GCNA 4IRUA 4I2WA 3CVYA 2WXOA 4HVBA 4CT4A 2A4ZA 4NACA 3ASFA 4ILGA 5T8IA 3FTVA 3KS2A 2HM8A 2P58C 2VQ2A 2CHZA 3OTNA 3S7DA 4CT0A 4HS2A 5G2NA 3JQ1A 4A55A 2WXHA 2QFCA 2NC9A 1E8WA 2WXJA 1E8ZA 3NF1A 3ML9A 3B7RL 5CCLA 3CVLA 5D0QD 2KATA 2IONA 4G26A 3CLJA 3MZLB 5FTPA 4PY3A 2CG2A 1PY1A 4A1SA 4V3IA 4CEMA 2J09A 3ZXSA 3ZHEA 2XGMA 1XGWA 5FZSA 2J4BA 2CHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPI A;  4H7X A;  3ESK A;  5LCW C;  3K9I A;  4F3V A;  4BT8 A;  2C2L A;  4O6F A;  5FZR A;  3MKR A;  4UI9 C;  3RO3 A;  4GPK A;  3Q49 B;  4NPS A;  5JFF A;  4I9C A;  3SF4 A;  2XGO A;  4Y6W A;  1HXI A;  3FWV A;  4LU4 A;  2L6J A;  1HH8 A;  3LPZ A;  1ZU2 A;  3CKB A;  4XIF A;  5EKQ D;  2Q7F A;  4WND A;  5ARF A;  5M72 A;  3CVQ A;  3TAX A;  2FO7 A;  4AY5 A;  1YA0 A;  1NA0 A;  3WXX A;  2IFU A;  4RG9 A;  1B89 A;  2WQH A;  4ME2 A;  1E96 B;  3FP3 A;  4LEU A;  2MHK A;  3RIB A;  4N39 A;  5HI7 A;  3CEQ A;  4AM9 A;  3ASG A;  3S7F A;  2HYZ A;  3ZN3 A;  5A6C A;  4N3B A;  1ZBP A;  3S7J A;  1KT1 A;  3OXL A;  4X2D A;  1KT0 A;  4J8D A;  5AYW D;  4APO A;  3LET A;  3CVN A;  4CGW A;  2R5S A;  3CK9 A;  5CCM A;  2VYI A;  2OND A;  2KCK A;  3MA5 A;  3AS5 A;  1WAO 1;  2VY3 A;  4U07 A;  2VGX B;  3QOU A;  4G24 A;  4I1A A;  3SN9 A;  3RO2 A;  2Y4T A;  3LY7 A;  5BT1 A;  5FT9 A;  2DBA A;  3QKY A;  3AS8 A;  4XI0 A;  1ELW A;  5CKL A;  4AIF A;  3EDT B;  3S7B A;  3AS4 A;  3FFL A;  5EX3 A;  2JK8 A;  2BUG A;  3ZHE B;  4EQF A;  5D0O D;  5BNW A;  3ZCB A;  3U4T A;  2JLB A;  4BTA A;  3Q15 A;  4GA1 A;  1WM5 A;  2G03 A;  3RU0 A;  5JJ6 A;  3SZ7 A;  4AY6 A;  2VGY A;  4JA9 A;  2WPV A;  4UQX A;  4B94 A;  4J8F A;  3PE3 A;  4YVQ C;  3ZPJ A;  3ASH A;  3UUX A;  4J8E A;  3ZLM A;  3PE4 A;  5A7D B;  4WNE A;  5ARG A;  3CUC A;  4I17 A;  4WGJ A;  2LSU A;  3KAE A;  4YND A;  2FBN A;  5KJK A;  2KCV A;  3QWV A;  1ELR A;  1IHG A;  4H7Y A;  5G04 J;  4UQZ A;  4NQ0 A;  4N2Q A;  4IN3 B;  3GYZ A;  4N3C A;  2XCB A;  3KD7 A;  3Q4A B;  4GZ6 A;  3LKU A;  2PQR A;  4X2E A;  4GCO A;  5CHE E;  2LNI A;  3S6A A;  2C0L A;  2YHC A;  1P5Q A;  2HR2 A;  1Y8M A;  5CGL A;  3CK7 A;  3U3W A;  2E2E A;  4G2V A;  1NZN A;  4HOS A;  3SHG A;  1NA3 A;  3IEG A;  4HOR A;  2KC7 A;  2VSN A;  2XGS A;  4CGV A;  3ZC7 A;  2UY1 B;  1OUV A;  3GZ1 A;  3TG5 A;  1FCH A;  1KLX A;  4M16 A;  5JJT A;  5FJY A;  3HYM B;  3ZFW A;  4WNG A;  2Y4U A;  4JA7 A;  2PQN A;  5G05 C;  1W3B A;  2V5F A;  4U04 A;  4U0S A;  2YQ8 A;  3ASD A;  4JHR A;  3QDN A;  3N3U A;  3N71 A;  3CV0 A;  1IYG A;  4GZ3 A;  4XI8 A;  3SE5 A;  5DIZ A;  4XI9 A;  4GZ5 A;  4UQY A;  3LY9 A;  3QWP A;  4I9E A;  4I2Z A;  2UY1 A;  4WNF A;  4JL0 A;  1HZ4 A;  3LYA A;  3VTX A;  4KBQ A;  3GZ2 A;  4BWR A;  4N5C A;  3PDN A;  4HOT A;  1PC2 A;  5EX0 A;  2F6S A;  2PL2 A;  3UPV A;  1XNF A;  2AVP A;  4X2C A;  3CKC A;  4GYW A;  3CVP A;  4UI9 K;  2C0M A;  2UWJ G;  3MV2 B;  3JYS A;  2GW1 A;  4N2S A;  4BTB A;  4KYO B;  4GYO A;  4J0U A;  5JFZ A;  3QWW A;  5G04 C;  3UQ3 A;  2VZA A;  5KJL A;  2KCL A;  3OXG A;  3OXF A;  3R9A B;  2XEV A;  2XCC A;  5FZQ A;  4U0U A;  4HOQ A;  3ULQ A;  3Q5M A;  4W9R A;  4G23 A;  5JJ7 A;  3LY8 A;  5C1D A;  4G1T A;  3ZGQ A;  2HO1 A;  5LCW J;  2FEZ A;  2IF4 A;  5BW8 C;  5KJM A;  3LCA A;  3RJV A;  4GA0 A;  4ABN A;  3VTY A;  3URZ A;  4YVO A;  2I6H A;  4GA2 A;  4RG6 A;  4N67 A;  2VSY A;  5EU0 A;  3E4B A;  4HOU A;  3GW4 A;  5DBK A;  2FF4 A;  4UI9 J;  2FI7 A;  2OOE A;  4N3A A;  5G05 J;  3MEK A;  1QZ2 A;  3TGO A;  4NRH B;  4U0Z A;  4G25 A;  4KXK B;  2LSV A;  4BT9 A;  3BEE A;  5HQ8 A;  1A17 A;  4CDR A;  2J9Q A;  5KJN A;  1QQE A;  1TJC A;  4Y6C A;  3TG4 A;  3Q47 B;  3RKV A;  5CMT A;  2VGX A;  2PZI A;  3CK8 A;  3O48 A;  4GYY A;  4WUY A;  4ITR A;  3MV3 B;  4GCN A;  4I2W A;  3ASF A;  3KS2 A;  2P58 C;  2VQ2 A;  3S7D A;  2QFC A;  2NC9 A;  3NF1 A;  5CCL A;  3CVL A;  5D0Q D;  2KAT A;  4G26 A;  5FTP A;  4PY3 A;  4A1S A;  3ZHE A;  2XGM A;  5FZS A; 
#chains in the Genus database with same CATH topology
 1OWN A;  3G2T A;  3ZYK A;  3MKQ A;  4H7X A;  1TNY A;  3FH7 A;  5CRV A;  2WVI A;  2H6I A;  3L6A A;  3BUA A;  2NYJ A;  1BLX B;  4C0E A;  3I4R B;  4DUI A;  2Y0B G;  4EZK A;  4GPK A;  3RRN B;  1D8E A;  5J90 A;  5ENP D;  4I43 A;  4KVM A;  1ZB1 A;  2XGO A;  3Q78 A;  5T4Y A;  2WXL A;  3VLE A;  1IXV A;  3FWV A;  4ANW A;  3QAQ A;  2H6G A;  1RW2 A;  4XIF A;  2Q7F A;  3B7T A;  4WND A;  5ARF A;  4ANV A;  5M72 A;  3EUV A;  1N4S A;  2WXG A;  4FHK A;  2AXZ A;  4G8K A;  3O4Z A;  4U8Y D;  3WXX A;  4RG9 A;  1B89 A;  2R02 A;  2KZT A;  1NL4 A;  1E96 B;  2MHK A;  5HI7 A;  1TJF A;  2QYU A;  1U3C A;  2ETB A;  3DPY A;  3S7F A;  4KZ0 A;  4I1O B;  4A3V A;  3PZ2 A;  1NH1 A;  4N3B A;  1ZBP A;  3D9O A;  1V55 E;  3FU5 A;  5KNH D;  1KT1 A;  5LFA A;  4X2D A;  4HXI A;  1KT0 A;  3JUE A;  3QK0 A;  2R5S A;  5E76 A;  3PUJ A;  2VYI A;  4ILH B;  3MA5 A;  2A5E A;  3DRA A;  2VY3 A;  1BI7 B;  2Y3A A;  5CBO A;  3QOU A;  1TNZ A;  2L0I A;  3RO2 A;  1SVX A;  3FUD A;  4FLB A;  3HDX A;  2P9U G;  5BT1 A;  2A5U A;  4R7L A;  3NZU A;  2CFU A;  3V30 A;  3EU9 A;  4XI0 A;  3FFL A;  4NIK A;  3FH8 A;  2JK8 A;  4GTT A;  3D9H A;  2DIW A;  3SGH A;  3FUF A;  3FUK A;  1OCC E;  4BTA A;  4GTR A;  3Q15 A;  4A1G A;  3CHO A;  5ENR D;  3SZ7 A;  4AY6 A;  3UMV A;  4B0Z A;  2VGY A;  5FQ7 A;  2WPV A;  2F8Y A;  3FY4 A;  4UQX A;  3GZS A;  3PEU B;  4O1O A;  3FUJ A;  4IUL A;  1KZO A;  3ZLM A;  4AOF A;  2OCC E;  1A5E A;  4MRU A;  2L9B A;  3UKR G;  2P2C P;  2OEW A;  4WGJ A;  3APD A;  4K5A B;  2JAB A;  1V54 E;  3UIN C;  1RZ4 A;  4KT6 B;  3CGH A;  2KCV A;  1ELR A;  3KSL A;  3LEW A;  3NOC D;  4GTV A;  2XPY A;  4U8V D;  3T8M A;  2J49 A;  4TV3 A;  2OVF A;  2IU1 A;  2XRY A;  3D9M A;  4JXT A;  4OYS A;  1OCR E;  3KEZ A;  4D10 C;  1O5M A;  2XCB A;  1UW4 B;  1FPP A;  4EHM A;  5D2M C;  3DXM G;  2PQR A;  4GCO A;  3ABK E;  2C0L A;  3UI2 A;  1WY6 A;  3U64 A;  5B1A E;  4UWH A;  1K8K G;  1Y8M A;  1N94 A;  3LS8 A;  2RD0 A;  3SHG A;  1NA3 A;  2XQ0 A;  1NFI E;  2UY1 B;  3GZ1 A;  1KLX A;  4M16 A;  5JJT A;  2F0Y A;  1TR4 A;  5AIJ A;  2V8S E;  3T5X A;  3B7U X;  4JA7 A;  1NP7 A;  2PQN A;  4U04 A;  2BF0 X;  4JHR A;  2I2O A;  2QY7 A;  3CV0 A;  3C72 A;  3VLD A;  4GZ3 A;  4XI8 A;  1OXJ A;  3J5Q B;  2P9N G;  2WXM A;  4GMR A;  3LY9 A;  4I2Z A;  5AAO A;  3T8K A;  4FP7 A;  1HZ4 A;  3LYA A;  1N4R A;  4HLL A;  3S2A A;  3Q7A A;  3GZ2 A;  3FHE A;  1OWP A;  4CYM D;  3L82 A;  1D8D A;  1YCS B;  4N5C A;  3PDN A;  4EPZ A;  4UWF A;  1Z3Y A;  2PL2 A;  2IO3 C;  2AVP A;  2C0M A;  3NBN B;  4BTB A;  4J0U A;  3FU3 A;  3TWU A;  2VZA A;  2R2L A;  4C0M A;  3B7B A;  4UWK A;  1DC2 A;  3VLF A;  1S70 B;  1MX6 A;  2XCC A;  4FC8 A;  3KSQ A;  3JXJ A;  2WB2 A;  1H2T C;  3W9G A;  3TWT A;  1TN8 A;  4FLH A;  2LXM A;  3HRA A;  4BY6 A;  5JJ7 A;  3FUM A;  4ACK A;  2AWI A;  5CRU A;  3CIA A;  2FEZ A;  1N11 A;  3AJI A;  2VTB B;  5BW8 C;  3V2X A;  5HRY A;  2E0I A;  2ZGG A;  2ETA A;  3VTY A;  3R9M A;  2V4H C;  4GA2 A;  4B8C B;  5EU0 A;  3UT8 A;  3DEP A;  3GW4 A;  4LG6 A;  4ZFH A;  4L9P A;  2FF4 A;  4UI9 J;  1N0Q A;  2RFA A;  3I4G A;  3PZ4 A;  3MGB A;  2XPZ A;  3HG0 D;  3HVE A;  1S0P A;  3ONL A;  1HG2 A;  3FTS A;  3C3O A;  2VTB A;  1X5B A;  1JUQ A;  4HFG A;  2WXN A;  4DX7 D;  4AJW A;  2XHE A;  4C48 B;  3ULY A;  1AWC B;  4CDR A;  2J9Q A;  4CDN A;  2DVW A;  4DPR A;  3ONK A;  3ML8 A;  2AXU A;  2VGX A;  1G3N B;  3ZU7 B;  2PZI A;  2F8X K;  3HVE B;  2IOL A;  1H19 A;  3CVY A;  1UJK A;  1MZC A;  3NAW A;  4CT4 A;  4GTP A;  4NAC A;  3ASF A;  4ILG A;  5T8I A;  3KS2 A;  2P58 C;  2WXH A;  1D9S A;  2NC9 A;  1E8W A;  3B7R L;  3CVL A;  2KAT A;  2ION A;  4V3I A;  3ZHE A;  2XGM A;  5FZS A;  4Q94 A;  2LAI A;  2XPI A;  2EIK E;  2GRO B;  2CFZ A;  2WXP A;  3TWS A;  5FZR A;  2LXL A;  1S64 A;  3RO3 A;  3Q49 B;  4L1B A;  4PUC A;  2ZU6 B;  4XX5 A;  3MYV A;  1N54 A;  5JFF A;  4BSX A;  3SF4 A;  4AVX A;  1HXI A;  4LU4 A;  2L6J A;  1WDY A;  3CKB A;  1L5J A;  5EKQ D;  5FWQ A;  3TAX A;  4Z68 A;  2WQ6 A;  1AP7 A;  2IFU A;  1DCQ A;  3SQV A;  2IQC A;  3PZD A;  3UM2 A;  4XEI G;  2WMO A;  1IHB A;  3ESL A;  3CEQ A;  2X3M A;  3ZN3 A;  5A6C A;  1TNB A;  3S7J A;  2WXR A;  2OVB A;  2J4D A;  4DX5 D;  3B7S A;  4MS6 A;  3LET A;  3CVW A;  2KXP C;  4CGW A;  5CCM A;  2IY0 C;  2OND A;  1H2V C;  4GAA A;  1WAO 1;  4LER A;  4U07 A;  3FU0 A;  4AEZ C;  4F6R D;  4J7W A;  2P9L G;  3SN9 A;  2ZIR A;  4K5B A;  3APF A;  2XRZ A;  3AS8 A;  3C5R A;  4U8H A;  1ELW A;  4YDE A;  1HG5 A;  3HXD A;  3G2U A;  3MJW A;  3CVX A;  2BUG A;  5EYP F;  2BTD A;  4GTO A;  1O1S A;  3FTW A;  4EQF A;  4I6J A;  5BNW A;  3BG1 B;  3U4T A;  4GTQ A;  3SFX A;  4EBA A;  3LDZ A;  1DCE A;  4GA1 A;  2ZXW E;  2I1J A;  3FU6 A;  4JA9 A;  4JEH A;  1UN9 A;  1HF8 A;  3PE3 A;  2GRN B;  3ZPJ A;  5CMW A;  4LSZ E;  2QC9 A;  3PE4 A;  2BKG A;  2V4L A;  3CUC A;  1IKN D;  3ZRH A;  1ELK A;  3U66 A;  3IKO B;  4NQ0 A;  3NZS A;  3ZW3 A;  1BI8 B;  3IBE A;  5CEA A;  4IN3 B;  3GYZ A;  3KD7 A;  3PS6 A;  3ISM C;  4GZ6 A;  5EYL A;  5CHE E;  4F7A A;  2LNI A;  2RKK A;  2XZT G;  4LNB A;  4YDO A;  2HR2 A;  1NI1 A;  5CGL A;  4I6E A;  3U3W A;  4DX1 A;  2E2E A;  4BEP A;  1NZN A;  3IEG A;  4HOR A;  5FQ8 A;  2VSN A;  4CGV A;  3ZC7 A;  3ZXP A;  3E37 A;  3MCX A;  5IY5 E;  1HO8 A;  4DX2 A;  4KMO A;  1SA5 A;  2Y4U A;  4HI9 A;  5JA4 D;  2V5F A;  3CHP A;  3JQ0 A;  4HRL A;  4U0S A;  2YQ8 A;  3ASD A;  3QDN A;  3V31 A;  5FQ6 A;  2V0P A;  4TXQ A;  3N71 A;  3TWR A;  1IQR A;  4GZD A;  4U63 A;  3L08 A;  3SE5 A;  5DIZ A;  4U96 D;  4UQY A;  2DYS E;  3QWP A;  4I9E A;  4A3T A;  3EHN A;  5BXO A;  2IO2 C;  4KBQ A;  3FUN A;  3I5P A;  3SFY A;  4DK5 A;  4J6I A;  5ENQ D;  3G2S A;  4GB9 A;  3D9N A;  4BWR A;  1TYQ G;  5ENO D;  3UPV A;  1E7U A;  3CKC A;  4GYW A;  3EIJ A;  1KPS B;  3MV2 B;  1EDU A;  3LVQ E;  3L22 A;  4KYO B;  4PH4 B;  3D9K A;  3RRM B;  4EZJ A;  2VSO E;  2Y69 E;  5KNG A;  3DSS A;  3OXF A;  4JPS A;  5CEC B;  3UX4 A;  1Z5S C;  2R59 A;  4U95 D;  3EU5 A;  2ZGD A;  1FVF A;  1O1R A;  1OCO E;  2VGE A;  3Q5M A;  3DSW A;  3ULQ A;  4W9R A;  3IHV A;  3FTU A;  2H6H A;  3CQG B;  5J08 A;  4Q69 A;  5C1D A;  4G1T A;  3SBT B;  5LCW J;  1UG3 A;  1HS6 A;  2IF4 A;  3AAA C;  5KJM A;  2JEK A;  3URZ A;  2GGF A;  3ZYQ A;  5LP0 A;  1N0R A;  2XEH A;  4ATZ D;  3FTZ A;  4YVO A;  4ACL A;  2DZN A;  4RG6 A;  4N67 A;  2VSY A;  4TUM A;  1O1T A;  3APC A;  4NUR A;  1BU9 A;  3L13 A;  1QZ2 A;  1LD8 A;  1TN7 A;  1Q2Z A;  3UT4 A;  5FIN A;  4OVV A;  1TNO A;  4ZHB A;  3W9F A;  3P1U A;  4L2L A;  3AG2 E;  2LSV A;  3TWV A;  1N4Q A;  2IJG X;  5CED B;  5HQ8 A;  3HIZ A;  2L6B A;  4K0R A;  2GRM A;  5KJN A;  1QQE A;  1TJC A;  2X6K A;  2AJA A;  4Y6C A;  3ZYL A;  3D9P A;  3G2V A;  3AG3 E;  3SBS A;  3ZKJ A;  4ITR A;  4HVB A;  1S63 A;  2A4Z A;  4CZ2 D;  5G2N A;  4GTM A;  3NF1 A;  2WXJ A;  1E8Z A;  3HXF A;  3C3Q A;  3CLJ A;  3MZL B;  1WG0 A;  2CG2 A;  4CEM A;  2J09 A;  2XZD G;  3K9I A;  1UN8 A;  4BT8 A;  4CCA A;  4P29 A;  3Q75 A;  4O6F A;  1LF8 A;  3MKR A;  4UI9 C;  2AXV A;  1PAQ A;  2MOW A;  2XEN A;  4JHK A;  3DEO A;  5B3S E;  2PM6 A;  5FQ4 A;  4I9C A;  3NB2 A;  1E90 A;  2YIN A;  1U3D A;  4BER A;  4JW1 A;  3TWX A;  1E8X A;  4GU5 A;  2ILR A;  5JMN D;  3UKU G;  1YYH A;  3CHS A;  3Q73 A;  5B1B E;  4FHJ A;  4BSZ B;  3CVQ A;  3HXC A;  4AY5 A;  1YA0 A;  1QNF A;  4AV7 A;  2WQH A;  3DBS A;  2MRI A;  3FP3 A;  4B93 B;  2J08 A;  2FUL A;  2NSZ A;  4AM9 A;  1UOH A;  2HYZ A;  3L54 A;  3JCK C;  4I6G A;  3SNX A;  5AQ9 A;  4J8D A;  5AYW D;  3FUI A;  3V79 K;  4APO A;  3I3N A;  3BG0 B;  2LO6 A;  4BFR A;  2KCK A;  5ENN A;  4J8Y A;  2KZT B;  5G55 A;  2VGX B;  4G24 A;  4I1A A;  4HB5 A;  4FUL A;  2P9P G;  2Y4T A;  1HE8 A;  3LY7 A;  4HLE A;  4IYP A;  1H6P A;  4DLO A;  5AN8 A;  3D9J A;  4AXH A;  5FT9 A;  5EN5 D;  3AG4 E;  5CKL A;  4AIF A;  3EDT B;  3RK6 A;  1SZ9 A;  3SI5 A;  1TEZ A;  2B6C A;  1Z6T A;  3ZHE B;  2IOS A;  4GML A;  3MX3 A;  1U2V G;  2JLB A;  1WM5 A;  3RU0 A;  3EHR A;  2H6F A;  3FTX A;  5JJ6 A;  5E75 A;  3E34 A;  4TXP A;  4B94 A;  4YVQ C;  3ENE A;  1SQM A;  5AJL A;  3CQC B;  5A7D B;  3ZIM A;  3IHY A;  1OWO A;  2M63 A;  4I17 A;  4J8S A;  3KEA A;  4O1P A;  4X8Q A;  2NUD A;  3KAE A;  2F37 A;  4YND A;  2J8S D;  3F6Q A;  5KJK A;  2QYJ A;  3AU5 A;  4CRW A;  1H6K A;  4H7Y A;  5G04 J;  1JPL A;  4XKC A;  4FJY A;  3FH5 A;  5CBN A;  3IXE A;  4N3C A;  1E7V A;  3RSE G;  4DI4 A;  3ZUV B;  3ABL E;  1OWM A;  3CHQ A;  3Q4A B;  3ABM E;  4X2E A;  3SO8 A;  1P5Q A;  2LAH A;  1E8Y A;  2YNQ A;  2MYO A;  4EZL A;  3CK7 A;  2PM7 A;  4G2V A;  3L9T A;  3QAR A;  4HOS A;  2KC7 A;  3FUH A;  2XGS A;  1MHQ A;  5AEN A;  3V2O A;  2DCP A;  2WXI A;  3TG5 A;  1FCH A;  4RVB A;  4WWP A;  2P9S G;  3PVL A;  3HYM B;  3ZFW A;  4WNG A;  2WM9 A;  5G05 C;  3SD5 A;  1BPO A;  1W3B A;  4HBD A;  5JHB A;  4F1P A;  3N3U A;  2WXF A;  1H0A A;  2CHW A;  4QQI A;  1FVH A;  2L0T B;  1IYG A;  1K1A A;  3IV0 A;  5FIO A;  3PRE A;  4XI9 A;  2EQX A;  3D3M A;  3OAW A;  3PZ1 A;  2UY1 A;  1EPU A;  4WNF A;  3VTX A;  2PNN A;  4I1M A;  4LNG A;  3G2W A;  3TXN A;  3PUK A;  3UIO C;  5EX0 A;  2F6S A;  2RFM A;  1XNF A;  2IEJ A;  4X2C A;  3CR3 A;  1JCQ A;  3ASN E;  3CHR A;  2UWJ G;  2Y1L E;  4PS8 A;  3CST A;  2BED A;  1INZ A;  4E6H A;  4LRZ A;  1TNU A;  1MX2 A;  2B0O E;  4GYO A;  3CHM A;  5JFZ A;  5G04 C;  5C2Y A;  2AW6 A;  5KJL A;  2KCL A;  5EDS A;  2R03 A;  2ETC A;  1YMP A;  1MQS A;  4APF A;  2FO1 E;  5BV1 A;  2XEV A;  2OEV A;  4HRM B;  3DWL G;  5H7P A;  5ENT D;  4CDM A;  3TXM A;  3TWQ A;  4HOQ A;  4C9B B;  5CER B;  5CMY A;  2EIM E;  4WWO A;  3RAU A;  3ZGQ A;  4JB8 P;  3E33 A;  3EJN A;  5BUZ A;  2P9K G;  5KWD A;  4GA0 A;  3T9K A;  4BET A;  2I6H A;  3UXG A;  4HOU A;  5EIL A;  2EIJ E;  5DBK A;  4B8A A;  3E30 A;  2FI7 A;  4M3O A;  2OOE A;  3ASO E;  4N3A A;  5G05 J;  3MEK A;  2KM4 A;  3LXU X;  4DRX E;  1K1B A;  4G11 A;  2OV8 A;  2EIN E;  5T3R A;  4G25 A;  4BX8 A;  1DVP A;  2X6I A;  4KXK B;  2NXP A;  1TN6 A;  4BT9 A;  3BEE A;  3HHM A;  4HQD A;  1H6O A;  5AQ7 A;  2VSX E;  2VJ8 A;  3Q47 B;  1N95 A;  3FUE A;  3D9L A;  4YDW A;  4XE0 A;  3O48 A;  4WUY A;  3MV3 B;  4JEU A;  4GCN A;  4IRU A;  4I2W A;  2WXO A;  3S7D A;  3OTN A;  2CHZ A;  3SY2 A;  4HS2 A;  3X2Q E;  4A55 A;  2QFC A;  1MYO A;  3ML9 A;  3HXB A;  4G26 A;  5FTP A;  4PY3 A;  5KBA A;  2KBX A;  2CHX A;  4BX9 A;  4HI8 A;  3ESK A;  5LCW C;  4B89 A;  4F3V A;  4O60 A;  2C2L A;  3FDH A;  4DI3 A;  3UIP C;  4JVS A;  2I1K A;  3DSU A;  3PRZ A;  3UT7 A;  2BKK B;  2DWZ A;  4FJZ A;  3EIQ C;  2J07 A;  1DNP A;  4NPS A;  2CG3 A;  1UJJ A;  3AU4 A;  1SW6 A;  1FT1 A;  4Y6W A;  5BPP A;  1X81 A;  4UUC A;  1HH8 A;  3LPZ A;  1ZU2 A;  4LUN U;  3Q79 A;  3FTY A;  3Q7F A;  3NOG D;  4QFV A;  2GRR B;  2FO7 A;  1NA0 A;  1MJ0 A;  4FAD A;  3ZEF A;  4ME2 A;  4LEU A;  4OVU A;  3RIB A;  4N39 A;  4ANU A;  5BV0 A;  3TL5 A;  5EIB E;  2WQ7 A;  5ITZ F;  3ASG A;  5A23 A;  5AQA A;  3OXL A;  5ANL A;  4HNA D;  3CVN A;  4M7C A;  3CK9 A;  3WG7 E;  3CSF A;  5ENS D;  4G8L A;  3AS5 A;  1K3Z D;  2XEE A;  3QC1 A;  3B95 A;  2WXQ A;  3LJN A;  3UM0 A;  2RG8 A;  3TWW A;  3BU8 A;  1SA4 A;  1N4P A;  3CVU A;  2DBA A;  3QKY A;  4DX6 D;  3S7B A;  3PZ3 A;  3AS4 A;  3PH0 C;  5EX3 A;  1VDY A;  4EBA G;  1LTX A;  4FU3 A;  2XS1 A;  5HS0 A;  5D0O D;  4TRQ A;  2DYR E;  3MKQ B;  3ZCB A;  3T5V A;  3QJZ A;  4TUU A;  2NUN A;  2G03 A;  3R7R A;  4HRN A;  4J8F A;  3ASH A;  3UUX A;  4J8E A;  4LCT A;  4GTS A;  4L23 A;  4WNE A;  5ARG A;  3ULE G;  4WWN A;  3DPD A;  3Q9N C;  1OY3 D;  1QYM A;  4AP2 A;  4OAU C;  4JZY A;  3AG1 E;  1QBQ A;  2LSU A;  2X6H A;  2X6J A;  4ILI A;  2FBN A;  3NQP A;  1KZP A;  3QWV A;  2XS8 A;  2GRL A;  1IHG A;  4JC8 A;  3D9I A;  4UQZ A;  1MX4 A;  4PS7 A;  3DSX A;  3FEX A;  4GPM A;  4L7T A;  4N2Q A;  1JCR A;  3TJP A;  5KCM A;  4LNU D;  5EID A;  3LKU A;  4TXR A;  1OWL A;  3S6A A;  1N52 A;  1LD7 A;  2YHC A;  3CVV A;  3P2B A;  3JUI A;  4EEC A;  3QB2 A;  2GRQ B;  1HFA A;  3RRU A;  1JWG A;  3EHM A;  2GRP B;  3PEV B;  1OUV A;  2I9C A;  2R17 C;  3HXE A;  5FJY A;  2HE0 A;  4PS3 A;  4RLY A;  3C98 A;  1HX8 A;  3ZYM A;  2WXK A;  3B13 A;  1SZA A;  4K5C A;  4GZ5 A;  3L16 A;  4JL0 A;  3FUL A;  3U9W A;  4WAF A;  2EIL E;  4HOT A;  4E85 A;  1IQU A;  4UWG A;  1PC2 A;  4KVO A;  3E32 A;  3CVP A;  4UI9 K;  1JWF A;  4DLQ A;  3JYS A;  2GW1 A;  4N2S A;  4JHJ A;  2P9I G;  4MKT A;  2YHE A;  3Q9U C;  2R05 A;  4FA6 A;  3ZVV A;  3QWW A;  3UQ3 A;  4A63 B;  4BES A;  2LUH A;  3OXG A;  3DSV A;  5ANR A;  3R9A B;  3PNT B;  2X38 A;  3J5P A;  4MLP A;  5FZQ A;  4ANX A;  5D66 A;  3UTM A;  1H2U A;  4U0U A;  1GW6 A;  4GZC A;  3SHF A;  1EF1 C;  4L2Y A;  4G23 A;  5AJD A;  4YDY A;  3LY8 A;  4PDX A;  2HO1 A;  2QZA A;  4Q96 A;  3BQO A;  3UM3 A;  4XKB A;  1HU3 A;  3L17 A;  2X6F A;  3LCA A;  3FEY A;  3RJV A;  1EYH A;  4ABN A;  4KZC A;  5AQB A;  4ATG A;  3LVR E;  3R7Q A;  1BD8 A;  4F1S A;  3E4B A;  2ZIS A;  1Z3X A;  4U7E B;  4F53 A;  3ZNG A;  4RSY A;  3QNK A;  4UWL A;  4GMJ A;  3C3R A;  5BXU A;  3TGO A;  3DST A;  4NRH B;  1OT8 A;  3JXI A;  1JCS A;  4U0Z A;  1FT2 A;  3PNL B;  5LX8 A;  3LJ3 A;  5HKP A;  1N9A A;  1A17 A;  4URK A;  4K03 A;  4RQI A;  4OAV B;  4JD2 G;  1Y6I A;  1OCZ E;  3SFZ A;  5LOZ A;  3TG4 A;  3UM1 A;  3RKV A;  5CMT A;  4XZ4 A;  4N5Q A;  3CK8 A;  4GYY A;  2WMN A;  4DJA A;  2DZO A;  5JHA A;  3DXK G;  3FTV A;  2HM8 A;  2VQ2 A;  4CT0 A;  3JQ1 A;  2V5Q C;  5AAR A;  4MBG A;  5CCL A;  5D0Q D;  4A1S A;  1PY1 A;  3EHQ A;  3ZXS A;  1XGW A;  2J4B A; 
#chains in the Genus database with same CATH homology
 1OWN A;  4Q94 A;  3G2T A;  4BX9 A;  2LAI A;  2XPI A;  3ESK A;  3MKQ A;  4H7X A;  3ZYK A;  5LCW C;  4B89 A;  3K9I A;  1UN8 A;  4F3V A;  3FH7 A;  4BT8 A;  4CCA A;  2C2L A;  4P29 A;  2WVI A;  3FDH A;  3L6A A;  4DI3 A;  4JVS A;  2CFZ A;  2I1K A;  3PRZ A;  2WXP A;  4O6F A;  1LF8 A;  5FZR A;  3UT7 A;  4C0E A;  3MKR A;  3I4R B;  4UI9 C;  2AXV A;  1PAQ A;  2MOW A;  3EIQ C;  4FJZ A;  2J07 A;  3RO3 A;  4EZK A;  1DNP A;  4GPK A;  3RRN B;  3Q49 B;  4JHK A;  4NPS A;  4L1B A;  5J90 A;  2CG3 A;  4PUC A;  4I43 A;  4KVM A;  2ZU6 B;  1UJJ A;  3AU4 A;  4XX5 A;  3MYV A;  1N54 A;  2PM6 A;  5JFF A;  5FQ4 A;  4BSX A;  4I9C A;  3SF4 A;  1E90 A;  2YIN A;  2XGO A;  4AVX A;  1U3D A;  4Y6W A;  5T4Y A;  2WXL A;  5BPP A;  1HXI A;  4JW1 A;  3VLE A;  3FWV A;  1E8X A;  4ANW A;  4GU5 A;  2ILR A;  4LU4 A;  2L6J A;  3QAQ A;  1HH8 A;  3LPZ A;  1ZU2 A;  3CKB A;  4LUN U;  3CHS A;  1L5J A;  4XIF A;  3FTY A;  5EKQ D;  2Q7F A;  3B7T A;  4WND A;  4FHJ A;  5ARF A;  4ANV A;  5M72 A;  3CVQ A;  5FWQ A;  3TAX A;  4QFV A;  2WXG A;  4FHK A;  2FO7 A;  4AY5 A;  2AXZ A;  3O4Z A;  1YA0 A;  1NA0 A;  2WQ6 A;  1QNF A;  3WXX A;  2IFU A;  4FAD A;  4RG9 A;  4AV7 A;  3ZEF A;  1B89 A;  2IQC A;  3PZD A;  2WQH A;  2KZT A;  3DBS A;  2MRI A;  4ME2 A;  2WMO A;  1E96 B;  3FP3 A;  3ESL A;  4LEU A;  4OVU A;  2MHK A;  3RIB A;  4N39 A;  2J08 A;  1TJF A;  5HI7 A;  4ANU A;  3CEQ A;  5BV0 A;  2FUL A;  2NSZ A;  3TL5 A;  1U3C A;  4AM9 A;  2WQ7 A;  3ASG A;  3S7F A;  2HYZ A;  4KZ0 A;  3L54 A;  2X3M A;  4I1O B;  4A3V A;  3JCK C;  3ZN3 A;  5A6C A;  4N3B A;  5A23 A;  1ZBP A;  3D9O A;  3FU5 A;  3S7J A;  1KT1 A;  3OXL A;  4I6G A;  5LFA A;  3SNX A;  5ANL A;  4X2D A;  4HXI A;  1KT0 A;  4J8D A;  5AYW D;  2WXR A;  3FUI A;  2OVB A;  2J4D A;  3B7S A;  4MS6 A;  4APO A;  3LET A;  3QK0 A;  3CVW A;  3CVN A;  4CGW A;  3I3N A;  3BG0 B;  2R5S A;  3CK9 A;  5CCM A;  5E76 A;  3PUJ A;  2VYI A;  2LO6 A;  4ILH B;  4BFR A;  2OND A;  2KCK A;  3CSF A;  1H2V C;  3MA5 A;  5ENN A;  4GAA A;  3AS5 A;  2KZT B;  1WAO 1;  3QC1 A;  2VY3 A;  4LER A;  5G55 A;  2Y3A A;  4U07 A;  3FU0 A;  2VGX B;  4AEZ C;  3QOU A;  4G24 A;  2WXQ A;  4I1A A;  3SN9 A;  2L0I A;  4FUL A;  3RO2 A;  3FUD A;  2Y4T A;  3HDX A;  4FLB A;  1HE8 A;  3APF A;  3LY7 A;  4HLE A;  5BT1 A;  4IYP A;  2A5U A;  2RG8 A;  4R7L A;  4DLO A;  3D9J A;  3NZU A;  3CVU A;  4AXH A;  5FT9 A;  2XRZ A;  2CFU A;  2DBA A;  3QKY A;  3AS8 A;  4U8H A;  4XI0 A;  1ELW A;  5CKL A;  4AIF A;  3EDT B;  3S7B A;  3AS4 A;  3RK6 A;  3PH0 C;  1HG5 A;  3FFL A;  5EX3 A;  1VDY A;  1SZ9 A;  3G2U A;  3MJW A;  3RRU A;  3FH8 A;  3SI5 A;  4EBA G;  3CVX A;  1TEZ A;  2JK8 A;  2BUG A;  4FU3 A;  1Z6T A;  2BTD A;  3ZHE B;  3FTW A;  2IOS A;  4EQF A;  4GML A;  5D0O D;  2DIW A;  4TRQ A;  3MX3 A;  4I6J A;  3MKQ B;  5BNW A;  3BG1 B;  3SGH A;  3ZCB A;  3FUF A;  3FUK A;  3U4T A;  3T5V A;  3QJZ A;  2JLB A;  4EBA A;  4TUU A;  4BTA A;  3LDZ A;  3Q15 A;  4GA1 A;  4A1G A;  3CHO A;  1WM5 A;  2G03 A;  3R7R A;  3RU0 A;  2I1J A;  3FTX A;  3FU6 A;  5JJ6 A;  3SZ7 A;  4AY6 A;  5E75 A;  3UMV A;  4B0Z A;  2VGY A;  4JA9 A;  5FQ7 A;  2WPV A;  4JEH A;  1UN9 A;  3FY4 A;  4UQX A;  1HF8 A;  4B94 A;  3GZS A;  4J8F A;  3PEU B;  3PE3 A;  4YVQ C;  3FUJ A;  3ZPJ A;  3ASH A;  5CMW A;  4IUL A;  4HOR A;  3ENE A;  3UUX A;  4J8E A;  3ZLM A;  4AOF A;  4LCT A;  3PE4 A;  4L23 A;  1SQM A;  5AJL A;  3CQC B;  5A7D B;  4WNE A;  4MRU A;  5ARG A;  3ZIM A;  2L9B A;  3IHY A;  2V4L A;  4WWN A;  3CUC A;  1OWO A;  2M63 A;  3DPD A;  4I17 A;  4WGJ A;  3APD A;  4J8S A;  4AP2 A;  4JZY A;  3ZRH A;  1ELK A;  2LSU A;  2X6H A;  3KAE A;  4YND A;  4KT6 B;  2X6J A;  3U66 A;  3CGH A;  4ILI A;  2FBN A;  5KJK A;  3NQP A;  2KCV A;  3QWV A;  1ELR A;  2GRL A;  3LEW A;  3AU5 A;  1IHG A;  4JC8 A;  1H6K A;  4H7Y A;  3D9I A;  5G04 J;  4CRW A;  4UQZ A;  2XPY A;  3IKO B;  3T8M A;  1JPL A;  2J49 A;  4NQ0 A;  4PS7 A;  4TV3 A;  3NZS A;  4XKC A;  3ZW3 A;  3FEX A;  3FH5 A;  4FJY A;  2OVF A;  2IU1 A;  3IBE A;  4L7T A;  2XRY A;  3D9M A;  4N2Q A;  4JXT A;  4OYS A;  4IN3 B;  3KEZ A;  3GYZ A;  4N3C A;  4D10 C;  2XCB A;  1E7V A;  3KD7 A;  4DI4 A;  3TJP A;  1UW4 B;  3PS6 A;  5KCM A;  1OWM A;  3CHQ A;  3Q4A B;  4GZ6 A;  3LKU A;  2PQR A;  4X2E A;  1OWL A;  4GCO A;  5CHE E;  4F7A A;  2LNI A;  3S6A A;  2C0L A;  1WY6 A;  3U64 A;  1N52 A;  2YHC A;  1P5Q A;  4UWH A;  2HR2 A;  2LAH A;  3CVV A;  1Y8M A;  1E8Y A;  3P2B A;  5CGL A;  2YNQ A;  3JUI A;  3LS8 A;  4EEC A;  3CK7 A;  4I6E A;  4EZL A;  3U3W A;  2E2E A;  2RD0 A;  2PM7 A;  3QB2 A;  4G2V A;  1NZN A;  3QAR A;  4HOS A;  1HFA A;  3SHG A;  1NA3 A;  3IEG A;  1JWG A;  2XQ0 A;  2KC7 A;  2VSN A;  3FUH A;  2XGS A;  3EHM A;  1MHQ A;  5FQ8 A;  3ZC7 A;  4CGV A;  5AEN A;  3PEV B;  2UY1 B;  1OUV A;  2DCP A;  2WXI A;  3GZ1 A;  2I9C A;  1FCH A;  1KLX A;  3MCX A;  2R17 C;  4RVB A;  4M16 A;  3TG5 A;  5JJT A;  4WWP A;  5FJY A;  1HO8 A;  3PVL A;  3HYM B;  5AIJ A;  2V8S E;  3ZFW A;  3T5X A;  4PS3 A;  4KMO A;  3B7U X;  4WNG A;  3C98 A;  2Y4U A;  2WM9 A;  4JA7 A;  1NP7 A;  2PQN A;  1HX8 A;  5G05 C;  3SD5 A;  1BPO A;  1W3B A;  2WXK A;  3ZYM A;  2V5F A;  4U04 A;  3CHP A;  3JQ0 A;  3B13 A;  5JHB A;  4U0S A;  2YQ8 A;  2BF0 X;  3ASD A;  4JHR A;  3QDN A;  2I2O A;  5FQ6 A;  3N3U A;  2QY7 A;  2V0P A;  2WXF A;  3N71 A;  1H0A A;  2CHW A;  1IQR A;  3CV0 A;  4GZD A;  1FVH A;  1SZA A;  2L0T B;  3VLD A;  1IYG A;  4U63 A;  4GZ3 A;  3IV0 A;  4XI8 A;  3L08 A;  3SE5 A;  2WXM A;  5DIZ A;  3PRE A;  4XI9 A;  2EQX A;  4GZ5 A;  4UQY A;  3D3M A;  3LY9 A;  3QWP A;  4I9E A;  4I2Z A;  3L16 A;  3OAW A;  2UY1 A;  1EPU A;  4A3T A;  4WNF A;  4JL0 A;  4FP7 A;  1HZ4 A;  3FUL A;  3EHN A;  3LYA A;  3VTX A;  4KBQ A;  3U9W A;  3FUN A;  3S2A A;  3I5P A;  3GZ2 A;  4WAF A;  4DK5 A;  4I1M A;  4J6I A;  3FHE A;  1OWP A;  3G2S A;  4GB9 A;  3G2W A;  3D9N A;  4BWR A;  4N5C A;  3PDN A;  3TXN A;  4HOT A;  3PUK A;  4E85 A;  1IQU A;  4UWF A;  4EPZ A;  4UWG A;  1Z3Y A;  1PC2 A;  4KVO A;  5EX0 A;  2F6S A;  2PL2 A;  3UPV A;  1XNF A;  2AVP A;  4X2C A;  1E7U A;  3CKC A;  3CR3 A;  4GYW A;  3CVP A;  4UI9 K;  3CHR A;  1JWF A;  3EIJ A;  4DLQ A;  2C0M A;  2UWJ G;  4PS8 A;  3CST A;  3MV2 B;  3JYS A;  1INZ A;  2GW1 A;  1EDU A;  3LVQ E;  4E6H A;  4N2S A;  4JHJ A;  4LRZ A;  4MKT A;  3L22 A;  4BTB A;  2YHE A;  4KYO B;  4FA6 A;  4GYO A;  4PH4 B;  4J0U A;  3D9K A;  3CHM A;  3ZVV A;  5JFZ A;  3FU3 A;  3RRM B;  3QWW A;  5G04 C;  3UQ3 A;  2VZA A;  4EZJ A;  4C0M A;  2VSO E;  4UWK A;  5C2Y A;  2AW6 A;  5KJL A;  3VLF A;  2KCL A;  3OXG A;  5EDS A;  3OXF A;  4JPS A;  5ANR A;  3R9A B;  3PNT B;  1MQS A;  2X38 A;  3UX4 A;  4APF A;  5BV1 A;  2XEV A;  2R59 A;  2XCC A;  4MLP A;  4FC8 A;  5FZQ A;  4ANX A;  2WB2 A;  4CDM A;  1H2T C;  1FVF A;  3TXM A;  1H2U A;  4U0U A;  4FLH A;  1GW6 A;  4HOQ A;  4BY6 A;  4GZC A;  3Q5M A;  3ULQ A;  4C9B B;  3SHF A;  4W9R A;  1EF1 C;  3IHV A;  4L2Y A;  3FTU A;  5CMY A;  4G23 A;  5AJD A;  5JJ7 A;  3FUM A;  3CQG B;  3LY8 A;  5J08 A;  4ACK A;  4Q69 A;  5C1D A;  2AWI A;  4G1T A;  4PDX A;  4WWO A;  3SBT B;  2HO1 A;  3ZGQ A;  3CIA A;  5LCW J;  1UG3 A;  1HS6 A;  2FEZ A;  4Q96 A;  3EJN A;  2VTB B;  4XKB A;  5BUZ A;  2IF4 A;  1HU3 A;  3L17 A;  5BW8 C;  5KJM A;  2E0I A;  2X6F A;  3LCA A;  3FEY A;  3RJV A;  1EYH A;  4GA0 A;  4ABN A;  2JEK A;  4KZC A;  3URZ A;  3VTY A;  4ATG A;  2GGF A;  3ZYQ A;  5LP0 A;  3LVR E;  4YVO A;  4ACL A;  3FTZ A;  2I6H A;  3R7Q A;  4GA2 A;  4RG6 A;  4N67 A;  2VSY A;  4F1S A;  4B8C B;  5EU0 A;  3UT8 A;  3E4B A;  4HOU A;  4F53 A;  1Z3X A;  3GW4 A;  5DBK A;  2FF4 A;  4UI9 J;  4B8A A;  3APC A;  4NUR A;  4RSY A;  2FI7 A;  3QNK A;  2OOE A;  4M3O A;  4N3A A;  5G05 J;  3I4G A;  4UWL A;  4GMJ A;  3MGB A;  2XPZ A;  3L13 A;  3MEK A;  3HVE A;  1S0P A;  3ONL A;  2KM4 A;  1HG2 A;  3FTS A;  3LXU X;  1QZ2 A;  3TGO A;  3UT4 A;  2VTB A;  4G11 A;  2OV8 A;  4NRH B;  4OVV A;  1X5B A;  5T3R A;  1JUQ A;  4HFG A;  4U0Z A;  2WXN A;  3PNL B;  4G25 A;  3LJ3 A;  5LX8 A;  4AJW A;  3P1U A;  2XHE A;  4BX8 A;  4L2L A;  1DVP A;  2X6I A;  4KXK B;  2LSV A;  2NXP A;  2IJG X;  4BT9 A;  3BEE A;  3HHM A;  1A17 A;  3HIZ A;  4CDR A;  4URK A;  5HQ8 A;  4K0R A;  2GRM A;  4K03 A;  2J9Q A;  5KJN A;  1QQE A;  3SFZ A;  1Y6I A;  4CDN A;  1TJC A;  2X6K A;  4Y6C A;  2VSX E;  5LOZ A;  3ZYL A;  2VJ8 A;  3TG4 A;  4DPR A;  3D9P A;  3ONK A;  3Q47 B;  3G2V A;  3SBS A;  3ML8 A;  3FUE A;  5CMT A;  3D9L A;  3RKV A;  2AXU A;  2VGX A;  4XZ4 A;  2PZI A;  3CK8 A;  4XE0 A;  3HVE B;  3O48 A;  4GYY A;  2WMN A;  2IOL A;  4ITR A;  4WUY A;  4DJA A;  1H19 A;  3MV3 B;  4JEU A;  5JHA A;  1UJK A;  4GCN A;  4IRU A;  4I2W A;  3CVY A;  2WXO A;  4HVB A;  4CT4 A;  2A4Z A;  4NAC A;  3ASF A;  4ILG A;  5T8I A;  3FTV A;  3KS2 A;  2HM8 A;  2P58 C;  2VQ2 A;  2CHZ A;  3OTN A;  3S7D A;  4CT0 A;  4HS2 A;  5G2N A;  3JQ1 A;  4A55 A;  2WXH A;  2QFC A;  2NC9 A;  1E8W A;  2WXJ A;  1E8Z A;  3NF1 A;  3ML9 A;  3B7R L;  5CCL A;  3CVL A;  5D0Q D;  2KAT A;  2ION A;  4G26 A;  3CLJ A;  3MZL B;  5FTP A;  4PY3 A;  2CG2 A;  1PY1 A;  4A1S A;  4V3I A;  4CEM A;  2J09 A;  3ZXS A;  3ZHE A;  2XGM A;  1XGW A;  5FZS A;  2J4B A;  2CHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...