4U0SA

Structure of eukaryotic fic domain containing protein with adp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
326
structure length
323
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSINSALRRVMEETYYHHIYHTVAIGGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 323
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u0sA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u0sA01
4N3BA 5CHEE 5G05C 3ZFWA 3CK8A 4PY3A 4I2ZA 5HQ8A 3CUCA 3RIBA 3QOUA 5KJNA 4WGJA 2IF4A 3GYZA 3O48A 1HXIA 1XNFA 2XGMA 2VSYA 3Q5MA 4M16A 3URZA 4BTBA 5BNWA 3K9IA 3LYAA 3BEEA 4GZ3A 4RG6A 4GA2A 3Q4AB 4ITRA 1ZBPA 4UQYA 4HOSA 4Y6WA 4I2WA 3VTYA 4KYOB 4ME2A 3TAXA 2VZAA 3GZ2A 4BWRA 3ASGA 3CEQA 3LY7A 4XIFA 3KS2A 5EU0A 4AIFA 5EX3A 3ZCBA 4JA7A 2NC9A 1ELRA 3S6AA 4LEUA 5C1DA 1NA0A 4GCNA 1A17A 2VGYA 4UI9J 4GCOA 4UQXA 5G04C 2PZIA 2PQRA 4CGVA 5LCWJ 3UQ3A 3LCAA 4GYOA 2F6SA 2WQHA 4GZ6A 4HOUA 3SN9A 3ASFA 4AY5A 4BT8A 5EX0A 3MKRA 1OUVA 3PE3A 3RO3A 4RG9A 3SZ7A 4EQFA 5JFFA 1NZNA 3CVPA 4X2CA 3CV0A 5FZSA 5AYWD 3UPVA 3SHGA 4G1TA 2Y4TA 2L6JA 2YHCA 1QQEA 3R9AB 4O6FA 5JJ7A 4AM9A 3CK9A 4APOA 5LCWC 2LNIA 3IEGA 2VGXA 2UY1B 3MV3B 3QWWA 1PC2A 5JFZA 2OOEA 2PL2A 3QWPA 2Q7FA 3S7DA 2VY3A 2UY1A 4GA1A 4IN3B 1ELWA 3TGOA 2LSVA 2V5FA 2KCVA 2AVPA 3AS8A 4KBQA 3ZC7A 1NA3A 2HYZA 2FO7A 2VSNA 2C0LA 2DBAA 1KT1A 2FF4A 5CCMA 2JK8A 4JHRA 4G2VA 1YA0A 3RJVA 3NF1A 1IYGA 3N3UA 2JLBA 2R5SA 4U0SA 3KD7A 4HOTA 1IHGA 3WXXA 2XGSA 4HOQA 3OXGA 3ZHEB 4N3CA 5ARGA 2C0MA 3RKVA 1FCHA 3KAEA 4KXKB 4WNFA 4G24A 3U3WA 5EKQD 3ZHEA 4W9RA 1Y8MA 3FP3A 4GYYA 3OXLA 3ZPJA 1W3BA 4Y6CA 4UI9K 4G25A 3UUXA 2ONDA 3LETA 5HI7A 5DBKA 3ASDA 5FT9A 2WPVA 3S7BA 2FEZA 3RO2A 5BW8C 3Q15A 4JL0A 4ABNA 3PDNA 5G05J 5A6CA 5FJYA 5FTPA 4JA9A 2FI7A 4WUYA 4WNDA 4A1SA 5CCLA 4H7XA 5A7DB 3ZLMA 2QFCA 2IFUA 4GA0A 3S7FA 1HZ4A 1HH8A 4J0UA 4UI9C 5D0QD 4YVQC 3CKCA 4BT9A 5JJTA 3ESKA 5BT1A 3VTXA 1B89A 4N2QA 4YNDA 4U04A 2XCCA 4AY6A 3CKBA 4N5CA 3JYSA 2MHKA 4G23A 4G26A 4B94A 4U07A 5ARFA 3ASHA 4F3VA 3OXFA 3PE4A 5FZQA 4I9EA 4X2DA 2KCKA 5FZRA 1ZU2A 1KT0A 2I6HA 4LU4A 2C2LA 5M72A 3GZ1A 3GW4A 4GZ5A 2HR2A 5CKLA 3AS4A 4CDRA 4GPKA 1KLXA 5KJMA 3TG5A 4U0ZA 2BUGA 2KATA 2FBNA 3MEKA 2E2EA 2XPIA 4J8EA 5JJ6A 5G04J 4WNEA 3AS5A 3CVLA 2XCBA 4NPSA 3ZGQA 2YQ8A 4XI0A 3S7JA 4U0UA 2Y4UA 5CMTA 3LY9A 3SF4A 2KC7A 5CGLA 2HO1A 4BTAA 1WAO1 4XI8A 4N2SA 4WNGA 3LPZA 2GW1A 3CVNA 4N67A 2VQ2A 3QDNA 1E96B 3E4BA 4GYWA 4X2EA 3Q49B 3LY8A 3HYMB 4XI9A 4I17A 2LSUA 4I9CA 3TG4A 4UQZA 4CGWA 3QWVA 2XEVA 3FWVA 3QKYA 4I1AA 2XGOA 3SE5A 3ULQA 5DIZA 1TJCA 4J8FA 3Q47B 3MV2B 3RU0A 2UWJG 3ZN3A 2G03A 3CK7A 1P5QA 2PQNA 1WM5A 3EDTB 3U4TA 4N39A 4NQ0A 3LKUA 5KJLA 5D0OD 3FFLA 4HORA 4YVOA 1QZ2A 2VGXB 3MA5A 2J9QA 2VYIA 3CVQA 5KJKA 4N3AA 3N71A 4J8DA 4NRHB 4H7YA 2KCLA 2P58C
chains in the Genus database with same CATH superfamily
2X3MA 3T8MA 3ZFWA 5E76A 3RIBA 4OYSA 2B6CA 5ENOD 4EZJA 4HLEA 3GYZA 3MGBA 1G3NB 5BXOA 1H19A 2L0TB 1XNFA 3NOGD 4U7EB 5AN8A 3G2WA 1TNOA 1SW6A 2F8YA 4BTBA 2BKGA 2WQ7A 2WXRA 3ZU7B 3Q4AB 4UQYA 5LP0A 3HHMA 3L16A 4GTOA 5AJDA 1Z3XA 2ZIRA 4I2WA 5FQ6A 2HE0A 3VTYA 3SD5A 3HRAA 4DRXE 4JZYA 4ME2A 3NAWA 3LY7A 2ZU6B 1IQUA 2GRMA 1OCZE 4TV3A 3PEUB 4AIFA 1E90A 4YDWA 1JWGA 2NC9A 2LXMA 3W9GA 5C1DA 3DRAA 5G04C 4GB9A 2OEWA 3LCAA 5IY5E 3FTZA 4F1SA 5AJLA 3SN9A 4GU5A 5CRVA 5EX0A 3D9JA 3ZYQA 4DX7D 5J08A 3I3NA 3RO3A 3D9OA 1LD7A 2LAIA 4Q94A 5FZSA 4Q96A 5FWQA 2IQCA 3SHGA 4O1OA 2YHCA 3G2UA 1N94A 2KZTA 2CHWA 5JJ7A 2VSOE 2OVBA 5AIJA 2WXNA 1QBQA 2H6IA 4APFA 4OVUA 1U3CA 2L0IA 5JFZA 3LJNA 4BX9A 5EIBE 4BETA 2VY3A 2UY1A 4GA1A 3C5RA 1JPLA 3ZIMA 1ELWA 3TGOA 5FQ7A 3U64A 5J90A 2V0PA 4GTSA 4F53A 3NB2A 2FULA 2HYZA 2VSNA 4F1PA 1KT1A 5CCMA 3QAQA 1H2VC 1TNYA 3UX4A 3NF1A 1IYGA 3WG7E 1JCSA 4U0SA 3KD7A 3CHSA 4PS8A 4GAAA 4HOTA 1IHGA 4LRZA 1N11A 5AARA 3ZEFA 3VLEA 2NXPA 1UG3A 4KXKB 3UKRG 2IOSA 4WNFA 5EKQD 1Y8MA 3FP3A 3ASNE 1S0PA 4R7LA 5CBNA 2M63A 4Y6CA 3TXMA 3Q9NC 3T9KA 2ONDA 2WPVA 3FEYA 3Q75A 3RO2A 3ZUVB 3PNTB 4ABNA 5A6CA 4ATZD 3IKOB 3JUIA 4WWNA 1BI7B 4JA9A 5H7PA 4K5CA 4WUYA 4MKTA 4A1SA 3ONKA 3PS6A 1EYHA 3AG2E 4HRMB 1NH1A 5T4YA 3S7FA 3SBSA 3T5VA 4LNBA 1TNBA 3LS8A 4FLHA 5JJTA 5KBAA 3LVRE 2WXGA 4DX6D 4N2QA 4YNDA 3PNLB 2XCCA 4N5CA 4G23A 1O1SA 4G26A 4U07A 1WG0A 4PDXA 3PUJA 4NACA 3OXFA 3PE4A 2KCKA 5FZRA 3CR3A 2WXKA 3X2QE 1KT0A 4LU4A 3APCA 3EUVA 3GW4A 4GZ5A 2AXVA 4NURA 4G8KA 3ZW3A 4CDRA 2BUGA 2KATA 1NP7A 2E2EA 5G04J 3P1UA 4CEMA 4WNEA 2DCPA 4TUUA 2GRRB 3B13A 3IV0A 2IJGX 3BQOA 2XHEA 3QB2A 2YQ8A 4HBDA 2IU1A 1HFAA 2I1JA 3EIJA 2KC7A 2HO1A 2OV8A 2NUNA 3L9TA 2XEEA 4WNGA 3LPZA 3FH7A 1JCQA 2OVFA 4N67A 3DBSA 4NIKA 4I1OB 4ZHBA 3IBEA 4ILHB 4ZFHA 4TUMA 1OCOE 4GYWA 2IO2C 3EHMA 3CVWA 4XI9A 1IQRA 2LSUA 2MOWA 1N4SA 4FHKA 4EZLA 3R7QA 3JUEA 4UQZA 3TWWA 5G2NA 4CGWA 4A63B 2XEVA 3Q9UC 3FWVA 3ULQA 3FU0A 2EQXA 1TJCA 2V4HC 1HG5A 4KVOA 3EDTB 3U4TA 1BI8B 4L1BA 3DEOA 5HKPA 3AU4A 1BPOA 3EHNA 4GPMA 4KMOA 4A1GA 4G8LA 4BY6A 3PREA 2VGXB 1OWPA 2Y1LE 1X81A 1UW4B 2J9QA 3B7UX 4JC8A 4AXHA 2P58C 5ENNA 1FVFA 1N52A 5BUZA 4FULA 3CK8A 4I2ZA 2J4BA 4B0ZA 3CUCA 2X6FA 1MJ0A 4WGJA 2IF4A 2WQ6A 4WAFA 1OWLA 1K3ZD 1EDUA 2VSYA 3Q5MA 1HE8A 1SQMA 3URZA 3FEXA 3K9IA 2IY0C 4RG6A 4KT6B 2GRNB 3B7BA 1D9SA 3RAUA 4FC8A 2J08A 4L2YA 4FA6A 4CDMA 4KYOB 1WY6A 2I9CA 3FULA 4BWRA 3ASGA 2F0YA 4ANXA 3CEQA 4K0RA 3SHFA 4V3IA 4U8YD 5EDSA 1TN6A 2GRQB 3JXJA 2H6GA 3FU6A 1IKND 2AJAA 3RK6A 1RZ4A 1ELRA 1NA0A 4GCNA 2VGYA 4C0MA 2PZIA 2PQRA 4CGVA 5LCWJ 2YINA 4P29A 2WQHA 5T8IA 4GTVA 4GZDA 4GZ6A 2F8XK 4L23A 3ULYA 1LD8A 3IHYA 4MS6A 2VTBA 3SZ7A 2J8SD 2KZTB 3FTWA 4DK5A 4JHKA 2Y4TA 3ONLA 4EBAG 2CHZA 2X38A 3R9AB 4O6FA 3QC1A 5KCMA 3ZXPA 4AM9A 3LVQE 3SY2A 3UTMA 4APOA 2KXPC 2LNIA 2AXUA 2VGXA 2UY1B 3D9MA 2CFUA 1PC2A 4D10C 3JXIA 2OEVA 3QNKA 2PL2A 3S7DA 1H6OA 2V5FA 2KCVA 4LCTA 1YMPA 4CZ2D 1L5JA 2E0IA 3PZ1A 3UINC 4L9PA 3BUAA 2ETCA 3CIAA 1YCSB 3B7TA 2FO7A 2DBAA 3CHQA 4LERA 3SFZA 3FUHA 4JHRA 3ZKJA 3SNXA 3CHMA 4HB5A 4GMLA 3W9FA 3N3UA 2RG8A 3EU9A 3G2TA 2GRLA 2ZGGA 3WXXA 1NI1A 4ANUA 4FADA 1N4PA 3OXGA 4N3CA 2DZOA 3RKVA 1FCHA 4CT4A 1S70B 2A4ZA 3ZHEA 3PEVB 4W9RA 1BD8A 3D9KA 3DSSA 3S2AA 4EPZA 3ZPJA 3CSFA 1QNFA 3FTXA 1N0QA 5LOZA 3UUXA 4KVMA 1OWOA 4K5AB 2JABA 4XKCA 4AOFA 2KM4A 2FEZA 3L54A 4UWFA 3BG1B 3TWRA 5BW8C 3JQ1A 3OAWA 3FY4A 3CVXA 5FJYA 4LUNU 2FI7A 3HIZA 3ISMC 1Z3YA 1UJJA 4FU3A 1DC2A 4YDOA 4GMRA 5CCLA 5CEAA 4K5BA 2VGEA 4HI9A 2IFUA 4BEPA 1K8KG 2WXPA 5BXUA 4J0UA 2ETBA 5EILA 3T8KA 4UI9C 2QZAA 3CKCA 3PZ3A 2WMOA 5B3SE 4BT9A 3FUKA 1LTXA 1KPSB 1U3DA 4B8CB 4DI3A 5BT1A 1B89A 1BU9A 3CKBA 5D2MC 3JYSA 1UOHA 2MHKA 3R9MA 4B94A 4PUCA 5D66A 4JHJA 1OCRE 2XPZA 3ASHA 3D9HA 4ACKA 4F3VA 5FZQA 4I9EA 3MCXA 2I2OA 5ENTD 2IEJA 2EIME 3DXKG 3TJPA 5M72A 4U8VD 4IULA 5AQBA 2XPYA 2XS8A 2WXJA 4CRWA 2CG2A 2IOLA 4IRUA 4ATGA 1KLXA 5KJMA 3UM3A 2WXIA 1TN8A 3D9IA 4GTPA 5AQAA 3C3OA 2FBNA 5LX8A 2V5QC 3MEKA 1E8ZA 1H0AA 5EYLA 4HXIA 4A55A 3HXCA 5AQ9A 4U96D 2XCBA 4LNUD 3P2BA 2LO6A 5CBOA 3J5QB 4UWHA 3FTYA 4U0UA 2NYJA 2Y4UA 4EECA 3LY9A 3Q78A 2H6HA 2EIJE 5CGLA 3FUIA 4BTAA 4Z68A 3VLFA 4GZCA 3CLJA 4GTMA 3PZ2A 4XKBA 3CVVA 1OY3D 4BERA 2QYUA 3DSWA 3JQ0A 2GGFA 1MX6A 4BFRA 3Q49B 5A23A 4I1MA 3FUFA 5EIDA 4I9CA 3TG4A 3DWLG 1DCQA 4TXRA 3V79K 1HX8A 3E37A 4L7TA 3SE5A 4BESA 4AP2A 1HU3A 2XRZA 1SVXA 5FQ4A 3RU0A 3FU3A 1S63A 2G03A 3CK7A 5JHBA 3RRNB 1P5QA 1WM5A 1TEZA 4J6IA 5E75A 2DYRE 4HORA 2H6FA 3CVQA 3QK0A 3UIPC 4H7YA 5CHEE 3AJIA 4EBAA 3QOUA 4UUCA 4GTRA 2A5EA 2BTDA 5AAOA 2L6BA 4AEZC 4C0EA 4CT0A 3L08A 3D9PA 1HXIA 2WXQA 3KSLA 3UT8A 3MYVA 5BNWA 3PZ4A 3E34A 3C3QA 2WXMA 1MQSA 3LYAA 4RQIA 3ZYKA 4GA2A 4HOSA 2JEKA 5CERB 4JW1A 5B1BE 1AP7A 2R03A 1FPPA 2XRYA 3Q79A 3TAXA 3GZ2A 4A3TA 3SFXA 3UM1A 3FUMA 2R2LA 1ZB1A 3ABKE 4TXQA 3RRMB 3KS2A 5EU0A 1LF8A 3AU5A 3ZCBA 1TR4A 3QJZA 2EILE 4QQIA 3ZXSA 3S6AA 1A17A 4UI9J 4FP7A 4GCOA 5ENRD 1JUQA 4PS3A 4CYMD 2VTBB 4JVSA 3ASFA 1VDYA 3ABME 4AY5A 4BT8A 4OAVB 1D8EA 3MKRA 3FUJA 1GW6A 3SBTB 5HS0A 3PE3A 4RG9A 2ILRA 4EQFA 4PS7A 5JFFA 1NZNA 3CVPA 3SI5A 2RFAA 5AYWD 1SA4A 3Q73A 2P9IG 1QQEA 3B7RL 3JCKC 3CVYA 3CK9A 4DPRA 3FH5A 3AG1E 3V2XA 3IEGA 1DCEA 1O5MA 3FU5A 3NOCD 3QWWA 3IXEA 3Q7FA 3UT4A 2OOEA 4DI4A 3QWPA 2Q7FA 3KSQA 1WDYA 2WXHA 5BPPA 3TWTA 5FQ8A 3BU8A 3L13A 3SO8A 2XQ0A 3LJ3A 1O1TA 3I4RB 3HXEA 1E8YA 4U95D 2J09A 2Y69E 5T3RA 4JXTA 4KBQA 4A3VA 4B89A 3ZC7A 1NA3A 3TWSA 3O4ZA 1E8WA 3J5PA 4DX5D 2C0LA 5KNHD 1FVHA 4FLBA 3L6AA 2FF4A 1N4RA 3DEPA 3RJVA 2J07A 3FDHA 2WVIA 3AAAC 3CHRA 5BV0A 3PRZA 1Z5SC 2WMNA 1UJKA 3NZUA 2XGSA 2DIWA 1PY1A 1D8DA 3ZHEB 4J8SA 1N4QA 3DSVA 2P9NG 1HF8A 4HQDA 1U2VG 4ANWA 4GYYA 1HS6A 1SZ9A 4URKA 5B1AE 3UKUG 3PVLA 3ML9A 2DVWA 3EHRA 3EIQC 4XZ4A 3LETA 3DPYA 3D9NA 4JD2G 2I1KA 5DBKA 2P9PG 3FH8A 3UI2A 5BV1A 3ZYLA 5FTPA 4B93B 4CCAA 2MRIA 1MZCA 4H7XA 4Q69A 2QFCA 3U9WA 4GA0A 3B7SA 4LSZE 1HZ4A 1HH8A 1TN7A 2XZDG 5FIOA 2MYOA 4ANVA 4HVBA 4RVBA 2BEDA 3ESKA 3TWUA 4YDEA 3VTXA 3TXNA 3CSTA 3HXBA 1IHBA 1FT1A 2EIKE 4X2DA 3FTVA 1OCCE 1Z6TA 2PM6A 4WWPA 3HXDA 3CHOA 3SGHA 2VJ8A 2C2LA 2PM7A 3GZ1A 4AV7A 2HR2A 5CKLA 3AS4A 2ZXWE 4KZCA 3ZNGA 4GPKA 4FHJA 3Q7AA 2XPIA 5JJ6A 5AENA 1SA5A 3ML8A 4DLQA 3LEWA 4M3OA 1N0RA 4JEUA 3HVEA 4B8AA 2BKKB 3UXGA 3CVLA 4DUIA 4NPSA 1TNZA 3ZGQA 3B95A 2VSXE 3HG0D 4XI0A 4K03A 2DYSE 3NQPA 2LAHA 2V8SE 2DWZA 4ILIA 4XI8A 2NUDA 4ILGA 1MHQA 2GW1A 4EZKA 2P9LG 3I5PA 2XS1A 1E96B 3E4BA 3FUNA 2KBXA 5CMYA 5HRYA 2X6IA 1INZA 1TNUA 4GTQA 3HYMB 4I17A 1E7VA 1YYHA 3FUDA 4MBGA 2LXLA 4AJWA 3QKYA 4I1AA 3L82A 1KZOA 5FINA 2XGOA 1FT2A 4F7AA 5DIZA 4XX5A 3V2OA 2A5UA 3Q47B 1SZAA 3APDA 4N39A 2P9KG 2RFMA 4MLPA 1OWNA 4E85A 5D0OD 4UWKA 3V30A 4F6RD 1QZ2A 3HDXA 1EPUA 3MA5A 4HLLA 2VYIA 5KJKA 3AG4E 4N3AA 3PUKA 1RW2A 4NRHB 3TWVA 2KCLA 4N3BA 5G05C 3CHPA 4DX1A 4PY3A 5HQ8A 3CQGB 5KJNA 1H2UA 5JMND 2WB2A 2CHXA 2QY7A 3O48A 5KWDA 3C72A 4O60A 2XGMA 1QYMA 4C48B 4M16A 5AQ7A 3BEEA 4GZ3A 4GMJA 4UWLA 4ITRA 1ZBPA 3CQCB 2CG3A 5CEDB 4Y6WA 4UWGA 4GTTA 2VZAA 2FO1E 3ZYMA 3NBNB 1IXVA 1N9AA 1TYQG 3ABLE 1XGWA 4XIFA 3NZSA 2DZNA 5EX3A 4JA7A 1N95A 5CMWA 4LEUA 4G11A 4PH4B 2ETAA 4UQXA 3LDZA 3UQ3A 3QARA 4GYOA 2F6SA 1OT8A 3CVUA 4HOUA 3R7RA 2YHEA 1OXJA 3F6QA 1OUVA 2WXLA 3FTUA 4L2LA 1OWMA 2CFZA 4EHMA 2PNNA 1HG2A 2J4DA 4X2CA 3CV0A 4XEIG 4RSYA 1Y6IA 3UPVA 4G1TA 5ANRA 4FJZA 2L6JA 4HRLA 3ASOE 3TL5A 5JA4D 4KZ0A 2OCCE 2EINE 4JB8P 2R05A 2GROB 3KEAA 2V4LA 5LCWC 3AG3E 3MV3B 3IHVA 1MYOA 2RKKA 4LG6A 3ESLA 4IN3B 3I4GA 1V55E 2LSVA 3TWQA 1O1RA 4QFVA 3HXFA 2QC9A 3ULEG 2AVPA 3MX3A 3AS8A 4BSXA 4U63A 3UM0A 4YDYA 3BG0B 5ENSD 4DX2A 3MZLB 2IO3C 2QYJA 1K1BA 5LFAA 1A5EA 3ENEA 2JK8A 4O1PA 3DSXA 4G2VA 4BSZB 1YA0A 3D9LA 1V54E 3DSTA 3CGHA 2Y0BG 2P9SG 3FTSA 3L22A 2JLBA 2R5SA 4HRNA 3EJNA 1N54A 3DSUA 4HOQA 4I43A 4U8HA 4C9BB 2XZTG 3FHEA 5ARGA 2C0MA 5C2YA 3KAEA 3MKQB 4CDNA 4BX8A 4G24A 3U3WA 1E8XA 2P9UG 3EHQA 2NSZA 2R17C 4ACLA 4DJAA 3PZDA 4TXPA 2ZISA 3E30A 3OXLA 3G2VA 1H6PA 1W3BA 2RD0A 1Q2ZA 4OAUC 2AW6A 4UI9K 4G25A 3FUEA 4OVVA 3RSEG 3GZSA 1H6KA 5CECB 3SQVA 2R02A 5HI7A 3ASDA 5FT9A 1ELKA 3S7BA 3Q15A 4JL0A 4J8YA 3V31A 3PDNA 5G05J 4I6JA 2P2CP 4RLYA 5EYPF 4WNDA 3VLDA 5A7DB 3SFYA 3DPDA 4FJYA 3ZLMA 1H2TC 5CRUA 2BF0X 4YVQC 5D0QD 3E33A 3KEZA 3PH0C 4M7CA 4HS2A 4U04A 4AY6A 3C3RA 1DVPA 5G55A 1BLXB 3OTNA 5ARFA 2LUHA 3APFA 4LNGA 1ZU2A 1AWCB 1K1AA 2B0OE 2YNQA 2I6HA 4JPSA 1NL4A 3TWXA 4J7WA 5ITZF 2WXOA 3DXMG 4XE0A 1JWFA 2ZGDA 3HVEB 2WXFA 3TG5A 4I6EA 1MX4A 1S64A 5EN5D 4U0ZA 4J8EA 3U66A 3AS5A 5ENQD 2WM9A 2GRPB 3D3MA 5ENPD 2R59A 3ZRHA 2IONA 3S7JA 3E32A 4HFGA 5CMTA 1PAQA 3SF4A 3UIOC 1HO8A 2XEHA 3MKQA 1WAO1 2X6HA 4AVXA 1UN8A 2HM8A 4N2SA 3RRUA 3CVNA 2X6JA 3UMVA 2VQ2A 3QDNA 5KNGA 3MJWA 2J49A 2Y3AA 3G2SA 3T5XA 4IYPA 1MX2A 4X2EA 4MRUA 3LY8A 1E7UA 2AXZA 4WWOA 2X6KA 4HI8A 1UN9A 1KZPA 3QWVA 3UM2A 2L9BA 4I6GA 2F37A 4JEHA 1EF1C 2AWIA 4J8FA 3MV2B 1X5BA 1NFIE 2UWJG 4HNAD 3ZN3A 3L17A 4TRQA 2PQNA 3LXUX 4NQ0A 2XENA 4X8QA 3LKUA 3EU5A 5KJLA 3ZVVA 3FFLA 5JHAA 4YVOA 1JCRA 4DLOA 4E6HA 4N5QA 3UT7A 1DNPA 3C98A 3N71A 5ANLA 4J8DA 1TJFA
chains in the Genus database with same CATH topology
4N3BA 5CHEE 2X3MA 3CHPA 5G05C 3T8MA 5ENNA 3ZFWA 1FVFA 1N52A 5BUZA 4FULA 3CK8A 4PY3A 2J4BA 4I2ZA 4B0ZA 3CUCA 2X6FA 5E76A 3RIBA 4EBAA 5HQ8A 3QOUA 4OYSA 3CQGB 5KJNA 1H2UA 2BTDA 4WGJA 4AEZC 4EZJA 4C0EA 4CT0A 4HLEA 2WB2A 2CHXA 2IF4A 3GYZA 2WQ6A 2QY7A 3O48A 3MGBA 4WAFA 3L08A 3D9PA 1H19A 1OWLA 1HXIA 1XNFA 2L0TB 2XGMA 2WXQA 1EDUA 2VSYA 3G2WA 3Q5MA 1HE8A 3UT8A 3MYVA 4M16A 1SQMA 3URZA 4BTBA 5BNWA 3FEXA 3K9IA 3LYAA 2WXMA 1MQSA 2WQ7A 3BEEA 4GZ3A 3ZYKA 4RG6A 4GMJA 2WXRA 4GA2A 4UWLA 3Q4AB 4ITRA 1ZBPA 3CQCB 4UQYA 4KT6B 5LP0A 2CG3A 4HOSA 2JEKA 3HHMA 4JW1A 3L16A 4Y6WA 4UWGA 5AJDA 1Z3XA 4I2WA 5FQ6A 4FC8A 2J08A 4L2YA 4FA6A 3VTYA 2XRYA 3SD5A 4CDMA 4KYOB 4JZYA 4ME2A 1WY6A 3TAXA 2VZAA 3GZ2A 2I9CA 4A3TA 3FULA 4BWRA 3ASGA 3ZYMA 4ANXA 3FUMA 3CEQA 3LY7A 2ZU6B 1IQUA 2GRMA 4K0RA 3SHFA 1XGWA 3RRMB 4XIFA 3KS2A 5EU0A 4V3IA 3NZSA 3PEUB 1LF8A 4TV3A 3AU5A 4AIFA 5EX3A 3ZCBA 1E90A 5EDSA 3QJZA 3FU6A 1JWGA 4JA7A 2NC9A 3RK6A 3ZXSA 5CMWA 1ELRA 3S6AA 4LEUA 4G11A 5C1DA 1NA0A 4GCNA 1A17A 2VGYA 4PH4B 4UI9J 4FP7A 4GCOA 4C0MA 4UQXA 5G04C 2PZIA 2PQRA 4CGVA 3LDZA 5LCWJ 4GB9A 3UQ3A 3LCAA 3QARA 3FTZA 4GYOA 1JUQA 2F6SA 2WQHA 2YINA 4P29A 4PS3A 5T8IA 4F1SA 3CVUA 2VTBB 4GZDA 4GZ6A 4HOUA 4JVSA 5AJLA 3SN9A 2YHEA 3ASFA 3R7RA 1VDYA 4GU5A 4L23A 4AY5A 4BT8A 5EX0A 3D9JA 3MKRA 3FUJA 1OUVA 2WXLA 3FTUA 3IHYA 4L2LA 3ZYQA 1GW6A 3SBTB 3I3NA 5J08A 1OWMA 2CFZA 4MS6A 3PE3A 3RO3A 4RG9A 3SZ7A 2VTBA 2ILRA 3D9OA 4PS7A 4EQFA 2LAIA 5JFFA 1NZNA 3CVPA 1HG2A 2J4DA 4Q94A 4X2CA 3CV0A 5FZSA 3SI5A 4Q96A 4RSYA 5FWQA 2KZTB 3FTWA 5AYWD 2IQCA 4JHKA 4DK5A 1Y6IA 3UPVA 3SHGA 4G1TA 2Y4TA 5ANRA 4FJZA 2L6JA 2YHCA 1QQEA 3ONLA 4EBAG 2CHZA 2X38A 3B7RL 3R9AB 3G2UA 4O6FA 3TL5A 2KZTA 2CHWA 3JCKC 3QC1A 4KZ0A 5JJ7A 2VSOE 5KCMA 3LVQE 4AM9A 3CVYA 2OVBA 5AIJA 3CK9A 2WXNA 4DPRA 2V4LA 4APFA 4APOA 5LCWC 3FH5A 4OVUA 2LNIA 2AXUA 3IEGA 2VGXA 2UY1B 3MV3B 3D9MA 2CFUA 1U3CA 1PC2A 3FU5A 3QWWA 4D10C 2L0IA 5JFZA 3IHVA 3QNKA 3UT4A 2OOEA 4BX9A 4DI4A 2PL2A 3QWPA 2Q7FA 3S7DA 2VY3A 2UY1A 3ESLA 4GA1A 2WXHA 1JPLA 4IN3B 3ZIMA 5BPPA 1ELWA 3I4GA 3TGOA 2LSVA 5FQ8A 5FQ7A 3U64A 3L13A 2V5FA 2KCVA 2XQ0A 4LCTA 5J90A 2V0PA 3LJ3A 4QFVA 1L5JA 3I4RB 1E8YA 2J09A 2E0IA 4F53A 1TJFA 2AVPA 5T3RA 3MX3A 4JXTA 3AS8A 4KBQA 2FULA 4A3VA 4B89A 4BSXA 3CIAA 3ZC7A 1NA3A 3B7TA 4U63A 3O4ZA 1E8WA 2HYZA 2FO7A 2VSNA 3BG0B 2C0LA 2DBAA 1FVHA 3CHQA 3MZLB 1KT1A 4FLBA 4LERA 3L6AA 3SFZA 5LFAA 3FUHA 2FF4A 3ENEA 5CCMA 2JK8A 4JHRA 3SNXA 3QAQA 1H2VC 4G2VA 3CHMA 3UX4A 1YA0A 4GMLA 3RJVA 3D9LA 3NF1A 2J07A 3FDHA 1IYGA 3N3UA 2WVIA 3CGHA 3FTSA 3L22A 2JLBA 2RG8A 2R5SA 3CHRA 4U0SA 3G2TA 3KD7A 3CHSA 4PS8A 2GRLA 3EJNA 4GAAA 3PRZA 5BV0A 4HOTA 1IHGA 2WMNA 1N54A 1UJKA 3NZUA 2XGSA 3WXXA 4ANUA 4FADA 4HOQA 4I43A 4LRZA 2DIWA 4U8HA 1PY1A 3OXGA 3ZEFA 3ZHEB 4N3CA 4C9BB 3VLEA 2NXPA 4J8SA 3FHEA 5ARGA 2C0MA 1UG3A 3RKVA 1FCHA 5C2YA 3KAEA 3MKQB 4KXKB 4CT4A 2IOSA 4CDNA 4BX8A 2A4ZA 4WNFA 4G24A 3U3WA 1E8XA 5EKQD 3PEVB 1HF8A 4W9RA 3ZHEA 2R17C 2NSZA 1Y8MA 4ACLA 3FP3A 3PZDA 4DJAA 3D9KA 4ANWA 4GYYA 1HS6A 1SZ9A 4URKA 3OXLA 4AXHA 3G2VA 3S2AA 3PVLA 4EPZA 3ML9A 3ZPJA 1S0PA 3CSFA 4R7LA 1QNFA 1W3BA 2M63A 4Y6CA 2RD0A 3FTXA 3TXMA 3EIQC 2AW6A 4UI9K 4G25A 3FUEA 4OVVA 5LOZA 3UUXA 4KVMA 1OWOA 3GZSA 1H6KA 3LETA 2ONDA 4XZ4A 3D9NA 4XKCA 4AOFA 5HI7A 2I1KA 5DBKA 3ASDA 5FT9A 1ELKA 2KM4A 2WPVA 3S7BA 3FH8A 2FEZA 3L54A 4UWFA 3BG1B 3FEYA 3RO2A 5BW8C 3PNTB 3JQ1A 3OAWA 3Q15A 4JL0A 5BV1A 3FY4A 4ABNA 3PDNA 5G05J 5A6CA 4I6JA 3IKOB 3JUIA 3CVXA 4WWNA 5FJYA 4LUNU 5FTPA 4JA9A 3ZYLA 2FI7A 3HIZA 4CCAA 1Z3YA 2MRIA 1UJJA 4WUYA 4MKTA 4FU3A 4WNDA 3VLDA 4A1SA 5CCLA 3ONKA 3PS6A 4H7XA 5A7DB 1EYHA 3DPDA 4Q69A 4FJYA 3ZLMA 2QFCA 1H2TC 2IFUA 4GA0A 5T4YA 3U9WA 3B7SA 3S7FA 1HZ4A 3SBSA 3T5VA 2WXPA 1HH8A 4J0UA 4ANVA 4HVBA 2BF0X 4UI9C 4RVBA 5D0QD 4YVQC 3CKCA 2WMOA 3LS8A 4FLHA 4BT9A 3FUKA 3KEZA 5JJTA 3ESKA 3PH0C 1U3DA 4B8CB 4DI3A 3LVRE 5BT1A 3VTXA 1B89A 2WXGA 4HS2A 3TXNA 3CSTA 4N2QA 4YNDA 3PNLB 4U04A 2XCCA 4AY6A 3CKBA 4N5CA 3JYSA 1DVPA 5G55A 2MHKA 4G23A 4G26A 3OTNA 4B94A 4U07A 4PUCA 4JHJA 5ARFA 4PDXA 2XPZA 3ASHA 3PUJA 4NACA 4ACKA 3APFA 4F3VA 3OXFA 3PE4A 5FZQA 4I9EA 4X2DA 3FTVA 2KCKA 5FZRA 1ZU2A 3CR3A 1Z6TA 2PM6A 2WXKA 3MCXA 2I2OA 4WWPA 3CHOA 3SGHA 2VJ8A 2YNQA 1KT0A 2I6HA 4LU4A 2C2LA 4JPSA 3TJPA 5M72A 3APCA 2PM7A 3GZ1A 4IULA 3GW4A 4AV7A 4GZ5A 2HR2A 2XPYA 2AXVA 5CKLA 3AS4A 4NURA 4KZCA 4CRWA 2WXJA 3ZW3A 2WXOA 2CG2A 4XE0A 2IOLA 4CDRA 4IRUA 1JWFA 4ATGA 4GPKA 1KLXA 4FHJA 5KJMA 3HVEB 3TG5A 2WXFA 4I6EA 2WXIA 3D9IA 4U0ZA 2BUGA 2KATA 5LX8A 2FBNA 1NP7A 2E2EA 2XPIA 3MEKA 4J8EA 5JJ6A 1E8ZA 1H0AA 5G04J 5AENA 3P1UA 3ML8A 4DLQA 4CEMA 3LEWA 3U66A 4M3OA 4WNEA 4JEUA 3HVEA 2DCPA 4HXIA 3AS5A 4TUUA 4B8AA 3B13A 3IV0A 2WM9A 4A55A 3CVLA 2IJGX 2XCBA 4NPSA 2LO6A 3P2BA 3ZGQA 2XHEA 3D3MA 3QB2A 4UWHA 2R59A 2YQ8A 2VSXE 3ZRHA 4XI0A 2IONA 3S7JA 4K03A 3FTYA 3NQPA 4U0UA 1HFAA 2IU1A 2LAHA 2Y4UA 4HFGA 4EECA 5CMTA 3LY9A 2I1JA 1PAQA 3EIJA 3SF4A 2KC7A 2V8SE 5CGLA 3FUIA 2HO1A 2OV8A 4BTAA 1HO8A 3VLFA 4ILIA 3MKQA 4GZCA 1WAO1 2X6HA 4XI8A 4AVXA 1UN8A 3CLJA 4ILGA 1MHQA 2HM8A 4WNGA 4N2SA 3LPZA 3RRUA 2GW1A 3CVNA 2X6JA 4EZKA 4XKBA 3FH7A 3I5PA 3CVVA 3UMVA 2OVFA 4N67A 2VQ2A 3DBSA 3QDNA 1E96B 4I1OB 3E4BA 3IBEA 3FUNA 3JQ0A 3MJWA 2J49A 4ILHB 2Y3AA 3G2SA 5CMYA 3T5XA 2GGFA 2X6IA 4GYWA 4IYPA 4BFRA 1INZA 4X2EA 3Q49B 4MRUA 3LY8A 3EHMA 5A23A 3HYMB 4XI9A 3CVWA 4I17A 1E7UA 4I1MA 1IQRA 2AXZA 1E7VA 2LSUA 2MOWA 3FUFA 4I9CA 3TG4A 3FUDA 4FHKA 4WWOA 2X6KA 4EZLA 3R7QA 4UQZA 1HX8A 5G2NA 4CGWA 1UN9A 3QWVA 4AJWA 2XEVA 3FWVA 3QKYA 4I1AA 2XGOA 4L7TA 2L9BA 4I6GA 3SE5A 3ULQA 3FU0A 2EQXA 4F7AA 5DIZA 4XX5A 4AP2A 1TJCA 4JEHA 1HU3A 1EF1C 2XRZA 1HG5A 5FQ4A 2AWIA 2A5UA 3Q47B 4J8FA 4KVOA 1SZAA 3FU3A 3MV2B 1X5BA 2UWJG 3APDA 4TRQA 3RU0A 3L17A 2G03A 3CK7A 3ZN3A 5JHBA 3RRNB 1P5QA 2PQNA 1WM5A 3EDTB 3U4TA 4L1BA 4N39A 3LXUX 4NQ0A 1TEZA 3LKUA 3AU4A 4MLPA 1BPOA 1OWNA 3ZVVA 3EHNA 4J6IA 4KMOA 5D0OD 4E85A 5KJLA 4UWKA 4A1GA 3FFLA 5E75A 5JHAA 4BY6A 4HORA 4YVOA 1QZ2A 3PREA 2VGXB 3HDXA 1OWPA 1EPUA 4DLOA 3MA5A 2J9QA 1UW4B 4E6HA 3UT7A 1DNPA 3C98A 3B7UX 2VYIA 4JC8A 3CVQA 3QK0A 5KJKA 4N3AA 3N71A 5ANLA 3PUKA 4J8DA 4NRHB 4H7YA 2KCLA 2P58C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3B A;  5CHE E;  5G05 C;  3ZFW A;  3CK8 A;  4PY3 A;  4I2Z A;  5HQ8 A;  3CUC A;  3RIB A;  3QOU A;  5KJN A;  4WGJ A;  2IF4 A;  3GYZ A;  3O48 A;  1HXI A;  1XNF A;  2XGM A;  2VSY A;  3Q5M A;  4M16 A;  3URZ A;  4BTB A;  5BNW A;  3K9I A;  3LYA A;  3BEE A;  4GZ3 A;  4RG6 A;  4GA2 A;  3Q4A B;  4ITR A;  1ZBP A;  4UQY A;  4HOS A;  4Y6W A;  4I2W A;  3VTY A;  4KYO B;  4ME2 A;  3TAX A;  2VZA A;  3GZ2 A;  4BWR A;  3ASG A;  3CEQ A;  3LY7 A;  4XIF A;  3KS2 A;  5EU0 A;  4AIF A;  5EX3 A;  3ZCB A;  4JA7 A;  2NC9 A;  1ELR A;  3S6A A;  4LEU A;  5C1D A;  1NA0 A;  4GCN A;  1A17 A;  2VGY A;  4UI9 J;  4GCO A;  4UQX A;  5G04 C;  2PZI A;  2PQR A;  4CGV A;  5LCW J;  3UQ3 A;  3LCA A;  4GYO A;  2F6S A;  2WQH A;  4GZ6 A;  4HOU A;  3SN9 A;  3ASF A;  4AY5 A;  4BT8 A;  5EX0 A;  3MKR A;  1OUV A;  3PE3 A;  3RO3 A;  4RG9 A;  3SZ7 A;  4EQF A;  5JFF A;  1NZN A;  3CVP A;  4X2C A;  3CV0 A;  5FZS A;  5AYW D;  3UPV A;  3SHG A;  4G1T A;  2Y4T A;  2L6J A;  2YHC A;  1QQE A;  3R9A B;  4O6F A;  5JJ7 A;  4AM9 A;  3CK9 A;  4APO A;  5LCW C;  2LNI A;  3IEG A;  2VGX A;  2UY1 B;  3MV3 B;  3QWW A;  1PC2 A;  5JFZ A;  2OOE A;  2PL2 A;  3QWP A;  2Q7F A;  3S7D A;  2VY3 A;  2UY1 A;  4GA1 A;  4IN3 B;  1ELW A;  3TGO A;  2LSV A;  2V5F A;  2KCV A;  2AVP A;  3AS8 A;  4KBQ A;  3ZC7 A;  1NA3 A;  2HYZ A;  2FO7 A;  2VSN A;  2C0L A;  2DBA A;  1KT1 A;  2FF4 A;  5CCM A;  2JK8 A;  4JHR A;  4G2V A;  1YA0 A;  3RJV A;  3NF1 A;  1IYG A;  3N3U A;  2JLB A;  2R5S A;  4U0S A;  3KD7 A;  4HOT A;  1IHG A;  3WXX A;  2XGS A;  4HOQ A;  3OXG A;  3ZHE B;  4N3C A;  5ARG A;  2C0M A;  3RKV A;  1FCH A;  3KAE A;  4KXK B;  4WNF A;  4G24 A;  3U3W A;  5EKQ D;  3ZHE A;  4W9R A;  1Y8M A;  3FP3 A;  4GYY A;  3OXL A;  3ZPJ A;  1W3B A;  4Y6C A;  4UI9 K;  4G25 A;  3UUX A;  2OND A;  3LET A;  5HI7 A;  5DBK A;  3ASD A;  5FT9 A;  2WPV A;  3S7B A;  2FEZ A;  3RO2 A;  5BW8 C;  3Q15 A;  4JL0 A;  4ABN A;  3PDN A;  5G05 J;  5A6C A;  5FJY A;  5FTP A;  4JA9 A;  2FI7 A;  4WUY A;  4WND A;  4A1S A;  5CCL A;  4H7X A;  5A7D B;  3ZLM A;  2QFC A;  2IFU A;  4GA0 A;  3S7F A;  1HZ4 A;  1HH8 A;  4J0U A;  4UI9 C;  5D0Q D;  4YVQ C;  3CKC A;  4BT9 A;  5JJT A;  3ESK A;  5BT1 A;  3VTX A;  1B89 A;  4N2Q A;  4YND A;  4U04 A;  2XCC A;  4AY6 A;  3CKB A;  4N5C A;  3JYS A;  2MHK A;  4G23 A;  4G26 A;  4B94 A;  4U07 A;  5ARF A;  3ASH A;  4F3V A;  3OXF A;  3PE4 A;  5FZQ A;  4I9E A;  4X2D A;  2KCK A;  5FZR A;  1ZU2 A;  1KT0 A;  2I6H A;  4LU4 A;  2C2L A;  5M72 A;  3GZ1 A;  3GW4 A;  4GZ5 A;  2HR2 A;  5CKL A;  3AS4 A;  4CDR A;  4GPK A;  1KLX A;  5KJM A;  3TG5 A;  4U0Z A;  2BUG A;  2KAT A;  2FBN A;  3MEK A;  2E2E A;  2XPI A;  4J8E A;  5JJ6 A;  5G04 J;  4WNE A;  3AS5 A;  3CVL A;  2XCB A;  4NPS A;  3ZGQ A;  2YQ8 A;  4XI0 A;  3S7J A;  4U0U A;  2Y4U A;  5CMT A;  3LY9 A;  3SF4 A;  2KC7 A;  5CGL A;  2HO1 A;  4BTA A;  1WAO 1;  4XI8 A;  4N2S A;  4WNG A;  3LPZ A;  2GW1 A;  3CVN A;  4N67 A;  2VQ2 A;  3QDN A;  1E96 B;  3E4B A;  4GYW A;  4X2E A;  3Q49 B;  3LY8 A;  3HYM B;  4XI9 A;  4I17 A;  2LSU A;  4I9C A;  3TG4 A;  4UQZ A;  4CGW A;  3QWV A;  2XEV A;  3FWV A;  3QKY A;  4I1A A;  2XGO A;  3SE5 A;  3ULQ A;  5DIZ A;  1TJC A;  4J8F A;  3Q47 B;  3MV2 B;  3RU0 A;  2UWJ G;  3ZN3 A;  2G03 A;  3CK7 A;  1P5Q A;  2PQN A;  1WM5 A;  3EDT B;  3U4T A;  4N39 A;  4NQ0 A;  3LKU A;  5KJL A;  5D0O D;  3FFL A;  4HOR A;  4YVO A;  1QZ2 A;  2VGX B;  3MA5 A;  2J9Q A;  2VYI A;  3CVQ A;  5KJK A;  4N3A A;  3N71 A;  4J8D A;  4NRH B;  4H7Y A;  2KCL A;  2P58 C; 
#chains in the Genus database with same CATH topology
 2X3M A;  3T8M A;  3ZFW A;  5E76 A;  3RIB A;  4OYS A;  2B6C A;  5ENO D;  4EZJ A;  4HLE A;  3GYZ A;  3MGB A;  1G3N B;  5BXO A;  1H19 A;  2L0T B;  1XNF A;  3NOG D;  4U7E B;  5AN8 A;  3G2W A;  1TNO A;  1SW6 A;  2F8Y A;  4BTB A;  2BKG A;  2WQ7 A;  2WXR A;  3ZU7 B;  3Q4A B;  4UQY A;  5LP0 A;  3HHM A;  3L16 A;  4GTO A;  5AJD A;  1Z3X A;  2ZIR A;  4I2W A;  5FQ6 A;  2HE0 A;  3VTY A;  3SD5 A;  3HRA A;  4DRX E;  4JZY A;  4ME2 A;  3NAW A;  3LY7 A;  2ZU6 B;  1IQU A;  2GRM A;  1OCZ E;  4TV3 A;  3PEU B;  4AIF A;  1E90 A;  4YDW A;  1JWG A;  2NC9 A;  2LXM A;  3W9G A;  5C1D A;  3DRA A;  5G04 C;  4GB9 A;  2OEW A;  3LCA A;  5IY5 E;  3FTZ A;  4F1S A;  5AJL A;  3SN9 A;  4GU5 A;  5CRV A;  5EX0 A;  3D9J A;  3ZYQ A;  4DX7 D;  5J08 A;  3I3N A;  3RO3 A;  3D9O A;  1LD7 A;  2LAI A;  4Q94 A;  5FZS A;  4Q96 A;  5FWQ A;  2IQC A;  3SHG A;  4O1O A;  2YHC A;  3G2U A;  1N94 A;  2KZT A;  2CHW A;  5JJ7 A;  2VSO E;  2OVB A;  5AIJ A;  2WXN A;  1QBQ A;  2H6I A;  4APF A;  4OVU A;  1U3C A;  2L0I A;  5JFZ A;  3LJN A;  4BX9 A;  5EIB E;  4BET A;  2VY3 A;  2UY1 A;  4GA1 A;  3C5R A;  1JPL A;  3ZIM A;  1ELW A;  3TGO A;  5FQ7 A;  3U64 A;  5J90 A;  2V0P A;  4GTS A;  4F53 A;  3NB2 A;  2FUL A;  2HYZ A;  2VSN A;  4F1P A;  1KT1 A;  5CCM A;  3QAQ A;  1H2V C;  1TNY A;  3UX4 A;  3NF1 A;  1IYG A;  3WG7 E;  1JCS A;  4U0S A;  3KD7 A;  3CHS A;  4PS8 A;  4GAA A;  4HOT A;  1IHG A;  4LRZ A;  1N11 A;  5AAR A;  3ZEF A;  3VLE A;  2NXP A;  1UG3 A;  4KXK B;  3UKR G;  2IOS A;  4WNF A;  5EKQ D;  1Y8M A;  3FP3 A;  3ASN E;  1S0P A;  4R7L A;  5CBN A;  2M63 A;  4Y6C A;  3TXM A;  3Q9N C;  3T9K A;  2OND A;  2WPV A;  3FEY A;  3Q75 A;  3RO2 A;  3ZUV B;  3PNT B;  4ABN A;  5A6C A;  4ATZ D;  3IKO B;  3JUI A;  4WWN A;  1BI7 B;  4JA9 A;  5H7P A;  4K5C A;  4WUY A;  4MKT A;  4A1S A;  3ONK A;  3PS6 A;  1EYH A;  3AG2 E;  4HRM B;  1NH1 A;  5T4Y A;  3S7F A;  3SBS A;  3T5V A;  4LNB A;  1TNB A;  3LS8 A;  4FLH A;  5JJT A;  5KBA A;  3LVR E;  2WXG A;  4DX6 D;  4N2Q A;  4YND A;  3PNL B;  2XCC A;  4N5C A;  4G23 A;  1O1S A;  4G26 A;  4U07 A;  1WG0 A;  4PDX A;  3PUJ A;  4NAC A;  3OXF A;  3PE4 A;  2KCK A;  5FZR A;  3CR3 A;  2WXK A;  3X2Q E;  1KT0 A;  4LU4 A;  3APC A;  3EUV A;  3GW4 A;  4GZ5 A;  2AXV A;  4NUR A;  4G8K A;  3ZW3 A;  4CDR A;  2BUG A;  2KAT A;  1NP7 A;  2E2E A;  5G04 J;  3P1U A;  4CEM A;  4WNE A;  2DCP A;  4TUU A;  2GRR B;  3B13 A;  3IV0 A;  2IJG X;  3BQO A;  2XHE A;  3QB2 A;  2YQ8 A;  4HBD A;  2IU1 A;  1HFA A;  2I1J A;  3EIJ A;  2KC7 A;  2HO1 A;  2OV8 A;  2NUN A;  3L9T A;  2XEE A;  4WNG A;  3LPZ A;  3FH7 A;  1JCQ A;  2OVF A;  4N67 A;  3DBS A;  4NIK A;  4I1O B;  4ZHB A;  3IBE A;  4ILH B;  4ZFH A;  4TUM A;  1OCO E;  4GYW A;  2IO2 C;  3EHM A;  3CVW A;  4XI9 A;  1IQR A;  2LSU A;  2MOW A;  1N4S A;  4FHK A;  4EZL A;  3R7Q A;  3JUE A;  4UQZ A;  3TWW A;  5G2N A;  4CGW A;  4A63 B;  2XEV A;  3Q9U C;  3FWV A;  3ULQ A;  3FU0 A;  2EQX A;  1TJC A;  2V4H C;  1HG5 A;  4KVO A;  3EDT B;  3U4T A;  1BI8 B;  4L1B A;  3DEO A;  5HKP A;  3AU4 A;  1BPO A;  3EHN A;  4GPM A;  4KMO A;  4A1G A;  4G8L A;  4BY6 A;  3PRE A;  2VGX B;  1OWP A;  2Y1L E;  1X81 A;  1UW4 B;  2J9Q A;  3B7U X;  4JC8 A;  4AXH A;  2P58 C;  5ENN A;  1FVF A;  1N52 A;  5BUZ A;  4FUL A;  3CK8 A;  4I2Z A;  2J4B A;  4B0Z A;  3CUC A;  2X6F A;  1MJ0 A;  4WGJ A;  2IF4 A;  2WQ6 A;  4WAF A;  1OWL A;  1K3Z D;  1EDU A;  2VSY A;  3Q5M A;  1HE8 A;  1SQM A;  3URZ A;  3FEX A;  3K9I A;  2IY0 C;  4RG6 A;  4KT6 B;  2GRN B;  3B7B A;  1D9S A;  3RAU A;  4FC8 A;  2J08 A;  4L2Y A;  4FA6 A;  4CDM A;  4KYO B;  1WY6 A;  2I9C A;  3FUL A;  4BWR A;  3ASG A;  2F0Y A;  4ANX A;  3CEQ A;  4K0R A;  3SHF A;  4V3I A;  4U8Y D;  5EDS A;  1TN6 A;  2GRQ B;  3JXJ A;  2H6G A;  3FU6 A;  1IKN D;  2AJA A;  3RK6 A;  1RZ4 A;  1ELR A;  1NA0 A;  4GCN A;  2VGY A;  4C0M A;  2PZI A;  2PQR A;  4CGV A;  5LCW J;  2YIN A;  4P29 A;  2WQH A;  5T8I A;  4GTV A;  4GZD A;  4GZ6 A;  2F8X K;  4L23 A;  3ULY A;  1LD8 A;  3IHY A;  4MS6 A;  2VTB A;  3SZ7 A;  2J8S D;  2KZT B;  3FTW A;  4DK5 A;  4JHK A;  2Y4T A;  3ONL A;  4EBA G;  2CHZ A;  2X38 A;  3R9A B;  4O6F A;  3QC1 A;  5KCM A;  3ZXP A;  4AM9 A;  3LVQ E;  3SY2 A;  3UTM A;  4APO A;  2KXP C;  2LNI A;  2AXU A;  2VGX A;  2UY1 B;  3D9M A;  2CFU A;  1PC2 A;  4D10 C;  3JXI A;  2OEV A;  3QNK A;  2PL2 A;  3S7D A;  1H6O A;  2V5F A;  2KCV A;  4LCT A;  1YMP A;  4CZ2 D;  1L5J A;  2E0I A;  3PZ1 A;  3UIN C;  4L9P A;  3BUA A;  2ETC A;  3CIA A;  1YCS B;  3B7T A;  2FO7 A;  2DBA A;  3CHQ A;  4LER A;  3SFZ A;  3FUH A;  4JHR A;  3ZKJ A;  3SNX A;  3CHM A;  4HB5 A;  4GML A;  3W9F A;  3N3U A;  2RG8 A;  3EU9 A;  3G2T A;  2GRL A;  2ZGG A;  3WXX A;  1NI1 A;  4ANU A;  4FAD A;  1N4P A;  3OXG A;  4N3C A;  2DZO A;  3RKV A;  1FCH A;  4CT4 A;  1S70 B;  2A4Z A;  3ZHE A;  3PEV B;  4W9R A;  1BD8 A;  3D9K A;  3DSS A;  3S2A A;  4EPZ A;  3ZPJ A;  3CSF A;  1QNF A;  3FTX A;  1N0Q A;  5LOZ A;  3UUX A;  4KVM A;  1OWO A;  4K5A B;  2JAB A;  4XKC A;  4AOF A;  2KM4 A;  2FEZ A;  3L54 A;  4UWF A;  3BG1 B;  3TWR A;  5BW8 C;  3JQ1 A;  3OAW A;  3FY4 A;  3CVX A;  5FJY A;  4LUN U;  2FI7 A;  3HIZ A;  3ISM C;  1Z3Y A;  1UJJ A;  4FU3 A;  1DC2 A;  4YDO A;  4GMR A;  5CCL A;  5CEA A;  4K5B A;  2VGE A;  4HI9 A;  2IFU A;  4BEP A;  1K8K G;  2WXP A;  5BXU A;  4J0U A;  2ETB A;  5EIL A;  3T8K A;  4UI9 C;  2QZA A;  3CKC A;  3PZ3 A;  2WMO A;  5B3S E;  4BT9 A;  3FUK A;  1LTX A;  1KPS B;  1U3D A;  4B8C B;  4DI3 A;  5BT1 A;  1B89 A;  1BU9 A;  3CKB A;  5D2M C;  3JYS A;  1UOH A;  2MHK A;  3R9M A;  4B94 A;  4PUC A;  5D66 A;  4JHJ A;  1OCR E;  2XPZ A;  3ASH A;  3D9H A;  4ACK A;  4F3V A;  5FZQ A;  4I9E A;  3MCX A;  2I2O A;  5ENT D;  2IEJ A;  2EIM E;  3DXK G;  3TJP A;  5M72 A;  4U8V D;  4IUL A;  5AQB A;  2XPY A;  2XS8 A;  2WXJ A;  4CRW A;  2CG2 A;  2IOL A;  4IRU A;  4ATG A;  1KLX A;  5KJM A;  3UM3 A;  2WXI A;  1TN8 A;  3D9I A;  4GTP A;  5AQA A;  3C3O A;  2FBN A;  5LX8 A;  2V5Q C;  3MEK A;  1E8Z A;  1H0A A;  5EYL A;  4HXI A;  4A55 A;  3HXC A;  5AQ9 A;  4U96 D;  2XCB A;  4LNU D;  3P2B A;  2LO6 A;  5CBO A;  3J5Q B;  4UWH A;  3FTY A;  4U0U A;  2NYJ A;  2Y4U A;  4EEC A;  3LY9 A;  3Q78 A;  2H6H A;  2EIJ E;  5CGL A;  3FUI A;  4BTA A;  4Z68 A;  3VLF A;  4GZC A;  3CLJ A;  4GTM A;  3PZ2 A;  4XKB A;  3CVV A;  1OY3 D;  4BER A;  2QYU A;  3DSW A;  3JQ0 A;  2GGF A;  1MX6 A;  4BFR A;  3Q49 B;  5A23 A;  4I1M A;  3FUF A;  5EID A;  4I9C A;  3TG4 A;  3DWL G;  1DCQ A;  4TXR A;  3V79 K;  1HX8 A;  3E37 A;  4L7T A;  3SE5 A;  4BES A;  4AP2 A;  1HU3 A;  2XRZ A;  1SVX A;  5FQ4 A;  3RU0 A;  3FU3 A;  1S63 A;  2G03 A;  3CK7 A;  5JHB A;  3RRN B;  1P5Q A;  1WM5 A;  1TEZ A;  4J6I A;  5E75 A;  2DYR E;  4HOR A;  2H6F A;  3CVQ A;  3QK0 A;  3UIP C;  4H7Y A;  5CHE E;  3AJI A;  4EBA A;  3QOU A;  4UUC A;  4GTR A;  2A5E A;  2BTD A;  5AAO A;  2L6B A;  4AEZ C;  4C0E A;  4CT0 A;  3L08 A;  3D9P A;  1HXI A;  2WXQ A;  3KSL A;  3UT8 A;  3MYV A;  5BNW A;  3PZ4 A;  3E34 A;  3C3Q A;  2WXM A;  1MQS A;  3LYA A;  4RQI A;  3ZYK A;  4GA2 A;  4HOS A;  2JEK A;  5CER B;  4JW1 A;  5B1B E;  1AP7 A;  2R03 A;  1FPP A;  2XRY A;  3Q79 A;  3TAX A;  3GZ2 A;  4A3T A;  3SFX A;  3UM1 A;  3FUM A;  2R2L A;  1ZB1 A;  3ABK E;  4TXQ A;  3RRM B;  3KS2 A;  5EU0 A;  1LF8 A;  3AU5 A;  3ZCB A;  1TR4 A;  3QJZ A;  2EIL E;  4QQI A;  3ZXS A;  3S6A A;  1A17 A;  4UI9 J;  4FP7 A;  4GCO A;  5ENR D;  1JUQ A;  4PS3 A;  4CYM D;  2VTB B;  4JVS A;  3ASF A;  1VDY A;  3ABM E;  4AY5 A;  4BT8 A;  4OAV B;  1D8E A;  3MKR A;  3FUJ A;  1GW6 A;  3SBT B;  5HS0 A;  3PE3 A;  4RG9 A;  2ILR A;  4EQF A;  4PS7 A;  5JFF A;  1NZN A;  3CVP A;  3SI5 A;  2RFA A;  5AYW D;  1SA4 A;  3Q73 A;  2P9I G;  1QQE A;  3B7R L;  3JCK C;  3CVY A;  3CK9 A;  4DPR A;  3FH5 A;  3AG1 E;  3V2X A;  3IEG A;  1DCE A;  1O5M A;  3FU5 A;  3NOC D;  3QWW A;  3IXE A;  3Q7F A;  3UT4 A;  2OOE A;  4DI4 A;  3QWP A;  2Q7F A;  3KSQ A;  1WDY A;  2WXH A;  5BPP A;  3TWT A;  5FQ8 A;  3BU8 A;  3L13 A;  3SO8 A;  2XQ0 A;  3LJ3 A;  1O1T A;  3I4R B;  3HXE A;  1E8Y A;  4U95 D;  2J09 A;  2Y69 E;  5T3R A;  4JXT A;  4KBQ A;  4A3V A;  4B89 A;  3ZC7 A;  1NA3 A;  3TWS A;  3O4Z A;  1E8W A;  3J5P A;  4DX5 D;  2C0L A;  5KNH D;  1FVH A;  4FLB A;  3L6A A;  2FF4 A;  1N4R A;  3DEP A;  3RJV A;  2J07 A;  3FDH A;  2WVI A;  3AAA C;  3CHR A;  5BV0 A;  3PRZ A;  1Z5S C;  2WMN A;  1UJK A;  3NZU A;  2XGS A;  2DIW A;  1PY1 A;  1D8D A;  3ZHE B;  4J8S A;  1N4Q A;  3DSV A;  2P9N G;  1HF8 A;  4HQD A;  1U2V G;  4ANW A;  4GYY A;  1HS6 A;  1SZ9 A;  4URK A;  5B1A E;  3UKU G;  3PVL A;  3ML9 A;  2DVW A;  3EHR A;  3EIQ C;  4XZ4 A;  3LET A;  3DPY A;  3D9N A;  4JD2 G;  2I1K A;  5DBK A;  2P9P G;  3FH8 A;  3UI2 A;  5BV1 A;  3ZYL A;  5FTP A;  4B93 B;  4CCA A;  2MRI A;  1MZC A;  4H7X A;  4Q69 A;  2QFC A;  3U9W A;  4GA0 A;  3B7S A;  4LSZ E;  1HZ4 A;  1HH8 A;  1TN7 A;  2XZD G;  5FIO A;  2MYO A;  4ANV A;  4HVB A;  4RVB A;  2BED A;  3ESK A;  3TWU A;  4YDE A;  3VTX A;  3TXN A;  3CST A;  3HXB A;  1IHB A;  1FT1 A;  2EIK E;  4X2D A;  3FTV A;  1OCC E;  1Z6T A;  2PM6 A;  4WWP A;  3HXD A;  3CHO A;  3SGH A;  2VJ8 A;  2C2L A;  2PM7 A;  3GZ1 A;  4AV7 A;  2HR2 A;  5CKL A;  3AS4 A;  2ZXW E;  4KZC A;  3ZNG A;  4GPK A;  4FHJ A;  3Q7A A;  2XPI A;  5JJ6 A;  5AEN A;  1SA5 A;  3ML8 A;  4DLQ A;  3LEW A;  4M3O A;  1N0R A;  4JEU A;  3HVE A;  4B8A A;  2BKK B;  3UXG A;  3CVL A;  4DUI A;  4NPS A;  1TNZ A;  3ZGQ A;  3B95 A;  2VSX E;  3HG0 D;  4XI0 A;  4K03 A;  2DYS E;  3NQP A;  2LAH A;  2V8S E;  2DWZ A;  4ILI A;  4XI8 A;  2NUD A;  4ILG A;  1MHQ A;  2GW1 A;  4EZK A;  2P9L G;  3I5P A;  2XS1 A;  1E96 B;  3E4B A;  3FUN A;  2KBX A;  5CMY A;  5HRY A;  2X6I A;  1INZ A;  1TNU A;  4GTQ A;  3HYM B;  4I17 A;  1E7V A;  1YYH A;  3FUD A;  4MBG A;  2LXL A;  4AJW A;  3QKY A;  4I1A A;  3L82 A;  1KZO A;  5FIN A;  2XGO A;  1FT2 A;  4F7A A;  5DIZ A;  4XX5 A;  3V2O A;  2A5U A;  3Q47 B;  1SZA A;  3APD A;  4N39 A;  2P9K G;  2RFM A;  4MLP A;  1OWN A;  4E85 A;  5D0O D;  4UWK A;  3V30 A;  4F6R D;  1QZ2 A;  3HDX A;  1EPU A;  3MA5 A;  4HLL A;  2VYI A;  5KJK A;  3AG4 E;  4N3A A;  3PUK A;  1RW2 A;  4NRH B;  3TWV A;  2KCL A;  4N3B A;  5G05 C;  3CHP A;  4DX1 A;  4PY3 A;  5HQ8 A;  3CQG B;  5KJN A;  1H2U A;  5JMN D;  2WB2 A;  2CHX A;  2QY7 A;  3O48 A;  5KWD A;  3C72 A;  4O60 A;  2XGM A;  1QYM A;  4C48 B;  4M16 A;  5AQ7 A;  3BEE A;  4GZ3 A;  4GMJ A;  4UWL A;  4ITR A;  1ZBP A;  3CQC B;  2CG3 A;  5CED B;  4Y6W A;  4UWG A;  4GTT A;  2VZA A;  2FO1 E;  3ZYM A;  3NBN B;  1IXV A;  1N9A A;  1TYQ G;  3ABL E;  1XGW A;  4XIF A;  3NZS A;  2DZN A;  5EX3 A;  4JA7 A;  1N95 A;  5CMW A;  4LEU A;  4G11 A;  4PH4 B;  2ETA A;  4UQX A;  3LDZ A;  3UQ3 A;  3QAR A;  4GYO A;  2F6S A;  1OT8 A;  3CVU A;  4HOU A;  3R7R A;  2YHE A;  1OXJ A;  3F6Q A;  1OUV A;  2WXL A;  3FTU A;  4L2L A;  1OWM A;  2CFZ A;  4EHM A;  2PNN A;  1HG2 A;  2J4D A;  4X2C A;  3CV0 A;  4XEI G;  4RSY A;  1Y6I A;  3UPV A;  4G1T A;  5ANR A;  4FJZ A;  2L6J A;  4HRL A;  3ASO E;  3TL5 A;  5JA4 D;  4KZ0 A;  2OCC E;  2EIN E;  4JB8 P;  2R05 A;  2GRO B;  3KEA A;  2V4L A;  5LCW C;  3AG3 E;  3MV3 B;  3IHV A;  1MYO A;  2RKK A;  4LG6 A;  3ESL A;  4IN3 B;  3I4G A;  1V55 E;  2LSV A;  3TWQ A;  1O1R A;  4QFV A;  3HXF A;  2QC9 A;  3ULE G;  2AVP A;  3MX3 A;  3AS8 A;  4BSX A;  4U63 A;  3UM0 A;  4YDY A;  3BG0 B;  5ENS D;  4DX2 A;  3MZL B;  2IO3 C;  2QYJ A;  1K1B A;  5LFA A;  1A5E A;  3ENE A;  2JK8 A;  4O1P A;  3DSX A;  4G2V A;  4BSZ B;  1YA0 A;  3D9L A;  1V54 E;  3DST A;  3CGH A;  2Y0B G;  2P9S G;  3FTS A;  3L22 A;  2JLB A;  2R5S A;  4HRN A;  3EJN A;  1N54 A;  3DSU A;  4HOQ A;  4I43 A;  4U8H A;  4C9B B;  2XZT G;  3FHE A;  5ARG A;  2C0M A;  5C2Y A;  3KAE A;  3MKQ B;  4CDN A;  4BX8 A;  4G24 A;  3U3W A;  1E8X A;  2P9U G;  3EHQ A;  2NSZ A;  2R17 C;  4ACL A;  4DJA A;  3PZD A;  4TXP A;  2ZIS A;  3E30 A;  3OXL A;  3G2V A;  1H6P A;  1W3B A;  2RD0 A;  1Q2Z A;  4OAU C;  2AW6 A;  4UI9 K;  4G25 A;  3FUE A;  4OVV A;  3RSE G;  3GZS A;  1H6K A;  5CEC B;  3SQV A;  2R02 A;  5HI7 A;  3ASD A;  5FT9 A;  1ELK A;  3S7B A;  3Q15 A;  4JL0 A;  4J8Y A;  3V31 A;  3PDN A;  5G05 J;  4I6J A;  2P2C P;  4RLY A;  5EYP F;  4WND A;  3VLD A;  5A7D B;  3SFY A;  3DPD A;  4FJY A;  3ZLM A;  1H2T C;  5CRU A;  2BF0 X;  4YVQ C;  5D0Q D;  3E33 A;  3KEZ A;  3PH0 C;  4M7C A;  4HS2 A;  4U04 A;  4AY6 A;  3C3R A;  1DVP A;  5G55 A;  1BLX B;  3OTN A;  5ARF A;  2LUH A;  3APF A;  4LNG A;  1ZU2 A;  1AWC B;  1K1A A;  2B0O E;  2YNQ A;  2I6H A;  4JPS A;  1NL4 A;  3TWX A;  4J7W A;  5ITZ F;  2WXO A;  3DXM G;  4XE0 A;  1JWF A;  2ZGD A;  3HVE B;  2WXF A;  3TG5 A;  4I6E A;  1MX4 A;  1S64 A;  5EN5 D;  4U0Z A;  4J8E A;  3U66 A;  3AS5 A;  5ENQ D;  2WM9 A;  2GRP B;  3D3M A;  5ENP D;  2R59 A;  3ZRH A;  2ION A;  3S7J A;  3E32 A;  4HFG A;  5CMT A;  1PAQ A;  3SF4 A;  3UIO C;  1HO8 A;  2XEH A;  3MKQ A;  1WAO 1;  2X6H A;  4AVX A;  1UN8 A;  2HM8 A;  4N2S A;  3RRU A;  3CVN A;  2X6J A;  3UMV A;  2VQ2 A;  3QDN A;  5KNG A;  3MJW A;  2J49 A;  2Y3A A;  3G2S A;  3T5X A;  4IYP A;  1MX2 A;  4X2E A;  4MRU A;  3LY8 A;  1E7U A;  2AXZ A;  4WWO A;  2X6K A;  4HI8 A;  1UN9 A;  1KZP A;  3QWV A;  3UM2 A;  2L9B A;  4I6G A;  2F37 A;  4JEH A;  1EF1 C;  2AWI A;  4J8F A;  3MV2 B;  1X5B A;  1NFI E;  2UWJ G;  4HNA D;  3ZN3 A;  3L17 A;  4TRQ A;  2PQN A;  3LXU X;  4NQ0 A;  2XEN A;  4X8Q A;  3LKU A;  3EU5 A;  5KJL A;  3ZVV A;  3FFL A;  5JHA A;  4YVO A;  1JCR A;  4DLO A;  4E6H A;  4N5Q A;  3UT7 A;  1DNP A;  3C98 A;  3N71 A;  5ANL A;  4J8D A;  1TJF A; 
#chains in the Genus database with same CATH homology
 4N3B A;  5CHE E;  2X3M A;  3CHP A;  5G05 C;  3T8M A;  5ENN A;  3ZFW A;  1FVF A;  1N52 A;  5BUZ A;  4FUL A;  3CK8 A;  4PY3 A;  2J4B A;  4I2Z A;  4B0Z A;  3CUC A;  2X6F A;  5E76 A;  3RIB A;  4EBA A;  5HQ8 A;  3QOU A;  4OYS A;  3CQG B;  5KJN A;  1H2U A;  2BTD A;  4WGJ A;  4AEZ C;  4EZJ A;  4C0E A;  4CT0 A;  4HLE A;  2WB2 A;  2CHX A;  2IF4 A;  3GYZ A;  2WQ6 A;  2QY7 A;  3O48 A;  3MGB A;  4WAF A;  3L08 A;  3D9P A;  1H19 A;  1OWL A;  1HXI A;  1XNF A;  2L0T B;  2XGM A;  2WXQ A;  1EDU A;  2VSY A;  3G2W A;  3Q5M A;  1HE8 A;  3UT8 A;  3MYV A;  4M16 A;  1SQM A;  3URZ A;  4BTB A;  5BNW A;  3FEX A;  3K9I A;  3LYA A;  2WXM A;  1MQS A;  2WQ7 A;  3BEE A;  4GZ3 A;  3ZYK A;  4RG6 A;  4GMJ A;  2WXR A;  4GA2 A;  4UWL A;  3Q4A B;  4ITR A;  1ZBP A;  3CQC B;  4UQY A;  4KT6 B;  5LP0 A;  2CG3 A;  4HOS A;  2JEK A;  3HHM A;  4JW1 A;  3L16 A;  4Y6W A;  4UWG A;  5AJD A;  1Z3X A;  4I2W A;  5FQ6 A;  4FC8 A;  2J08 A;  4L2Y A;  4FA6 A;  3VTY A;  2XRY A;  3SD5 A;  4CDM A;  4KYO B;  4JZY A;  4ME2 A;  1WY6 A;  3TAX A;  2VZA A;  3GZ2 A;  2I9C A;  4A3T A;  3FUL A;  4BWR A;  3ASG A;  3ZYM A;  4ANX A;  3FUM A;  3CEQ A;  3LY7 A;  2ZU6 B;  1IQU A;  2GRM A;  4K0R A;  3SHF A;  1XGW A;  3RRM B;  4XIF A;  3KS2 A;  5EU0 A;  4V3I A;  3NZS A;  3PEU B;  1LF8 A;  4TV3 A;  3AU5 A;  4AIF A;  5EX3 A;  3ZCB A;  1E90 A;  5EDS A;  3QJZ A;  3FU6 A;  1JWG A;  4JA7 A;  2NC9 A;  3RK6 A;  3ZXS A;  5CMW A;  1ELR A;  3S6A A;  4LEU A;  4G11 A;  5C1D A;  1NA0 A;  4GCN A;  1A17 A;  2VGY A;  4PH4 B;  4UI9 J;  4FP7 A;  4GCO A;  4C0M A;  4UQX A;  5G04 C;  2PZI A;  2PQR A;  4CGV A;  3LDZ A;  5LCW J;  4GB9 A;  3UQ3 A;  3LCA A;  3QAR A;  3FTZ A;  4GYO A;  1JUQ A;  2F6S A;  2WQH A;  2YIN A;  4P29 A;  4PS3 A;  5T8I A;  4F1S A;  3CVU A;  2VTB B;  4GZD A;  4GZ6 A;  4HOU A;  4JVS A;  5AJL A;  3SN9 A;  2YHE A;  3ASF A;  3R7R A;  1VDY A;  4GU5 A;  4L23 A;  4AY5 A;  4BT8 A;  5EX0 A;  3D9J A;  3MKR A;  3FUJ A;  1OUV A;  2WXL A;  3FTU A;  3IHY A;  4L2L A;  3ZYQ A;  1GW6 A;  3SBT B;  3I3N A;  5J08 A;  1OWM A;  2CFZ A;  4MS6 A;  3PE3 A;  3RO3 A;  4RG9 A;  3SZ7 A;  2VTB A;  2ILR A;  3D9O A;  4PS7 A;  4EQF A;  2LAI A;  5JFF A;  1NZN A;  3CVP A;  1HG2 A;  2J4D A;  4Q94 A;  4X2C A;  3CV0 A;  5FZS A;  3SI5 A;  4Q96 A;  4RSY A;  5FWQ A;  2KZT B;  3FTW A;  5AYW D;  2IQC A;  4JHK A;  4DK5 A;  1Y6I A;  3UPV A;  3SHG A;  4G1T A;  2Y4T A;  5ANR A;  4FJZ A;  2L6J A;  2YHC A;  1QQE A;  3ONL A;  4EBA G;  2CHZ A;  2X38 A;  3B7R L;  3R9A B;  3G2U A;  4O6F A;  3TL5 A;  2KZT A;  2CHW A;  3JCK C;  3QC1 A;  4KZ0 A;  5JJ7 A;  2VSO E;  5KCM A;  3LVQ E;  4AM9 A;  3CVY A;  2OVB A;  5AIJ A;  3CK9 A;  2WXN A;  4DPR A;  2V4L A;  4APF A;  4APO A;  5LCW C;  3FH5 A;  4OVU A;  2LNI A;  2AXU A;  3IEG A;  2VGX A;  2UY1 B;  3MV3 B;  3D9M A;  2CFU A;  1U3C A;  1PC2 A;  3FU5 A;  3QWW A;  4D10 C;  2L0I A;  5JFZ A;  3IHV A;  3QNK A;  3UT4 A;  2OOE A;  4BX9 A;  4DI4 A;  2PL2 A;  3QWP A;  2Q7F A;  3S7D A;  2VY3 A;  2UY1 A;  3ESL A;  4GA1 A;  2WXH A;  1JPL A;  4IN3 B;  3ZIM A;  5BPP A;  1ELW A;  3I4G A;  3TGO A;  2LSV A;  5FQ8 A;  5FQ7 A;  3U64 A;  3L13 A;  2V5F A;  2KCV A;  2XQ0 A;  4LCT A;  5J90 A;  2V0P A;  3LJ3 A;  4QFV A;  1L5J A;  3I4R B;  1E8Y A;  2J09 A;  2E0I A;  4F53 A;  1TJF A;  2AVP A;  5T3R A;  3MX3 A;  4JXT A;  3AS8 A;  4KBQ A;  2FUL A;  4A3V A;  4B89 A;  4BSX A;  3CIA A;  3ZC7 A;  1NA3 A;  3B7T A;  4U63 A;  3O4Z A;  1E8W A;  2HYZ A;  2FO7 A;  2VSN A;  3BG0 B;  2C0L A;  2DBA A;  1FVH A;  3CHQ A;  3MZL B;  1KT1 A;  4FLB A;  4LER A;  3L6A A;  3SFZ A;  5LFA A;  3FUH A;  2FF4 A;  3ENE A;  5CCM A;  2JK8 A;  4JHR A;  3SNX A;  3QAQ A;  1H2V C;  4G2V A;  3CHM A;  3UX4 A;  1YA0 A;  4GML A;  3RJV A;  3D9L A;  3NF1 A;  2J07 A;  3FDH A;  1IYG A;  3N3U A;  2WVI A;  3CGH A;  3FTS A;  3L22 A;  2JLB A;  2RG8 A;  2R5S A;  3CHR A;  4U0S A;  3G2T A;  3KD7 A;  3CHS A;  4PS8 A;  2GRL A;  3EJN A;  4GAA A;  3PRZ A;  5BV0 A;  4HOT A;  1IHG A;  2WMN A;  1N54 A;  1UJK A;  3NZU A;  2XGS A;  3WXX A;  4ANU A;  4FAD A;  4HOQ A;  4I43 A;  4LRZ A;  2DIW A;  4U8H A;  1PY1 A;  3OXG A;  3ZEF A;  3ZHE B;  4N3C A;  4C9B B;  3VLE A;  2NXP A;  4J8S A;  3FHE A;  5ARG A;  2C0M A;  1UG3 A;  3RKV A;  1FCH A;  5C2Y A;  3KAE A;  3MKQ B;  4KXK B;  4CT4 A;  2IOS A;  4CDN A;  4BX8 A;  2A4Z A;  4WNF A;  4G24 A;  3U3W A;  1E8X A;  5EKQ D;  3PEV B;  1HF8 A;  4W9R A;  3ZHE A;  2R17 C;  2NSZ A;  1Y8M A;  4ACL A;  3FP3 A;  3PZD A;  4DJA A;  3D9K A;  4ANW A;  4GYY A;  1HS6 A;  1SZ9 A;  4URK A;  3OXL A;  4AXH A;  3G2V A;  3S2A A;  3PVL A;  4EPZ A;  3ML9 A;  3ZPJ A;  1S0P A;  3CSF A;  4R7L A;  1QNF A;  1W3B A;  2M63 A;  4Y6C A;  2RD0 A;  3FTX A;  3TXM A;  3EIQ C;  2AW6 A;  4UI9 K;  4G25 A;  3FUE A;  4OVV A;  5LOZ A;  3UUX A;  4KVM A;  1OWO A;  3GZS A;  1H6K A;  3LET A;  2OND A;  4XZ4 A;  3D9N A;  4XKC A;  4AOF A;  5HI7 A;  2I1K A;  5DBK A;  3ASD A;  5FT9 A;  1ELK A;  2KM4 A;  2WPV A;  3S7B A;  3FH8 A;  2FEZ A;  3L54 A;  4UWF A;  3BG1 B;  3FEY A;  3RO2 A;  5BW8 C;  3PNT B;  3JQ1 A;  3OAW A;  3Q15 A;  4JL0 A;  5BV1 A;  3FY4 A;  4ABN A;  3PDN A;  5G05 J;  5A6C A;  4I6J A;  3IKO B;  3JUI A;  3CVX A;  4WWN A;  5FJY A;  4LUN U;  5FTP A;  4JA9 A;  3ZYL A;  2FI7 A;  3HIZ A;  4CCA A;  1Z3Y A;  2MRI A;  1UJJ A;  4WUY A;  4MKT A;  4FU3 A;  4WND A;  3VLD A;  4A1S A;  5CCL A;  3ONK A;  3PS6 A;  4H7X A;  5A7D B;  1EYH A;  3DPD A;  4Q69 A;  4FJY A;  3ZLM A;  2QFC A;  1H2T C;  2IFU A;  4GA0 A;  5T4Y A;  3U9W A;  3B7S A;  3S7F A;  1HZ4 A;  3SBS A;  3T5V A;  2WXP A;  1HH8 A;  4J0U A;  4ANV A;  4HVB A;  2BF0 X;  4UI9 C;  4RVB A;  5D0Q D;  4YVQ C;  3CKC A;  2WMO A;  3LS8 A;  4FLH A;  4BT9 A;  3FUK A;  3KEZ A;  5JJT A;  3ESK A;  3PH0 C;  1U3D A;  4B8C B;  4DI3 A;  3LVR E;  5BT1 A;  3VTX A;  1B89 A;  2WXG A;  4HS2 A;  3TXN A;  3CST A;  4N2Q A;  4YND A;  3PNL B;  4U04 A;  2XCC A;  4AY6 A;  3CKB A;  4N5C A;  3JYS A;  1DVP A;  5G55 A;  2MHK A;  4G23 A;  4G26 A;  3OTN A;  4B94 A;  4U07 A;  4PUC A;  4JHJ A;  5ARF A;  4PDX A;  2XPZ A;  3ASH A;  3PUJ A;  4NAC A;  4ACK A;  3APF A;  4F3V A;  3OXF A;  3PE4 A;  5FZQ A;  4I9E A;  4X2D A;  3FTV A;  2KCK A;  5FZR A;  1ZU2 A;  3CR3 A;  1Z6T A;  2PM6 A;  2WXK A;  3MCX A;  2I2O A;  4WWP A;  3CHO A;  3SGH A;  2VJ8 A;  2YNQ A;  1KT0 A;  2I6H A;  4LU4 A;  2C2L A;  4JPS A;  3TJP A;  5M72 A;  3APC A;  2PM7 A;  3GZ1 A;  4IUL A;  3GW4 A;  4AV7 A;  4GZ5 A;  2HR2 A;  2XPY A;  2AXV A;  5CKL A;  3AS4 A;  4NUR A;  4KZC A;  4CRW A;  2WXJ A;  3ZW3 A;  2WXO A;  2CG2 A;  4XE0 A;  2IOL A;  4CDR A;  4IRU A;  1JWF A;  4ATG A;  4GPK A;  1KLX A;  4FHJ A;  5KJM A;  3HVE B;  3TG5 A;  2WXF A;  4I6E A;  2WXI A;  3D9I A;  4U0Z A;  2BUG A;  2KAT A;  5LX8 A;  2FBN A;  1NP7 A;  2E2E A;  2XPI A;  3MEK A;  4J8E A;  5JJ6 A;  1E8Z A;  1H0A A;  5G04 J;  5AEN A;  3P1U A;  3ML8 A;  4DLQ A;  4CEM A;  3LEW A;  3U66 A;  4M3O A;  4WNE A;  4JEU A;  3HVE A;  2DCP A;  4HXI A;  3AS5 A;  4TUU A;  4B8A A;  3B13 A;  3IV0 A;  2WM9 A;  4A55 A;  3CVL A;  2IJG X;  2XCB A;  4NPS A;  2LO6 A;  3P2B A;  3ZGQ A;  2XHE A;  3D3M A;  3QB2 A;  4UWH A;  2R59 A;  2YQ8 A;  2VSX E;  3ZRH A;  4XI0 A;  2ION A;  3S7J A;  4K03 A;  3FTY A;  3NQP A;  4U0U A;  1HFA A;  2IU1 A;  2LAH A;  2Y4U A;  4HFG A;  4EEC A;  5CMT A;  3LY9 A;  2I1J A;  1PAQ A;  3EIJ A;  3SF4 A;  2KC7 A;  2V8S E;  5CGL A;  3FUI A;  2HO1 A;  2OV8 A;  4BTA A;  1HO8 A;  3VLF A;  4ILI A;  3MKQ A;  4GZC A;  1WAO 1;  2X6H A;  4XI8 A;  4AVX A;  1UN8 A;  3CLJ A;  4ILG A;  1MHQ A;  2HM8 A;  4WNG A;  4N2S A;  3LPZ A;  3RRU A;  2GW1 A;  3CVN A;  2X6J A;  4EZK A;  4XKB A;  3FH7 A;  3I5P A;  3CVV A;  3UMV A;  2OVF A;  4N67 A;  2VQ2 A;  3DBS A;  3QDN A;  1E96 B;  4I1O B;  3E4B A;  3IBE A;  3FUN A;  3JQ0 A;  3MJW A;  2J49 A;  4ILH B;  2Y3A A;  3G2S A;  5CMY A;  3T5X A;  2GGF A;  2X6I A;  4GYW A;  4IYP A;  4BFR A;  1INZ A;  4X2E A;  3Q49 B;  4MRU A;  3LY8 A;  3EHM A;  5A23 A;  3HYM B;  4XI9 A;  3CVW A;  4I17 A;  1E7U A;  4I1M A;  1IQR A;  2AXZ A;  1E7V A;  2LSU A;  2MOW A;  3FUF A;  4I9C A;  3TG4 A;  3FUD A;  4FHK A;  4WWO A;  2X6K A;  4EZL A;  3R7Q A;  4UQZ A;  1HX8 A;  5G2N A;  4CGW A;  1UN9 A;  3QWV A;  4AJW A;  2XEV A;  3FWV A;  3QKY A;  4I1A A;  2XGO A;  4L7T A;  2L9B A;  4I6G A;  3SE5 A;  3ULQ A;  3FU0 A;  2EQX A;  4F7A A;  5DIZ A;  4XX5 A;  4AP2 A;  1TJC A;  4JEH A;  1HU3 A;  1EF1 C;  2XRZ A;  1HG5 A;  5FQ4 A;  2AWI A;  2A5U A;  3Q47 B;  4J8F A;  4KVO A;  1SZA A;  3FU3 A;  3MV2 B;  1X5B A;  2UWJ G;  3APD A;  4TRQ A;  3RU0 A;  3L17 A;  2G03 A;  3CK7 A;  3ZN3 A;  5JHB A;  3RRN B;  1P5Q A;  2PQN A;  1WM5 A;  3EDT B;  3U4T A;  4L1B A;  4N39 A;  3LXU X;  4NQ0 A;  1TEZ A;  3LKU A;  3AU4 A;  4MLP A;  1BPO A;  1OWN A;  3ZVV A;  3EHN A;  4J6I A;  4KMO A;  5D0O D;  4E85 A;  5KJL A;  4UWK A;  4A1G A;  3FFL A;  5E75 A;  5JHA A;  4BY6 A;  4HOR A;  4YVO A;  1QZ2 A;  3PRE A;  2VGX B;  3HDX A;  1OWP A;  1EPU A;  4DLO A;  3MA5 A;  2J9Q A;  1UW4 B;  4E6H A;  3UT7 A;  1DNP A;  3C98 A;  3B7U X;  2VYI A;  4JC8 A;  3CVQ A;  3QK0 A;  5KJK A;  4N3A A;  3N71 A;  5ANL A;  3PUK A;  4J8D A;  4NRH B;  4H7Y A;  2KCL A;  2P58 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...