4U0SA

Structure of eukaryotic fic domain containing protein with adp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
326
structure length
323
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSINSALRRVMEETYYHHIYHTVAIGGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 323
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u0sA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u0sA01
4JA7A 3TAXA 3MKRA 4U04A 4H7XA 1OUVA 2YQ8A 3MEKA 3UUXA 3SF4A 4UQYA 4XI0A 5HI7A 1QQEA 3LY9A 4B94A 4KXKB 4WNGA 5M72A 2FO7A 4U0SA 4Y6CA 4N3BA 5A7DB 4YNDA 3QWWA 3LCAA 2BUGA 5CMTA 2XCBA 3KAEA 3FWVA 3K9IA 3S6AA 2FF4A 4CDRA 2QFCA 2PQRA 5CCMA 2KATA 4CGWA 3CK9A 4GPKA 2DBAA 4G25A 4AY5A 3Q15A 4N2QA 2HR2A 1KT0A 4WNFA 2KCLA 5CKLA 3OXLA 5CGLA 3QDNA 3LYAA 3GW4A 2KCVA 3URZA 5KJKA 3ZPJA 2PL2A 4NRHB 3N3UA 1QZ2A 4RG9A 2PQNA 4U0ZA 2UY1A 4G23A 2F6SA 2E2EA 3ASGA 2UWJG 2C2LA 3CUCA 4JA9A 4I9CA 3ASDA 3CEQA 1W3BA 1YA0A 4J8EA 2VYIA 3ASHA 3ULQA 4LU4A 3ESKA 3CVQA 3ASFA 3ZCBA 1HH8A 2UY1B 3ZLMA 3PE4A 3SZ7A 1WAO1 2KC7A 4CGVA 3ZHEA 5A6CA 3OXGA 4G26A 3NF1A 4I9EA 1B89A 2JK8A 4X2CA 3S7BA 2L6JA 1WM5A 2FEZA 4N67A 1TJCA 5G04J 2LNIA 2R5SA 1KLXA 3EDTB 3KS2A 5EKQD 3S7FA 2KCKA 3FFLA 2VY3A 5G04C 4GA1A 4LEUA 3LY8A 3ZHEB 4I17A 3JYSA 2LSVA 3CVNA 2AVPA 2NC9A 2WQHA 3PE3A 3MV3B 2VQ2A 3PDNA 5EX3A 2FBNA 4WNEA 4HORA 5EX0A 4XI8A 1P5QA 2C0LA 2Y4UA 4G24A 2V5FA 4H7YA 3R9AB 1HXIA 5BT1A 5FJYA 3FP3A 3AS8A 4ITRA 4W9RA 4BWRA 4WNDA 3QWVA 4GA0A 5JJTA 4YVOA 4WUYA 3CVPA 3RIBA 3U4TA 3VTYA 2JLBA 3OXFA 4G1TA 5D0OD 4U07A 2G03A 2P58C 3CV0A 3S7JA 3SE5A 3SHGA 4GCNA 3MA5A 2MHKA 2I6HA 4APOA 4YVQC 3CKCA 2GW1A 4ABNA 4IN3B 5JFZA 3RO2A 2XCCA 5DBKA 4UQZA 4JHRA 3AS4A 4AIFA 3RU0A 2XPIA 3Q49B 4GZ6A 1XNFA 4I2ZA 4NPSA 4HOQA 3WXXA 4GYOA 3VTXA 5KJNA 3SN9A 2OOEA 1FCHA 5FZRA 4I1AA 3QOUA 2VGXA 3U3WA 3LETA 4PY3A 3AS5A 5FZSA 2IF4A 4N5CA 2XEVA 2FI7A 2VGYA 1IHGA 4UI9J 1NA0A 4J8FA 1A17A 3Q47B 4X2EA 3O48A 4Y6WA 2VGXB 4UI9C 3ZN3A 4HOTA 3GZ2A 3LY7A 4N39A 5AYWD 1KT1A 3CVLA 5C1DA 5DIZA 4A1SA 3CK7A 3UPVA 2VSYA 4O6FA 5HQ8A 2WPVA 3TG5A 2XGSA 3ZFWA 1NA3A 2VSNA 3HYMB 4RG6A 3UQ3A 5JJ6A 1PC2A 4M16A 3BEEA 2ONDA 3TG4A 3MV2B 4GA2A 3Q5MA 2XGOA 2HYZA 5FT9A 5EU0A 4I2WA 4X2DA 3S7DA 2YHCA 4GZ3A 3ZC7A 3RO3A 3Q4AB 1ELWA 5G05J 2XGMA 3LPZA 4NQ0A 3GZ1A 4N3CA 4AM9A 4N2SA 3RJVA 4JL0A 4J8DA 3QWPA 3KD7A 4J0UA 5G05C 4BTAA 4ME2A 5JJ7A 3TGOA 4HOUA 3RKVA 2Q7FA 4UQXA 5ARFA 5FTPA 4XI9A 4UI9K 4KYOB 4EQFA 5BNWA 1ZBPA 4F3VA 2LSUA 4GCOA 4GYWA 4BTBA 4U0UA 2J9QA 3CK8A 2Y4TA 3GYZA 4AY6A 5FZQA 4KBQA 1Y8MA 4GZ5A 5LCWJ 5JFFA 4HOSA 5D0QD 5ARGA 3LKUA 1E96B 5LCWC 3CKBA 5BW8C 2VZAA 1ELRA 4XIFA 4N3AA 3E4BA 4BT8A 4GYYA 4BT9A 1ZU2A 4G2VA 2C0MA 5CHEE 1NZNA 1IYGA 3N71A 2IFUA 2PZIA 5KJMA 5CCLA 3ZGQA 3QKYA 5KJLA 1HZ4A 2HO1A 3IEGA 4WGJA
chains in the Genus database with same CATH superfamily
4JA7A 3MKRA 2XHEA 4M7CA 3EHRA 3TWRA 4LNBA 2IQCA 2DCPA 4XI0A 2R02A 3ZYQA 4E6HA 4TXQA 4Y6CA 4N3BA 2MRIA 4J6IA 3KAEA 3TXNA 3PEUB 3ZRHA 4FJZA 4JB8P 4FLHA 2ZISA 4A1GA 3KSLA 5CCMA 4XEIG 2I9CA 5KWDA 4L1BA 5CMYA 4Z68A 2F8YA 3ULEG 3E34A 4GPKA 3W9GA 2R05A 4QFVA 1U3CA 4LUNU 3AU4A 3L08A 3J5PA 2KCLA 1PY1A 3FH7A 4L23A 2P2CP 5CGLA 1X5BA 3TWQA 2IY0C 3QDNA 1HF8A 2KCVA 3Q9NC 3MX3A 1LF8A 2VGEA 3N3UA 3PZ4A 1QZ2A 4HXIA 5EILA 3AJIA 1Y6IA 4WWOA 4U0ZA 3Q78A 3V2XA 3ASGA 4MLPA 4U7EB 3U64A 4JA9A 4CYMD 3CEQA 1W3BA 4J8EA 4KVMA 1RW2A 3UT4A 1BLXB 3Q9UC 1U3DA 4CDMA 1D9SA 3B7SA 3ML9A 3PE4A 1WAO1 2P9IG 1D8EA 5A6CA 2L0IA 1UJJA 1B89A 1K3ZD 3G2WA 3E33A 2P9PG 4ANVA 2AW6A 2GGFA 1TJCA 1KLXA 5EKQD 3S7FA 4HB5A 3R9MA 2QZAA 3FFLA 2VY3A 4LNUD 3NZUA 5G2NA 5J08A 3Q73A 2XQ0A 2LSVA 3FTUA 2WQHA 4Q94A 3PE3A 2VQ2A 3PDNA 4DPRA 4GTSA 1N54A 3RRNB 2Y4UA 4F6RD 1TN8A 3R9AB 1NFIE 4AP2A 4APFA 3EHMA 4ITRA 4BWRA 4WNDA 4E85A 4XKBA 1BU9A 1DVPA 2CFZA 1YYHA 1H0AA 3Q7FA 2GRLA 5EYLA 3HIZA 3VTYA 4G1TA 3VLDA 4OAVB 2XEHA 4NACA 5D0OD 3NQPA 3X2QE 3I3NA 3CV0A 3SE5A 1OCCE 4GCNA 3BUAA 1TR4A 5BV0A 5ENQD 3UTMA 4AJWA 5B1AE 1SA4A 3ENEA 3SI5A 3EHNA 4HS2A 4UWHA 2AXZA 4GTOA 1MYOA 5JFZA 3DSUA 2XCCA 1TNUA 1TNZA 5FQ7A 3L22A 1IQRA 3V2OA 4CZ2D 4HI9A 4UWLA 1L5JA 1E7UA 1K8KG 2EQXA 2OVFA 5CEDB 4I2ZA 4NPSA 3PREA 3VTXA 3SN9A 1AP7A 2YINA 1FCHA 3HVEB 3ASNE 4JEHA 5FZRA 4DJAA 1HX8A 3ABKE 3U3WA 3MGBA 3FH5A 1KZPA 2FI7A 1H2TC 2VGYA 4ILGA 4UI9J 1H2UA 3CIAA 4YDEA 4J8FA 1Q2ZA 3Q47B 3DPDA 1SQMA 3APDA 3SFZA 3Q7AA 3ZN3A 4HOTA 3LY7A 4N39A 1KT1A 2R2LA 3HDXA 5C1DA 3DEPA 3CHPA 4BSXA 4A1SA 5AENA 2VSYA 3DXKG 3HRAA 4O6FA 4PS8A 2J08A 3TG5A 3CGHA 1V54E 4EBAA 3AAAC 2A5UA 4TXPA 2ETBA 5KCMA 3JXIA 4F1PA 2NXPA 4DI4A 3KSQA 3HYMB 4PS3A 5T4YA 5AN8A 3PEVB 3UQ3A 2ETCA 5JJ6A 3D9OA 2XS1A 4M16A 1HU3A 1S63A 2WVIA 4L7TA 4DX6D 1OXJA 4Q69A 4BX8A 4GA2A 1FVHA 1QYMA 4YDYA 4YDWA 3D9JA 3TWVA 2HYZA 4JC8A 5FT9A 2YHCA 4FU3A 4GZ3A 1UW4B 3PZ1A 1Z6TA 4K0RA 3Q4AB 1NL4A 4ATGA 2KZTB 4FC8A 3TWWA 3LDZA 5G05J 2XGMA 1EYHA 4R7LA 4N3CA 4B0ZA 3RJVA 1N4PA 4J8DA 3OTNA 3RRUA 4J0UA 4JD2G 4BTAA 3J5QB 4HNAD 1BI8B 3RKVA 4UQXA 2V4HC 2KM4A 3LXUX 4P29A 1TNYA 5BNWA 1H6KA 2CHWA 2X3MA 3PUKA 2WXRA 4BTBA 3FUHA 2VJ8A 4ILHB 2J9QA 1N0RA 5ENPD 5EN5D 2DVWA 2Y4TA 5JHBA 1MJ0A 1Y8MA 4XE0A 5JFFA 1NP7A 5ENOD 4HBDA 3LKUA 1E96B 5LCWC 3PS6A 3C72A 3F6QA 3ZVVA 2OEVA 5HKPA 2R03A 4WWNA 3E4BA 4FULA 4GYYA 4BT9A 1ZU2A 3I4RB 5FWQA 2Y0BG 3PZDA 4L2LA 1UJKA 4ANXA 1E90A 2IFUA 3DWLG 3ZYMA 2PZIA 3UM2A 1N0QA 1HZ4A 2HO1A 2IO3C 1PAQA 5AJDA 2CHXA 3TAXA 4U04A 5HRYA 3UUXA 2YNQA 1IQUA 4UQYA 1TEZA 1O1TA 1QQEA 3D9IA 5AQBA 4WNGA 4J8SA 3SGHA 4TUUA 4B8CB 4YNDA 2CFUA 3QWWA 4WAFA 3K9IA 1HG2A 3SNXA 2NUNA 5A23A 3ZW3A 2OVBA 5AJLA 2PQRA 2Y1LE 4CGWA 3QARA 1X81A 2R59A 3CK9A 2DYSE 1WY6A 2LUHA 2DBAA 2M63A 5CBOA 2HR2A 2BEDA 3D9PA 2J07A 3EU9A 4TV3A 3TWSA 2MOWA 4CDNA 3GW4A 1DC2A 2PL2A 2L0TB 4NRHB 3QNKA 1H6OA 4RG9A 5FQ4A 2UY1A 4U8VD 4G23A 4OVUA 3BG0B 2F6SA 3FU0A 4GMRA 2UWJG 2I2OA 3CVYA 4I9CA 1YA0A 2VYIA 4LU4A 2QY7A 3ASFA 3PUJA 1HG5A 1QBQA 3ZCBA 1HH8A 4J7WA 3HXCA 5BV1A 4O1PA 4EECA 3SZ7A 4M3OA 2KC7A 4BETA 4CGVA 3CSFA 3OXGA 4AV7A 4I9EA 1OCRE 4X2CA 4QQIA 2CG2A 3S7BA 2L6JA 1WM5A 5C2YA 3AG2E 4IRUA 2KBXA 4GA1A 4LEUA 3APFA 3ZHEB 4I17A 3FU6A 2DZNA 4K5AB 2AVPA 2NC9A 3MV3B 4JHKA 5EX0A 2C0LA 4ZFHA 2V5FA 1HXIA 5BT1A 3EJNA 5FJYA 3PH0C 3C3QA 3ZUVB 3R7QA 4DX1A 4F1SA 5AQ7A 3JUEA 4GB9A 3TL5A 2L6BA 4GA0A 2WQ7A 2P9NG 3EIJA 1HO8A 4XZ4A 4G11A 1JPLA 4AVXA 4A63B 4GMLA 3RIBA 4ATZD 2GROB 3DXMG 2EIME 4FP7A 4JVSA 3DEOA 3Q79A 3PZ3A 4U07A 1N11A 4YDOA 4AOFA 3SHGA 3MYVA 4TXRA 5CEAA 2L9BA 3P2BA 4A3VA 4I1MA 4PS7A 4APOA 3FULA 3CKCA 3FTZA 2GW1A 3FTYA 4ABNA 3HXFA 2WB2A 5DBKA 4UQZA 1H2VC 3IXEA 2JABA 4AIFA 2OEWA 2X38A 3SFXA 4GZ6A 3P1UA 4HOQA 3WXXA 3RAUA 1JWGA 2OOEA 3D9LA 3VLFA 4RVBA 4DI3A 4FHJA 1LTXA 4KZCA 3LETA 2VTBA 3TXMA 2WXQA 3APCA 1IHGA 5J90A 2V8SE 3ML8A 3B7BA 3CVUA 5IY5E 2VGXB 1OCZE 4UI9C 5H7PA 4DUIA 3ZEFA 5AYWD 1D8DA 2I1JA 3CVLA 5BUZA 5EIDA 3HXDA 1G3NB 4D10C 5CBNA 4PUCA 3SO8A 3FTXA 3UKUG 2LO6A 5HQ8A 3UINC 2WPVA 4K03A 3DPYA 1Z5SC 2ETAA 2LXLA 2OV8A 3U66A 2DYRE 3NOGD 2NYJA 3TWTA 3E37A 4PH4B 3QAQA 3IV0A 3FDHA 3CR3A 1PC2A 4MRUA 3TG4A 1E7VA 3L16A 1OWLA 2GRRB 2PNNA 3FTWA 3S7DA 4DLQA 2PM6A 2RFMA 3ZC7A 2YHEA 3RO3A 2AWIA 4HQDA 5EDSA 3GZ1A 4AM9A 3SY2A 4V3IA 4DK5A 1S0PA 1Z3XA 5G05C 4A3TA 4EPZA 5G55A 1O5MA 2Q7FA 5ARFA 3IKOB 3FUIA 4UI9K 1UN8A 2X6FA 5HS0A 4F3VA 4B93B 2IOSA 4FLBA 4GPMA 3HHMA 4JPSA 2IOLA 3DSSA 1OWMA 3EU5A 2CHZA 3SQVA 4IYPA 3GYZA 4U8HA 5AQAA 3PZ2A 5FZQA 3SBSA 4C0EA 2WXLA 4KBQA 1E8XA 4HOSA 4MKTA 3IHVA 3CKBA 4L9PA 1ELRA 4XIFA 3FU3A 3IBEA 3LS8A 3KEAA 4MBGA 3L17A 3ULYA 3QJZA 3EHQA 4DLOA 3NAWA 4I1OB 3FUJA 5KJMA 5CCLA 4ANWA 3QKYA 1MX2A 2WQ6A 3L6AA 1OWNA 4LCTA 3CHMA 1OUVA 2XEEA 2F8XK 2QYJA 1MZCA 2WXMA 3MEKA 1JCRA 3SF4A 1TNOA 1IKND 3CVXA 3UM0A 3UX4A 4O60A 4CEMA 2X6HA 4KXKB 4DX5D 3G2VA 4FJYA 3ABME 4IULA 4XKCA 3OAWA 3UT8A 5A7DB 3LCAA 2BUGA 5CMTA 2XCBA 3FWVA 3S6AA 3EUVA 4CDRA 3ONLA 4C48B 2DIWA 3FU5A 4A55A 2ZIRA 3ONKA 1HFAA 2JEKA 3U9WA 4HI8A 4G25A 4F7AA 4AY5A 3Q15A 4N2QA 3FEYA 2BKGA 4KMOA 1TN7A 3LEWA 4U8YD 2EIKE 5CKLA 2WXFA 3OXLA 1O1RA 3V31A 2F0YA 3D3MA 4BSZB 2WXIA 3ZPJA 3C5RA 5AQ9A 3JQ1A 1K1AA 5ENRD 3ZKJA 3D9KA 1LD8A 2E2EA 4GAAA 3T8KA 3VLEA 2FO1E 2C2LA 1OT8A 3CUCA 3B7UX 4HLLA 3ASDA 1N52A 3C3OA 3SFYA 2HM8A 3ULQA 3RSEG 3V30A 5LX8A 1GW6A 4HRNA 5CECB 1VDYA 3CHOA 5FQ8A 2KXPC 1S64A 4NURA 5G04J 2LAIA 2LNIA 2R5SA 3EDTB 3KS2A 1UN9A 2RG8A 3LY8A 3MCXA 2ZGGA 3JYSA 3B13A 2P9UG 4GMJA 5EX3A 2FBNA 4JEUA 4WNEA 4GU5A 3S2AA 3NB2A 4G24A 1MHQA 5ANRA 3JUIA 4H7YA 4BESA 1MQSA 3AS8A 2XPYA 4LERA 3HXEA 4K5BA 4UUCA 3SBTB 1MX4A 4AXHA 3UI2A 3UMVA 2X6IA 2BF0X 1YMPA 4WUYA 1E8ZA 3CVPA 3U4TA 2VSXE 3ESLA 4G8KA 4Q96A 3ISMC 4X8QA 3ZXPA 2H6FA 2P58C 2WMOA 3S7JA 1K1BA 1OWOA 5B3SE 4L2YA 2MHKA 3BG1B 1LD7A 5EIBE 5CERB 4UWKA 2A4ZA 4YVQC 4BY6A 4DX2A 3I5PA 1JUQA 3HVEA 5ENSD 3GZSA 4JHRA 2FULA 1FVFA 1HE8A 2XPIA 2XS8A 1XNFA 2NSZA 1WG0A 4GYOA 3LVQE 1ELKA 2XENA 4I1AA 2IJGX 3C3RA 3B7RL 3AG1E 4TUMA 4KZ0A 2A5EA 5E76A 4PY3A 4UWFA 5FZSA 4JHJA 3MJWA 2IF4A 5ENTD 3C98A 5KNHD 4ILIA 1A17A 2VSOE 4X2EA 1N4RA 2WMNA 5CRUA 3MZLB 2EILE 4HRMB 5JMND 2RFAA 3UPVA 1FT1A 4BX9A 3PVLA 4ANUA 3T5XA 3D9HA 1TN6A 5D66A 2XGSA 3G2UA 2QYUA 3ZFWA 1NA3A 5LP0A 3LJ3A 1UG3A 5AARA 3BEEA 4URKA 2ONDA 4WWPA 4ACKA 1SA5A 2KZTA 3MV2B 4CCAA 2EIJE 2WXGA 2XGOA 1QNFA 4GTTA 5BPPA 5T3RA 1A5EA 3FUDA 4FHKA 3T5VA 4ZHBA 2F37A 3ZU7B 2IO2C 2ZU6B 4NQ0A 3G2SA 4N2SA 3DRAA 4JL0A 3T9KA 5KBAA 3QWPA 4GTQA 3ZXSA 4EZKA 4ME2A 3FTSA 4HOUA 3FTVA 3WG7E 5FTPA 1TJFA 3CHQA 4XI9A 4OVVA 5EYPF 4EHMA 3TJPA 1XGWA 4LSZE 4EQFA 1OCOE 1JWFA 3ZIMA 3FUFA 2XPZA 3UM1A 4U0UA 2XRYA 2Y3AA 3HXBA 3UIPC 4I6JA 2J09A 5FINA 3B95A 3CK8A 4U63A 3DSVA 3AG3E 4AY6A 4GZ5A 1EPUA 3R7RA 2EINE 2MYOA 4DRXE 5JHAA 3FH8A 2BTDA 1BI7B 3RK6A 2HE0A 4N3AA 4G2VA 2C0MA 3AU5A 5CHEE 1INZA 2ILRA 1JCSA 4U96D 5T8IA 3ZGQA 5KJLA 4FADA 4LNGA 4I43A 4WGJA 3KEZA 2AJAA 4FA6A 4H7XA 2YQ8A 4MS6A 1E8YA 3TWXA 1H6PA 1FT2A 1KZOA 5HI7A 4KT6B 3LY9A 4B94A 1BPOA 1SW6A 5M72A 2FO7A 1OY3D 1E8WA 4U0SA 2E0IA 2IU1A 2IEJA 4GZDA 5ENNA 2FF4A 2QFCA 3NOCD 3SHFA 1NI1A 2P9KG 1AWCB 2KATA 4CT0A 1IHBA 1ZB1A 2GRPB 5JA4D 3L54A 2GRNB 3BU8A 1KT0A 3JCKC 4WNFA 1V55E 2ZGDA 3SD5A 4G8LA 3UT7A 3CVVA 1RZ4A 3JQ0A 3LYAA 3FEXA 3HG0D 2WXHA 3URZA 3O4ZA 5KJKA 2LAHA 1N9AA 1S70B 4PDXA 2WXOA 3CLJA 4GTPA 2PQNA 3FUNA 3CSTA 3UKRG 4B8AA 2OCCE 2XZDG 3BQOA 3E32A 2I1KA 3DSXA 4BFRA 4OYSA 4KVOA 3PNTB 3ASHA 4O1OA 3ESKA 4DX7D 3CVQA 3FY4A 1U2VG 2UY1B 3QB2A 3ZLMA 1DNPA 4BEPA 3ABLE 4J8YA 5LFAA 2GRQB 3ZHEA 2WXKA 3MKQB 3PRZA 1N94A 3NF1A 4G26A 2JK8A 2CG3A 5AIJA 2V0PA 2FEZA 1TNBA 4N67A 2ZXWE 2V5QC 3G2TA 3PNLB 2KCKA 4JW1A 5KNGA 5G04C 2XRZA 1H19A 3DBSA 3CVNA 2B6CA 4NIKA 2RD0A 4UWGA 4HORA 3QK0A 3UIOC 4XI8A 1P5QA 3FUKA 4JZYA 1DCEA 3V79K 3FP3A 2QC9A 4W9RA 4U95D 2J4DA 3ASOE 3QWVA 4XX5A 4EZLA 2RKKA 1NH1A 5D2MC 2LXMA 4F53A 1O1SA 4LG6A 5JJTA 3CHRA 4YVOA 1N95A 2JLBA 3OXFA 4HFGA 2DZOA 1N4QA 2J49A 2G03A 3MA5A 2I6HA 3NBNB 2X6KA 2B0OE 4CT4A 2Y69E 2P9SG 3ZYLA 1EF1C 4IN3B 3RO2A 1WDYA 4BERA 1MX6A 3AS4A 3CHSA 3RU0A 3Q49B 4C0MA 4N5QA 3RRMB 2P9LG 2J4BA 4B89A 3TWUA 5KJNA 3Q75A 3B7TA 3QOUA 2H6HA 2VGXA 1HS6A 3DSWA 3AS5A 4EZJA 1N4SA 1OWPA 4N5CA 3D9NA 2XEVA 5ANLA 1NA0A 3O48A 4Y6WA 3CQGB 3GZ2A 2VTBB 1TYQG 1EDUA 1FPPA 5DIZA 4HVBA 2WXPA 4ACLA 3CK7A 4GTMA 3L82A 5E75A 1SVXA 5BXOA 1Z3YA 1IXVA 2VSNA 4LRZA 4I6GA 1UOHA 4RG6A 3L9TA 2X6JA 2GRMA 3W9FA 3I4GA 1SZ9A 5AAOA 4OAUC 3FUEA 3UXGA 3E30A 4GZCA 2V4LA 3Q5MA 5LOZA 2PM7A 1JCQA 5FQ6A 5EU0A 3DSTA 4I2WA 3UM3A 4X2DA 2AXVA 2AXUA 3ZYKA 3EIQC 3LVRE 1ELWA 2NUDA 3LPZA 4CRWA 2WXNA 4RLYA 3KD7A 2WM9A 3CQCB 5JJ7A 3TGOA 2J8SD 3FUMA 4TRQA 4C9BB 3L13A 4K5CA 4RSYA 4KYOB 3NZSA 5FIOA 3AG4E 2IONA 3CVWA 3QC1A 1ZBPA 2H6IA 1SZAA 5ITZF 2LSUA 2H6GA 4GCOA 4RQIA 4GYWA 2WXJA 1BD8A 3LJNA 3D9MA 4I6EA 5CRVA 4AEZC 2DWZA 4HRLA 2R17C 4GTVA 5LCWJ 5D0QD 5ARGA 2XZTG 4GTRA 3MKQA 4JXTA 3T8MA 3IHYA 1DCQA 5BW8C 2VZAA 5BXUA 5CMWA 4BT8A 4HLEA 1NZNA 1IYGA 3FHEA 3N71A 5B1BE 3JXJA 2BKKB 3ZNGA 4EBAG 1YCSB 3IEGA 1KPSB
chains in the Genus database with same CATH topology
2CHXA 4FA6A 4JA7A 4LCTA 3TAXA 3MKRA 4U04A 2XHEA 3CHMA 4H7XA 1OUVA 2YQ8A 2WXMA 3MEKA 4MS6A 1E8YA 3UUXA 3SF4A 2YNQA 1IQUA 3CVXA 4UQYA 1TEZA 2IQCA 3UX4A 2DCPA 4XI0A 5HI7A 1QQEA 4KT6B 3LY9A 3ZYQA 3D9IA 4CEMA 2X6HA 4B94A 1BPOA 4KXKB 4WNGA 4E6HA 5M72A 2FO7A 4J8SA 3G2VA 1E8WA 4FJYA 4U0SA 3SGHA 4TUUA 4Y6CA 4IULA 4XKCA 4N3BA 3OAWA 2E0IA 3UT8A 4B8CB 5A7DB 2MRIA 4YNDA 2CFUA 2IU1A 3QWWA 4J6IA 3LCAA 2BUGA 4WAFA 4GZDA 5CMTA 2XCBA 3KAEA 3FWVA 3TXNA 3K9IA 3PEUB 1HG2A 3ZRHA 5ENNA 3S6AA 4FJZA 3SNXA 2FF4A 4CDRA 5A23A 3ZW3A 3ONLA 4FLHA 2QFCA 4A1GA 2OVBA 2DIWA 5AJLA 3SHFA 2PQRA 3FU5A 5CCMA 2I9CA 4A55A 2KATA 3ONKA 4L1BA 4CGWA 1HFAA 5CMYA 3QARA 4CT0A 2R59A 2JEKA 3CK9A 3U9WA 1WY6A 4GPKA 2DBAA 4G25A 3L54A 4F7AA 4AY5A 3Q15A 4N2QA 2M63A 3FEYA 2HR2A 4QFVA 1U3CA 1KT0A 4LUNU 3AU4A 4KMOA 3JCKC 3D9PA 3L08A 4WNFA 2KCLA 1PY1A 2J07A 3SD5A 3LEWA 3FH7A 5CKLA 2WXFA 3OXLA 4L23A 3UT7A 3CVVA 5CGLA 4TV3A 3JQ0A 1X5BA 3QDNA 1HF8A 2MOWA 3LYAA 3D3MA 3GW4A 4CDNA 2KCVA 3FEXA 2WXHA 3URZA 2WXIA 3O4ZA 3MX3A 5KJKA 3ZPJA 2PL2A 2L0TB 2LAHA 1LF8A 4NRHB 3QNKA 3N3UA 4PDXA 2WXOA 3CLJA 1QZ2A 4HXIA 4RG9A 5FQ4A 2PQNA 1Y6IA 3JQ1A 4WWOA 4U0ZA 2UY1A 3FUNA 4G23A 3D9KA 3BG0B 4OVUA 3CSTA 2F6SA 3FU0A 4B8AA 2E2EA 4GAAA 3ASGA 3VLEA 2UWJG 2C2LA 4MLPA 2I2OA 2I1KA 3U64A 4BFRA 3CVYA 3CUCA 3B7UX 4I9CA 4JA9A 3ASDA 3CEQA 4KVOA 4OYSA 1N52A 1W3BA 1YA0A 3PNTB 4J8EA 2VYIA 3ASHA 4KVMA 2HM8A 4LU4A 3ULQA 3UT4A 2QY7A 1U3DA 4CDMA 3ESKA 3CVQA 3ASFA 1GW6A 5LX8A 3FY4A 1HG5A 3ZCBA 3PUJA 1HH8A 3B7SA 3ML9A 2UY1B 3QB2A 5BV1A 4EECA 3ZLMA 1DNPA 3PE4A 4M3OA 1WAO1 3SZ7A 2KC7A 5LFAA 4CGVA 1VDYA 3ZHEA 5A6CA 2WXKA 2L0IA 3CSFA 1UJJA 3MKQB 3OXGA 3NF1A 3PRZA 4G26A 4I9EA 1B89A 3CHOA 4AV7A 2JK8A 4X2CA 2CG3A 3G2WA 2CG2A 3S7BA 2L6JA 4ANVA 5FQ8A 5AIJA 1WM5A 2V0PA 4NURA 2AW6A 2GGFA 2FEZA 4N67A 5C2YA 1TJCA 5G04J 4IRUA 2LAIA 2LNIA 2R5SA 1KLXA 3EDTB 3KS2A 3G2TA 5EKQD 3PNLB 3S7FA 1UN9A 2KCKA 2RG8A 3FFLA 4JW1A 2VY3A 5G04C 4GA1A 4LEUA 3NZUA 3APFA 5G2NA 5J08A 3LY8A 2XRZA 3ZHEB 3MCXA 4I17A 2XQ0A 3JYSA 1H19A 3B13A 3FU6A 2LSVA 3DBSA 3CVNA 2AVPA 2NC9A 3FTUA 2WQHA 4GMJA 4Q94A 3PE3A 3MV3B 2VQ2A 3PDNA 4DPRA 5EX3A 2FBNA 2RD0A 1N54A 4JEUA 4JHKA 4UWGA 4WNEA 4HORA 5EX0A 3QK0A 4GU5A 3RRNB 3S2AA 4XI8A 1P5QA 2C0LA 2Y4UA 3FUKA 1MHQA 4G24A 4JZYA 5ANRA 3JUIA 2V5FA 4H7YA 3R9AB 1HXIA 5BT1A 3EJNA 4AP2A 5FJYA 3PH0C 3FP3A 4APFA 3R7QA 3EHMA 1MQSA 3AS8A 4ITRA 4W9RA 4F1SA 4BWRA 4GB9A 2J4DA 3QWVA 4WNDA 2XPYA 4LERA 4XKBA 4XX5A 3TL5A 4E85A 4EZLA 4GA0A 2WQ7A 3SBTB 1DVPA 3EIJA 4F53A 4AXHA 1HO8A 2CFZA 4XZ4A 4G11A 3UMVA 2X6IA 1H0AA 5JJTA 1JPLA 2BF0X 3CHRA 2GRLA 4YVOA 4AVXA 4WUYA 4GMLA 1E8ZA 3CVPA 3RIBA 3U4TA 3HIZA 3VTYA 2VSXE 2JLBA 3OXFA 3ESLA 4G1TA 3VLDA 4Q96A 4FP7A 4NACA 4JVSA 5D0OD 4HFGA 3NQPA 2J49A 4U07A 2G03A 3I3NA 4AOFA 2P58C 3CV0A 2WMOA 3S7JA 3SE5A 3SHGA 4GCNA 1OWOA 4L2YA 3MYVA 5BV0A 3MA5A 4BY6A 2L9BA 2I6HA 2MHKA 3P2BA 4AJWA 3BG1B 4A3VA 2X6KA 4CT4A 4UWKA 4I1MA 4PS7A 4APOA 3ENEA 2A4ZA 3CKCA 3FULA 4YVQC 3SI5A 3ZYLA 3EHNA 1EF1C 3FTZA 2GW1A 3FTYA 4HS2A 4UWHA 4ABNA 2AXZA 3I5PA 4IN3B 1JUQA 5JFZA 3RO2A 2WB2A 2XCCA 5FQ7A 5DBKA 3L22A 1IQRA 3HVEA 4UQZA 3GZSA 4JHRA 2FULA 3AS4A 1FVFA 1H2VC 3CHSA 4UWLA 1L5JA 4AIFA 1HE8A 1E7UA 2XPIA 2X38A 3Q49B 3RU0A 4C0MA 3RRMB 2J4BA 4GZ6A 2EQXA 2OVFA 3P1UA 4B89A 1XNFA 2NSZA 4I2ZA 4NPSA 3PREA 4HOQA 3WXXA 4GYOA 3VTXA 5KJNA 3SN9A 2OOEA 1JWGA 3LVQE 2YINA 1FCHA 1ELKA 3HVEB 3D9LA 4JEHA 5FZRA 3B7TA 4I1AA 2IJGX 3QOUA 3VLFA 4DJAA 2VGXA 1HX8A 3B7RL 4RVBA 4DI3A 4FHJA 3U3WA 4KZCA 4KZ0A 3LETA 1HS6A 2VTBA 5E76A 3MGBA 4PY3A 3AS5A 4UWFA 4JHJA 3MJWA 2IF4A 2WXQA 5FZSA 3TXMA 3FH5A 1OWPA 4N5CA 3C98A 3D9NA 2XEVA 3APCA 5ANLA 2FI7A 1H2TC 2VGYA 4ILGA 1IHGA 4ILIA 4UI9J 1NA0A 1H2UA 3CIAA 5J90A 2V8SE 4J8FA 3ML8A 1A17A 4EZJA 3Q47B 2VSOE 3CVUA 3DPDA 4X2EA 3O48A 4Y6WA 2VGXB 1SQMA 3APDA 4UI9C 3SFZA 3ZN3A 2WMNA 3CQGB 4HOTA 3GZ2A 3LY7A 3ZEFA 4N39A 2VTBB 5AYWD 3MZLB 2I1JA 1KT1A 3HDXA 3CVLA 1EDUA 5BUZA 5C1DA 3CHPA 5DIZA 4HVBA 4BSXA 2WXPA 4A1SA 4ACLA 4D10C 3CK7A 5AENA 3UPVA 4BX9A 2VSYA 4PUCA 3PVLA 4ANUA 3FTXA 3T5XA 5E75A 4O6FA 2LO6A 4PS8A 5HQ8A 2WPVA 1Z3YA 4K03A 2J08A 3TG5A 2XGSA 2OV8A 3U66A 3CGHA 3G2UA 4EBAA 2A5UA 5KCMA 3ZFWA 2NXPA 4DI4A 1NA3A 2VSNA 3HYMB 4LRZA 4PH4B 3QAQA 4PS3A 5T4YA 4I6GA 5LP0A 3IV0A 3LJ3A 3FDHA 3PEVB 4RG6A 3UQ3A 1UG3A 5JJ6A 2X6JA 3CR3A 2GRMA 3D9OA 3I4GA 1PC2A 4M16A 1HU3A 1SZ9A 3BEEA 4MRUA 4URKA 2ONDA 2WVIA 4L7TA 4WWPA 4ACKA 2KZTA 3FUEA 3TG4A 3MV2B 4Q69A 1E7VA 4BX8A 4GA2A 3L16A 1OWLA 4GZCA 4CCAA 2WXGA 2V4LA 2XGOA 1QNFA 3Q5MA 1FVHA 5LOZA 2PM7A 3D9JA 2HYZA 5BPPA 4JC8A 5FT9A 5FQ6A 5T3RA 5EU0A 4I2WA 3FTWA 4X2DA 3S7DA 2YHCA 3FUDA 4FU3A 4FHKA 2AXVA 4GZ3A 2PM6A 2AXUA 4DLQA 3T5VA 1UW4B 1Z6TA 3ZYKA 4K0RA 3ZC7A 2YHEA 3RO3A 3EIQC 2AWIA 3Q4AB 5AJDA 3LVRE 1ELWA 4ATGA 2KZTB 4FC8A 5EDSA 3LDZA 5G05J 2XGMA 2ZU6B 1EYHA 3LPZA 2WXNA 4NQ0A 4CRWA 4R7LA 3GZ1A 4N3CA 4AM9A 4B0ZA 3G2SA 4N2SA 3RJVA 4JL0A 4J8DA 4V3IA 3OTNA 4DK5A 1S0PA 1Z3XA 3RRUA 3QWPA 3KD7A 4J0UA 5G05C 3ZXSA 4BTAA 4EZKA 4A3TA 4ME2A 4EPZA 2WM9A 3CQCB 5JJ7A 3FTSA 3TGOA 4HOUA 5G55A 3RKVA 3FTVA 2Q7FA 3FUMA 4UQXA 1TJFA 3CHQA 3IKOB 4TRQA 5ARFA 5FTPA 4XI9A 3FUIA 4C9BB 4OVVA 4UI9K 2KM4A 3L13A 4RSYA 4KYOB 3NZSA 1UN8A 3TJPA 2X6FA 1XGWA 3LXUX 4P29A 4EQFA 2IONA 5BNWA 3CVWA 3QC1A 1H6KA 1ZBPA 1JWFA 1SZAA 3ZIMA 2LSUA 4F3VA 4GCOA 2IOSA 3FUFA 2CHWA 2X3MA 4FLBA 3PUKA 3HHMA 4GYWA 2XPZA 2WXJA 4JPSA 2IOLA 2WXRA 4U0UA 1OWMA 3FUHA 4BTBA 2XRYA 2VJ8A 2Y3AA 4ILHB 3D9MA 2J9QA 4I6EA 4I6JA 2J09A 2CHZA 4AEZC 4IYPA 3CK8A 2Y4TA 2R17C 3GYZA 4U63A 4U8HA 4AY6A 5JHBA 5FZQA 3SBSA 4C0EA 2WXLA 4KBQA 1Y8MA 4GZ5A 5LCWJ 1E8XA 4XE0A 1EPUA 5JFFA 1NP7A 4HOSA 5D0QD 3R7RA 5ARGA 4MKTA 3LKUA 1E96B 3MKQA 5LCWC 3IHVA 4JXTA 3PS6A 3T8MA 5JHAA 3IHYA 3CKBA 3FH8A 5BW8C 2VZAA 3ZVVA 2BTDA 1ELRA 4XIFA 3RK6A 4N3AA 5CMWA 4WWNA 3E4BA 4BT8A 4FULA 4GYYA 4BT9A 1ZU2A 3FU3A 3I4RB 4G2VA 5FWQA 2C0MA 3IBEA 3LS8A 4HLEA 3AU5A 3L17A 3PZDA 4L2LA 5CHEE 1NZNA 1IYGA 3QJZA 1UJKA 4ANXA 3FHEA 1E90A 3N71A 2IFUA 3ZYMA 1INZA 4EBAG 4DLOA 2PZIA 4I1OB 3FUJA 2ILRA 5KJMA 5CCLA 5T8IA 4ANWA 3ZGQA 3QKYA 5KJLA 1HZ4A 2HO1A 4FADA 2WQ6A 3IEGA 3L6AA 1PAQA 1OWNA 4I43A 4WGJA 3KEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JA7 A;  3TAX A;  3MKR A;  4U04 A;  4H7X A;  1OUV A;  2YQ8 A;  3MEK A;  3UUX A;  3SF4 A;  4UQY A;  4XI0 A;  5HI7 A;  1QQE A;  3LY9 A;  4B94 A;  4KXK B;  4WNG A;  5M72 A;  2FO7 A;  4U0S A;  4Y6C A;  4N3B A;  5A7D B;  4YND A;  3QWW A;  3LCA A;  2BUG A;  5CMT A;  2XCB A;  3KAE A;  3FWV A;  3K9I A;  3S6A A;  2FF4 A;  4CDR A;  2QFC A;  2PQR A;  5CCM A;  2KAT A;  4CGW A;  3CK9 A;  4GPK A;  2DBA A;  4G25 A;  4AY5 A;  3Q15 A;  4N2Q A;  2HR2 A;  1KT0 A;  4WNF A;  2KCL A;  5CKL A;  3OXL A;  5CGL A;  3QDN A;  3LYA A;  3GW4 A;  2KCV A;  3URZ A;  5KJK A;  3ZPJ A;  2PL2 A;  4NRH B;  3N3U A;  1QZ2 A;  4RG9 A;  2PQN A;  4U0Z A;  2UY1 A;  4G23 A;  2F6S A;  2E2E A;  3ASG A;  2UWJ G;  2C2L A;  3CUC A;  4JA9 A;  4I9C A;  3ASD A;  3CEQ A;  1W3B A;  1YA0 A;  4J8E A;  2VYI A;  3ASH A;  3ULQ A;  4LU4 A;  3ESK A;  3CVQ A;  3ASF A;  3ZCB A;  1HH8 A;  2UY1 B;  3ZLM A;  3PE4 A;  3SZ7 A;  1WAO 1;  2KC7 A;  4CGV A;  3ZHE A;  5A6C A;  3OXG A;  4G26 A;  3NF1 A;  4I9E A;  1B89 A;  2JK8 A;  4X2C A;  3S7B A;  2L6J A;  1WM5 A;  2FEZ A;  4N67 A;  1TJC A;  5G04 J;  2LNI A;  2R5S A;  1KLX A;  3EDT B;  3KS2 A;  5EKQ D;  3S7F A;  2KCK A;  3FFL A;  2VY3 A;  5G04 C;  4GA1 A;  4LEU A;  3LY8 A;  3ZHE B;  4I17 A;  3JYS A;  2LSV A;  3CVN A;  2AVP A;  2NC9 A;  2WQH A;  3PE3 A;  3MV3 B;  2VQ2 A;  3PDN A;  5EX3 A;  2FBN A;  4WNE A;  4HOR A;  5EX0 A;  4XI8 A;  1P5Q A;  2C0L A;  2Y4U A;  4G24 A;  2V5F A;  4H7Y A;  3R9A B;  1HXI A;  5BT1 A;  5FJY A;  3FP3 A;  3AS8 A;  4ITR A;  4W9R A;  4BWR A;  4WND A;  3QWV A;  4GA0 A;  5JJT A;  4YVO A;  4WUY A;  3CVP A;  3RIB A;  3U4T A;  3VTY A;  2JLB A;  3OXF A;  4G1T A;  5D0O D;  4U07 A;  2G03 A;  2P58 C;  3CV0 A;  3S7J A;  3SE5 A;  3SHG A;  4GCN A;  3MA5 A;  2MHK A;  2I6H A;  4APO A;  4YVQ C;  3CKC A;  2GW1 A;  4ABN A;  4IN3 B;  5JFZ A;  3RO2 A;  2XCC A;  5DBK A;  4UQZ A;  4JHR A;  3AS4 A;  4AIF A;  3RU0 A;  2XPI A;  3Q49 B;  4GZ6 A;  1XNF A;  4I2Z A;  4NPS A;  4HOQ A;  3WXX A;  4GYO A;  3VTX A;  5KJN A;  3SN9 A;  2OOE A;  1FCH A;  5FZR A;  4I1A A;  3QOU A;  2VGX A;  3U3W A;  3LET A;  4PY3 A;  3AS5 A;  5FZS A;  2IF4 A;  4N5C A;  2XEV A;  2FI7 A;  2VGY A;  1IHG A;  4UI9 J;  1NA0 A;  4J8F A;  1A17 A;  3Q47 B;  4X2E A;  3O48 A;  4Y6W A;  2VGX B;  4UI9 C;  3ZN3 A;  4HOT A;  3GZ2 A;  3LY7 A;  4N39 A;  5AYW D;  1KT1 A;  3CVL A;  5C1D A;  5DIZ A;  4A1S A;  3CK7 A;  3UPV A;  2VSY A;  4O6F A;  5HQ8 A;  2WPV A;  3TG5 A;  2XGS A;  3ZFW A;  1NA3 A;  2VSN A;  3HYM B;  4RG6 A;  3UQ3 A;  5JJ6 A;  1PC2 A;  4M16 A;  3BEE A;  2OND A;  3TG4 A;  3MV2 B;  4GA2 A;  3Q5M A;  2XGO A;  2HYZ A;  5FT9 A;  5EU0 A;  4I2W A;  4X2D A;  3S7D A;  2YHC A;  4GZ3 A;  3ZC7 A;  3RO3 A;  3Q4A B;  1ELW A;  5G05 J;  2XGM A;  3LPZ A;  4NQ0 A;  3GZ1 A;  4N3C A;  4AM9 A;  4N2S A;  3RJV A;  4JL0 A;  4J8D A;  3QWP A;  3KD7 A;  4J0U A;  5G05 C;  4BTA A;  4ME2 A;  5JJ7 A;  3TGO A;  4HOU A;  3RKV A;  2Q7F A;  4UQX A;  5ARF A;  5FTP A;  4XI9 A;  4UI9 K;  4KYO B;  4EQF A;  5BNW A;  1ZBP A;  4F3V A;  2LSU A;  4GCO A;  4GYW A;  4BTB A;  4U0U A;  2J9Q A;  3CK8 A;  2Y4T A;  3GYZ A;  4AY6 A;  5FZQ A;  4KBQ A;  1Y8M A;  4GZ5 A;  5LCW J;  5JFF A;  4HOS A;  5D0Q D;  5ARG A;  3LKU A;  1E96 B;  5LCW C;  3CKB A;  5BW8 C;  2VZA A;  1ELR A;  4XIF A;  4N3A A;  3E4B A;  4BT8 A;  4GYY A;  4BT9 A;  1ZU2 A;  4G2V A;  2C0M A;  5CHE E;  1NZN A;  1IYG A;  3N71 A;  2IFU A;  2PZI A;  5KJM A;  5CCL A;  3ZGQ A;  3QKY A;  5KJL A;  1HZ4 A;  2HO1 A;  3IEG A;  4WGJ A; 
#chains in the Genus database with same CATH topology
 4JA7 A;  3MKR A;  2XHE A;  4M7C A;  3EHR A;  3TWR A;  4LNB A;  2IQC A;  2DCP A;  4XI0 A;  2R02 A;  3ZYQ A;  4E6H A;  4TXQ A;  4Y6C A;  4N3B A;  2MRI A;  4J6I A;  3KAE A;  3TXN A;  3PEU B;  3ZRH A;  4FJZ A;  4JB8 P;  4FLH A;  2ZIS A;  4A1G A;  3KSL A;  5CCM A;  4XEI G;  2I9C A;  5KWD A;  4L1B A;  5CMY A;  4Z68 A;  2F8Y A;  3ULE G;  3E34 A;  4GPK A;  3W9G A;  2R05 A;  4QFV A;  1U3C A;  4LUN U;  3AU4 A;  3L08 A;  3J5P A;  2KCL A;  1PY1 A;  3FH7 A;  4L23 A;  2P2C P;  5CGL A;  1X5B A;  3TWQ A;  2IY0 C;  3QDN A;  1HF8 A;  2KCV A;  3Q9N C;  3MX3 A;  1LF8 A;  2VGE A;  3N3U A;  3PZ4 A;  1QZ2 A;  4HXI A;  5EIL A;  3AJI A;  1Y6I A;  4WWO A;  4U0Z A;  3Q78 A;  3V2X A;  3ASG A;  4MLP A;  4U7E B;  3U64 A;  4JA9 A;  4CYM D;  3CEQ A;  1W3B A;  4J8E A;  4KVM A;  1RW2 A;  3UT4 A;  1BLX B;  3Q9U C;  1U3D A;  4CDM A;  1D9S A;  3B7S A;  3ML9 A;  3PE4 A;  1WAO 1;  2P9I G;  1D8E A;  5A6C A;  2L0I A;  1UJJ A;  1B89 A;  1K3Z D;  3G2W A;  3E33 A;  2P9P G;  4ANV A;  2AW6 A;  2GGF A;  1TJC A;  1KLX A;  5EKQ D;  3S7F A;  4HB5 A;  3R9M A;  2QZA A;  3FFL A;  2VY3 A;  4LNU D;  3NZU A;  5G2N A;  5J08 A;  3Q73 A;  2XQ0 A;  2LSV A;  3FTU A;  2WQH A;  4Q94 A;  3PE3 A;  2VQ2 A;  3PDN A;  4DPR A;  4GTS A;  1N54 A;  3RRN B;  2Y4U A;  4F6R D;  1TN8 A;  3R9A B;  1NFI E;  4AP2 A;  4APF A;  3EHM A;  4ITR A;  4BWR A;  4WND A;  4E85 A;  4XKB A;  1BU9 A;  1DVP A;  2CFZ A;  1YYH A;  1H0A A;  3Q7F A;  2GRL A;  5EYL A;  3HIZ A;  3VTY A;  4G1T A;  3VLD A;  4OAV B;  2XEH A;  4NAC A;  5D0O D;  3NQP A;  3X2Q E;  3I3N A;  3CV0 A;  3SE5 A;  1OCC E;  4GCN A;  3BUA A;  1TR4 A;  5BV0 A;  5ENQ D;  3UTM A;  4AJW A;  5B1A E;  1SA4 A;  3ENE A;  3SI5 A;  3EHN A;  4HS2 A;  4UWH A;  2AXZ A;  4GTO A;  1MYO A;  5JFZ A;  3DSU A;  2XCC A;  1TNU A;  1TNZ A;  5FQ7 A;  3L22 A;  1IQR A;  3V2O A;  4CZ2 D;  4HI9 A;  4UWL A;  1L5J A;  1E7U A;  1K8K G;  2EQX A;  2OVF A;  5CED B;  4I2Z A;  4NPS A;  3PRE A;  3VTX A;  3SN9 A;  1AP7 A;  2YIN A;  1FCH A;  3HVE B;  3ASN E;  4JEH A;  5FZR A;  4DJA A;  1HX8 A;  3ABK E;  3U3W A;  3MGB A;  3FH5 A;  1KZP A;  2FI7 A;  1H2T C;  2VGY A;  4ILG A;  4UI9 J;  1H2U A;  3CIA A;  4YDE A;  4J8F A;  1Q2Z A;  3Q47 B;  3DPD A;  1SQM A;  3APD A;  3SFZ A;  3Q7A A;  3ZN3 A;  4HOT A;  3LY7 A;  4N39 A;  1KT1 A;  2R2L A;  3HDX A;  5C1D A;  3DEP A;  3CHP A;  4BSX A;  4A1S A;  5AEN A;  2VSY A;  3DXK G;  3HRA A;  4O6F A;  4PS8 A;  2J08 A;  3TG5 A;  3CGH A;  1V54 E;  4EBA A;  3AAA C;  2A5U A;  4TXP A;  2ETB A;  5KCM A;  3JXI A;  4F1P A;  2NXP A;  4DI4 A;  3KSQ A;  3HYM B;  4PS3 A;  5T4Y A;  5AN8 A;  3PEV B;  3UQ3 A;  2ETC A;  5JJ6 A;  3D9O A;  2XS1 A;  4M16 A;  1HU3 A;  1S63 A;  2WVI A;  4L7T A;  4DX6 D;  1OXJ A;  4Q69 A;  4BX8 A;  4GA2 A;  1FVH A;  1QYM A;  4YDY A;  4YDW A;  3D9J A;  3TWV A;  2HYZ A;  4JC8 A;  5FT9 A;  2YHC A;  4FU3 A;  4GZ3 A;  1UW4 B;  3PZ1 A;  1Z6T A;  4K0R A;  3Q4A B;  1NL4 A;  4ATG A;  2KZT B;  4FC8 A;  3TWW A;  3LDZ A;  5G05 J;  2XGM A;  1EYH A;  4R7L A;  4N3C A;  4B0Z A;  3RJV A;  1N4P A;  4J8D A;  3OTN A;  3RRU A;  4J0U A;  4JD2 G;  4BTA A;  3J5Q B;  4HNA D;  1BI8 B;  3RKV A;  4UQX A;  2V4H C;  2KM4 A;  3LXU X;  4P29 A;  1TNY A;  5BNW A;  1H6K A;  2CHW A;  2X3M A;  3PUK A;  2WXR A;  4BTB A;  3FUH A;  2VJ8 A;  4ILH B;  2J9Q A;  1N0R A;  5ENP D;  5EN5 D;  2DVW A;  2Y4T A;  5JHB A;  1MJ0 A;  1Y8M A;  4XE0 A;  5JFF A;  1NP7 A;  5ENO D;  4HBD A;  3LKU A;  1E96 B;  5LCW C;  3PS6 A;  3C72 A;  3F6Q A;  3ZVV A;  2OEV A;  5HKP A;  2R03 A;  4WWN A;  3E4B A;  4FUL A;  4GYY A;  4BT9 A;  1ZU2 A;  3I4R B;  5FWQ A;  2Y0B G;  3PZD A;  4L2L A;  1UJK A;  4ANX A;  1E90 A;  2IFU A;  3DWL G;  3ZYM A;  2PZI A;  3UM2 A;  1N0Q A;  1HZ4 A;  2HO1 A;  2IO3 C;  1PAQ A;  5AJD A;  2CHX A;  3TAX A;  4U04 A;  5HRY A;  3UUX A;  2YNQ A;  1IQU A;  4UQY A;  1TEZ A;  1O1T A;  1QQE A;  3D9I A;  5AQB A;  4WNG A;  4J8S A;  3SGH A;  4TUU A;  4B8C B;  4YND A;  2CFU A;  3QWW A;  4WAF A;  3K9I A;  1HG2 A;  3SNX A;  2NUN A;  5A23 A;  3ZW3 A;  2OVB A;  5AJL A;  2PQR A;  2Y1L E;  4CGW A;  3QAR A;  1X81 A;  2R59 A;  3CK9 A;  2DYS E;  1WY6 A;  2LUH A;  2DBA A;  2M63 A;  5CBO A;  2HR2 A;  2BED A;  3D9P A;  2J07 A;  3EU9 A;  4TV3 A;  3TWS A;  2MOW A;  4CDN A;  3GW4 A;  1DC2 A;  2PL2 A;  2L0T B;  4NRH B;  3QNK A;  1H6O A;  4RG9 A;  5FQ4 A;  2UY1 A;  4U8V D;  4G23 A;  4OVU A;  3BG0 B;  2F6S A;  3FU0 A;  4GMR A;  2UWJ G;  2I2O A;  3CVY A;  4I9C A;  1YA0 A;  2VYI A;  4LU4 A;  2QY7 A;  3ASF A;  3PUJ A;  1HG5 A;  1QBQ A;  3ZCB A;  1HH8 A;  4J7W A;  3HXC A;  5BV1 A;  4O1P A;  4EEC A;  3SZ7 A;  4M3O A;  2KC7 A;  4BET A;  4CGV A;  3CSF A;  3OXG A;  4AV7 A;  4I9E A;  1OCR E;  4X2C A;  4QQI A;  2CG2 A;  3S7B A;  2L6J A;  1WM5 A;  5C2Y A;  3AG2 E;  4IRU A;  2KBX A;  4GA1 A;  4LEU A;  3APF A;  3ZHE B;  4I17 A;  3FU6 A;  2DZN A;  4K5A B;  2AVP A;  2NC9 A;  3MV3 B;  4JHK A;  5EX0 A;  2C0L A;  4ZFH A;  2V5F A;  1HXI A;  5BT1 A;  3EJN A;  5FJY A;  3PH0 C;  3C3Q A;  3ZUV B;  3R7Q A;  4DX1 A;  4F1S A;  5AQ7 A;  3JUE A;  4GB9 A;  3TL5 A;  2L6B A;  4GA0 A;  2WQ7 A;  2P9N G;  3EIJ A;  1HO8 A;  4XZ4 A;  4G11 A;  1JPL A;  4AVX A;  4A63 B;  4GML A;  3RIB A;  4ATZ D;  2GRO B;  3DXM G;  2EIM E;  4FP7 A;  4JVS A;  3DEO A;  3Q79 A;  3PZ3 A;  4U07 A;  1N11 A;  4YDO A;  4AOF A;  3SHG A;  3MYV A;  4TXR A;  5CEA A;  2L9B A;  3P2B A;  4A3V A;  4I1M A;  4PS7 A;  4APO A;  3FUL A;  3CKC A;  3FTZ A;  2GW1 A;  3FTY A;  4ABN A;  3HXF A;  2WB2 A;  5DBK A;  4UQZ A;  1H2V C;  3IXE A;  2JAB A;  4AIF A;  2OEW A;  2X38 A;  3SFX A;  4GZ6 A;  3P1U A;  4HOQ A;  3WXX A;  3RAU A;  1JWG A;  2OOE A;  3D9L A;  3VLF A;  4RVB A;  4DI3 A;  4FHJ A;  1LTX A;  4KZC A;  3LET A;  2VTB A;  3TXM A;  2WXQ A;  3APC A;  1IHG A;  5J90 A;  2V8S E;  3ML8 A;  3B7B A;  3CVU A;  5IY5 E;  2VGX B;  1OCZ E;  4UI9 C;  5H7P A;  4DUI A;  3ZEF A;  5AYW D;  1D8D A;  2I1J A;  3CVL A;  5BUZ A;  5EID A;  3HXD A;  1G3N B;  4D10 C;  5CBN A;  4PUC A;  3SO8 A;  3FTX A;  3UKU G;  2LO6 A;  5HQ8 A;  3UIN C;  2WPV A;  4K03 A;  3DPY A;  1Z5S C;  2ETA A;  2LXL A;  2OV8 A;  3U66 A;  2DYR E;  3NOG D;  2NYJ A;  3TWT A;  3E37 A;  4PH4 B;  3QAQ A;  3IV0 A;  3FDH A;  3CR3 A;  1PC2 A;  4MRU A;  3TG4 A;  1E7V A;  3L16 A;  1OWL A;  2GRR B;  2PNN A;  3FTW A;  3S7D A;  4DLQ A;  2PM6 A;  2RFM A;  3ZC7 A;  2YHE A;  3RO3 A;  2AWI A;  4HQD A;  5EDS A;  3GZ1 A;  4AM9 A;  3SY2 A;  4V3I A;  4DK5 A;  1S0P A;  1Z3X A;  5G05 C;  4A3T A;  4EPZ A;  5G55 A;  1O5M A;  2Q7F A;  5ARF A;  3IKO B;  3FUI A;  4UI9 K;  1UN8 A;  2X6F A;  5HS0 A;  4F3V A;  4B93 B;  2IOS A;  4FLB A;  4GPM A;  3HHM A;  4JPS A;  2IOL A;  3DSS A;  1OWM A;  3EU5 A;  2CHZ A;  3SQV A;  4IYP A;  3GYZ A;  4U8H A;  5AQA A;  3PZ2 A;  5FZQ A;  3SBS A;  4C0E A;  2WXL A;  4KBQ A;  1E8X A;  4HOS A;  4MKT A;  3IHV A;  3CKB A;  4L9P A;  1ELR A;  4XIF A;  3FU3 A;  3IBE A;  3LS8 A;  3KEA A;  4MBG A;  3L17 A;  3ULY A;  3QJZ A;  3EHQ A;  4DLO A;  3NAW A;  4I1O B;  3FUJ A;  5KJM A;  5CCL A;  4ANW A;  3QKY A;  1MX2 A;  2WQ6 A;  3L6A A;  1OWN A;  4LCT A;  3CHM A;  1OUV A;  2XEE A;  2F8X K;  2QYJ A;  1MZC A;  2WXM A;  3MEK A;  1JCR A;  3SF4 A;  1TNO A;  1IKN D;  3CVX A;  3UM0 A;  3UX4 A;  4O60 A;  4CEM A;  2X6H A;  4KXK B;  4DX5 D;  3G2V A;  4FJY A;  3ABM E;  4IUL A;  4XKC A;  3OAW A;  3UT8 A;  5A7D B;  3LCA A;  2BUG A;  5CMT A;  2XCB A;  3FWV A;  3S6A A;  3EUV A;  4CDR A;  3ONL A;  4C48 B;  2DIW A;  3FU5 A;  4A55 A;  2ZIR A;  3ONK A;  1HFA A;  2JEK A;  3U9W A;  4HI8 A;  4G25 A;  4F7A A;  4AY5 A;  3Q15 A;  4N2Q A;  3FEY A;  2BKG A;  4KMO A;  1TN7 A;  3LEW A;  4U8Y D;  2EIK E;  5CKL A;  2WXF A;  3OXL A;  1O1R A;  3V31 A;  2F0Y A;  3D3M A;  4BSZ B;  2WXI A;  3ZPJ A;  3C5R A;  5AQ9 A;  3JQ1 A;  1K1A A;  5ENR D;  3ZKJ A;  3D9K A;  1LD8 A;  2E2E A;  4GAA A;  3T8K A;  3VLE A;  2FO1 E;  2C2L A;  1OT8 A;  3CUC A;  3B7U X;  4HLL A;  3ASD A;  1N52 A;  3C3O A;  3SFY A;  2HM8 A;  3ULQ A;  3RSE G;  3V30 A;  5LX8 A;  1GW6 A;  4HRN A;  5CEC B;  1VDY A;  3CHO A;  5FQ8 A;  2KXP C;  1S64 A;  4NUR A;  5G04 J;  2LAI A;  2LNI A;  2R5S A;  3EDT B;  3KS2 A;  1UN9 A;  2RG8 A;  3LY8 A;  3MCX A;  2ZGG A;  3JYS A;  3B13 A;  2P9U G;  4GMJ A;  5EX3 A;  2FBN A;  4JEU A;  4WNE A;  4GU5 A;  3S2A A;  3NB2 A;  4G24 A;  1MHQ A;  5ANR A;  3JUI A;  4H7Y A;  4BES A;  1MQS A;  3AS8 A;  2XPY A;  4LER A;  3HXE A;  4K5B A;  4UUC A;  3SBT B;  1MX4 A;  4AXH A;  3UI2 A;  3UMV A;  2X6I A;  2BF0 X;  1YMP A;  4WUY A;  1E8Z A;  3CVP A;  3U4T A;  2VSX E;  3ESL A;  4G8K A;  4Q96 A;  3ISM C;  4X8Q A;  3ZXP A;  2H6F A;  2P58 C;  2WMO A;  3S7J A;  1K1B A;  1OWO A;  5B3S E;  4L2Y A;  2MHK A;  3BG1 B;  1LD7 A;  5EIB E;  5CER B;  4UWK A;  2A4Z A;  4YVQ C;  4BY6 A;  4DX2 A;  3I5P A;  1JUQ A;  3HVE A;  5ENS D;  3GZS A;  4JHR A;  2FUL A;  1FVF A;  1HE8 A;  2XPI A;  2XS8 A;  1XNF A;  2NSZ A;  1WG0 A;  4GYO A;  3LVQ E;  1ELK A;  2XEN A;  4I1A A;  2IJG X;  3C3R A;  3B7R L;  3AG1 E;  4TUM A;  4KZ0 A;  2A5E A;  5E76 A;  4PY3 A;  4UWF A;  5FZS A;  4JHJ A;  3MJW A;  2IF4 A;  5ENT D;  3C98 A;  5KNH D;  4ILI A;  1A17 A;  2VSO E;  4X2E A;  1N4R A;  2WMN A;  5CRU A;  3MZL B;  2EIL E;  4HRM B;  5JMN D;  2RFA A;  3UPV A;  1FT1 A;  4BX9 A;  3PVL A;  4ANU A;  3T5X A;  3D9H A;  1TN6 A;  5D66 A;  2XGS A;  3G2U A;  2QYU A;  3ZFW A;  1NA3 A;  5LP0 A;  3LJ3 A;  1UG3 A;  5AAR A;  3BEE A;  4URK A;  2OND A;  4WWP A;  4ACK A;  1SA5 A;  2KZT A;  3MV2 B;  4CCA A;  2EIJ E;  2WXG A;  2XGO A;  1QNF A;  4GTT A;  5BPP A;  5T3R A;  1A5E A;  3FUD A;  4FHK A;  3T5V A;  4ZHB A;  2F37 A;  3ZU7 B;  2IO2 C;  2ZU6 B;  4NQ0 A;  3G2S A;  4N2S A;  3DRA A;  4JL0 A;  3T9K A;  5KBA A;  3QWP A;  4GTQ A;  3ZXS A;  4EZK A;  4ME2 A;  3FTS A;  4HOU A;  3FTV A;  3WG7 E;  5FTP A;  1TJF A;  3CHQ A;  4XI9 A;  4OVV A;  5EYP F;  4EHM A;  3TJP A;  1XGW A;  4LSZ E;  4EQF A;  1OCO E;  1JWF A;  3ZIM A;  3FUF A;  2XPZ A;  3UM1 A;  4U0U A;  2XRY A;  2Y3A A;  3HXB A;  3UIP C;  4I6J A;  2J09 A;  5FIN A;  3B95 A;  3CK8 A;  4U63 A;  3DSV A;  3AG3 E;  4AY6 A;  4GZ5 A;  1EPU A;  3R7R A;  2EIN E;  2MYO A;  4DRX E;  5JHA A;  3FH8 A;  2BTD A;  1BI7 B;  3RK6 A;  2HE0 A;  4N3A A;  4G2V A;  2C0M A;  3AU5 A;  5CHE E;  1INZ A;  2ILR A;  1JCS A;  4U96 D;  5T8I A;  3ZGQ A;  5KJL A;  4FAD A;  4LNG A;  4I43 A;  4WGJ A;  3KEZ A;  2AJA A;  4FA6 A;  4H7X A;  2YQ8 A;  4MS6 A;  1E8Y A;  3TWX A;  1H6P A;  1FT2 A;  1KZO A;  5HI7 A;  4KT6 B;  3LY9 A;  4B94 A;  1BPO A;  1SW6 A;  5M72 A;  2FO7 A;  1OY3 D;  1E8W A;  4U0S A;  2E0I A;  2IU1 A;  2IEJ A;  4GZD A;  5ENN A;  2FF4 A;  2QFC A;  3NOC D;  3SHF A;  1NI1 A;  2P9K G;  1AWC B;  2KAT A;  4CT0 A;  1IHB A;  1ZB1 A;  2GRP B;  5JA4 D;  3L54 A;  2GRN B;  3BU8 A;  1KT0 A;  3JCK C;  4WNF A;  1V55 E;  2ZGD A;  3SD5 A;  4G8L A;  3UT7 A;  3CVV A;  1RZ4 A;  3JQ0 A;  3LYA A;  3FEX A;  3HG0 D;  2WXH A;  3URZ A;  3O4Z A;  5KJK A;  2LAH A;  1N9A A;  1S70 B;  4PDX A;  2WXO A;  3CLJ A;  4GTP A;  2PQN A;  3FUN A;  3CST A;  3UKR G;  4B8A A;  2OCC E;  2XZD G;  3BQO A;  3E32 A;  2I1K A;  3DSX A;  4BFR A;  4OYS A;  4KVO A;  3PNT B;  3ASH A;  4O1O A;  3ESK A;  4DX7 D;  3CVQ A;  3FY4 A;  1U2V G;  2UY1 B;  3QB2 A;  3ZLM A;  1DNP A;  4BEP A;  3ABL E;  4J8Y A;  5LFA A;  2GRQ B;  3ZHE A;  2WXK A;  3MKQ B;  3PRZ A;  1N94 A;  3NF1 A;  4G26 A;  2JK8 A;  2CG3 A;  5AIJ A;  2V0P A;  2FEZ A;  1TNB A;  4N67 A;  2ZXW E;  2V5Q C;  3G2T A;  3PNL B;  2KCK A;  4JW1 A;  5KNG A;  5G04 C;  2XRZ A;  1H19 A;  3DBS A;  3CVN A;  2B6C A;  4NIK A;  2RD0 A;  4UWG A;  4HOR A;  3QK0 A;  3UIO C;  4XI8 A;  1P5Q A;  3FUK A;  4JZY A;  1DCE A;  3V79 K;  3FP3 A;  2QC9 A;  4W9R A;  4U95 D;  2J4D A;  3ASO E;  3QWV A;  4XX5 A;  4EZL A;  2RKK A;  1NH1 A;  5D2M C;  2LXM A;  4F53 A;  1O1S A;  4LG6 A;  5JJT A;  3CHR A;  4YVO A;  1N95 A;  2JLB A;  3OXF A;  4HFG A;  2DZO A;  1N4Q A;  2J49 A;  2G03 A;  3MA5 A;  2I6H A;  3NBN B;  2X6K A;  2B0O E;  4CT4 A;  2Y69 E;  2P9S G;  3ZYL A;  1EF1 C;  4IN3 B;  3RO2 A;  1WDY A;  4BER A;  1MX6 A;  3AS4 A;  3CHS A;  3RU0 A;  3Q49 B;  4C0M A;  4N5Q A;  3RRM B;  2P9L G;  2J4B A;  4B89 A;  3TWU A;  5KJN A;  3Q75 A;  3B7T A;  3QOU A;  2H6H A;  2VGX A;  1HS6 A;  3DSW A;  3AS5 A;  4EZJ A;  1N4S A;  1OWP A;  4N5C A;  3D9N A;  2XEV A;  5ANL A;  1NA0 A;  3O48 A;  4Y6W A;  3CQG B;  3GZ2 A;  2VTB B;  1TYQ G;  1EDU A;  1FPP A;  5DIZ A;  4HVB A;  2WXP A;  4ACL A;  3CK7 A;  4GTM A;  3L82 A;  5E75 A;  1SVX A;  5BXO A;  1Z3Y A;  1IXV A;  2VSN A;  4LRZ A;  4I6G A;  1UOH A;  4RG6 A;  3L9T A;  2X6J A;  2GRM A;  3W9F A;  3I4G A;  1SZ9 A;  5AAO A;  4OAU C;  3FUE A;  3UXG A;  3E30 A;  4GZC A;  2V4L A;  3Q5M A;  5LOZ A;  2PM7 A;  1JCQ A;  5FQ6 A;  5EU0 A;  3DST A;  4I2W A;  3UM3 A;  4X2D A;  2AXV A;  2AXU A;  3ZYK A;  3EIQ C;  3LVR E;  1ELW A;  2NUD A;  3LPZ A;  4CRW A;  2WXN A;  4RLY A;  3KD7 A;  2WM9 A;  3CQC B;  5JJ7 A;  3TGO A;  2J8S D;  3FUM A;  4TRQ A;  4C9B B;  3L13 A;  4K5C A;  4RSY A;  4KYO B;  3NZS A;  5FIO A;  3AG4 E;  2ION A;  3CVW A;  3QC1 A;  1ZBP A;  2H6I A;  1SZA A;  5ITZ F;  2LSU A;  2H6G A;  4GCO A;  4RQI A;  4GYW A;  2WXJ A;  1BD8 A;  3LJN A;  3D9M A;  4I6E A;  5CRV A;  4AEZ C;  2DWZ A;  4HRL A;  2R17 C;  4GTV A;  5LCW J;  5D0Q D;  5ARG A;  2XZT G;  4GTR A;  3MKQ A;  4JXT A;  3T8M A;  3IHY A;  1DCQ A;  5BW8 C;  2VZA A;  5BXU A;  5CMW A;  4BT8 A;  4HLE A;  1NZN A;  1IYG A;  3FHE A;  3N71 A;  5B1B E;  3JXJ A;  2BKK B;  3ZNG A;  4EBA G;  1YCS B;  3IEG A;  1KPS B; 
#chains in the Genus database with same CATH homology
 2CHX A;  4FA6 A;  4JA7 A;  4LCT A;  3TAX A;  3MKR A;  4U04 A;  2XHE A;  3CHM A;  4H7X A;  1OUV A;  2YQ8 A;  2WXM A;  3MEK A;  4MS6 A;  1E8Y A;  3UUX A;  3SF4 A;  2YNQ A;  1IQU A;  3CVX A;  4UQY A;  1TEZ A;  2IQC A;  3UX4 A;  2DCP A;  4XI0 A;  5HI7 A;  1QQE A;  4KT6 B;  3LY9 A;  3ZYQ A;  3D9I A;  4CEM A;  2X6H A;  4B94 A;  1BPO A;  4KXK B;  4WNG A;  4E6H A;  5M72 A;  2FO7 A;  4J8S A;  3G2V A;  1E8W A;  4FJY A;  4U0S A;  3SGH A;  4TUU A;  4Y6C A;  4IUL A;  4XKC A;  4N3B A;  3OAW A;  2E0I A;  3UT8 A;  4B8C B;  5A7D B;  2MRI A;  4YND A;  2CFU A;  2IU1 A;  3QWW A;  4J6I A;  3LCA A;  2BUG A;  4WAF A;  4GZD A;  5CMT A;  2XCB A;  3KAE A;  3FWV A;  3TXN A;  3K9I A;  3PEU B;  1HG2 A;  3ZRH A;  5ENN A;  3S6A A;  4FJZ A;  3SNX A;  2FF4 A;  4CDR A;  5A23 A;  3ZW3 A;  3ONL A;  4FLH A;  2QFC A;  4A1G A;  2OVB A;  2DIW A;  5AJL A;  3SHF A;  2PQR A;  3FU5 A;  5CCM A;  2I9C A;  4A55 A;  2KAT A;  3ONK A;  4L1B A;  4CGW A;  1HFA A;  5CMY A;  3QAR A;  4CT0 A;  2R59 A;  2JEK A;  3CK9 A;  3U9W A;  1WY6 A;  4GPK A;  2DBA A;  4G25 A;  3L54 A;  4F7A A;  4AY5 A;  3Q15 A;  4N2Q A;  2M63 A;  3FEY A;  2HR2 A;  4QFV A;  1U3C A;  1KT0 A;  4LUN U;  3AU4 A;  4KMO A;  3JCK C;  3D9P A;  3L08 A;  4WNF A;  2KCL A;  1PY1 A;  2J07 A;  3SD5 A;  3LEW A;  3FH7 A;  5CKL A;  2WXF A;  3OXL A;  4L23 A;  3UT7 A;  3CVV A;  5CGL A;  4TV3 A;  3JQ0 A;  1X5B A;  3QDN A;  1HF8 A;  2MOW A;  3LYA A;  3D3M A;  3GW4 A;  4CDN A;  2KCV A;  3FEX A;  2WXH A;  3URZ A;  2WXI A;  3O4Z A;  3MX3 A;  5KJK A;  3ZPJ A;  2PL2 A;  2L0T B;  2LAH A;  1LF8 A;  4NRH B;  3QNK A;  3N3U A;  4PDX A;  2WXO A;  3CLJ A;  1QZ2 A;  4HXI A;  4RG9 A;  5FQ4 A;  2PQN A;  1Y6I A;  3JQ1 A;  4WWO A;  4U0Z A;  2UY1 A;  3FUN A;  4G23 A;  3D9K A;  3BG0 B;  4OVU A;  3CST A;  2F6S A;  3FU0 A;  4B8A A;  2E2E A;  4GAA A;  3ASG A;  3VLE A;  2UWJ G;  2C2L A;  4MLP A;  2I2O A;  2I1K A;  3U64 A;  4BFR A;  3CVY A;  3CUC A;  3B7U X;  4I9C A;  4JA9 A;  3ASD A;  3CEQ A;  4KVO A;  4OYS A;  1N52 A;  1W3B A;  1YA0 A;  3PNT B;  4J8E A;  2VYI A;  3ASH A;  4KVM A;  2HM8 A;  4LU4 A;  3ULQ A;  3UT4 A;  2QY7 A;  1U3D A;  4CDM A;  3ESK A;  3CVQ A;  3ASF A;  1GW6 A;  5LX8 A;  3FY4 A;  1HG5 A;  3ZCB A;  3PUJ A;  1HH8 A;  3B7S A;  3ML9 A;  2UY1 B;  3QB2 A;  5BV1 A;  4EEC A;  3ZLM A;  1DNP A;  3PE4 A;  4M3O A;  1WAO 1;  3SZ7 A;  2KC7 A;  5LFA A;  4CGV A;  1VDY A;  3ZHE A;  5A6C A;  2WXK A;  2L0I A;  3CSF A;  1UJJ A;  3MKQ B;  3OXG A;  3NF1 A;  3PRZ A;  4G26 A;  4I9E A;  1B89 A;  3CHO A;  4AV7 A;  2JK8 A;  4X2C A;  2CG3 A;  3G2W A;  2CG2 A;  3S7B A;  2L6J A;  4ANV A;  5FQ8 A;  5AIJ A;  1WM5 A;  2V0P A;  4NUR A;  2AW6 A;  2GGF A;  2FEZ A;  4N67 A;  5C2Y A;  1TJC A;  5G04 J;  4IRU A;  2LAI A;  2LNI A;  2R5S A;  1KLX A;  3EDT B;  3KS2 A;  3G2T A;  5EKQ D;  3PNL B;  3S7F A;  1UN9 A;  2KCK A;  2RG8 A;  3FFL A;  4JW1 A;  2VY3 A;  5G04 C;  4GA1 A;  4LEU A;  3NZU A;  3APF A;  5G2N A;  5J08 A;  3LY8 A;  2XRZ A;  3ZHE B;  3MCX A;  4I17 A;  2XQ0 A;  3JYS A;  1H19 A;  3B13 A;  3FU6 A;  2LSV A;  3DBS A;  3CVN A;  2AVP A;  2NC9 A;  3FTU A;  2WQH A;  4GMJ A;  4Q94 A;  3PE3 A;  3MV3 B;  2VQ2 A;  3PDN A;  4DPR A;  5EX3 A;  2FBN A;  2RD0 A;  1N54 A;  4JEU A;  4JHK A;  4UWG A;  4WNE A;  4HOR A;  5EX0 A;  3QK0 A;  4GU5 A;  3RRN B;  3S2A A;  4XI8 A;  1P5Q A;  2C0L A;  2Y4U A;  3FUK A;  1MHQ A;  4G24 A;  4JZY A;  5ANR A;  3JUI A;  2V5F A;  4H7Y A;  3R9A B;  1HXI A;  5BT1 A;  3EJN A;  4AP2 A;  5FJY A;  3PH0 C;  3FP3 A;  4APF A;  3R7Q A;  3EHM A;  1MQS A;  3AS8 A;  4ITR A;  4W9R A;  4F1S A;  4BWR A;  4GB9 A;  2J4D A;  3QWV A;  4WND A;  2XPY A;  4LER A;  4XKB A;  4XX5 A;  3TL5 A;  4E85 A;  4EZL A;  4GA0 A;  2WQ7 A;  3SBT B;  1DVP A;  3EIJ A;  4F53 A;  4AXH A;  1HO8 A;  2CFZ A;  4XZ4 A;  4G11 A;  3UMV A;  2X6I A;  1H0A A;  5JJT A;  1JPL A;  2BF0 X;  3CHR A;  2GRL A;  4YVO A;  4AVX A;  4WUY A;  4GML A;  1E8Z A;  3CVP A;  3RIB A;  3U4T A;  3HIZ A;  3VTY A;  2VSX E;  2JLB A;  3OXF A;  3ESL A;  4G1T A;  3VLD A;  4Q96 A;  4FP7 A;  4NAC A;  4JVS A;  5D0O D;  4HFG A;  3NQP A;  2J49 A;  4U07 A;  2G03 A;  3I3N A;  4AOF A;  2P58 C;  3CV0 A;  2WMO A;  3S7J A;  3SE5 A;  3SHG A;  4GCN A;  1OWO A;  4L2Y A;  3MYV A;  5BV0 A;  3MA5 A;  4BY6 A;  2L9B A;  2I6H A;  2MHK A;  3P2B A;  4AJW A;  3BG1 B;  4A3V A;  2X6K A;  4CT4 A;  4UWK A;  4I1M A;  4PS7 A;  4APO A;  3ENE A;  2A4Z A;  3CKC A;  3FUL A;  4YVQ C;  3SI5 A;  3ZYL A;  3EHN A;  1EF1 C;  3FTZ A;  2GW1 A;  3FTY A;  4HS2 A;  4UWH A;  4ABN A;  2AXZ A;  3I5P A;  4IN3 B;  1JUQ A;  5JFZ A;  3RO2 A;  2WB2 A;  2XCC A;  5FQ7 A;  5DBK A;  3L22 A;  1IQR A;  3HVE A;  4UQZ A;  3GZS A;  4JHR A;  2FUL A;  3AS4 A;  1FVF A;  1H2V C;  3CHS A;  4UWL A;  1L5J A;  4AIF A;  1HE8 A;  1E7U A;  2XPI A;  2X38 A;  3Q49 B;  3RU0 A;  4C0M A;  3RRM B;  2J4B A;  4GZ6 A;  2EQX A;  2OVF A;  3P1U A;  4B89 A;  1XNF A;  2NSZ A;  4I2Z A;  4NPS A;  3PRE A;  4HOQ A;  3WXX A;  4GYO A;  3VTX A;  5KJN A;  3SN9 A;  2OOE A;  1JWG A;  3LVQ E;  2YIN A;  1FCH A;  1ELK A;  3HVE B;  3D9L A;  4JEH A;  5FZR A;  3B7T A;  4I1A A;  2IJG X;  3QOU A;  3VLF A;  4DJA A;  2VGX A;  1HX8 A;  3B7R L;  4RVB A;  4DI3 A;  4FHJ A;  3U3W A;  4KZC A;  4KZ0 A;  3LET A;  1HS6 A;  2VTB A;  5E76 A;  3MGB A;  4PY3 A;  3AS5 A;  4UWF A;  4JHJ A;  3MJW A;  2IF4 A;  2WXQ A;  5FZS A;  3TXM A;  3FH5 A;  1OWP A;  4N5C A;  3C98 A;  3D9N A;  2XEV A;  3APC A;  5ANL A;  2FI7 A;  1H2T C;  2VGY A;  4ILG A;  1IHG A;  4ILI A;  4UI9 J;  1NA0 A;  1H2U A;  3CIA A;  5J90 A;  2V8S E;  4J8F A;  3ML8 A;  1A17 A;  4EZJ A;  3Q47 B;  2VSO E;  3CVU A;  3DPD A;  4X2E A;  3O48 A;  4Y6W A;  2VGX B;  1SQM A;  3APD A;  4UI9 C;  3SFZ A;  3ZN3 A;  2WMN A;  3CQG B;  4HOT A;  3GZ2 A;  3LY7 A;  3ZEF A;  4N39 A;  2VTB B;  5AYW D;  3MZL B;  2I1J A;  1KT1 A;  3HDX A;  3CVL A;  1EDU A;  5BUZ A;  5C1D A;  3CHP A;  5DIZ A;  4HVB A;  4BSX A;  2WXP A;  4A1S A;  4ACL A;  4D10 C;  3CK7 A;  5AEN A;  3UPV A;  4BX9 A;  2VSY A;  4PUC A;  3PVL A;  4ANU A;  3FTX A;  3T5X A;  5E75 A;  4O6F A;  2LO6 A;  4PS8 A;  5HQ8 A;  2WPV A;  1Z3Y A;  4K03 A;  2J08 A;  3TG5 A;  2XGS A;  2OV8 A;  3U66 A;  3CGH A;  3G2U A;  4EBA A;  2A5U A;  5KCM A;  3ZFW A;  2NXP A;  4DI4 A;  1NA3 A;  2VSN A;  3HYM B;  4LRZ A;  4PH4 B;  3QAQ A;  4PS3 A;  5T4Y A;  4I6G A;  5LP0 A;  3IV0 A;  3LJ3 A;  3FDH A;  3PEV B;  4RG6 A;  3UQ3 A;  1UG3 A;  5JJ6 A;  2X6J A;  3CR3 A;  2GRM A;  3D9O A;  3I4G A;  1PC2 A;  4M16 A;  1HU3 A;  1SZ9 A;  3BEE A;  4MRU A;  4URK A;  2OND A;  2WVI A;  4L7T A;  4WWP A;  4ACK A;  2KZT A;  3FUE A;  3TG4 A;  3MV2 B;  4Q69 A;  1E7V A;  4BX8 A;  4GA2 A;  3L16 A;  1OWL A;  4GZC A;  4CCA A;  2WXG A;  2V4L A;  2XGO A;  1QNF A;  3Q5M A;  1FVH A;  5LOZ A;  2PM7 A;  3D9J A;  2HYZ A;  5BPP A;  4JC8 A;  5FT9 A;  5FQ6 A;  5T3R A;  5EU0 A;  4I2W A;  3FTW A;  4X2D A;  3S7D A;  2YHC A;  3FUD A;  4FU3 A;  4FHK A;  2AXV A;  4GZ3 A;  2PM6 A;  2AXU A;  4DLQ A;  3T5V A;  1UW4 B;  1Z6T A;  3ZYK A;  4K0R A;  3ZC7 A;  2YHE A;  3RO3 A;  3EIQ C;  2AWI A;  3Q4A B;  5AJD A;  3LVR E;  1ELW A;  4ATG A;  2KZT B;  4FC8 A;  5EDS A;  3LDZ A;  5G05 J;  2XGM A;  2ZU6 B;  1EYH A;  3LPZ A;  2WXN A;  4NQ0 A;  4CRW A;  4R7L A;  3GZ1 A;  4N3C A;  4AM9 A;  4B0Z A;  3G2S A;  4N2S A;  3RJV A;  4JL0 A;  4J8D A;  4V3I A;  3OTN A;  4DK5 A;  1S0P A;  1Z3X A;  3RRU A;  3QWP A;  3KD7 A;  4J0U A;  5G05 C;  3ZXS A;  4BTA A;  4EZK A;  4A3T A;  4ME2 A;  4EPZ A;  2WM9 A;  3CQC B;  5JJ7 A;  3FTS A;  3TGO A;  4HOU A;  5G55 A;  3RKV A;  3FTV A;  2Q7F A;  3FUM A;  4UQX A;  1TJF A;  3CHQ A;  3IKO B;  4TRQ A;  5ARF A;  5FTP A;  4XI9 A;  3FUI A;  4C9B B;  4OVV A;  4UI9 K;  2KM4 A;  3L13 A;  4RSY A;  4KYO B;  3NZS A;  1UN8 A;  3TJP A;  2X6F A;  1XGW A;  3LXU X;  4P29 A;  4EQF A;  2ION A;  5BNW A;  3CVW A;  3QC1 A;  1H6K A;  1ZBP A;  1JWF A;  1SZA A;  3ZIM A;  2LSU A;  4F3V A;  4GCO A;  2IOS A;  3FUF A;  2CHW A;  2X3M A;  4FLB A;  3PUK A;  3HHM A;  4GYW A;  2XPZ A;  2WXJ A;  4JPS A;  2IOL A;  2WXR A;  4U0U A;  1OWM A;  3FUH A;  4BTB A;  2XRY A;  2VJ8 A;  2Y3A A;  4ILH B;  3D9M A;  2J9Q A;  4I6E A;  4I6J A;  2J09 A;  2CHZ A;  4AEZ C;  4IYP A;  3CK8 A;  2Y4T A;  2R17 C;  3GYZ A;  4U63 A;  4U8H A;  4AY6 A;  5JHB A;  5FZQ A;  3SBS A;  4C0E A;  2WXL A;  4KBQ A;  1Y8M A;  4GZ5 A;  5LCW J;  1E8X A;  4XE0 A;  1EPU A;  5JFF A;  1NP7 A;  4HOS A;  5D0Q D;  3R7R A;  5ARG A;  4MKT A;  3LKU A;  1E96 B;  3MKQ A;  5LCW C;  3IHV A;  4JXT A;  3PS6 A;  3T8M A;  5JHA A;  3IHY A;  3CKB A;  3FH8 A;  5BW8 C;  2VZA A;  3ZVV A;  2BTD A;  1ELR A;  4XIF A;  3RK6 A;  4N3A A;  5CMW A;  4WWN A;  3E4B A;  4BT8 A;  4FUL A;  4GYY A;  4BT9 A;  1ZU2 A;  3FU3 A;  3I4R B;  4G2V A;  5FWQ A;  2C0M A;  3IBE A;  3LS8 A;  4HLE A;  3AU5 A;  3L17 A;  3PZD A;  4L2L A;  5CHE E;  1NZN A;  1IYG A;  3QJZ A;  1UJK A;  4ANX A;  3FHE A;  1E90 A;  3N71 A;  2IFU A;  3ZYM A;  1INZ A;  4EBA G;  4DLO A;  2PZI A;  4I1O B;  3FUJ A;  2ILR A;  5KJM A;  5CCL A;  5T8I A;  4ANW A;  3ZGQ A;  3QKY A;  5KJL A;  1HZ4 A;  2HO1 A;  4FAD A;  2WQ6 A;  3IEG A;  3L6A A;  1PAQ A;  1OWN A;  4I43 A;  4WGJ A;  3KEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...