4U0TA

Crystal structure of adc-7 beta-lactamase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
357
structure length
357
Chain Sequence
b'TPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPTDIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTSGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYVVLNAIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADC-7 beta-lactamase
molecule tags Hydrolase
source organism Acinetobacter baumannii
publication title Biochemical and Structural Analysis of Inhibitors Targeting the ADC-7 Cephalosporinase of Acinetobacter baumannii.
pubmed doi rcsb
total genus 123
structure length 357
sequence length 357
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4u0tA00
1ESIA 1PI5A 4E6XA 5GLCA 4UA7A 1ZG6A 2H10A 1K57C 4S2MA 4B4XA 4U0XA 2WKHA 1N9BA 1MXOA 1W5DA 1YLTA 1LI0A 2EX2A 1G6AA 3VFFA 1NJ4A 2OV5A 3IT9A 4A5RA 1KGFA 4BENA 3BEBA 1PW1A 1L0GA 3NIAA 4X53A 4B88A 1K54C 3UO9A 4KENB 2H0YA 4OH0A 2HDQA 4KZBA 1IYPA 4P0MA 4OPRA 3DTMA 5CRFA 5GLDA 3OCNA 2ZC5B 3PBNA 4IVIA 3PTEA 5EVID 1O7EA 4GD6A 4QU3A 1G68A 2WZZA 3OPLA 2ZC3B 2J9PA 1IKGA 1K6SA 2C5WB 5FQJA 3PBOA 2QMIA 2PU2A 3E2KA 3BFGA 1OMEA 1RGZA 3ZGAB 2XDMA 2HPBA 4BQMA 3QNCA 4KZ6A 4QB8A 2E8IA 5DTSA 5CGWA 4R1GA 2EX6A 3ITBA 1IEMA 3VP2A 2ZQ7A 4UHUA 3CMZA 3GTCA 5EECA 1RCJA 4K91A 2ZQDA 2XLNA 1BTLA 2ZMAA 2WUQA 1LHYA 5HFOA 3VP3A 3BFEA 1FR1A 3CJMA 2XH9A 1ESUA 2ZQAA 2JE5A 1U60A 2X71A 3PBSA 4QHCA 4S2IA 4OLDA 2EX8A 3VMAA 1RGYA 3DW0A 5FAPA 5E2EA 3CG5A 1MY8A 1I2SA 3GR2A 4UA9A 4ZTKA 2OSUA 1ES3A 2XD5A 2IWBA 1GHPA 1RP5A 3G4PA 1KE0A 1KGEA 2RL3A 3O87A 4QY5A 3MZDA 4WBGA 2WGVA 1Y54A 4E3LA 5CXWA 2C6WB 4MBKA 3UNWA 3MKFA 3IWQA 4JXVA 3W4PA 3S4XA 2Y2HA 1CEFA 3RXXA 4FH4A 1TEMA 1S6RA 3UPNA 1ALQA 4MLLA 4KZ7A 1E3UA 4E6WA 2V1ZA 4QJGA 5KZHA 1K57A 3Q7ZA 3M2KA 3SS3A 1ES5A 3GMWA 2EX9A 2G2UA 2Y4AA 4K0WA 1GHIA 4Y0TA 1NRFA 4HESA 4JBFA 4BLMA 3SS4A 2DRWA 1ERMA 3I7JA 2Y2LA 1CI9A 1N4OA 4K0XA 5FASA 1VM1A 2WYXA 3Q7VA 5EE8A 1Z6FA 4GZBA 4LV3A 1ES2A 5F1FA 3DWZA 4CPKA 3C4OA 5DF9A 5EVIB 4OQ0A 1EROA 1PZPA 4P6BA 4ZDXA 4KZ8A 3M6BA 5JYOA 3GV9A 4HBTA 4UA6A 1BLCA 3W4QA 1MWUA 3A3JA 3G30A 4GB7A 5U47A 2Y59A 1YLYA 3G32A 5HAQA 2JCHA 3G34A 3PBRA 4KG5A 4Y0UA 5A91A 3IXDA 4DXCA 3S1YA 3IWOA 2Y2MA 1YLJA 4N9KA 3OC2A 4RA7A 5GLAA 3WRZA 1ZG4A 5E2GA 4JXWA 3GQZA 3ZG8B 4UAAA 3A3IA 4NETA 5FQIA 4WEKA 2P74A 2Y2GA 5HAIA 5FQKA 1YMSA 4EWFA 3V39A 4XXRA 1PZOA 2ZC4B 3N8RA 5A93A 4L0LA 2QZ6A 1YLPA 3UDIA 3VP4A 4C75A 1NYYA 3V3SA 1I2WA 4FD8A 3ZG5A 3HREA 1DJAA 2Y2JA 3IHBA 4BL3A 3O3VA 4DDSA 5FSRA 1IYOA 1BULA 1HZOA 3PAEA 5FI2A 3NY4A 4ZJ2A 1ZC2A 3UN7A 1K25A 3IWIA 2FFYA 3ITAA 1DJBA 2Y55A 1K56D 4JF5A 3VOZA 1XGIA 2IWDA 3N8SA 1IYSA 3BM6A 4KZ5A 4E3MA 5CHUA 3IH8A 1M6KA 4S2JA 4R3JA 5GHYA 1XXMA 4S2PA 3HVFA 4RX3A 5DF8A 3ZHHA 5FAQA 5FQMA 5HARA 2ZM2A 4OLGA 3ZG7B 4EBPA 3SH9A 2BLSA 2ZD8A 4E3NA 1MKIA 4R4RA 3MBZA 3BFFA 1PIOA 3NC8A 1C3BA 1FCOA 2WZXA 3ZNYA 2FFFB 5CTNA 3NDGA 5FQ9A 5CERA 1SHVA 4OOYA 4C6YA 1XA7A 5BOHA 5KSCA 1WYBA 3BLMA 3HLFA 3DWKA 4OQHA 1AXBA 1YLWA 1O07A 4PM5A 4RYEA 4X69A 1YMXA 2HP9A 3NCKA 3C7VA 3FYZA 4MBFA 4WYYA 3HBRA 4WM9A 2VGJA 1KE4A 1E3UD 1K4FA 3S22A 2G2WA 4RX2A 3O88A 2ZQ8A 5TR7A 3QHYA 4P85A 2EXAA 2RCXA 4WZ5C 3ZNTA 3OCLA 3HLWA 5HL1A 1GA9A 1IYQA 2EFXA 5HW3A 1W7FA 1KGGA 1FSWA 3FKVA 1NXYA 1WE4A 3FZCA 4H8RA 5DVAA 1BT5A 4WZ4A 3M6HA 1FCNA 4FSFA 4JF6A 1M40A 2PBYA 1JVJA 5HAPA 4MBHA 5GLBA 1VQQA 2XF3A 3HL9A 1PYYA 4GOGA 2ZC6B 4S2NC 3TG9A 4EBLA 4PMAA 1NZUA 4P87A 4DE2A 2XGNA 4PPRA 4R4SA 1PWGA 2B5RA 1H8YA 5FI7A 3IH9A 3NDEA 3ZVWA 1TDLA 4JF4A 4BD0A 4JPMA 3VP1A 1IKIA 3QNBA 4FH2A 4OONA 4LV2A 2DCFA 5E2FA 3BRMA 4NK3A 5E43A 5TFQA 4F94A 3C4PA 3Q7VB 4ZAMA 3V50A 1K55A 3IXGA 4EUZA 3SH7A 3EQVA 4C3QA 5EVIA 3VP0A 1K54A 4GDNA 3W8KA 2R9XA 3ISGA 4WELA 4X6TA 2OLUA 3JYIA 5I94A 3PAGA 4DRTA 2HDRA 4ID4A 1JWZA 4OPQA 4IEDA 4ZBEA 4E3KA 5JYPA 5L2FA 5HX9A 5DTKA 1FQGA 4R3BA 1MWRA 3WS0A 3UY6A 3FWLA 4KQOA 4JLFA 2ZQ9A 3HUMA 4PM6A 1ONGA 2P9VB 4OOLA 5G18A 3WS2A 4E3JA 1KDWA 3AGFA 4YINA 1SKFA 4ZJ1A 3ZG9B 3MZEA 5GL9A 2Z2LB 1K4EA 2WK0A 4KZ9A 5CEBA 1K55C 5FATA 4DE0A 5DF7A 1EI5A 4KQQA 3IF6C 1BLSA 4QD4A 2Y91A 5FA7A 2HP5A 3HLEA 5F83A 1W8YA 1KDSA 1ZKJA 5CHJA 3UE0A 5CGXA 3WS4A 2A3UA 3VSKA 1S0WA 3G2ZA 3BLSA 3HLGA 4U3TA 1KE3A 2CC1A 4BJPA 4WMCD 1PWCA 4YFMA 2XFTA 5FQQA 1GCEA 1ES4A 4LCMA 4QY6A 3V5MA 1KVLA 3N8LA 3ZDJA 3N4IA 1BUEA 1MWSA 1SCWA 1BLPA 1IELA 4R23A 3SOIA 4GNUA 4LV1A 3RJUA 5FI6A 5AQ9A 3UDXA 4OP8A 5EOOA 4KQRA 4JKTA 1K6RA 1K56A 2EFUA 2Y2PA 4DXBA 3O86A 4XUZA 5EVIC 1CEGA 1SDEA 3GVBA 3P98A 3IF6B 1JTDA 3IQAA 3M2JA 5AQAA 4KZAA 1GHMA 1YM1A 2Y2IA 4X68A 3NI9A 3LY4A 2Y2KA 4KG6A 1YLZA 4U0TA 4DE3A 1KVMA 5DTTA 1HTZA 3A3FA 3UPOA 2ZQCA 1SDNA 1L2SA 4E3OA 3ZG0A 4Q8IA 5EOEA 5FDHA 3PBQA 4IBXA 1YQSA 1YT4A 4HEFA 1TDGA 1XPBA 1XP4A 4GN2A 1E4DA 1L0FA 2H0TA 4KZ3A 4S2NA 1MPLA 2P9VA 3HLCA 3MFDA 1QMFA 4OOMA 4S2KA 3HLBA 4MNRA 4Y0OA 5M1AA 2H5SA 3IXBA 2XD1A 3V3RA 2WGWA 2IWCA 1FR6A 3G31A 1E25A 4OPZA 2DNSA 2VGKA 3GRJA 1PW8A 2HDUA 2Q9NA 3HUNA 4FCFA 4IVKA 4D2OA 1LLBA 2X02A 5FAOA 1PWDA 2V2FF 2OLVA 1K38A 3B3XA 3BYDA 3LCEA 3G35A 1XGJA 4O7DA 1BLHA 1BSGA 3WWXA 4E3IA 4OKPA 5CTMA 3MKEA 1XX2A 5A90A 2GDNA 3HLDA 4WZ5A 3Q07A 3ZVTA 2WKEA 4BL2A 1Q2QA 3N7WA 2ZM0A 2XK1A 3OPHA 2A49A 3UE3A 4B4ZA 2Y2OA 5TGFA 5EUAA 4ZJ3A 1NYMA 3AGDA 3WS1A 3C5AA 5A92A 1I5QA 4LCLA 2Y2QA 2ZC7A 1TVFA 3MXRA 3OPRA 5IHVA 2JC7A 2QPNA 1Q2PA 2ZJ9A 4N1HA 4LV0A 3A3EA 4GDBA 3LO7A 4WEJA 4Z9QA 3VSLA 1PI4A 2Z2MB 3FV7A 4EBNA 2WAEA 1FSYA 2ZM8A 4DF6A 3D4FA 5CECA 2XEPA 3N6IA 5E2HA 4EQIA 2HDSA 1H5XA 1BZAA 4S2LA 1XA1A 3WS5A 3G2YA 4OPYA 4X55A 2XR0A 3A3DA 3Q1FA 5D3OA 5EVLA 1QMEA 4MEZA 4WMCA 1HD8A 2J9OA 4Y7PA 4S2OA 4KZ4A 3BECA 4M3KA 3Q82A 3OZHA 5GHZA 3GSGA 1MBLA 3UE1A 1CK3A 3RXWA 5GHXA 3SH8A 5EPHA 3ZFZA 1ERQA 5M19A 2UWXA 1DY6A 4HBUA 5J8XA 4XUXA 3P09A 3UPPA 4BD1A 1NZOA 1CI8A 3OPPA 2J7VA 4GKUA 4R0QA 4CJNA 2EXBA 3LY3A 1FOFA 3ZCZA 4DE1A 1L0DA 4N9LA 2BG1A 1J9MA 3CZDA 3TSGA 1JWPA 4RVAA 1JWVA 2V20A 2WGWB 4OP5A 1ONHA 1LI9A 1WYCA 3Q81A 2Y2NA 3SS5A 4OVDA 4PM8A 2ZLYA 5F1GA 1GA0A 4EV4A 5CGSA 5AQBA 3PBTA 1NY0A 3FKWA 5M18A 3BFCA 1L0EA 4LENA 2WAFA 3BFDA 5AQ7A 2I72A 3NBLA 3IXHA 3IHAA 2J8YA 5KMWA 4IBRA 1DJCA 4GD8A 4PM9A 1JTGA 4DKIA 4KG2A 4PM7A 2Q9MA 4X56A 3IF5A 2R9WA 1XKZA 3MXSA 2WADA 1W79A 1EWZA 4N92A 3TOIA 3HUOA 3C7UA 3W4OA 2PU4A 4OQGA 1MWTA 2XFSA 2WGIA 4N1XA 5CHMA 3E2LA 1H8ZA 3VFHA 3EQUA 1W8QA 4JXGA 3WRTA 2X01A 3AGEA 4OQIA 1LL9A 2HP6A 3MZFA 3UDFA 1FCMA 1HVBA 2JBFA 5KSHA 4JXSA 3IF6A 4DDYA 2XQZA 5CEDA 3VOYA 5F82A 1LL5A 2WKIA 3LEZA
chains in the Genus database with same CATH superfamily
1ESIA 4E6XA 2W3HA 1YSQA 1W5DA 1LI0A 4EETB 4H6JB 1NJ4A 3KSFA 1LSXA 3VOLA 2HV1A 2H0YA 4EEPA 4LRZE 4DJ3A 3DTMA 5CRFA 3TE8A 2ZC5B 3OPLA 2ZC3B 1TS8A 1XFNA 5FQJA 2B02A 2QMIA 3FPWA 3IS2B 1OMEA 3ZGAB 4GHIA 4R1GA 5DKLA 3KYZA 2ZQ7A 3OBFA 1RCJA 4K91A 1BTLA 1TS0A 2XH9A 3PBSA 2ZQAA 1U60A 4S2IA 4EUVA 3LIDA 4ZTKA 3G4PA 2RL3A 4LGWA 1OTIA 1S66L 3MKFA 1CEFA 1TEMA 3F1PA 2V1ZA 4QJGA 3Q7ZA 3M2KA 3E4PA 4Y0TA 2G2UA 2Y4AA 2VKSA 4K0WA 3UB7A 2DRWA 2WKPA 4NXBA 4K0XA 5FASA 2VX8A 4Z1WA 5EE8A 4GZBA 3S7NA 5TJJA 5DKKA 1PZPA 1DRMA 3T4QA 4UA6A 5U47A 5HAQA 2JCHA 5L10A 4KG5A 4Y0UA 3IXDA 3F1OA 3S1YA 4N9KA 5GLAA 3JVVA 3WRZA 5E2GA 4WEKA 3EOIA 2P74A 5F68A 2Y2GA 3CITA 3V39A 4XXRA 2ZC4B 3N8RA 2D02A 2V8FA 1I2WA 4B9OA 5FSRA 1IYOA 3PAEA 1STZA 2HGVA 4I39A 5FI2A 3IWIA 1Y28A 4GS9A 4JF5A 4PKYA 1XGIA 3IH8A 2OAP1 5J3WA 4NG2A 2INWA 4S2PA 3BY8A 1A0KA 1YAXA 3ZG7B 3E98A 4YOFA 4E3NA 1MKIA 1F9IA 3KSGA 2M7VA 5L8MA 4GHIB 2FFFB 1P9RA 4WL9A 3NDGA 3P01A 1O07A 3NCKA 3W2ZA 4MBFA 4B93A 2QWSA 1DP9A 1E3UD 3S22A 2G2WA 2V8CA 3QHYA 2RCXA 4WZ5C 3ZNTA 3ZQ5A 3OCLA 5HW3A 3LIAA 4DJ2A 1BT5A 1CJFA 1JVJA 5HAPA 4LFUA 5GLBA 1VQQA 2P04A 3BY9A 2VLGA 4GOGA 3TG9A 2V9AA 3K3DA 3MFXA 3T1SA 1UGUA 4DE2A 4R4SA 1NWZA 5FI7A 3LEQA 5F69A 5HPFA 4BD0A 1PRQA 5DFYA 2PD8A 4F94A 1BYWA 4WELA 3UB9A 3QP6A 3JYIA 4DRTA 2GNXA 2HDRA 4ID4A 4II7A 5DTKA 2HZ5A 3UY6A 4KQDA 2JN7A 2P9VB 3WS2A 3AGFA 1G6OA 2GX5A 4QPRA 2Z2LB 1K4EA 4KZ9A 4MMNA 3LIBA 3UB8A 4HIAA 4Y15A 4QD4A 1IFQA 5F83A 2JKRM 3UE0A 5CGXA 2L4RA 3G2ZA 2BTFP 3IX4A 4YFMA 4LCMA 1S1ZA 3CPTA 1F2KA 3N8LA 2PR5A 1BUEA 1SCWA 1VHMA 5EV0A 3SOIA 4OP8A 4KQRA 2Y2PA 3O86A 4XUZA 5EVIC 3GVBA 3M2JA 4HH3A 4CLCD 1GHMA 4X68A 1YLZA 1SDNA 2JKTM 2PYRA 4E3OA 2G7UA 1YQSA 2K31A 4GN2A 4KZ3A 3MF0A 2P9VA 4OOMA 4S2KA 4O01A 4Y0OA 2XD1A 1OTDA 4OPZA 2VGKA 3GRJA 3H7WA 3HUNA 2YKHA 2X02A 3ULFA 3LCEA 3B3XA 4E3IA 1XX2A 5A90A 3B47A 4BBUA 2A49A 1F98A 3UE3A 2Y2OA 2PHYA 4WUJA 4G3KA 3WS1A 1SZVA 4LCLA 1XJ3A 5G4ZA 4WEJA 2JC7A 3CUEA 4EU0A 4GDBA 2XEPA 2NUPC 5AVFA 4EQIA 4CLCA 3LR3A 3T1RA 2PRFA 2XR0A 3Q1FA 4G3WA 5EVLA 2R78A 2J9OA 4Y7PA 3F1PB 3Q82A 2W0NA 1CK3A 2V0WA 3P09A 2D01A 3SZTA 3OPPA 4R0QA 4CJNA 2EXBA 1N9NA 3ZCZA 1L0DA 2BG1A 3TSGA 1OPXA 4G3VA 5L09A 2WGWB 3Q81A 2JKFA 3BWLA 5F1GA 4EV4A 3C38A 5CGSA 3PBTA 1VEUA 5AQ7A 4EXOA 4Y13A 5KMWA 1DJCA 1TD5A 3IF5A 5TBMA 3HUOA 5J4EA 4OQGA 2XFSA 2WGIA 5CHMA 1H8ZA 4OQIA 5KSHA 2PAVP 3R7WB 1L3LA 3D72A 4GCZA 3LEZA 3MMHA 2H10A 1K57C 4B4XA 4U0XA 1MXOA 2W1TA 2W3FA 2OV5A 2NUTC 3IT9A 4PHTA 1PW1A 1L0GA 4X53A 4B88A 5FDSA 1Z09A 4OPRA 5EVID 3PR6A 4NEED 3PBOA 5K5BA 1OTAA 4R38A 5DTSA 5CGWA 4CLCE 3VP2A 4UHUA 5EECA 5KIZA 1OT6A 1F5MA 2FZ0A 3VP3A 1LHYA 1FR1A 4P6ZS 1ESUA 2JE5A 4Q0HA 3VMAA 1RGYA 3GR2A 1PNEA 2XD5A 1GHPA 1RP5A 1KE0A 4HJ4A 2JKRI 3BW6A 1Y54A 4FTXA 1VEUB 2H28A 4MBKA 3UNWA 4F3LA 3EEHA 3S4XA 4AFIA 3EGDC 3UPNA 3QP1A 2OOLA 1E3UA 3T4TA 1K57A 3BQ8A 1ES5A 3GMWA 2EX9A 1GHIA 4HESA 4JBFA 4GJ4A 5HPIA 4HH2A 2XA7S 3EWKA 4JGQA 3NECA 3I7JA 2Y2LA 1VM1A 2WYXA 2J3TD 4NXFA 4LV3A 5AJGA 3S7OA 1XFQA 3C4OA 5DF9A 2JHEA 5EVIB 1EROA 4P6BA 4ZDXA 5JYOA 3GV9A 3W4QA 3A3JA 4GB7A 1YLYA 3KYQA 3KX0X 2DMWA 3IWOA 1YLJA 2XROA 3A3IA 1YPRA 5FQIA 3MXQA 1YMSA 4HP9A 3ICYA 2Q0OA 5A93A 1YLPA 3UDIA 3VP4A 4C75A 2O0YA 3V3SA 1T19A 1DJAA 4BL3A 1T18A 2VZWA 1ZC2A 3E0YA 2FFYA 3LR5A 3ITAA 4FOFA 1K56D 3L7HA 4KZ5A 5CHUA 1M6KA 1XXMA 4WF0A 4RX3A 5FQMA 4UQIS 2ZM2A 5EM1A 3MS6A 2QYBA 2BLSA 2A2LA 2HJ9C 3VV4A 1OJ5A 1H3QA 4IUKA 4R4RA 3MBZA 3BFFA 1CF0A 1FCOA 4BMWA 2XRNA 5CTNA 5CERA 1SHVA 4ZRRA 4OOYA 1XA7A 5KSCA 1WYBA 3HLFA 4OQHA 4PM5A 4RYEA 4X69A 1YMXA 3C7VA 2O9BA 3H7WB 4LRXC 4GLQA 3UB5P 4RX2A 5TR7A 5HD3A 5HL1A 1IYQA 1YSPA 2QKPA 1NXYA 1K0KA 4H8RA 3EEAA 4WZ4A 1FCNA 1M40A 4GW9A 1AWIA 4MBHA 3HL9A 1PYYA 2V1AA 1LSWA 2OWJA 2PT7A 4YNRA 4Y17A 4P87A 2XGNA 1PWGA 1VB6A 5LBRA 3NHQA 1H8YA 3IH9A 1TDLA 4JPMA 1CQAA 3QNBA 4OONA 3BRMA 4NK3A 5E43A 3C4PA 3Q7VB 3V50A 3UMDA 4EUZA 2QJ7A 4LRYC 3EQVA 5EVIA 3PAGA 5IT5A 2W1RA 4DMZA 2GJ3A 1S4SA 4LPZA 3UE6A 4KQOA 3VE3A 2OWHA 3HUMA 4BWIA 1KDWA 4YINA 1SKFA 3D3OA 2I9VA 3MZEA 1TS6A 2WK0A 4DE0A 4KQQA 3IF6C 2W3DA 3C2WA 1ZKJA 4U3TA 1KE3A 2CC1A 1PWCA 3T4OA 2XFTA 5FQQA 3V5MA 3ZDJA 3N4IA 4R23A 4GNUA 5FI6A 3DBAA 5AQ9A 3UDXA 3DAVA 5EOOA 4MN7A 1K6RA 1CEGA 1JTDA 4X1LA 1IOUA 5CX7A 1G28A 3NI9A 4U0TA 2Y2KA 4ME4A 1HTZA 3A3FA 4RQ9A 4WN5A 1L2SA 5FDHA 2JKGA 4IBXA 3HJKA 5FL3A 2ZL1A 2J80A 1XJ4A 3D9YA 1S1YA 3HLBA 4MNRA 1TS7A 2WGWA 1FR6A 3E4OA 4KUOA 2Q9NA 2HDUA 3T4LA 3OOVA 4IVKA 1LLBA 1NRJA 1ZHHB 2V2FF 3BYDA 3G35A 3K2NA 4OKPA 5CTMA 4NXEA 2GDNA 3HLDA 4WZ5A 2WKEA 3N7WA 2ZM0A 3AGDA 3HCYA 2Y2QA 3MXRA 2QPNA 1Q2PA 1D1JA 4LV0A 3A3EA 3LO7A 1PI4A 2Z2MB 3FV7A 2WAEA 1MZUA 2HDSA 4LLOB 4OPYA 1QMEA 4WMCA 4M3KA 3GSGA 1P0ZA 1XJ6A 3RXWA 3SH8A 5EPHA 3PXPA 2EWVA 2UWXA 4HBUA 3P7NA 5HWVA 3UPPA 1CI8A 3NULA 4MDZA 1FOFA 3DTKA 4N9LA 1JWPA 1ONHA 1WYCA 4PM8A 1GA0A 1T1BA 3IS2A 5M18A 2W3EA 3IHAA 2Z6CA 4PM9A 3QP4A 3CPTB 4E04A 2WADA 2VV8A 3E4QA 3AGEA 1H0MA 2VGLS 3UDFA 1HVBA 2PYPA 2L0WA 2XQZA 5CEDA 3VOYA 2OAQ1 4MLLA 3T1QB 5FEFA 5GLCA 4UA7A 1DP6A 3MQOA 4S2MA 4MN5A 2K7SA 1DP8A 1YLTA 1VETA 1EW0A 2EX2A 1ACFA 1KGFA 2W27A 3U4LP 3NIAA 4I3AA 4GS9B 4KENB 3FPVA 2HDQA 2A24B 4X1MA 5GLDA 3OCNA 3PTEA 4GD6A 2VGLM 2PU2A 3E2KA 3BFGA 3GECA 1VETB 1RGZA 2XDMA 2HPBA 3QNCA 4KZ6A 3ITBA 4HP4A 4PAUA 5MC7A 3S7PA 3RH8B 2ZQDA 2ZMAA 1LT0A 1OTEA 3BFEA 3CJMA 2X71A 4QHCA 5FAPA 5E2EA 3CG5A 1MY8A 2OSUA 2IWBA 4QY5A 3O87A 5DJUA 3MZDA 2P7JA 2WGVA 2C6WB 3W4PA 3IWQA 1ODVA 3RXXA 4E6WA 5L07A 5TBMB 2QHKA 4ARZA 2ZMFA 1N4OA 1Z6FA 1V9ZA 3DWZA 4OQ0A 3H82A 3M6BA 4HBTA 1MWUA 3A0RA 1YKDA 3F1NB 3G32A 1V9YA 4Y3IA 3PBRA 3QP8A 3LIEA 1FILA 4RA7A 1ZG4A 4JXWA 4IUHA 4UAAA 4NETA 1S67L 4L9GA 5HAIA 1FIKA 2WKQA 1SKOB 1PZOA 4X25A 2QZ6A 1NYYA 3IHBA 5IU1A 3CUEC 1N9LA 4ZJ2A 3UN7A 1K25A 3ZYTA 4DN0A 3KO6A 3LYXA 2Y55A 2W3GA 5HDDA 3U2AA 2IWDA 3BM6A 4S2JA 4R3JA 5GHYA 2EA9A 3HVFA 2J3TC 5DF8A 3ZHHA 5FAQA 3MSHA 5HARA 4OLGA 4EBPA 3UB6A 2O99A 1PIOA 3NC8A 1C3BA 5AVEA 3ZNYA 2ZOIA 4HOIA 3BLMA 3DWKA 1YLWA 3BQAA 5HDSA 5HSQA 3FYZA 4WM9A 2M7UA 2VGJA 1KE4A 2VV6A 5F5YA 3O88A 3T50A 3LI8A 4P85A 2EXAA 2VJWA 3HLWA 3QP5A 1FSWA 1WE4A 3A0VA 3M6HA 4JF6A 1Y4OA 3DTEA 2EWWA 5IS1A 3PHYA 4PMAA 1T1AA 1GSWA 3ZVWA 4JF4A 3VP1A 4LV2A 5TFQA 4I38A 3IXGA 3SH7A 1K54A 4GDNA 2R9XA 3IX8A 4Y5FA 4HJ6A 3LR0A 1JWZA 5JYPA 5HX9A 3WS0A 3FWLA 4PM6A 1ONGA 4OOLA 4ZJ1A 3ZG9B 5GL9A 5EFWA 2VEAA 1BLSA 1MKMA 2V1BA 3HLEA 1W8YA 5CHJA 1ZTUA 3WS4A 3BLSA 1UWNX 4BJPA 4WMCD 3JVUA 1KVLA 1MWSA 3CAXA 1IELA 3RJUA 4NXGA 1KOUA 2PD7A 1LSVA 2YKFA 4JKTA 2EFUA 4DXBA 5DJTA 3IF6B 5AQAA 4KZAA 2Y2IA 2Z6DA 3CI6A 3LY4A 4KG6A 5DTTA 3UPOA 3S7QA 3C30A 4Q8IA 5EOEA 3PBQA 1TDGA 1XPBA 1E4DA 1L0FA 2E8JA 2H0TA 4S2NA 5J7EA 1MPLA 2HJEA 4HQAA 3OLOA 3FG8A 2H5SA 3T4KA 1OTBA 2IWCA 3G31A 1E25A 4PKYG 2ZBBA 4FCFA 3R7WA 3NOUC 3CLOA 1K38A 1XGJA 3MKEA 3Q07A 4R6LA 2O9CA 1Q2QA 2XK1A 4B4ZA 4JGPA 1JNUA 4ZJ3A 1NYMA 1TVFA 2ZM8A 4FUWA 4DF6A 2MJ6A 3N6IA 3GDIA 2GZAA 5E2HA 1H5XA 1BZAA 4S2LA 3JPUA 1XA1A 4D60A 3MQ0A 3WS5A 3G2YA 1MC0A 4MEZA 4MN6A 3KYEA 3NJAA 3BECA 3UE1A 3OZHA 1MBLA 2W1TB 5GHXA 3ZFZA 1ERQA 1DY6A 5J8XA 1D06A 4XUXA 2J7VA 4GKUA 4YWZA 3LY3A 4CLCC 3CZDA 3FC7A 4RVAA 1JWVA 2V20A 1LI9A 2Y2NA 3SS5A 3T4JA 5DFXA 3H82B 2LB9A 5AQBA 1NY0A 3FKWA 4HHDA 2WAFA 3BFDA 2I72A 3NBLA 3IXHA 4EEUA 2J8YA 4IBRA 4GD8A 1JTGA 2KOIA 4PM7A 2QJ5A 4X56A 1XKZA 2B18A 1W79A 1EWZA 2VK3A 3C7UA 2PU4A 4N1XA 3E2LA 4JXGA 4UEYA 3A0SA 1LL9A 2HP6A 3MZFA 1H8MA 1FCMA 2JBFA 5C5KA 2A24A 5F82A 1LL5A 2WKIA 1PI5A 5HDCA 1ZG6A 4Y2FA 2WKHA 1N9BA 2XSSA 1W63Q 1G6AA 3VFFA 4CQHA 4A5RA 4BENA 1TF1A 3BEBA 2VV7A 1K54C 3UO9A 4XT2A 4OH0A 5HZHA 4KZBA 1IYPA 4P0MA 4EERA 4WLAA 3PBNA 4IVIA 1O7EA 4QU3A 1G68A 2WZZA 2J9PA 3IBJA 1IKGA 2V0UA 1K6SA 2C5WB 4BQMA 4QB8A 2E8IA 2EX6A 1IEMA 5G4YA 3CMZA 3GTCA 3O5YA 2XLNA 2KDKA 2WUQA 5HFOA 2Y79A 4OLDA 2EX8A 3DW0A 5HD5A 1I2SA 4UA9A 3NOPC 1ES3A 4WBGA 1KGEA 4EQ1A 1X0OA 1NLZA 4E3LA 5CXWA 4I5SA 4JXVA 3K3CA 2Y2HA 1GSXA 4FH4A 1S6RA 1ALQA 3LI9A 4KZ7A 5KZHA 3SS3A 1NRFA 2HF6A 4BLMA 1GSVA 3SS4A 1ERMA 4KUKA 4HJ3A 1CI9A 1XJ2A 3Q7VA 1ES2A 3SW1A 5F1FA 4CPKA 1LL8A 4KZ8A 1BLCA 3G30A 2Y59A 4IJGA 3G34A 5A91A 4DXCA 2WKRA 2Y2MA 4BBTA 3OC2A 5HL6A 3GQZA 3ZG8B 2ACGA 3RTYA 2O9AA 5FQKA 4HY8A 4EWFA 4ETXA 4L0LA 3F1NA 4FD8A 3ZG5A 3HREA 1WA9A 4M4XA 2Y2JA 3O3VA 4DDSA 2UV0E 1BULA 1HZOA 4K08A 3NY4A 3T1XA 4XT2B 1DJBA 3DTIA 3VOZA 3N8SA 1IYSA 4E3MA 3EGXC 3H9WA 1OT9A 1D7EA 2PBDP 3QP2A 3SH9A 2ZD8A 4R3AA 2J3WA 3MJQA 1NLYA 2WZXA 5FQ9A 2KX6A 4C6YA 5BOHA 4JGOA 1AXBA 2HP9A 3KSIA 4R70A 4WYYA 3HBRA 2VA0A 1K4FA 2ZQ8A 3IX3A 1GA9A 4EW7A 2Y8HA 2EFXA 2ZOHA 1W7FA 1KGGA 3FKVA 3FZCA 2LB5A 5DVAA 4NKPA 1UWPX 4FSFA 5F6AA 3TJZC 5HWWA 2PBYA 4O0PA 2FH5A 2XF3A 3LGOA 1S4RA 2ZC6B 4S2NC 3F1OB 2ZL1B 4EBLA 1NZUA 4MCWA 3L9KA 4PPRA 4CLCB 3TW8A 2B5RA 3LR4A 4L9FA 3NDEA 1IKIA 4FH2A 2DCFA 5E2FA 4ZAMA 1K55A 3NOTC 4C3QA 4QWOA 3VP0A 3W8KA 3ISGA 4X6TA 3CHWP 2OLUA 5I94A 4OPQA 4IEDA 4ZBEA 4E3KA 5L2FA 4I3JA 1FQGA 3V67A 4R3BA 1MWRA 4JLFA 2ZQ9A 5G18A 3LICA 4E3JA 2AVXA 4L9EA 3LIFA 5CEBA 1K55C 5FATA 5DF7A 1EI5A 1G5UA 2CMNA 3T4SA 1SKOA 2Y91A 5FA7A 2HP5A 1HLUP 1KDSA 2A3UA 3VSKA 1S0WA 4IHQA 3HLGA 5HWTA 1W63M 3RFBA 1GCEA 1ES4A 4QY6A 4Q0JA 1BLPA 4LV1A 3HJIA 3BJNA 2IA2A 1K56A 3VE4A 1SDEA 3P98A 3IQAA 4BBVA 1YM1A 4HNBA 5I5LA 1T1CA 3B42A 4Q0IA 4DE3A 1KVMA 2ZQCA 3ZG0A 1YT4A 4HEFA 1XP4A 3HLCA 3MFDA 1QMFA 1J3WA 5M1AA 2K2NA 3IXBA 4I3IA 3V3RA 3B33A 2DNSA 3IBRA 1PW8A 2M1CA 3TRCA 4D2OA 4F3LB 5FAOA 1PWDA 3C8CA 2OLVA 4O7DA 1BLHA 1BSGA 3WWXA 3ZVTA 4H6JA 4BL2A 2XA7M 3OPHA 1PFLA 5TGFA 5EUAA 3C5AA 3PYPA 3UMEA 4EESA 5A92A 1I5QA 2ZC7A 2BASA 3OPRA 5IHVA 4N1HA 2ZJ9A 4JGRA 4Z9QA 3VSLA 4O8GA 4EBNA 1FSYA 2KLIA 3D4FA 5CECA 2ZMVA 3R4KA 4X55A 2L1MA 3A3DA 5D3OA 3MR0A 1HD8A 4S2OA 4KZ4A 5A8BA 5GHZA 3T12B 1P9WA 4ARZB 5M19A 1N9OA 1OJGA 5FEGA 4BD1A 1NZOA 3KSHA 4ETZA 4DE1A 5EVEA 1J9MA 4P6ZM 4OP5A 4OVDA 2ZLYA 2B95A 3LFVA 3BFCA 1L0EA 4LENA 3LUQA 4DKIA 4KG2A 2Q9MA 2R9WA 3MXSA 3TOIA 3W4OA 4N92A 2JKTI 2PR6A 3G6OA 1MWTA 2PDRA 3VFHA 3EQUA 1W8QA 4UQIM 4HI4A 3WRTA 2P08A 2X01A 1P97A 3MQQA 5EM0A 3CWFA 3IF6A 4JXSA 4DDYA 4ESPA
chains in the Genus database with same CATH topology
1ESIA 1PI5A 4E6XA 5GLCA 4UA7A 1ZG6A 2H10A 1K57C 4S2MA 4B4XA 4U0XA 2WKHA 1N9BA 1MXOA 1W5DA 1YLTA 1LI0A 2EX2A 1G6AA 3VFFA 1NJ4A 2OV5A 3IT9A 4A5RA 1KGFA 4BENA 3BEBA 1PW1A 1L0GA 3NIAA 4X53A 4B88A 1K54C 3UO9A 4KENB 2H0YA 4OH0A 2HDQA 4KZBA 1IYPA 4P0MA 4OPRA 3DTMA 5CRFA 5GLDA 3OCNA 2ZC5B 3PBNA 4IVIA 3PTEA 5EVID 1O7EA 4GD6A 4QU3A 1G68A 2WZZA 3OPLA 2ZC3B 2J9PA 1IKGA 1K6SA 2C5WB 5FQJA 3PBOA 2QMIA 2PU2A 3E2KA 3BFGA 1OMEA 1RGZA 3ZGAB 2XDMA 2HPBA 4BQMA 3QNCA 4KZ6A 4QB8A 2E8IA 5DTSA 5CGWA 4R1GA 2EX6A 3ITBA 1IEMA 3VP2A 2ZQ7A 4UHUA 3CMZA 3GTCA 5EECA 1RCJA 4K91A 2ZQDA 2XLNA 1BTLA 2ZMAA 2WUQA 1LHYA 5HFOA 3VP3A 3BFEA 1FR1A 3CJMA 2XH9A 1ESUA 2ZQAA 2JE5A 1U60A 2X71A 3PBSA 4QHCA 4S2IA 4OLDA 2EX8A 3VMAA 1RGYA 3DW0A 5FAPA 5E2EA 3CG5A 1MY8A 1I2SA 3GR2A 4UA9A 4ZTKA 2OSUA 1ES3A 2XD5A 2IWBA 1GHPA 1RP5A 3G4PA 1KE0A 1KGEA 2RL3A 3O87A 4QY5A 3MZDA 4WBGA 2WGVA 1Y54A 4E3LA 5CXWA 2C6WB 4MBKA 3UNWA 3MKFA 3IWQA 4JXVA 3W4PA 3S4XA 2Y2HA 1CEFA 3RXXA 4FH4A 1TEMA 1S6RA 3UPNA 1ALQA 4MLLA 4KZ7A 1E3UA 4E6WA 2V1ZA 4QJGA 5KZHA 1K57A 3Q7ZA 3M2KA 3SS3A 1ES5A 3GMWA 2EX9A 2G2UA 2Y4AA 4K0WA 1GHIA 4Y0TA 1NRFA 4HESA 4JBFA 4BLMA 3SS4A 2DRWA 1ERMA 3I7JA 2Y2LA 1CI9A 1N4OA 4K0XA 5FASA 1VM1A 2WYXA 3Q7VA 5EE8A 1Z6FA 4GZBA 4LV3A 1ES2A 5F1FA 3DWZA 4CPKA 3C4OA 5DF9A 5EVIB 4OQ0A 1EROA 1PZPA 4P6BA 4ZDXA 4KZ8A 3M6BA 5JYOA 3GV9A 4HBTA 4UA6A 1BLCA 3W4QA 1MWUA 3A3JA 3G30A 4GB7A 5U47A 2Y59A 1YLYA 3G32A 5HAQA 2JCHA 3G34A 3PBRA 4KG5A 4Y0UA 5A91A 3IXDA 4DXCA 3S1YA 3IWOA 2Y2MA 1YLJA 4N9KA 3OC2A 4RA7A 5GLAA 3WRZA 1ZG4A 5E2GA 4JXWA 3GQZA 3ZG8B 4UAAA 3A3IA 4NETA 5FQIA 4WEKA 2P74A 2Y2GA 5HAIA 5FQKA 1YMSA 4EWFA 3V39A 4XXRA 1PZOA 2ZC4B 3N8RA 5A93A 4L0LA 2QZ6A 1YLPA 3UDIA 3VP4A 4C75A 1NYYA 3V3SA 1I2WA 4FD8A 3ZG5A 3HREA 1DJAA 2Y2JA 3IHBA 4BL3A 3O3VA 4DDSA 5FSRA 1IYOA 1BULA 1HZOA 3PAEA 5FI2A 3NY4A 4ZJ2A 1ZC2A 3UN7A 1K25A 3IWIA 2FFYA 3ITAA 1DJBA 2Y55A 1K56D 4JF5A 3VOZA 1XGIA 2IWDA 3N8SA 1IYSA 3BM6A 4KZ5A 4E3MA 5CHUA 3IH8A 1M6KA 4S2JA 4R3JA 5GHYA 1XXMA 4S2PA 3HVFA 4RX3A 5DF8A 3ZHHA 5FAQA 5FQMA 5HARA 2ZM2A 4OLGA 3ZG7B 4EBPA 3SH9A 2BLSA 2ZD8A 4E3NA 1MKIA 4R4RA 3MBZA 3BFFA 1PIOA 3NC8A 1C3BA 1FCOA 2WZXA 3ZNYA 2FFFB 5CTNA 3NDGA 5FQ9A 5CERA 1SHVA 4OOYA 4C6YA 1XA7A 5BOHA 5KSCA 1WYBA 3BLMA 3HLFA 3DWKA 4OQHA 1AXBA 1YLWA 1O07A 4PM5A 4RYEA 4X69A 1YMXA 2HP9A 3NCKA 3C7VA 3FYZA 4MBFA 4WYYA 3HBRA 4WM9A 2VGJA 1KE4A 1E3UD 1K4FA 3S22A 2G2WA 4RX2A 3O88A 2ZQ8A 5TR7A 3QHYA 4P85A 2EXAA 2RCXA 4WZ5C 3ZNTA 3OCLA 3HLWA 5HL1A 1GA9A 1IYQA 2EFXA 5HW3A 1W7FA 1KGGA 1FSWA 3FKVA 1NXYA 1WE4A 3FZCA 4H8RA 5DVAA 1BT5A 4WZ4A 3M6HA 1FCNA 4FSFA 4JF6A 1M40A 2PBYA 1JVJA 5HAPA 4MBHA 5GLBA 1VQQA 2XF3A 3HL9A 1PYYA 4GOGA 2ZC6B 4S2NC 3TG9A 4EBLA 4PMAA 1NZUA 4P87A 4DE2A 2XGNA 4PPRA 4R4SA 1PWGA 2B5RA 1H8YA 5FI7A 3IH9A 3NDEA 3ZVWA 1TDLA 4JF4A 4BD0A 4JPMA 3VP1A 1IKIA 3QNBA 4FH2A 4OONA 4LV2A 2DCFA 5E2FA 3BRMA 4NK3A 5E43A 5TFQA 4F94A 3C4PA 3Q7VB 4ZAMA 3V50A 1K55A 3IXGA 4EUZA 3SH7A 3EQVA 4C3QA 5EVIA 3VP0A 1K54A 4GDNA 3W8KA 2R9XA 3ISGA 4WELA 4X6TA 2OLUA 3JYIA 5I94A 3PAGA 4DRTA 2HDRA 4ID4A 1JWZA 4OPQA 4IEDA 4ZBEA 4E3KA 5JYPA 5L2FA 5HX9A 5DTKA 1FQGA 4R3BA 1MWRA 3WS0A 3UY6A 3FWLA 4KQOA 4JLFA 2ZQ9A 3HUMA 4PM6A 1ONGA 2P9VB 4OOLA 5G18A 3WS2A 4E3JA 1KDWA 3AGFA 4YINA 1SKFA 4ZJ1A 3ZG9B 3MZEA 5GL9A 2Z2LB 1K4EA 2WK0A 4KZ9A 5CEBA 1K55C 5FATA 4DE0A 5DF7A 1EI5A 4KQQA 3IF6C 1BLSA 4QD4A 2Y91A 5FA7A 2HP5A 3HLEA 5F83A 1W8YA 1KDSA 1ZKJA 5CHJA 3UE0A 5CGXA 3WS4A 2A3UA 3VSKA 1S0WA 3G2ZA 3BLSA 3HLGA 4U3TA 1KE3A 2CC1A 4BJPA 4WMCD 1PWCA 4YFMA 2XFTA 5FQQA 1GCEA 1ES4A 4LCMA 4QY6A 3V5MA 1KVLA 3N8LA 3ZDJA 3N4IA 1BUEA 1MWSA 1SCWA 1BLPA 1IELA 4R23A 3SOIA 4GNUA 4LV1A 3RJUA 5FI6A 5AQ9A 3UDXA 4OP8A 5EOOA 4KQRA 4JKTA 1K6RA 1K56A 2EFUA 2Y2PA 4DXBA 3O86A 4XUZA 5EVIC 1CEGA 1SDEA 3GVBA 3P98A 3IF6B 1JTDA 3IQAA 3M2JA 5AQAA 4KZAA 1GHMA 1YM1A 2Y2IA 4X68A 3NI9A 3LY4A 2Y2KA 4KG6A 1YLZA 4U0TA 4DE3A 1KVMA 5DTTA 1HTZA 3A3FA 3UPOA 2ZQCA 1SDNA 1L2SA 4E3OA 3ZG0A 4Q8IA 5EOEA 5FDHA 3PBQA 4IBXA 1YQSA 1YT4A 4HEFA 1TDGA 1XPBA 1XP4A 4GN2A 1E4DA 1L0FA 2H0TA 4KZ3A 4S2NA 1MPLA 2P9VA 3HLCA 3MFDA 1QMFA 4OOMA 4S2KA 3HLBA 4MNRA 4Y0OA 5M1AA 2H5SA 3IXBA 2XD1A 3V3RA 2WGWA 2IWCA 1FR6A 3G31A 1E25A 4OPZA 2DNSA 2VGKA 3GRJA 1PW8A 2HDUA 2Q9NA 3HUNA 4FCFA 4IVKA 4D2OA 1LLBA 2X02A 5FAOA 1PWDA 2V2FF 2OLVA 1K38A 3B3XA 3BYDA 3LCEA 3G35A 1XGJA 4O7DA 1BLHA 1BSGA 3WWXA 4E3IA 4OKPA 5CTMA 3MKEA 1XX2A 5A90A 2GDNA 3HLDA 4WZ5A 3Q07A 3ZVTA 2WKEA 4BL2A 1Q2QA 3N7WA 2ZM0A 2XK1A 3OPHA 2A49A 3UE3A 4B4ZA 2Y2OA 5TGFA 5EUAA 4ZJ3A 1NYMA 3AGDA 3WS1A 3C5AA 5A92A 1I5QA 4LCLA 2Y2QA 2ZC7A 1TVFA 3MXRA 3OPRA 5IHVA 2JC7A 2QPNA 1Q2PA 2ZJ9A 4N1HA 4LV0A 3A3EA 4GDBA 3LO7A 4WEJA 4Z9QA 3VSLA 1PI4A 2Z2MB 3FV7A 4EBNA 2WAEA 1FSYA 2ZM8A 4DF6A 3D4FA 5CECA 2XEPA 3N6IA 5E2HA 4EQIA 2HDSA 1H5XA 1BZAA 4S2LA 1XA1A 3WS5A 3G2YA 4OPYA 4X55A 2XR0A 3A3DA 3Q1FA 5D3OA 5EVLA 1QMEA 4MEZA 4WMCA 1HD8A 2J9OA 4Y7PA 4S2OA 4KZ4A 3BECA 4M3KA 3Q82A 3OZHA 5GHZA 3GSGA 1MBLA 3UE1A 1CK3A 3RXWA 5GHXA 3SH8A 5EPHA 3ZFZA 1ERQA 5M19A 2UWXA 1DY6A 4HBUA 5J8XA 4XUXA 3P09A 3UPPA 4BD1A 1NZOA 1CI8A 3OPPA 2J7VA 4GKUA 4R0QA 4CJNA 2EXBA 3LY3A 1FOFA 3ZCZA 4DE1A 1L0DA 4N9LA 2BG1A 1J9MA 3CZDA 3TSGA 1JWPA 4RVAA 1JWVA 2V20A 2WGWB 4OP5A 1ONHA 1LI9A 1WYCA 3Q81A 2Y2NA 3SS5A 4OVDA 4PM8A 2ZLYA 5F1GA 1GA0A 4EV4A 5CGSA 5AQBA 3PBTA 1NY0A 3FKWA 5M18A 3BFCA 1L0EA 4LENA 2WAFA 3BFDA 5AQ7A 2I72A 3NBLA 3IXHA 3IHAA 2J8YA 5KMWA 4IBRA 1DJCA 4GD8A 4PM9A 1JTGA 4DKIA 4KG2A 4PM7A 2Q9MA 4X56A 3IF5A 2R9WA 1XKZA 3MXSA 2WADA 1W79A 1EWZA 4N92A 3TOIA 3HUOA 3C7UA 3W4OA 2PU4A 4OQGA 1MWTA 2XFSA 2WGIA 4N1XA 5CHMA 3E2LA 1H8ZA 3VFHA 3EQUA 1W8QA 4JXGA 3WRTA 2X01A 3AGEA 4OQIA 1LL9A 2HP6A 3MZFA 3UDFA 1FCMA 1HVBA 2JBFA 5KSHA 4JXSA 3IF6A 4DDYA 2XQZA 5CEDA 3VOYA 5F82A 1LL5A 2WKIA 3LEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESI A;  1PI5 A;  4E6X A;  5GLC A;  4UA7 A;  1ZG6 A;  2H10 A;  1K57 C;  4S2M A;  4B4X A;  4U0X A;  2WKH A;  1N9B A;  1MXO A;  1W5D A;  1YLT A;  1LI0 A;  2EX2 A;  1G6A A;  3VFF A;  1NJ4 A;  2OV5 A;  3IT9 A;  4A5R A;  1KGF A;  4BEN A;  3BEB A;  1PW1 A;  1L0G A;  3NIA A;  4X53 A;  4B88 A;  1K54 C;  3UO9 A;  4KEN B;  2H0Y A;  4OH0 A;  2HDQ A;  4KZB A;  1IYP A;  4P0M A;  4OPR A;  3DTM A;  5CRF A;  5GLD A;  3OCN A;  2ZC5 B;  3PBN A;  4IVI A;  3PTE A;  5EVI D;  1O7E A;  4GD6 A;  4QU3 A;  1G68 A;  2WZZ A;  3OPL A;  2ZC3 B;  2J9P A;  1IKG A;  1K6S A;  2C5W B;  5FQJ A;  3PBO A;  2QMI A;  2PU2 A;  3E2K A;  3BFG A;  1OME A;  1RGZ A;  3ZGA B;  2XDM A;  2HPB A;  4BQM A;  3QNC A;  4KZ6 A;  4QB8 A;  2E8I A;  5DTS A;  5CGW A;  4R1G A;  2EX6 A;  3ITB A;  1IEM A;  3VP2 A;  2ZQ7 A;  4UHU A;  3CMZ A;  3GTC A;  5EEC A;  1RCJ A;  4K91 A;  2ZQD A;  2XLN A;  1BTL A;  2ZMA A;  2WUQ A;  1LHY A;  5HFO A;  3VP3 A;  3BFE A;  1FR1 A;  3CJM A;  2XH9 A;  1ESU A;  2ZQA A;  2JE5 A;  1U60 A;  2X71 A;  3PBS A;  4QHC A;  4S2I A;  4OLD A;  2EX8 A;  3VMA A;  1RGY A;  3DW0 A;  5FAP A;  5E2E A;  3CG5 A;  1MY8 A;  1I2S A;  3GR2 A;  4UA9 A;  4ZTK A;  2OSU A;  1ES3 A;  2XD5 A;  2IWB A;  1GHP A;  1RP5 A;  3G4P A;  1KE0 A;  1KGE A;  2RL3 A;  3O87 A;  4QY5 A;  3MZD A;  4WBG A;  2WGV A;  1Y54 A;  4E3L A;  5CXW A;  2C6W B;  4MBK A;  3UNW A;  3MKF A;  3IWQ A;  4JXV A;  3W4P A;  3S4X A;  2Y2H A;  1CEF A;  3RXX A;  4FH4 A;  1TEM A;  1S6R A;  3UPN A;  1ALQ A;  4MLL A;  4KZ7 A;  1E3U A;  4E6W A;  2V1Z A;  4QJG A;  5KZH A;  1K57 A;  3Q7Z A;  3M2K A;  3SS3 A;  1ES5 A;  3GMW A;  2EX9 A;  2G2U A;  2Y4A A;  4K0W A;  1GHI A;  4Y0T A;  1NRF A;  4HES A;  4JBF A;  4BLM A;  3SS4 A;  2DRW A;  1ERM A;  3I7J A;  2Y2L A;  1CI9 A;  1N4O A;  4K0X A;  5FAS A;  1VM1 A;  2WYX A;  3Q7V A;  5EE8 A;  1Z6F A;  4GZB A;  4LV3 A;  1ES2 A;  5F1F A;  3DWZ A;  4CPK A;  3C4O A;  5DF9 A;  5EVI B;  4OQ0 A;  1ERO A;  1PZP A;  4P6B A;  4ZDX A;  4KZ8 A;  3M6B A;  5JYO A;  3GV9 A;  4HBT A;  4UA6 A;  1BLC A;  3W4Q A;  1MWU A;  3A3J A;  3G30 A;  4GB7 A;  5U47 A;  2Y59 A;  1YLY A;  3G32 A;  5HAQ A;  2JCH A;  3G34 A;  3PBR A;  4KG5 A;  4Y0U A;  5A91 A;  3IXD A;  4DXC A;  3S1Y A;  3IWO A;  2Y2M A;  1YLJ A;  4N9K A;  3OC2 A;  4RA7 A;  5GLA A;  3WRZ A;  1ZG4 A;  5E2G A;  4JXW A;  3GQZ A;  3ZG8 B;  4UAA A;  3A3I A;  4NET A;  5FQI A;  4WEK A;  2P74 A;  2Y2G A;  5HAI A;  5FQK A;  1YMS A;  4EWF A;  3V39 A;  4XXR A;  1PZO A;  2ZC4 B;  3N8R A;  5A93 A;  4L0L A;  2QZ6 A;  1YLP A;  3UDI A;  3VP4 A;  4C75 A;  1NYY A;  3V3S A;  1I2W A;  4FD8 A;  3ZG5 A;  3HRE A;  1DJA A;  2Y2J A;  3IHB A;  4BL3 A;  3O3V A;  4DDS A;  5FSR A;  1IYO A;  1BUL A;  1HZO A;  3PAE A;  5FI2 A;  3NY4 A;  4ZJ2 A;  1ZC2 A;  3UN7 A;  1K25 A;  3IWI A;  2FFY A;  3ITA A;  1DJB A;  2Y55 A;  1K56 D;  4JF5 A;  3VOZ A;  1XGI A;  2IWD A;  3N8S A;  1IYS A;  3BM6 A;  4KZ5 A;  4E3M A;  5CHU A;  3IH8 A;  1M6K A;  4S2J A;  4R3J A;  5GHY A;  1XXM A;  4S2P A;  3HVF A;  4RX3 A;  5DF8 A;  3ZHH A;  5FAQ A;  5FQM A;  5HAR A;  2ZM2 A;  4OLG A;  3ZG7 B;  4EBP A;  3SH9 A;  2BLS A;  2ZD8 A;  4E3N A;  1MKI A;  4R4R A;  3MBZ A;  3BFF A;  1PIO A;  3NC8 A;  1C3B A;  1FCO A;  2WZX A;  3ZNY A;  2FFF B;  5CTN A;  3NDG A;  5FQ9 A;  5CER A;  1SHV A;  4OOY A;  4C6Y A;  1XA7 A;  5BOH A;  5KSC A;  1WYB A;  3BLM A;  3HLF A;  3DWK A;  4OQH A;  1AXB A;  1YLW A;  1O07 A;  4PM5 A;  4RYE A;  4X69 A;  1YMX A;  2HP9 A;  3NCK A;  3C7V A;  3FYZ A;  4MBF A;  4WYY A;  3HBR A;  4WM9 A;  2VGJ A;  1KE4 A;  1E3U D;  1K4F A;  3S22 A;  2G2W A;  4RX2 A;  3O88 A;  2ZQ8 A;  5TR7 A;  3QHY A;  4P85 A;  2EXA A;  2RCX A;  4WZ5 C;  3ZNT A;  3OCL A;  3HLW A;  5HL1 A;  1GA9 A;  1IYQ A;  2EFX A;  5HW3 A;  1W7F A;  1KGG A;  1FSW A;  3FKV A;  1NXY A;  1WE4 A;  3FZC A;  4H8R A;  5DVA A;  1BT5 A;  4WZ4 A;  3M6H A;  1FCN A;  4FSF A;  4JF6 A;  1M40 A;  2PBY A;  1JVJ A;  5HAP A;  4MBH A;  5GLB A;  1VQQ A;  2XF3 A;  3HL9 A;  1PYY A;  4GOG A;  2ZC6 B;  4S2N C;  3TG9 A;  4EBL A;  4PMA A;  1NZU A;  4P87 A;  4DE2 A;  2XGN A;  4PPR A;  4R4S A;  1PWG A;  2B5R A;  1H8Y A;  5FI7 A;  3IH9 A;  3NDE A;  3ZVW A;  1TDL A;  4JF4 A;  4BD0 A;  4JPM A;  3VP1 A;  1IKI A;  3QNB A;  4FH2 A;  4OON A;  4LV2 A;  2DCF A;  5E2F A;  3BRM A;  4NK3 A;  5E43 A;  5TFQ A;  4F94 A;  3C4P A;  3Q7V B;  4ZAM A;  3V50 A;  1K55 A;  3IXG A;  4EUZ A;  3SH7 A;  3EQV A;  4C3Q A;  5EVI A;  3VP0 A;  1K54 A;  4GDN A;  3W8K A;  2R9X A;  3ISG A;  4WEL A;  4X6T A;  2OLU A;  3JYI A;  5I94 A;  3PAG A;  4DRT A;  2HDR A;  4ID4 A;  1JWZ A;  4OPQ A;  4IED A;  4ZBE A;  4E3K A;  5JYP A;  5L2F A;  5HX9 A;  5DTK A;  1FQG A;  4R3B A;  1MWR A;  3WS0 A;  3UY6 A;  3FWL A;  4KQO A;  4JLF A;  2ZQ9 A;  3HUM A;  4PM6 A;  1ONG A;  2P9V B;  4OOL A;  5G18 A;  3WS2 A;  4E3J A;  1KDW A;  3AGF A;  4YIN A;  1SKF A;  4ZJ1 A;  3ZG9 B;  3MZE A;  5GL9 A;  2Z2L B;  1K4E A;  2WK0 A;  4KZ9 A;  5CEB A;  1K55 C;  5FAT A;  4DE0 A;  5DF7 A;  1EI5 A;  4KQQ A;  3IF6 C;  1BLS A;  4QD4 A;  2Y91 A;  5FA7 A;  2HP5 A;  3HLE A;  5F83 A;  1W8Y A;  1KDS A;  1ZKJ A;  5CHJ A;  3UE0 A;  5CGX A;  3WS4 A;  2A3U A;  3VSK A;  1S0W A;  3G2Z A;  3BLS A;  3HLG A;  4U3T A;  1KE3 A;  2CC1 A;  4BJP A;  4WMC D;  1PWC A;  4YFM A;  2XFT A;  5FQQ A;  1GCE A;  1ES4 A;  4LCM A;  4QY6 A;  3V5M A;  1KVL A;  3N8L A;  3ZDJ A;  3N4I A;  1BUE A;  1MWS A;  1SCW A;  1BLP A;  1IEL A;  4R23 A;  3SOI A;  4GNU A;  4LV1 A;  3RJU A;  5FI6 A;  5AQ9 A;  3UDX A;  4OP8 A;  5EOO A;  4KQR A;  4JKT A;  1K6R A;  1K56 A;  2EFU A;  2Y2P A;  4DXB A;  3O86 A;  4XUZ A;  5EVI C;  1CEG A;  1SDE A;  3GVB A;  3P98 A;  3IF6 B;  1JTD A;  3IQA A;  3M2J A;  5AQA A;  4KZA A;  1GHM A;  1YM1 A;  2Y2I A;  4X68 A;  3NI9 A;  3LY4 A;  2Y2K A;  4KG6 A;  1YLZ A;  4U0T A;  4DE3 A;  1KVM A;  5DTT A;  1HTZ A;  3A3F A;  3UPO A;  2ZQC A;  1SDN A;  1L2S A;  4E3O A;  3ZG0 A;  4Q8I A;  5EOE A;  5FDH A;  3PBQ A;  4IBX A;  1YQS A;  1YT4 A;  4HEF A;  1TDG A;  1XPB A;  1XP4 A;  4GN2 A;  1E4D A;  1L0F A;  2H0T A;  4KZ3 A;  4S2N A;  1MPL A;  2P9V A;  3HLC A;  3MFD A;  1QMF A;  4OOM A;  4S2K A;  3HLB A;  4MNR A;  4Y0O A;  5M1A A;  2H5S A;  3IXB A;  2XD1 A;  3V3R A;  2WGW A;  2IWC A;  1FR6 A;  3G31 A;  1E25 A;  4OPZ A;  2DNS A;  2VGK A;  3GRJ A;  1PW8 A;  2HDU A;  2Q9N A;  3HUN A;  4FCF A;  4IVK A;  4D2O A;  1LLB A;  2X02 A;  5FAO A;  1PWD A;  2V2F F;  2OLV A;  1K38 A;  3B3X A;  3BYD A;  3LCE A;  3G35 A;  1XGJ A;  4O7D A;  1BLH A;  1BSG A;  3WWX A;  4E3I A;  4OKP A;  5CTM A;  3MKE A;  1XX2 A;  5A90 A;  2GDN A;  3HLD A;  4WZ5 A;  3Q07 A;  3ZVT A;  2WKE A;  4BL2 A;  1Q2Q A;  3N7W A;  2ZM0 A;  2XK1 A;  3OPH A;  2A49 A;  3UE3 A;  4B4Z A;  2Y2O A;  5TGF A;  5EUA A;  4ZJ3 A;  1NYM A;  3AGD A;  3WS1 A;  3C5A A;  5A92 A;  1I5Q A;  4LCL A;  2Y2Q A;  2ZC7 A;  1TVF A;  3MXR A;  3OPR A;  5IHV A;  2JC7 A;  2QPN A;  1Q2P A;  2ZJ9 A;  4N1H A;  4LV0 A;  3A3E A;  4GDB A;  3LO7 A;  4WEJ A;  4Z9Q A;  3VSL A;  1PI4 A;  2Z2M B;  3FV7 A;  4EBN A;  2WAE A;  1FSY A;  2ZM8 A;  4DF6 A;  3D4F A;  5CEC A;  2XEP A;  3N6I A;  5E2H A;  4EQI A;  2HDS A;  1H5X A;  1BZA A;  4S2L A;  1XA1 A;  3WS5 A;  3G2Y A;  4OPY A;  4X55 A;  2XR0 A;  3A3D A;  3Q1F A;  5D3O A;  5EVL A;  1QME A;  4MEZ A;  4WMC A;  1HD8 A;  2J9O A;  4Y7P A;  4S2O A;  4KZ4 A;  3BEC A;  4M3K A;  3Q82 A;  3OZH A;  5GHZ A;  3GSG A;  1MBL A;  3UE1 A;  1CK3 A;  3RXW A;  5GHX A;  3SH8 A;  5EPH A;  3ZFZ A;  1ERQ A;  5M19 A;  2UWX A;  1DY6 A;  4HBU A;  5J8X A;  4XUX A;  3P09 A;  3UPP A;  4BD1 A;  1NZO A;  1CI8 A;  3OPP A;  2J7V A;  4GKU A;  4R0Q A;  4CJN A;  2EXB A;  3LY3 A;  1FOF A;  3ZCZ A;  4DE1 A;  1L0D A;  4N9L A;  2BG1 A;  1J9M A;  3CZD A;  3TSG A;  1JWP A;  4RVA A;  1JWV A;  2V20 A;  2WGW B;  4OP5 A;  1ONH A;  1LI9 A;  1WYC A;  3Q81 A;  2Y2N A;  3SS5 A;  4OVD A;  4PM8 A;  2ZLY A;  5F1G A;  1GA0 A;  4EV4 A;  5CGS A;  5AQB A;  3PBT A;  1NY0 A;  3FKW A;  5M18 A;  3BFC A;  1L0E A;  4LEN A;  2WAF A;  3BFD A;  5AQ7 A;  2I72 A;  3NBL A;  3IXH A;  3IHA A;  2J8Y A;  5KMW A;  4IBR A;  1DJC A;  4GD8 A;  4PM9 A;  1JTG A;  4DKI A;  4KG2 A;  4PM7 A;  2Q9M A;  4X56 A;  3IF5 A;  2R9W A;  1XKZ A;  3MXS A;  2WAD A;  1W79 A;  1EWZ A;  4N92 A;  3TOI A;  3HUO A;  3C7U A;  3W4O A;  2PU4 A;  4OQG A;  1MWT A;  2XFS A;  2WGI A;  4N1X A;  5CHM A;  3E2L A;  1H8Z A;  3VFH A;  3EQU A;  1W8Q A;  4JXG A;  3WRT A;  2X01 A;  3AGE A;  4OQI A;  1LL9 A;  2HP6 A;  3MZF A;  3UDF A;  1FCM A;  1HVB A;  2JBF A;  5KSH A;  4JXS A;  3IF6 A;  4DDY A;  2XQZ A;  5CED A;  3VOY A;  5F82 A;  1LL5 A;  2WKI A;  3LEZ A; 
#chains in the Genus database with same CATH topology
 1ESI A;  4E6X A;  2W3H A;  1YSQ A;  1W5D A;  1LI0 A;  4EET B;  4H6J B;  1NJ4 A;  3KSF A;  1LSX A;  3VOL A;  2HV1 A;  2H0Y A;  4EEP A;  4LRZ E;  4DJ3 A;  3DTM A;  5CRF A;  3TE8 A;  2ZC5 B;  3OPL A;  2ZC3 B;  1TS8 A;  1XFN A;  5FQJ A;  2B02 A;  2QMI A;  3FPW A;  3IS2 B;  1OME A;  3ZGA B;  4GHI A;  4R1G A;  5DKL A;  3KYZ A;  2ZQ7 A;  3OBF A;  1RCJ A;  4K91 A;  1BTL A;  1TS0 A;  2XH9 A;  3PBS A;  2ZQA A;  1U60 A;  4S2I A;  4EUV A;  3LID A;  4ZTK A;  3G4P A;  2RL3 A;  4LGW A;  1OTI A;  1S66 L;  3MKF A;  1CEF A;  1TEM A;  3F1P A;  2V1Z A;  4QJG A;  3Q7Z A;  3M2K A;  3E4P A;  4Y0T A;  2G2U A;  2Y4A A;  2VKS A;  4K0W A;  3UB7 A;  2DRW A;  2WKP A;  4NXB A;  4K0X A;  5FAS A;  2VX8 A;  4Z1W A;  5EE8 A;  4GZB A;  3S7N A;  5TJJ A;  5DKK A;  1PZP A;  1DRM A;  3T4Q A;  4UA6 A;  5U47 A;  5HAQ A;  2JCH A;  5L10 A;  4KG5 A;  4Y0U A;  3IXD A;  3F1O A;  3S1Y A;  4N9K A;  5GLA A;  3JVV A;  3WRZ A;  5E2G A;  4WEK A;  3EOI A;  2P74 A;  5F68 A;  2Y2G A;  3CIT A;  3V39 A;  4XXR A;  2ZC4 B;  3N8R A;  2D02 A;  2V8F A;  1I2W A;  4B9O A;  5FSR A;  1IYO A;  3PAE A;  1STZ A;  2HGV A;  4I39 A;  5FI2 A;  3IWI A;  1Y28 A;  4GS9 A;  4JF5 A;  4PKY A;  1XGI A;  3IH8 A;  2OAP 1;  5J3W A;  4NG2 A;  2INW A;  4S2P A;  3BY8 A;  1A0K A;  1YAX A;  3ZG7 B;  3E98 A;  4YOF A;  4E3N A;  1MKI A;  1F9I A;  3KSG A;  2M7V A;  5L8M A;  4GHI B;  2FFF B;  1P9R A;  4WL9 A;  3NDG A;  3P01 A;  1O07 A;  3NCK A;  3W2Z A;  4MBF A;  4B93 A;  2QWS A;  1DP9 A;  1E3U D;  3S22 A;  2G2W A;  2V8C A;  3QHY A;  2RCX A;  4WZ5 C;  3ZNT A;  3ZQ5 A;  3OCL A;  5HW3 A;  3LIA A;  4DJ2 A;  1BT5 A;  1CJF A;  1JVJ A;  5HAP A;  4LFU A;  5GLB A;  1VQQ A;  2P04 A;  3BY9 A;  2VLG A;  4GOG A;  3TG9 A;  2V9A A;  3K3D A;  3MFX A;  3T1S A;  1UGU A;  4DE2 A;  4R4S A;  1NWZ A;  5FI7 A;  3LEQ A;  5F69 A;  5HPF A;  4BD0 A;  1PRQ A;  5DFY A;  2PD8 A;  4F94 A;  1BYW A;  4WEL A;  3UB9 A;  3QP6 A;  3JYI A;  4DRT A;  2GNX A;  2HDR A;  4ID4 A;  4II7 A;  5DTK A;  2HZ5 A;  3UY6 A;  4KQD A;  2JN7 A;  2P9V B;  3WS2 A;  3AGF A;  1G6O A;  2GX5 A;  4QPR A;  2Z2L B;  1K4E A;  4KZ9 A;  4MMN A;  3LIB A;  3UB8 A;  4HIA A;  4Y15 A;  4QD4 A;  1IFQ A;  5F83 A;  2JKR M;  3UE0 A;  5CGX A;  2L4R A;  3G2Z A;  2BTF P;  3IX4 A;  4YFM A;  4LCM A;  1S1Z A;  3CPT A;  1F2K A;  3N8L A;  2PR5 A;  1BUE A;  1SCW A;  1VHM A;  5EV0 A;  3SOI A;  4OP8 A;  4KQR A;  2Y2P A;  3O86 A;  4XUZ A;  5EVI C;  3GVB A;  3M2J A;  4HH3 A;  4CLC D;  1GHM A;  4X68 A;  1YLZ A;  1SDN A;  2JKT M;  2PYR A;  4E3O A;  2G7U A;  1YQS A;  2K31 A;  4GN2 A;  4KZ3 A;  3MF0 A;  2P9V A;  4OOM A;  4S2K A;  4O01 A;  4Y0O A;  2XD1 A;  1OTD A;  4OPZ A;  2VGK A;  3GRJ A;  3H7W A;  3HUN A;  2YKH A;  2X02 A;  3ULF A;  3LCE A;  3B3X A;  4E3I A;  1XX2 A;  5A90 A;  3B47 A;  4BBU A;  2A49 A;  1F98 A;  3UE3 A;  2Y2O A;  2PHY A;  4WUJ A;  4G3K A;  3WS1 A;  1SZV A;  4LCL A;  1XJ3 A;  5G4Z A;  4WEJ A;  2JC7 A;  3CUE A;  4EU0 A;  4GDB A;  2XEP A;  2NUP C;  5AVF A;  4EQI A;  4CLC A;  3LR3 A;  3T1R A;  2PRF A;  2XR0 A;  3Q1F A;  4G3W A;  5EVL A;  2R78 A;  2J9O A;  4Y7P A;  3F1P B;  3Q82 A;  2W0N A;  1CK3 A;  2V0W A;  3P09 A;  2D01 A;  3SZT A;  3OPP A;  4R0Q A;  4CJN A;  2EXB A;  1N9N A;  3ZCZ A;  1L0D A;  2BG1 A;  3TSG A;  1OPX A;  4G3V A;  5L09 A;  2WGW B;  3Q81 A;  2JKF A;  3BWL A;  5F1G A;  4EV4 A;  3C38 A;  5CGS A;  3PBT A;  1VEU A;  5AQ7 A;  4EXO A;  4Y13 A;  5KMW A;  1DJC A;  1TD5 A;  3IF5 A;  5TBM A;  3HUO A;  5J4E A;  4OQG A;  2XFS A;  2WGI A;  5CHM A;  1H8Z A;  4OQI A;  5KSH A;  2PAV P;  3R7W B;  1L3L A;  3D72 A;  4GCZ A;  3LEZ A;  3MMH A;  2H10 A;  1K57 C;  4B4X A;  4U0X A;  1MXO A;  2W1T A;  2W3F A;  2OV5 A;  2NUT C;  3IT9 A;  4PHT A;  1PW1 A;  1L0G A;  4X53 A;  4B88 A;  5FDS A;  1Z09 A;  4OPR A;  5EVI D;  3PR6 A;  4NEE D;  3PBO A;  5K5B A;  1OTA A;  4R38 A;  5DTS A;  5CGW A;  4CLC E;  3VP2 A;  4UHU A;  5EEC A;  5KIZ A;  1OT6 A;  1F5M A;  2FZ0 A;  3VP3 A;  1LHY A;  1FR1 A;  4P6Z S;  1ESU A;  2JE5 A;  4Q0H A;  3VMA A;  1RGY A;  3GR2 A;  1PNE A;  2XD5 A;  1GHP A;  1RP5 A;  1KE0 A;  4HJ4 A;  2JKR I;  3BW6 A;  1Y54 A;  4FTX A;  1VEU B;  2H28 A;  4MBK A;  3UNW A;  4F3L A;  3EEH A;  3S4X A;  4AFI A;  3EGD C;  3UPN A;  3QP1 A;  2OOL A;  1E3U A;  3T4T A;  1K57 A;  3BQ8 A;  1ES5 A;  3GMW A;  2EX9 A;  1GHI A;  4HES A;  4JBF A;  4GJ4 A;  5HPI A;  4HH2 A;  2XA7 S;  3EWK A;  4JGQ A;  3NEC A;  3I7J A;  2Y2L A;  1VM1 A;  2WYX A;  2J3T D;  4NXF A;  4LV3 A;  5AJG A;  3S7O A;  1XFQ A;  3C4O A;  5DF9 A;  2JHE A;  5EVI B;  1ERO A;  4P6B A;  4ZDX A;  5JYO A;  3GV9 A;  3W4Q A;  3A3J A;  4GB7 A;  1YLY A;  3KYQ A;  3KX0 X;  2DMW A;  3IWO A;  1YLJ A;  2XRO A;  3A3I A;  1YPR A;  5FQI A;  3MXQ A;  1YMS A;  4HP9 A;  3ICY A;  2Q0O A;  5A93 A;  1YLP A;  3UDI A;  3VP4 A;  4C75 A;  2O0Y A;  3V3S A;  1T19 A;  1DJA A;  4BL3 A;  1T18 A;  2VZW A;  1ZC2 A;  3E0Y A;  2FFY A;  3LR5 A;  3ITA A;  4FOF A;  1K56 D;  3L7H A;  4KZ5 A;  5CHU A;  1M6K A;  1XXM A;  4WF0 A;  4RX3 A;  5FQM A;  4UQI S;  2ZM2 A;  5EM1 A;  3MS6 A;  2QYB A;  2BLS A;  2A2L A;  2HJ9 C;  3VV4 A;  1OJ5 A;  1H3Q A;  4IUK A;  4R4R A;  3MBZ A;  3BFF A;  1CF0 A;  1FCO A;  4BMW A;  2XRN A;  5CTN A;  5CER A;  1SHV A;  4ZRR A;  4OOY A;  1XA7 A;  5KSC A;  1WYB A;  3HLF A;  4OQH A;  4PM5 A;  4RYE A;  4X69 A;  1YMX A;  3C7V A;  2O9B A;  3H7W B;  4LRX C;  4GLQ A;  3UB5 P;  4RX2 A;  5TR7 A;  5HD3 A;  5HL1 A;  1IYQ A;  1YSP A;  2QKP A;  1NXY A;  1K0K A;  4H8R A;  3EEA A;  4WZ4 A;  1FCN A;  1M40 A;  4GW9 A;  1AWI A;  4MBH A;  3HL9 A;  1PYY A;  2V1A A;  1LSW A;  2OWJ A;  2PT7 A;  4YNR A;  4Y17 A;  4P87 A;  2XGN A;  1PWG A;  1VB6 A;  5LBR A;  3NHQ A;  1H8Y A;  3IH9 A;  1TDL A;  4JPM A;  1CQA A;  3QNB A;  4OON A;  3BRM A;  4NK3 A;  5E43 A;  3C4P A;  3Q7V B;  3V50 A;  3UMD A;  4EUZ A;  2QJ7 A;  4LRY C;  3EQV A;  5EVI A;  3PAG A;  5IT5 A;  2W1R A;  4DMZ A;  2GJ3 A;  1S4S A;  4LPZ A;  3UE6 A;  4KQO A;  3VE3 A;  2OWH A;  3HUM A;  4BWI A;  1KDW A;  4YIN A;  1SKF A;  3D3O A;  2I9V A;  3MZE A;  1TS6 A;  2WK0 A;  4DE0 A;  4KQQ A;  3IF6 C;  2W3D A;  3C2W A;  1ZKJ A;  4U3T A;  1KE3 A;  2CC1 A;  1PWC A;  3T4O A;  2XFT A;  5FQQ A;  3V5M A;  3ZDJ A;  3N4I A;  4R23 A;  4GNU A;  5FI6 A;  3DBA A;  5AQ9 A;  3UDX A;  3DAV A;  5EOO A;  4MN7 A;  1K6R A;  1CEG A;  1JTD A;  4X1L A;  1IOU A;  5CX7 A;  1G28 A;  3NI9 A;  4U0T A;  2Y2K A;  4ME4 A;  1HTZ A;  3A3F A;  4RQ9 A;  4WN5 A;  1L2S A;  5FDH A;  2JKG A;  4IBX A;  3HJK A;  5FL3 A;  2ZL1 A;  2J80 A;  1XJ4 A;  3D9Y A;  1S1Y A;  3HLB A;  4MNR A;  1TS7 A;  2WGW A;  1FR6 A;  3E4O A;  4KUO A;  2Q9N A;  2HDU A;  3T4L A;  3OOV A;  4IVK A;  1LLB A;  1NRJ A;  1ZHH B;  2V2F F;  3BYD A;  3G35 A;  3K2N A;  4OKP A;  5CTM A;  4NXE A;  2GDN A;  3HLD A;  4WZ5 A;  2WKE A;  3N7W A;  2ZM0 A;  3AGD A;  3HCY A;  2Y2Q A;  3MXR A;  2QPN A;  1Q2P A;  1D1J A;  4LV0 A;  3A3E A;  3LO7 A;  1PI4 A;  2Z2M B;  3FV7 A;  2WAE A;  1MZU A;  2HDS A;  4LLO B;  4OPY A;  1QME A;  4WMC A;  4M3K A;  3GSG A;  1P0Z A;  1XJ6 A;  3RXW A;  3SH8 A;  5EPH A;  3PXP A;  2EWV A;  2UWX A;  4HBU A;  3P7N A;  5HWV A;  3UPP A;  1CI8 A;  3NUL A;  4MDZ A;  1FOF A;  3DTK A;  4N9L A;  1JWP A;  1ONH A;  1WYC A;  4PM8 A;  1GA0 A;  1T1B A;  3IS2 A;  5M18 A;  2W3E A;  3IHA A;  2Z6C A;  4PM9 A;  3QP4 A;  3CPT B;  4E04 A;  2WAD A;  2VV8 A;  3E4Q A;  3AGE A;  1H0M A;  2VGL S;  3UDF A;  1HVB A;  2PYP A;  2L0W A;  2XQZ A;  5CED A;  3VOY A;  2OAQ 1;  4MLL A;  3T1Q B;  5FEF A;  5GLC A;  4UA7 A;  1DP6 A;  3MQO A;  4S2M A;  4MN5 A;  2K7S A;  1DP8 A;  1YLT A;  1VET A;  1EW0 A;  2EX2 A;  1ACF A;  1KGF A;  2W27 A;  3U4L P;  3NIA A;  4I3A A;  4GS9 B;  4KEN B;  3FPV A;  2HDQ A;  2A24 B;  4X1M A;  5GLD A;  3OCN A;  3PTE A;  4GD6 A;  2VGL M;  2PU2 A;  3E2K A;  3BFG A;  3GEC A;  1VET B;  1RGZ A;  2XDM A;  2HPB A;  3QNC A;  4KZ6 A;  3ITB A;  4HP4 A;  4PAU A;  5MC7 A;  3S7P A;  3RH8 B;  2ZQD A;  2ZMA A;  1LT0 A;  1OTE A;  3BFE A;  3CJM A;  2X71 A;  4QHC A;  5FAP A;  5E2E A;  3CG5 A;  1MY8 A;  2OSU A;  2IWB A;  4QY5 A;  3O87 A;  5DJU A;  3MZD A;  2P7J A;  2WGV A;  2C6W B;  3W4P A;  3IWQ A;  1ODV A;  3RXX A;  4E6W A;  5L07 A;  5TBM B;  2QHK A;  4ARZ A;  2ZMF A;  1N4O A;  1Z6F A;  1V9Z A;  3DWZ A;  4OQ0 A;  3H82 A;  3M6B A;  4HBT A;  1MWU A;  3A0R A;  1YKD A;  3F1N B;  3G32 A;  1V9Y A;  4Y3I A;  3PBR A;  3QP8 A;  3LIE A;  1FIL A;  4RA7 A;  1ZG4 A;  4JXW A;  4IUH A;  4UAA A;  4NET A;  1S67 L;  4L9G A;  5HAI A;  1FIK A;  2WKQ A;  1SKO B;  1PZO A;  4X25 A;  2QZ6 A;  1NYY A;  3IHB A;  5IU1 A;  3CUE C;  1N9L A;  4ZJ2 A;  3UN7 A;  1K25 A;  3ZYT A;  4DN0 A;  3KO6 A;  3LYX A;  2Y55 A;  2W3G A;  5HDD A;  3U2A A;  2IWD A;  3BM6 A;  4S2J A;  4R3J A;  5GHY A;  2EA9 A;  3HVF A;  2J3T C;  5DF8 A;  3ZHH A;  5FAQ A;  3MSH A;  5HAR A;  4OLG A;  4EBP A;  3UB6 A;  2O99 A;  1PIO A;  3NC8 A;  1C3B A;  5AVE A;  3ZNY A;  2ZOI A;  4HOI A;  3BLM A;  3DWK A;  1YLW A;  3BQA A;  5HDS A;  5HSQ A;  3FYZ A;  4WM9 A;  2M7U A;  2VGJ A;  1KE4 A;  2VV6 A;  5F5Y A;  3O88 A;  3T50 A;  3LI8 A;  4P85 A;  2EXA A;  2VJW A;  3HLW A;  3QP5 A;  1FSW A;  1WE4 A;  3A0V A;  3M6H A;  4JF6 A;  1Y4O A;  3DTE A;  2EWW A;  5IS1 A;  3PHY A;  4PMA A;  1T1A A;  1GSW A;  3ZVW A;  4JF4 A;  3VP1 A;  4LV2 A;  5TFQ A;  4I38 A;  3IXG A;  3SH7 A;  1K54 A;  4GDN A;  2R9X A;  3IX8 A;  4Y5F A;  4HJ6 A;  3LR0 A;  1JWZ A;  5JYP A;  5HX9 A;  3WS0 A;  3FWL A;  4PM6 A;  1ONG A;  4OOL A;  4ZJ1 A;  3ZG9 B;  5GL9 A;  5EFW A;  2VEA A;  1BLS A;  1MKM A;  2V1B A;  3HLE A;  1W8Y A;  5CHJ A;  1ZTU A;  3WS4 A;  3BLS A;  1UWN X;  4BJP A;  4WMC D;  3JVU A;  1KVL A;  1MWS A;  3CAX A;  1IEL A;  3RJU A;  4NXG A;  1KOU A;  2PD7 A;  1LSV A;  2YKF A;  4JKT A;  2EFU A;  4DXB A;  5DJT A;  3IF6 B;  5AQA A;  4KZA A;  2Y2I A;  2Z6D A;  3CI6 A;  3LY4 A;  4KG6 A;  5DTT A;  3UPO A;  3S7Q A;  3C30 A;  4Q8I A;  5EOE A;  3PBQ A;  1TDG A;  1XPB A;  1E4D A;  1L0F A;  2E8J A;  2H0T A;  4S2N A;  5J7E A;  1MPL A;  2HJE A;  4HQA A;  3OLO A;  3FG8 A;  2H5S A;  3T4K A;  1OTB A;  2IWC A;  3G31 A;  1E25 A;  4PKY G;  2ZBB A;  4FCF A;  3R7W A;  3NOU C;  3CLO A;  1K38 A;  1XGJ A;  3MKE A;  3Q07 A;  4R6L A;  2O9C A;  1Q2Q A;  2XK1 A;  4B4Z A;  4JGP A;  1JNU A;  4ZJ3 A;  1NYM A;  1TVF A;  2ZM8 A;  4FUW A;  4DF6 A;  2MJ6 A;  3N6I A;  3GDI A;  2GZA A;  5E2H A;  1H5X A;  1BZA A;  4S2L A;  3JPU A;  1XA1 A;  4D60 A;  3MQ0 A;  3WS5 A;  3G2Y A;  1MC0 A;  4MEZ A;  4MN6 A;  3KYE A;  3NJA A;  3BEC A;  3UE1 A;  3OZH A;  1MBL A;  2W1T B;  5GHX A;  3ZFZ A;  1ERQ A;  1DY6 A;  5J8X A;  1D06 A;  4XUX A;  2J7V A;  4GKU A;  4YWZ A;  3LY3 A;  4CLC C;  3CZD A;  3FC7 A;  4RVA A;  1JWV A;  2V20 A;  1LI9 A;  2Y2N A;  3SS5 A;  3T4J A;  5DFX A;  3H82 B;  2LB9 A;  5AQB A;  1NY0 A;  3FKW A;  4HHD A;  2WAF A;  3BFD A;  2I72 A;  3NBL A;  3IXH A;  4EEU A;  2J8Y A;  4IBR A;  4GD8 A;  1JTG A;  2KOI A;  4PM7 A;  2QJ5 A;  4X56 A;  1XKZ A;  2B18 A;  1W79 A;  1EWZ A;  2VK3 A;  3C7U A;  2PU4 A;  4N1X A;  3E2L A;  4JXG A;  4UEY A;  3A0S A;  1LL9 A;  2HP6 A;  3MZF A;  1H8M A;  1FCM A;  2JBF A;  5C5K A;  2A24 A;  5F82 A;  1LL5 A;  2WKI A;  1PI5 A;  5HDC A;  1ZG6 A;  4Y2F A;  2WKH A;  1N9B A;  2XSS A;  1W63 Q;  1G6A A;  3VFF A;  4CQH A;  4A5R A;  4BEN A;  1TF1 A;  3BEB A;  2VV7 A;  1K54 C;  3UO9 A;  4XT2 A;  4OH0 A;  5HZH A;  4KZB A;  1IYP A;  4P0M A;  4EER A;  4WLA A;  3PBN A;  4IVI A;  1O7E A;  4QU3 A;  1G68 A;  2WZZ A;  2J9P A;  3IBJ A;  1IKG A;  2V0U A;  1K6S A;  2C5W B;  4BQM A;  4QB8 A;  2E8I A;  2EX6 A;  1IEM A;  5G4Y A;  3CMZ A;  3GTC A;  3O5Y A;  2XLN A;  2KDK A;  2WUQ A;  5HFO A;  2Y79 A;  4OLD A;  2EX8 A;  3DW0 A;  5HD5 A;  1I2S A;  4UA9 A;  3NOP C;  1ES3 A;  4WBG A;  1KGE A;  4EQ1 A;  1X0O A;  1NLZ A;  4E3L A;  5CXW A;  4I5S A;  4JXV A;  3K3C A;  2Y2H A;  1GSX A;  4FH4 A;  1S6R A;  1ALQ A;  3LI9 A;  4KZ7 A;  5KZH A;  3SS3 A;  1NRF A;  2HF6 A;  4BLM A;  1GSV A;  3SS4 A;  1ERM A;  4KUK A;  4HJ3 A;  1CI9 A;  1XJ2 A;  3Q7V A;  1ES2 A;  3SW1 A;  5F1F A;  4CPK A;  1LL8 A;  4KZ8 A;  1BLC A;  3G30 A;  2Y59 A;  4IJG A;  3G34 A;  5A91 A;  4DXC A;  2WKR A;  2Y2M A;  4BBT A;  3OC2 A;  5HL6 A;  3GQZ A;  3ZG8 B;  2ACG A;  3RTY A;  2O9A A;  5FQK A;  4HY8 A;  4EWF A;  4ETX A;  4L0L A;  3F1N A;  4FD8 A;  3ZG5 A;  3HRE A;  1WA9 A;  4M4X A;  2Y2J A;  3O3V A;  4DDS A;  2UV0 E;  1BUL A;  1HZO A;  4K08 A;  3NY4 A;  3T1X A;  4XT2 B;  1DJB A;  3DTI A;  3VOZ A;  3N8S A;  1IYS A;  4E3M A;  3EGX C;  3H9W A;  1OT9 A;  1D7E A;  2PBD P;  3QP2 A;  3SH9 A;  2ZD8 A;  4R3A A;  2J3W A;  3MJQ A;  1NLY A;  2WZX A;  5FQ9 A;  2KX6 A;  4C6Y A;  5BOH A;  4JGO A;  1AXB A;  2HP9 A;  3KSI A;  4R70 A;  4WYY A;  3HBR A;  2VA0 A;  1K4F A;  2ZQ8 A;  3IX3 A;  1GA9 A;  4EW7 A;  2Y8H A;  2EFX A;  2ZOH A;  1W7F A;  1KGG A;  3FKV A;  3FZC A;  2LB5 A;  5DVA A;  4NKP A;  1UWP X;  4FSF A;  5F6A A;  3TJZ C;  5HWW A;  2PBY A;  4O0P A;  2FH5 A;  2XF3 A;  3LGO A;  1S4R A;  2ZC6 B;  4S2N C;  3F1O B;  2ZL1 B;  4EBL A;  1NZU A;  4MCW A;  3L9K A;  4PPR A;  4CLC B;  3TW8 A;  2B5R A;  3LR4 A;  4L9F A;  3NDE A;  1IKI A;  4FH2 A;  2DCF A;  5E2F A;  4ZAM A;  1K55 A;  3NOT C;  4C3Q A;  4QWO A;  3VP0 A;  3W8K A;  3ISG A;  4X6T A;  3CHW P;  2OLU A;  5I94 A;  4OPQ A;  4IED A;  4ZBE A;  4E3K A;  5L2F A;  4I3J A;  1FQG A;  3V67 A;  4R3B A;  1MWR A;  4JLF A;  2ZQ9 A;  5G18 A;  3LIC A;  4E3J A;  2AVX A;  4L9E A;  3LIF A;  5CEB A;  1K55 C;  5FAT A;  5DF7 A;  1EI5 A;  1G5U A;  2CMN A;  3T4S A;  1SKO A;  2Y91 A;  5FA7 A;  2HP5 A;  1HLU P;  1KDS A;  2A3U A;  3VSK A;  1S0W A;  4IHQ A;  3HLG A;  5HWT A;  1W63 M;  3RFB A;  1GCE A;  1ES4 A;  4QY6 A;  4Q0J A;  1BLP A;  4LV1 A;  3HJI A;  3BJN A;  2IA2 A;  1K56 A;  3VE4 A;  1SDE A;  3P98 A;  3IQA A;  4BBV A;  1YM1 A;  4HNB A;  5I5L A;  1T1C A;  3B42 A;  4Q0I A;  4DE3 A;  1KVM A;  2ZQC A;  3ZG0 A;  1YT4 A;  4HEF A;  1XP4 A;  3HLC A;  3MFD A;  1QMF A;  1J3W A;  5M1A A;  2K2N A;  3IXB A;  4I3I A;  3V3R A;  3B33 A;  2DNS A;  3IBR A;  1PW8 A;  2M1C A;  3TRC A;  4D2O A;  4F3L B;  5FAO A;  1PWD A;  3C8C A;  2OLV A;  4O7D A;  1BLH A;  1BSG A;  3WWX A;  3ZVT A;  4H6J A;  4BL2 A;  2XA7 M;  3OPH A;  1PFL A;  5TGF A;  5EUA A;  3C5A A;  3PYP A;  3UME A;  4EES A;  5A92 A;  1I5Q A;  2ZC7 A;  2BAS A;  3OPR A;  5IHV A;  4N1H A;  2ZJ9 A;  4JGR A;  4Z9Q A;  3VSL A;  4O8G A;  4EBN A;  1FSY A;  2KLI A;  3D4F A;  5CEC A;  2ZMV A;  3R4K A;  4X55 A;  2L1M A;  3A3D A;  5D3O A;  3MR0 A;  1HD8 A;  4S2O A;  4KZ4 A;  5A8B A;  5GHZ A;  3T12 B;  1P9W A;  4ARZ B;  5M19 A;  1N9O A;  1OJG A;  5FEG A;  4BD1 A;  1NZO A;  3KSH A;  4ETZ A;  4DE1 A;  5EVE A;  1J9M A;  4P6Z M;  4OP5 A;  4OVD A;  2ZLY A;  2B95 A;  3LFV A;  3BFC A;  1L0E A;  4LEN A;  3LUQ A;  4DKI A;  4KG2 A;  2Q9M A;  2R9W A;  3MXS A;  3TOI A;  3W4O A;  4N92 A;  2JKT I;  2PR6 A;  3G6O A;  1MWT A;  2PDR A;  3VFH A;  3EQU A;  1W8Q A;  4UQI M;  4HI4 A;  3WRT A;  2P08 A;  2X01 A;  1P97 A;  3MQQ A;  5EM0 A;  3CWF A;  3IF6 A;  4JXS A;  4DDY A;  4ESP A; 
#chains in the Genus database with same CATH homology
 1ESI A;  1PI5 A;  4E6X A;  5GLC A;  4UA7 A;  1ZG6 A;  2H10 A;  1K57 C;  4S2M A;  4B4X A;  4U0X A;  2WKH A;  1N9B A;  1MXO A;  1W5D A;  1YLT A;  1LI0 A;  2EX2 A;  1G6A A;  3VFF A;  1NJ4 A;  2OV5 A;  3IT9 A;  4A5R A;  1KGF A;  4BEN A;  3BEB A;  1PW1 A;  1L0G A;  3NIA A;  4X53 A;  4B88 A;  1K54 C;  3UO9 A;  4KEN B;  2H0Y A;  4OH0 A;  2HDQ A;  4KZB A;  1IYP A;  4P0M A;  4OPR A;  3DTM A;  5CRF A;  5GLD A;  3OCN A;  2ZC5 B;  3PBN A;  4IVI A;  3PTE A;  5EVI D;  1O7E A;  4GD6 A;  4QU3 A;  1G68 A;  2WZZ A;  3OPL A;  2ZC3 B;  2J9P A;  1IKG A;  1K6S A;  2C5W B;  5FQJ A;  3PBO A;  2QMI A;  2PU2 A;  3E2K A;  3BFG A;  1OME A;  1RGZ A;  3ZGA B;  2XDM A;  2HPB A;  4BQM A;  3QNC A;  4KZ6 A;  4QB8 A;  2E8I A;  5DTS A;  5CGW A;  4R1G A;  2EX6 A;  3ITB A;  1IEM A;  3VP2 A;  2ZQ7 A;  4UHU A;  3CMZ A;  3GTC A;  5EEC A;  1RCJ A;  4K91 A;  2ZQD A;  2XLN A;  1BTL A;  2ZMA A;  2WUQ A;  1LHY A;  5HFO A;  3VP3 A;  3BFE A;  1FR1 A;  3CJM A;  2XH9 A;  1ESU A;  2ZQA A;  2JE5 A;  1U60 A;  2X71 A;  3PBS A;  4QHC A;  4S2I A;  4OLD A;  2EX8 A;  3VMA A;  1RGY A;  3DW0 A;  5FAP A;  5E2E A;  3CG5 A;  1MY8 A;  1I2S A;  3GR2 A;  4UA9 A;  4ZTK A;  2OSU A;  1ES3 A;  2XD5 A;  2IWB A;  1GHP A;  1RP5 A;  3G4P A;  1KE0 A;  1KGE A;  2RL3 A;  3O87 A;  4QY5 A;  3MZD A;  4WBG A;  2WGV A;  1Y54 A;  4E3L A;  5CXW A;  2C6W B;  4MBK A;  3UNW A;  3MKF A;  3IWQ A;  4JXV A;  3W4P A;  3S4X A;  2Y2H A;  1CEF A;  3RXX A;  4FH4 A;  1TEM A;  1S6R A;  3UPN A;  1ALQ A;  4MLL A;  4KZ7 A;  1E3U A;  4E6W A;  2V1Z A;  4QJG A;  5KZH A;  1K57 A;  3Q7Z A;  3M2K A;  3SS3 A;  1ES5 A;  3GMW A;  2EX9 A;  2G2U A;  2Y4A A;  4K0W A;  1GHI A;  4Y0T A;  1NRF A;  4HES A;  4JBF A;  4BLM A;  3SS4 A;  2DRW A;  1ERM A;  3I7J A;  2Y2L A;  1CI9 A;  1N4O A;  4K0X A;  5FAS A;  1VM1 A;  2WYX A;  3Q7V A;  5EE8 A;  1Z6F A;  4GZB A;  4LV3 A;  1ES2 A;  5F1F A;  3DWZ A;  4CPK A;  3C4O A;  5DF9 A;  5EVI B;  4OQ0 A;  1ERO A;  1PZP A;  4P6B A;  4ZDX A;  4KZ8 A;  3M6B A;  5JYO A;  3GV9 A;  4HBT A;  4UA6 A;  1BLC A;  3W4Q A;  1MWU A;  3A3J A;  3G30 A;  4GB7 A;  5U47 A;  2Y59 A;  1YLY A;  3G32 A;  5HAQ A;  2JCH A;  3G34 A;  3PBR A;  4KG5 A;  4Y0U A;  5A91 A;  3IXD A;  4DXC A;  3S1Y A;  3IWO A;  2Y2M A;  1YLJ A;  4N9K A;  3OC2 A;  4RA7 A;  5GLA A;  3WRZ A;  1ZG4 A;  5E2G A;  4JXW A;  3GQZ A;  3ZG8 B;  4UAA A;  3A3I A;  4NET A;  5FQI A;  4WEK A;  2P74 A;  2Y2G A;  5HAI A;  5FQK A;  1YMS A;  4EWF A;  3V39 A;  4XXR A;  1PZO A;  2ZC4 B;  3N8R A;  5A93 A;  4L0L A;  2QZ6 A;  1YLP A;  3UDI A;  3VP4 A;  4C75 A;  1NYY A;  3V3S A;  1I2W A;  4FD8 A;  3ZG5 A;  3HRE A;  1DJA A;  2Y2J A;  3IHB A;  4BL3 A;  3O3V A;  4DDS A;  5FSR A;  1IYO A;  1BUL A;  1HZO A;  3PAE A;  5FI2 A;  3NY4 A;  4ZJ2 A;  1ZC2 A;  3UN7 A;  1K25 A;  3IWI A;  2FFY A;  3ITA A;  1DJB A;  2Y55 A;  1K56 D;  4JF5 A;  3VOZ A;  1XGI A;  2IWD A;  3N8S A;  1IYS A;  3BM6 A;  4KZ5 A;  4E3M A;  5CHU A;  3IH8 A;  1M6K A;  4S2J A;  4R3J A;  5GHY A;  1XXM A;  4S2P A;  3HVF A;  4RX3 A;  5DF8 A;  3ZHH A;  5FAQ A;  5FQM A;  5HAR A;  2ZM2 A;  4OLG A;  3ZG7 B;  4EBP A;  3SH9 A;  2BLS A;  2ZD8 A;  4E3N A;  1MKI A;  4R4R A;  3MBZ A;  3BFF A;  1PIO A;  3NC8 A;  1C3B A;  1FCO A;  2WZX A;  3ZNY A;  2FFF B;  5CTN A;  3NDG A;  5FQ9 A;  5CER A;  1SHV A;  4OOY A;  4C6Y A;  1XA7 A;  5BOH A;  5KSC A;  1WYB A;  3BLM A;  3HLF A;  3DWK A;  4OQH A;  1AXB A;  1YLW A;  1O07 A;  4PM5 A;  4RYE A;  4X69 A;  1YMX A;  2HP9 A;  3NCK A;  3C7V A;  3FYZ A;  4MBF A;  4WYY A;  3HBR A;  4WM9 A;  2VGJ A;  1KE4 A;  1E3U D;  1K4F A;  3S22 A;  2G2W A;  4RX2 A;  3O88 A;  2ZQ8 A;  5TR7 A;  3QHY A;  4P85 A;  2EXA A;  2RCX A;  4WZ5 C;  3ZNT A;  3OCL A;  3HLW A;  5HL1 A;  1GA9 A;  1IYQ A;  2EFX A;  5HW3 A;  1W7F A;  1KGG A;  1FSW A;  3FKV A;  1NXY A;  1WE4 A;  3FZC A;  4H8R A;  5DVA A;  1BT5 A;  4WZ4 A;  3M6H A;  1FCN A;  4FSF A;  4JF6 A;  1M40 A;  2PBY A;  1JVJ A;  5HAP A;  4MBH A;  5GLB A;  1VQQ A;  2XF3 A;  3HL9 A;  1PYY A;  4GOG A;  2ZC6 B;  4S2N C;  3TG9 A;  4EBL A;  4PMA A;  1NZU A;  4P87 A;  4DE2 A;  2XGN A;  4PPR A;  4R4S A;  1PWG A;  2B5R A;  1H8Y A;  5FI7 A;  3IH9 A;  3NDE A;  3ZVW A;  1TDL A;  4JF4 A;  4BD0 A;  4JPM A;  3VP1 A;  1IKI A;  3QNB A;  4FH2 A;  4OON A;  4LV2 A;  2DCF A;  5E2F A;  3BRM A;  4NK3 A;  5E43 A;  5TFQ A;  4F94 A;  3C4P A;  3Q7V B;  4ZAM A;  3V50 A;  1K55 A;  3IXG A;  4EUZ A;  3SH7 A;  3EQV A;  4C3Q A;  5EVI A;  3VP0 A;  1K54 A;  4GDN A;  3W8K A;  2R9X A;  3ISG A;  4WEL A;  4X6T A;  2OLU A;  3JYI A;  5I94 A;  3PAG A;  4DRT A;  2HDR A;  4ID4 A;  1JWZ A;  4OPQ A;  4IED A;  4ZBE A;  4E3K A;  5JYP A;  5L2F A;  5HX9 A;  5DTK A;  1FQG A;  4R3B A;  1MWR A;  3WS0 A;  3UY6 A;  3FWL A;  4KQO A;  4JLF A;  2ZQ9 A;  3HUM A;  4PM6 A;  1ONG A;  2P9V B;  4OOL A;  5G18 A;  3WS2 A;  4E3J A;  1KDW A;  3AGF A;  4YIN A;  1SKF A;  4ZJ1 A;  3ZG9 B;  3MZE A;  5GL9 A;  2Z2L B;  1K4E A;  2WK0 A;  4KZ9 A;  5CEB A;  1K55 C;  5FAT A;  4DE0 A;  5DF7 A;  1EI5 A;  4KQQ A;  3IF6 C;  1BLS A;  4QD4 A;  2Y91 A;  5FA7 A;  2HP5 A;  3HLE A;  5F83 A;  1W8Y A;  1KDS A;  1ZKJ A;  5CHJ A;  3UE0 A;  5CGX A;  3WS4 A;  2A3U A;  3VSK A;  1S0W A;  3G2Z A;  3BLS A;  3HLG A;  4U3T A;  1KE3 A;  2CC1 A;  4BJP A;  4WMC D;  1PWC A;  4YFM A;  2XFT A;  5FQQ A;  1GCE A;  1ES4 A;  4LCM A;  4QY6 A;  3V5M A;  1KVL A;  3N8L A;  3ZDJ A;  3N4I A;  1BUE A;  1MWS A;  1SCW A;  1BLP A;  1IEL A;  4R23 A;  3SOI A;  4GNU A;  4LV1 A;  3RJU A;  5FI6 A;  5AQ9 A;  3UDX A;  4OP8 A;  5EOO A;  4KQR A;  4JKT A;  1K6R A;  1K56 A;  2EFU A;  2Y2P A;  4DXB A;  3O86 A;  4XUZ A;  5EVI C;  1CEG A;  1SDE A;  3GVB A;  3P98 A;  3IF6 B;  1JTD A;  3IQA A;  3M2J A;  5AQA A;  4KZA A;  1GHM A;  1YM1 A;  2Y2I A;  4X68 A;  3NI9 A;  3LY4 A;  2Y2K A;  4KG6 A;  1YLZ A;  4U0T A;  4DE3 A;  1KVM A;  5DTT A;  1HTZ A;  3A3F A;  3UPO A;  2ZQC A;  1SDN A;  1L2S A;  4E3O A;  3ZG0 A;  4Q8I A;  5EOE A;  5FDH A;  3PBQ A;  4IBX A;  1YQS A;  1YT4 A;  4HEF A;  1TDG A;  1XPB A;  1XP4 A;  4GN2 A;  1E4D A;  1L0F A;  2H0T A;  4KZ3 A;  4S2N A;  1MPL A;  2P9V A;  3HLC A;  3MFD A;  1QMF A;  4OOM A;  4S2K A;  3HLB A;  4MNR A;  4Y0O A;  5M1A A;  2H5S A;  3IXB A;  2XD1 A;  3V3R A;  2WGW A;  2IWC A;  1FR6 A;  3G31 A;  1E25 A;  4OPZ A;  2DNS A;  2VGK A;  3GRJ A;  1PW8 A;  2HDU A;  2Q9N A;  3HUN A;  4FCF A;  4IVK A;  4D2O A;  1LLB A;  2X02 A;  5FAO A;  1PWD A;  2V2F F;  2OLV A;  1K38 A;  3B3X A;  3BYD A;  3LCE A;  3G35 A;  1XGJ A;  4O7D A;  1BLH A;  1BSG A;  3WWX A;  4E3I A;  4OKP A;  5CTM A;  3MKE A;  1XX2 A;  5A90 A;  2GDN A;  3HLD A;  4WZ5 A;  3Q07 A;  3ZVT A;  2WKE A;  4BL2 A;  1Q2Q A;  3N7W A;  2ZM0 A;  2XK1 A;  3OPH A;  2A49 A;  3UE3 A;  4B4Z A;  2Y2O A;  5TGF A;  5EUA A;  4ZJ3 A;  1NYM A;  3AGD A;  3WS1 A;  3C5A A;  5A92 A;  1I5Q A;  4LCL A;  2Y2Q A;  2ZC7 A;  1TVF A;  3MXR A;  3OPR A;  5IHV A;  2JC7 A;  2QPN A;  1Q2P A;  2ZJ9 A;  4N1H A;  4LV0 A;  3A3E A;  4GDB A;  3LO7 A;  4WEJ A;  4Z9Q A;  3VSL A;  1PI4 A;  2Z2M B;  3FV7 A;  4EBN A;  2WAE A;  1FSY A;  2ZM8 A;  4DF6 A;  3D4F A;  5CEC A;  2XEP A;  3N6I A;  5E2H A;  4EQI A;  2HDS A;  1H5X A;  1BZA A;  4S2L A;  1XA1 A;  3WS5 A;  3G2Y A;  4OPY A;  4X55 A;  2XR0 A;  3A3D A;  3Q1F A;  5D3O A;  5EVL A;  1QME A;  4MEZ A;  4WMC A;  1HD8 A;  2J9O A;  4Y7P A;  4S2O A;  4KZ4 A;  3BEC A;  4M3K A;  3Q82 A;  3OZH A;  5GHZ A;  3GSG A;  1MBL A;  3UE1 A;  1CK3 A;  3RXW A;  5GHX A;  3SH8 A;  5EPH A;  3ZFZ A;  1ERQ A;  5M19 A;  2UWX A;  1DY6 A;  4HBU A;  5J8X A;  4XUX A;  3P09 A;  3UPP A;  4BD1 A;  1NZO A;  1CI8 A;  3OPP A;  2J7V A;  4GKU A;  4R0Q A;  4CJN A;  2EXB A;  3LY3 A;  1FOF A;  3ZCZ A;  4DE1 A;  1L0D A;  4N9L A;  2BG1 A;  1J9M A;  3CZD A;  3TSG A;  1JWP A;  4RVA A;  1JWV A;  2V20 A;  2WGW B;  4OP5 A;  1ONH A;  1LI9 A;  1WYC A;  3Q81 A;  2Y2N A;  3SS5 A;  4OVD A;  4PM8 A;  2ZLY A;  5F1G A;  1GA0 A;  4EV4 A;  5CGS A;  5AQB A;  3PBT A;  1NY0 A;  3FKW A;  5M18 A;  3BFC A;  1L0E A;  4LEN A;  2WAF A;  3BFD A;  5AQ7 A;  2I72 A;  3NBL A;  3IXH A;  3IHA A;  2J8Y A;  5KMW A;  4IBR A;  1DJC A;  4GD8 A;  4PM9 A;  1JTG A;  4DKI A;  4KG2 A;  4PM7 A;  2Q9M A;  4X56 A;  3IF5 A;  2R9W A;  1XKZ A;  3MXS A;  2WAD A;  1W79 A;  1EWZ A;  4N92 A;  3TOI A;  3HUO A;  3C7U A;  3W4O A;  2PU4 A;  4OQG A;  1MWT A;  2XFS A;  2WGI A;  4N1X A;  5CHM A;  3E2L A;  1H8Z A;  3VFH A;  3EQU A;  1W8Q A;  4JXG A;  3WRT A;  2X01 A;  3AGE A;  4OQI A;  1LL9 A;  2HP6 A;  3MZF A;  3UDF A;  1FCM A;  1HVB A;  2JBF A;  5KSH A;  4JXS A;  3IF6 A;  4DDY A;  2XQZ A;  5CED A;  3VOY A;  5F82 A;  1LL5 A;  2WKI A;  3LEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...