4U0TA

Crystal structure of adc-7 beta-lactamase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
357
structure length
357
Chain Sequence
TPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPTDIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTSGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYVVLNAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Analysis of Inhibitors Targeting the ADC-7 Cephalosporinase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords ADC-7 beta-lactamase
total genus 123
structure length 357
sequence length 357
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4u0tA00
2EX8A 4Y7PA 1JWZA 1L0DA 3AGDA 1K57C 3FV7A 3W4QA 3IWOA 2XEPA 3NC8A 3V3SA 1ALQA 5GLBA 4S2LA 2FFFB 1RP5A 1SHVA 1SDNA 1HTZA 1MY8A 3ISGA 4ID4A 4EBLA 4LCMA 1KGEA 2XD1A 5EVIC 5HAQA 5M19A 3BECA 2RL3A 4X53A 5FA7A 2A3UA 5FI7A 2Z2MB 3VP1A 4ZDXA 5EECA 4M3KA 3BEBA 5EVID 3A3JA 3PTEA 3Q07A 3P98A 1YLZA 2GDNA 3MFDA 4BL3A 2X02A 1HZOA 5KSHA 1XGIA 4GZBA 3C5AA 3M6BA 3OCLA 1TEMA 4KG5A 4S2MA 3VFFA 1VQQA 4DDSA 1HD8A 1C3BA 4X6TA 5HARA 1L0GA 1W79A 4C3QA 4DXBA 4DDYA 5FQIA 1ONGA 1TDGA 1FCNA 2Y2JA 1K4EA 3AGFA 4QJGA 3OCNA 5CGWA 3PAEA 2WKHA 2ZC7A 2ZC4B 1K6RA 3CZDA 4GKUA 1JWVA 1QMEA 5A91A 2QMIA 4OQIA 1NZUA 1BT5A 3RXWA 4KZ5A 5EOEA 4RYEA 3GTCA 2JBFA 3UNWA 2R9WA 1G6AA 5CECA 4GNUA 1XA7A 5E2HA 4QB8A 4OPZA 3ZG9B 3P09A 1MWTA 1LHYA 3VSKA 4S2KA 5E2GA 4WMCA 1QMFA 4C6YA 4MNRA 3WRTA 3TSGA 1L0EA 3O3VA 1W8QA 4FD8A 1LL9A 4KQRA 2WKEA 5KSCA 4RA7A 4E6XA 5CHMA 3GMWA 5FQMA 2H0YA 4ZBEA 3SH9A 3MZDA 1YMXA 1YLPA 4JXGA 2ZQ8A 1MPLA 3HLDA 3FWLA 3WS4A 2VGJA 3W4OA 2EX9A 1NJ4A 1ESUA 5KMWA 3IXHA 4BL2A 1YT4A 3IXGA 4WEKA 3HLBA 3BLMA 3N8RA 5FAQA 1CEFA 1NYMA 2P9VA 3MZEA 1WYBA 4PM8A 3WS5A 1ES5A 5KZHA 2WADA 1PWGA 4MBFA 4O7DA 1DJAA 4BLMA 1PZOA 2I72A 4P85A 3UO9A 3M2KA 5F82A 4ZAMA 3G2ZA 4ZJ2A 2J8YA 1K54A 3EQVA 2EXBA 4B4ZA 1CEGA 4OQGA 2IWCA 5E2EA 3ZNTA 4S2PA 4R4RA 1YLTA 4S2OA 1MWRA 4UAAA 2WZXA 4S2NA 1K54C 4OQHA 1BLPA 1BTLA 1GHIA 1I5QA 1OMEA 1G68A 2HDSA 2PU2A 5HAPA 3NDEA 4WZ5C 3O87A 4R23A 5JYOA 2J9PA 2HDRA 1RGZA 1BLHA 3ZG8B 1JTDA 4K0XA 5E2FA 1KDSA 2Y4AA 4YFMA 4JXWA 4KG2A 2IWDA 1TVFA 4ZJ1A 5FI2A 4QY5A 3ZG0A 4MLLA 1I2SA 3IF5A 3CJMA 4N1XA 5CEBA 2EFXA 3WS2A 1E3UA 1Q2PA 1LL5A 2XD5A 2WGVA 5AQ7A 1E25A 4S2JA 2P74A 3DWZA 4KG6A 3VSLA 4E3OA 3BYDA 2XFSA 1WYCA 5A93A 3PAGA 4LV2A 3HUNA 4OVDA 5FAOA 5J8XA 3N4IA 5FQQA 1SKFA 4OH0A 3V3RA 5FSRA 5E43A 1K38A 3DW0A 3ZGAB 1CK3A 3VFHA 3VP0A 3G32A 5GHZA 5DTSA 3V5MA 2ZM2A 5HX9A 1MKIA 1VM1A 3HVFA 3O88A 4EWFA 4A5RA 4PPRA 1KE3A 1MWUA 2ZC5B 3IH8A 4BQMA 1E3UD 1O07A 2H10A 4WMCD 4C75A 2ZM0A 1LI9A 2OLVA 3LY4A 1K56A 3VP4A 3LO7A 4DKIA 4MEZA 4H8RA 4S2IA 3UE3A 5FQ9A 3GV9A 3NCKA 1ZG6A 1XPBA 3IH9A 5GHXA 3IHAA 4BD1A 3FYZA 4U0TA 2JCHA 3SH8A 4E3JA 1K56D 2C5WB 1AXBA 4X55A 2Y2MA 1ERMA 2IWBA 3V50A 4GOGA 1Z6FA 4JF6A 1RCJA 3MBZA 5HAIA 2V20A 2XH9A 1ESIA 1LLBA 4DE3A 2BG1A 4P6BA 1PW8A 2C6WB 1IKGA 5F1FA 3IWQA 1U60A 4OOYA 3ZVTA 1L2SA 5CRFA 5CEDA 2Y2LA 3W8KA 1XA1A 4DE2A 4R0QA 4EUZA 5GL9A 3UPNA 2J9OA 2Y2KA 1JWPA 3W4PA 3IT9A 4Y0TA 4OKPA 1I2WA 5M1AA 3PBQA 5FQKA 2BLSA 4NETA 1XGJA 1PI5A 1KGGA 5FDHA 3GRJA 2HDQA 4Z9QA 4ZTKA 5EUAA 3FKWA 3Q7ZA 4JLFA 4PM5A 1H8ZA 5TR7A 4QD4A 3UPOA 1MXOA 1FCMA 4R3BA 3G35A 5CHUA 1XP4A 1KDWA 1YLYA 3Q7VA 4PM9A 5CXWA 5EE8A 4OOMA 2WZZA 1CI9A 1K25A 3CMZA 4IBXA 4WELA 3IHBA 3DWKA 3UDFA 1BULA 5DF8A 5FI6A 3UN7A 4JXVA 4K0WA 4X68A 4KENB 1PZPA 4UA6A 3RJUA 1XKZA 2HP6A 2Y91A 4FSFA 2WAFA 4KZ6A 1NRFA 4OOLA 3G30A 4QHCA 4DE1A 3IQAA 3OPHA 4HESA 5CGXA 2ZLYA 1K57A 2WK0A 1IELA 4JPMA 3CG5A 3IXDA 1YQSA 5G18A 2CC1A 3C7UA 2EX2A 2Y2NA 3ZG5A 4OPQA 1O7EA 2Y2QA 2FFYA 5TGFA 3ZVWA 1BSGA 1J9MA 1PI4A 3HUOA 1JVJA 3BFGA 2PU4A 2ZQAA 3BM6A 5AQ9A 2E8IA 4KQOA 4U3TA 4RVAA 5HW3A 3DTMA 1GHMA 4HBTA 4DE0A 2VGKA 3TOIA 2XGNA 4GDNA 1MBLA 2WYXA 2X01A 2EFUA 3IWIA 4Y0UA 3MXRA 4OPYA 3UE0A 1FCOA 4KZ9A 3QNCA 5U47A 3JYIA 4WZ4A 2HPBA 3UPPA 5EVIA 4DF6A 2HP5A 1GCEA 2V2FF 4CPKA 1FQGA 1FOFA 3GVBA 3UE1A 5JYPA 1BLCA 1GHPA 4P0MA 1DJCA 2XR0A 1KGFA 2XF3A 5DF7A 5FATA 1ZG4A 3ZNYA 5I94A 1BUEA 4JF4A 4WZ5A 2A49A 3G31A 4U0XA 4PM7A 3LY3A 4WBGA 3TG9A 3NY4A 3OPRA 5CTNA 4E6WA 3N8LA 1M6KA 5CGSA 4Q8IA 2WAEA 3NIAA 3BFFA 3NBLA 3EQUA 3HBRA 1PWDA 1MWSA 3I7JA 4KZ3A 4EQIA 2XK1A 3GQZA 3IF6B 4GN2A 1ES4A 4XXRA 1Q2QA 5BOHA 3BFCA 4R3JA 4E3LA 4LV0A 1H8YA 1NXYA 3AGEA 3VP2A 4B88A 5EOOA 3BFDA 3BRMA 3PBSA 1YMSA 2Q9NA 2ZQ9A 3OC2A 3PBOA 4OONA 2P9VB 1FSWA 3A3FA 2Y2OA 3ZFZA 2ZQDA 3HLFA 1EWZA 2QPNA 2V1ZA 4UA9A 4X69A 3N7WA 5DF9A 3C4PA 1ES3A 1EI5A 2QZ6A 4KQQA 3VMAA 1IKIA 5CERA 3C4OA 3S1YA 1Y54A 2WGWA 3HLWA 3MKFA 3UDIA 3N6IA 4R1GA 1HVBA 4BD0A 2UWXA 2Y2PA 4KZ8A 2HP9A 5FASA 5EVIB 3V39A 4FCFA 4PM6A 1ZKJA 4EBNA 2XLNA 1NYYA 1K6SA 3ZDJA 1RGYA 5FQJA 5HL1A 3A3DA 3WS1A 4E3IA 3ZHHA 3ITBA 1IYPA 1IYOA 2HDUA 3B3XA 4N1HA 1ES2A 2OV5A 5L2FA 4FH4A 2JC7A 3SOIA 5GHYA 4E3NA 1NY0A 2R9XA 4MBHA 5CHJA 4HEFA 3M2JA 3QNBA 4N9KA 5GLCA 4FH2A 2OLUA 3HLCA 4OPRA 4K91A 1N9BA 3HLGA 3OZHA 2RCXA 2Y55A 1CI8A 4S2NC 3NDGA 3IF6C 5D3OA 1W7FA 5A90A 1IYQA 4JF5A 3E2KA 4E3KA 4E3MA 1DY6A 5AQBA 3UY6A 2Q9MA 4GD8A 4LV1A 1PYYA 2Y59A 4LENA 1GA0A 2XQZA 4CJNA 5M18A 4EV4A 2DCFA 1PWCA 1IEMA 1DJBA 3QHYA 3FKVA 3FZCA 1W5DA 2OSUA 4N9LA 3BFEA 2ZC3B 1WE4A 3IXBA 1LI0A 5DTKA 3Q82A 4WM9A 4BJPA 4X56A 3WWXA 2PBYA 3SH7A 3SS5A 1KE0A 1K4FA 4BENA 4YINA 1XX2A 4XUZA 5CTMA 1NZOA 1E4DA 4OP8A 5AQAA 5EPHA 3G2YA 4OLDA 3HLEA 2XDMA 2Y2HA 1JTGA 2J7VA 2ZM8A 1H5XA 3SS3A 3WRZA 2ZC6B 2XFTA 4D2OA 3OPLA 1BLSA 4QU3A 1FR6A 4WYYA 3PBRA 4QY6A 4RX3A 2WGIA 4RX2A 4HBUA 4DXCA 2ZQCA 3Q7VB 3HUMA 3VOYA 4GD6A 4LCLA 3HREA 4GB7A 4MBKA 3LCEA 2DRWA 4IBRA 3WS0A 3G4PA 3A3IA 4DRTA 2ZQ7A 2ZJ9A 4OQ0A 3D4FA 4UA7A 3A3EA 3ITAA 4KZ4A 2ZMAA 3HL9A 1N4OA 3PBTA 1W8YA 4UHUA 4NK3A 5A92A 5F1GA 3N8SA 4B4XA 3SS4A 3NI9A 3OPPA 1ERQA 4KZAA 3ZCZA 2EXAA 4IEDA 1FR1A 1PIOA 1EROA 1ZC2A 4IVKA 2Z2LB 1K55A 4LV3A 4Y0OA 5F83A 3C7VA 2B5RA 2X71A 5TFQA 4KZ7A 1FSYA 1KVMA 4P87A 1YM1A 3VP3A 2EX6A 3LEZA 1KE4A 3ZG7B 5DTTA 1K55C 1PW1A 2G2UA 4ZJ3A 5EVLA 1SDEA 1TDLA 4JKTA 2WKIA 4KZBA 3RXXA 3S4XA 1YLWA 4EBPA 3MKEA 4IVIA 4XUXA 1IYSA 3Q81A 5GLDA 1XXMA 4R4SA 2Y2IA 4OLGA 1KVLA 3PBNA 3MXSA 3VOZA 5DVAA 1GA9A 1ONHA 3BLSA 1SCWA 5IHVA 3MZFA 3O86A 2DNSA 4L0LA 3M6HA 3G34A 3E2LA 4PMAA 4OP5A 1S0WA 1L0FA 4F94A 2JE5A 4GDBA 2WGWB 3S22A 5HFOA 3GR2A 3IF6A 2WUQA 4N92A 2Y2GA 2ZD8A 3UDXA 1S6RA 4JBFA 1YLJA 4JXSA 5FAPA 5GLAA 2G2WA 1M40A 2H0TA 2H5SA 3GSGA 3Q1FA 1BZAA 4WEJA
chains in the Genus database with same CATH superfamily
1JWZA 1L0DA 3W4QA 5EM0A 1XFNA 4GW9A 2XEPA 1ALQA 1YSPA 4ID4A 1HTZA 1MY8A 3K2NA 1KGEA 5EVIC 5M19A 5IU1A 2RL3A 4PKYA 5FA7A 1P97A 2Z2MB 5EVID 3A3JA 3LFVA 3C38A 1YLZA 2PHYA 4S2MA 4KG5A 1TEMA 4MN7A 5KIZA 2J3WA 4X6TA 4C3QA 4GJ4A 5MC7A 3UB8A 5FQIA 2W1TA 2GNXA 5F68A 3CZDA 4IHQA 1BT5A 3RXWA 4KZ5A 4HIAA 3UNWA 1OTAA 1A0KA 4GNUA 1XA7A 3PYPA 2VKSA 3P09A 3ZG9B 1VHMA 1LHYA 3VSKA 3LR4A 4WMCA 1QMFA 1L0EA 2O99A 4FD8A 3A0SA 4CLCA 4KQRA 5DKLA 4RA7A 4E6XA 3MZDA 4EERA 3B42A 1CQAA 3WS4A 4ARZA 4CLCB 3W4OA 1NJ4A 4BMWA 3IXHA 1CEFA 2P9VA 3MZEA 4NXEA 4P6ZM 2OAQ1 4MBFA 4JGRA 5F82A 3MS6A 3G2ZA 4ZJ2A 2J8YA 4NXFA 4WN5A 2EXBA 4B4ZA 3ZNTA 3NOPC 4S2OA 1MWRA 3PR6A 4UAAA 4S2NA 1BTLA 1I5QA 1MZUA 2JKGA 3NJAA 5HAPA 3NDEA 3O87A 4I3AA 4R23A 5JYOA 2HDRA 1JTDA 2PDRA 5E2FA 1KDSA 2Y4AA 4JXWA 5FI2A 3ZG0A 5IS1A 1I2SA 3IF5A 5HWWA 3D9YA 4N1XA 5J3WA 1CJFA 2WGVA 1LL5A 4S2JA 3IX8A 4E3OA 2A24B 3BYDA 2L0WA 3HUNA 4OVDA 4GS9B 3N4IA 4OH0A 5E43A 2QJ7A 2Q0OA 1P9RA 1MKIA 2ZC5B 3IH8A 4GLQA 1E3UD 1O07A 3VP4A 2W3DA 2VEAA 3LO7A 3UE3A 1Z09A 4EXOA 3T4SA 4H6JA 4E3JA 1AXBA 4X55A 2Y2MA 2IWBA 4JF6A 3RH8B 2V20A 1LLBA 3R7WA 4DE3A 1VEUB 2B18A 3IWQA 1U60A 3ZVTA 5HWTA 4R70A 2JKRM 1XA1A 4DE2A 5GL9A 3QP2A 4Y0TA 4OKPA 3PBQA 4CLCE 1XGJA 4Z9QA 3QP5A 3GECA 1FCMA 5CHUA 1YLYA 4ETZA 2O9AA 4WELA 2V1BA 1ZHHB 3CHWP 5FI6A 1IOUA 4K0WA 1PFLA 2PBDP 2W0NA 1XKZA 5DJTA 4HJ4A 4QHCA 3IQAA 1S1YA 2BASA 4II7A 3EGDC 2EX2A 2Y2NA 4PKYG 1O7EA 2Y2QA 1BSGA 1HLUP 3HUOA 4BBUA 2E8IA 4I3JA 1LSWA 5HDSA 3IWIA 2NUPC 3E0YA 4KZ9A 4HP9A 4ARZB 4DF6A 2V2FF 2D01A 3T4KA 3UE1A 4P0MA 4O8GA 1DJCA 3L9KA 1BUEA 2HJEA 4Y15A 3P01A 4JGPA 1SKOB 3F1PB 4NXGA 5K5BA 5CGSA 3NIAA 3NBLA 1MWSA 3I7JA 4B93A 4HHDA 4KZ3A 4EQIA 5FDSA 1VETB 5BOHA 4K08A 4HJ6A 3KO6A 3ZYTA 1NXYA 4UQIM 4B88A 4KQDA 4EQ1A 3PBSA 2Q9NA 5TBMB 2Y8HA 3IBJA 2Y2OA 4UA9A 3C4PA 1T18A 3DAVA 1Y54A 3HLWA 3UDIA 1XFQA 3H7WA 5L10A 2UWXA 5EVIB 4FCFA 1XJ4A 1NYYA 2XLNA 3A3DA 4HJ3A 2JKTM 3ITBA 3SOIA 4MBHA 5CHJA 4N9KA 4DJ3A 4K91A 5DTKA 1L3LA 3T1XA 5EFWA 1CI8A 3CUEA 1W7FA 4JF5A 3CPTB 4KUOA 5AQBA 2ZMVA 1N9NA 2YKFA 5LBRA 3F1NA 3MQQA 3D72A 2YKHA 2DCFA 4EV4A 1PWCA 3FZCA 1W5DA 3BFEA 2V8FA 4I3IA 1N9OA 1OT6A 1J3WA 4BENA 1XX2A 4XUZA 3T1QB 1E4DA 5EPHA 2D02A 4OLDA 2L4RA 3HLEA 1D1JA 2Y2HA 1JTGA 1H5XA 3BW6A 3OPLA 4QU3A 1TS6A 4Y13A 3PBRA 4RX3A 3ULFA 4DXCA 1S4SA 1DP8A 4YWZA 4GB7A 3A3IA 2ZOIA 4DRTA 2ZQ7A 4UA7A 1OTEA 5F1GA 4B4XA 3NI9A 4KZAA 1ERQA 2XA7M 4MDZA 3ZCZA 1FR1A 2HF6A 1ZC2A 4AFIA 2Z2LB 1K55A 5L8MA 4HH2A 5EVEA 5F83A 5TFQA 4IUHA 3ZG7B 1K55C 1TS0A 1TDLA 3QP6A 3FG8A 3MKEA 4IVIA 4XUXA 5GLDA 3HCYA 5DVAA 1GA9A 1ONHA 1SCWA 4L9EA 1TS7A 1NLYA 4F94A 3GR2A 1Y28A 3UDXA 2ZD8A 3IX4A 4JBFA 5FAPA 1M40A 2H5SA 2EX8A 1K57C 3FV7A 2P08A 2VZWA 4S2LA 3JVVA 3ISGA 5HAQA 5G4ZA 1YSQA 3LIEA 1XGIA 4GZBA 1VQQA 1W79A 4DDYA 1ONGA 1TDGA 2Y2JA 4QJGA 2WKHA 2ZC7A 1ODVA 4GKUA 1QMEA 5A91A 4OQIA 1NZUA 4RYEA 2JBFA 1G6AA 5E2HA 4QB8A 2MJ6A 1MWTA 3K3DA 5E2GA 1W8QA 5L09A 1F2KA 2ZQ8A 3IBRA 1MPLA 3PHYA 2V9AA 2J3TD 5KMWA 3MMHA 1YT4A 3IXGA 4R38A 3N8RA 3UB5P 2GZAA 4BLMA 1PZOA 2I72A 4M4XA 4YOFA 4O01A 4EW7A 1CEGA 2VA0A 4OQGA 1DP9A 2WZXA 1BLPA 4G3WA 4JGQA 1OMEA 1ACFA 5HD5A 2HDSA 2PU2A 1BLHA 4I5SA 3UB9A 1TVFA 4QY5A 4MLLA 3UMEA 1SZVA 5FL3A 5CEBA 2EFXA 3LYXA 2P74A 3DWZA 4G3VA 4HI4A 3PAGA 4LV2A 5FAOA 4CLCC 4IJGA 5FQQA 1SKFA 4ZRRA 1K38A 3ZGAB 4Y3IA 3G32A 5GHZA 4CLCD 2CMNA 2ZM2A 3VE4A 3HVFA 4PPRA 4EESA 1MWUA 4C75A 2H10A 2HV1A 4DKIA 2K31A 3S7OA 1ZG6A 3IH9A 3KYZA 4BD1A 3FYZA 4U0TA 2JCHA 3MQ0A 2C5WB 1ERMA 4GOGA 1Z6FA 1RCJA 3VV4A 2BG1A 1L2SA 2ZBBA 5CRFA 5AVEA 2Y2KA 2VK3A 3W4PA 5M1AA 3VE3A 2BLSA 4L9FA 1F5MA 1PI5A 2HDQA 3FKWA 3Q7ZA 5TR7A 3LR0A 4O0PA 1MXOA 5CX7A 1KDWA 3Q7VA 4PM9A 5CXWA 2JN7A 1K25A 3IHBA 3IS2A 3UN7A 2ZL1A 3RJUA 3KX0X 3NECA 3OPHA 5CGXA 2Z6DA 3OOVA 1IELA 2WK0A 4JPMA 1YKDA 5HD3A 3C7UA 3B47A 3ZG5A 4NEED 5DFYA 5TGFA 3ZVWA 3CLOA 4Y5FA 1JVJA 2PU4A 2ZQAA 3BM6A 1GSXA 3DTMA 4HBTA 3JPUA 4DE0A 4GDNA 1MBLA 4DJ2A 3MXRA 3U2AA 5U47A 1BYWA 3JYIA 2NUTC 1GCEA 1FOFA 3GVBA 1KGFA 3ZNYA 2A49A 4U0XA 1CF0A 4PM7A 2INWA 3LY3A 4WBGA 3NY4A 3OPRA 1XJ3A 1S4RA 3BFFA 3EQUA 3HBRA 3PXPA 4MCWA 2XK1A 1ES4A 3KYEA 1Q2QA 3BFCA 3V67A 5A8BA 3T4OA 5EOOA 1LSVA 3BRMA 1NLZA 4H6JB 2P9VB 1FSWA 2ACGA 2QPNA 3N7WA 5DF9A 3L7HA 3T4LA 1IKIA 5HWVA 5HDDA 3S1YA 3F1NB 4R1GA 1W63M 3F1PA 4BD0A 2JKFA 2Y2PA 4KZ8A 4EBNA 1ZKJA 3OBFA 3NHQA 1K6SA 1RGYA 3WS1A 2P04A 2PYRA 1ES2A 4FH4A 1T1CA 5GHYA 4E3NA 4HEFA 3M2JA 2OLUA 1XJ6A 3OZHA 4S2NC 5D3OA 4EEUA 1IYQA 3EEAA 3E2KA 4NG2A 4E3MA 3T12B 2XA7S 1DY6A 3MSHA 3UY6A 2Q9MA 1PYYA 2VV6A 4LENA 3LIBA 1GA0A 2XQZA 5M18A 3QHYA 1DJBA 3FKVA 2VGLM 2ZC3B 3IXBA 4WM9A 4BJPA 4X56A 3SS5A 3QP8A 2EWWA 3EOIA 4EEPA 2GX5A 3WRZA 4D2OA 1FR6A 4QY6A 2ZQCA 3LEQA 3Q7VB 3HUMA 4LCLA 1PNEA 3WS0A 2ZJ9A 3D4FA 3A3EA 1ZTUA 3BQAA 2FH5A 3PBTA 4NK3A 2LB9A 3OPPA 2W3FA 3FC7A 2EXAA 4RQ9A 4IVKA 4LV3A 4Y0OA 3C7VA 2B5RA 2X71A 1FSYA 1KE4A 3ICYA 3A0VA 5EVLA 1TS8A 4XT2B 3CWFA 4KZBA 1YLWA 2QHKA 3Q81A 1XXMA 5F6AA 2Y2IA 3VOZA 3BLSA 4UEYA 3M6HA 3G34A 1S0WA 1L0FA 2OWHA 4X25A 2WGWB 3S22A 4HH3A 5HFOA 5IT5A 1G5UA 1S6RA 3LR5A 1YLJA 3Q1FA 4FUWA 1BZAA 3AGDA 1JNUA 3NC8A 2FFFB 3D3OA 3TE8A 3BY9A 1SHVA 1SDNA 4X1MA 1FIKA 4EBLA 4LCMA 2E8JA 2XD1A 1F98A 3LIAA 4X53A 3VP1A 4ZDXA 4I38A 1HZOA 3C5AA 3OCLA 3KSGA 3VFFA 2XROA 2XRNA 1C3BA 2ZC4B 4F3LA 1JWVA 2KLIA 2QMIA 3UB6A 5FEGA 3GTCA 5EM1A 5CECA 1LSXA 3BY8A 3K3CA 4OPZA 4CQHA 4S2KA 4WUJA 1P0ZA 2W1TB 4C6YA 4MNRA 4Z1WA 3TSGA 3O3VA 2WKEA 2VGLS 2WKRA 3GMWA 5CHMA 2H0YA 1YMXA 1YLPA 4JXGA 3HLDA 5EV0A 3HJKA 4BL2A 1TF1A 4WEKA 3BLMA 1T19A 1H8MA 5FAQA 2PT7A 1N9LA 2WADA 2B02A 4P85A 4R3AA 3UO9A 4MMNA 4ZAMA 2W3HA 4ETXA 2JKRI 4S2PA 4R4RA 3DTKA 3CUEC 3CITA 1K54C 4OQHA 3P7NA 1G68A 2Y79A 5J7EA 2IA2A 1RGZA 4P6ZS 3ZG8B 2ZL1B 4QWOA 4MN6A 2IWDA 4UQIS 3CJMA 2ZMFA 1E3UA 5AQ7A 2M7VA 4LRXC 1WYCA 5A93A 5J8XA 3V3RA 1OPXA 5FSRA 1CK3A 3VP0A 2L1MA 2KDKA 3V5MA 1NRJA 1VM1A 4EWFA 3BQ8A 4A5RA 1K0KA 4BQMA 4HP4A 1LI9A 2OLVA 3LY4A 3ZQ5A 3CPTA 2V8CA 4H8RA 4JGOA 1OTDA 3IHAA 5AJGA 1F9IA 3SH8A 5F69A 3V50A 2VV7A 5F5YA 3VOLA 2XH9A 3LGOA 2PD7A 4P6BA 1PW8A 3TRCA 1IKGA 5HPIA 5FEFA 4LGWA 3H9WA 2Y2LA 3W8KA 5HPFA 4R0QA 4EUZA 3UPNA 2J9OA 1OTIA 1JWPA 5TJJA 4HOIA 3KYQA 3G6OA 5FQKA 4NETA 5FDHA 4ZTKA 4JLFA 4PM5A 3G35A 1XP4A 1MC0A 4OOMA 4ESPA 1CI9A 4IBXA 3DWKA 3UDFA 1BULA 5DF8A 4X68A 4KENB 1PZPA 2P7JA 2HP6A 2Y91A 4KZ6A 3G30A 4HESA 3LI8A 3IXDA 5G18A 2CC1A 4G3KA 2FFYA 2QYBA 1J9MA 3E4QA 1PI4A 3BFGA 1GSWA 4KQOA 4RVAA 1GHMA 4QPRA 5HZHA 3TOIA 2EFUA 3MR0A 1SKOA 3UE0A 1FCOA 1GSVA 3MF0A 5EVIA 3H82B 1FQGA 2PAVP 4WZ5A 3TG9A 1H0MA 5CTNA 3N8LA 1M6KA 4Q8IA 3F1OA 5TBMA 2DMWA 3IF6B 4GN2A 2G7UA 2W3GA 4XXRA 2WKPA 1H8YA 4EETB 1FILA 1D7EA 2JKTI 3HJIA 3VP2A 3FPVA 4DN0A 3FPWA 3OC2A 3PBOA 2QJ5A 3O5YA 3LUQA 2PR5A 3ZFZA 2ZQDA 4DMZA 1EWZA 1VETA 2HGVA 3BJNA 4KQQA 5HL6A 3VMAA 5CERA 3C4OA 5DFXA 2WGWA 3N6IA 1HVBA 3V39A 5DJUA 3ZDJA 1VEUA 4E3IA 2O9CA 3ZHHA 2HDUA 4N1HA 4PAUA 2OV5A 3U4LP 1NY0A 5GLCA 4OPRA 1N9BA 1PRQA 2RCXA 3NDGA 1LT0A 5A90A 4E3KA 3EGXC 3S7NA 4GD8A 4LV1A 1YAXA 2WKQA 1IEMA 2OSUA 4Q0JA 3Q82A 3UB7A 2PBYA 3SH7A 1KE0A 1DRMA 1K4FA 4YINA 2K7SA 3JVUA 1P9WA 4OP8A 5AQAA 4D60A 4GS9A 3DBAA 2J7VA 3SZTA 2XFTA 1BLSA 3T50A 2J80A 4WYYA 4L9GA 5I5LA 4HBUA 1EW0A 1OJ5A 3KSIA 4GD6A 1VB6A 3NOTC 4MBKA 1IFQA 2DRWA 3MQOA 4OQ0A 2K2NA 4KZ4A 2ZMAA 3HL9A 1N4OA 3R4KA 5A92A 1NWZA 3SS4A 4IEDA 1EROA 4NXBA 3C30A 4KZ7A 4P87A 1YM1A 3VP3A 2EX6A 3LEZA 3LIFA 1OJGA 1SDEA 2WKIA 4EBPA 1IYSA 4R4SA 2QWSA 4OLGA 1KVLA 3PBNA 2GJ3A 3MZFA 2R78A 4PMAA 3E2LA 4OP5A 4GDBA 3IF6A 2WUQA 4N92A 4R6LA 1T1AA 4BWIA 3GSGA 2H0TA 4NKPA 4WEJA 1AWIA 4Y7PA 3IWOA 3V3SA 5GLBA 1RP5A 2OAP1 3BECA 2A3UA 5FI7A 3MXQA 5EECA 3UMDA 4M3KA 3BEBA 3PTEA 1WA9A 3P98A 3Q07A 2W27A 2GDNA 3MFDA 4BL3A 2H28A 2X02A 5KSHA 3M6BA 5HDCA 1HD8A 4DDSA 5HARA 1L0GA 2V0UA 4DXBA 1H3QA 2VJWA 1FCNA 3AGFA 1K4EA 2AVXA 3OCNA 5CGWA 3PAEA 1K6RA 3RFBA 1UWNX 5EOEA 2R9WA 3RTYA 4X1LA 4ME4A 3WRTA 3IS2B 4GHIB 1LL9A 1OTBA 3LICA 5KSCA 5FQMA 4ZBEA 3SH9A 3SW1A 2PRFA 2KOIA 3FWLA 2VGJA 3QP1A 2EX9A 1ESUA 3HLBA 2OWJA 4MN5A 2O0YA 1NYMA 1WYBA 4PM8A 3WS5A 1ES5A 2J3TC 5KZHA 1PWGA 4O7DA 1DJAA 3KSFA 4KUKA 3M2KA 2PD8A 5AVFA 3LIDA 3T4TA 3DTEA 1K54A 3EQVA 2FZ0A 5E2EA 3TJZC 2IWCA 4LFUA 1YLTA 2OOLA 3C8CA 1GHIA 1Y4OA 4WZ5C 3T1RA 2J9PA 4K0XA 1UWPX 4YFMA 4KG2A 4ZJ1A 4FTXA 3KSHA 3WS2A 1Q2PA 2XD5A 1X0OA 1E25A 3NULA 4KG6A 3VSLA 2XFSA 1STZA 5L07A 3B33A 3DW0A 3VFHA 5DTSA 5J4EA 3E4PA 4WL9A 5HX9A 3O88A 1KE3A 4WMCD 2ZM0A 1K56A 4BBVA 1G28A 4MEZA 4S2IA 5FQ9A 3GV9A 3NCKA 1XPBA 3QP4A 5GHXA 3IX3A 3DTIA 2A2LA 4LLOB 3EWKA 1K56D 2HZ5A 3S7PA 3MBZA 5HAIA 1ESIA 1W63Q 2BTFP 2ZOHA 2PR6A 3H82A 3T4QA 2C6WB 5F1FA 3T4JA 4OOYA 1V9YA 2EWVA 5CEDA 1LL8A 3IT9A 1I2WA 3UE6A 4WF0A 1KGGA 3GRJA 5EUAA 1MKMA 1H8ZA 3UPOA 4QD4A 4HY8A 4R3BA 3OLOA 5EE8A 2WZZA 3CMZA 3E4OA 4JXVA 5DKKA 1DP6A 4UA6A 4FSFA 2WAFA 4OOLA 1NRFA 4DE1A 3LR3A 2ZLYA 1K57A 4BBTA 3CG5A 1YQSA 1OT9A 2I9VA 3NOUC 4OPQA 1YPRA 5AQ9A 4U3TA 5HW3A 3F1OB 2VGKA 2XGNA 2EA9A 2WYXA 2X01A 4LRYC 4Y0UA 4OPYA 3QNCA 4WZ4A 2HPBA 3UPPA 2HP5A 4CPKA 1D06A 5JYPA 1BLCA 1GHPA 2XR0A 3C2WA 2XF3A 5DF7A 5FATA 1ZG4A 4EUVA 5I94A 4JF4A 3G31A 4GCZA 1TD5A 4E6WA 3LI9A 2WAEA 3S7QA 1PWDA 3GQZA 4WLAA 2LB5A 4FOFA 4R3JA 4E3LA 1S1ZA 4LV0A 3AGEA 3BFDA 4LPZA 1YMSA 4EU0A 2ZQ9A 4OONA 3R7WB 3A3FA 5G4YA 4F3LB 1S66L 3HLFA 2HJ9C 2V1ZA 4X69A 1ES3A 4YNRA 1EI5A 2O9BA 2QZ6A 3EEHA 3MKFA 1KOUA 2HP9A 4I39A 5FASA 4PM6A 1UGUA 1S67L 3BWLA 4HQAA 2W1RA 5FQJA 5HL1A 4LRZE 3MFXA 4PHTA 2VV8A 1IYPA 1IYOA 3B3XA 5L2FA 3W2ZA 2JC7A 2R9XA 3QNBA 4FH2A 3HLCA 2JHEA 3HLGA 2Y55A 3IF6C 2M7UA 3GDIA 5HSQA 5C5KA 2Y59A 3TW8A 2M1CA 4CJNA 2Z6CA 4N9LA 1WE4A 1V9ZA 1LI0A 2VLGA 3WWXA 2QKPA 5CTMA 1NZOA 3G2YA 2XDMA 4E04A 2ZM8A 2VX8A 3SS3A 2ZC6B 3E98A 2B95A 2V1AA 2WGIA 2V0WA 4RX2A 3A0RA 3VOYA 3HREA 3MJQA 3LCEA 4IBRA 4B9OA 3G4PA 3H7WB 4Q0IA 3ITAA 1W8YA 4UHUA 4XT2A 3N8SA 2A24A 1PIOA 1XJ2A 3CI6A 1G6OA 3CAXA 4GHIA 1KVMA 4HNBA 2XSSA 5DTTA 2PYPA 1PW1A 2G2UA 4ZJ3A 3S4XA 3RXXA 4JKTA 1T1BA 2UV0E 3MXSA 4Q0HA 2W3EA 5IHVA 3O86A 2DNSA 4L0LA 2KX6A 4Y17A 2JE5A 4Y2FA 2Y2GA 3T1SA 4JXSA 5GLAA 2G2WA 4IUKA
chains in the Genus database with same CATH topology
2EX8A 4Y7PA 1JWZA 1L0DA 3AGDA 1K57C 3FV7A 3W4QA 3IWOA 2XEPA 3NC8A 3V3SA 1ALQA 5GLBA 4S2LA 2FFFB 1RP5A 1SHVA 1SDNA 1HTZA 1MY8A 3ISGA 4ID4A 4EBLA 4LCMA 1KGEA 2XD1A 5EVIC 5HAQA 5M19A 3BECA 2RL3A 4X53A 5FA7A 2A3UA 5FI7A 2Z2MB 3VP1A 4ZDXA 5EECA 4M3KA 3BEBA 5EVID 3A3JA 3PTEA 3Q07A 3P98A 1YLZA 2GDNA 3MFDA 4BL3A 2X02A 1HZOA 5KSHA 1XGIA 4GZBA 3C5AA 3M6BA 3OCLA 1TEMA 4KG5A 4S2MA 3VFFA 1VQQA 4DDSA 1HD8A 1C3BA 4X6TA 5HARA 1L0GA 1W79A 4C3QA 4DXBA 4DDYA 5FQIA 1ONGA 1TDGA 1FCNA 2Y2JA 1K4EA 3AGFA 4QJGA 3OCNA 5CGWA 3PAEA 2WKHA 2ZC7A 2ZC4B 1K6RA 3CZDA 4GKUA 1JWVA 1QMEA 5A91A 2QMIA 4OQIA 1NZUA 1BT5A 3RXWA 4KZ5A 5EOEA 4RYEA 3GTCA 2JBFA 3UNWA 2R9WA 1G6AA 5CECA 4GNUA 1XA7A 5E2HA 4QB8A 4OPZA 3ZG9B 3P09A 1MWTA 1LHYA 3VSKA 4S2KA 5E2GA 4WMCA 1QMFA 4C6YA 4MNRA 3WRTA 3TSGA 1L0EA 3O3VA 1W8QA 4FD8A 1LL9A 4KQRA 2WKEA 5KSCA 4RA7A 4E6XA 5CHMA 3GMWA 5FQMA 2H0YA 4ZBEA 3SH9A 3MZDA 1YMXA 1YLPA 4JXGA 2ZQ8A 1MPLA 3HLDA 3FWLA 3WS4A 2VGJA 3W4OA 2EX9A 1NJ4A 1ESUA 5KMWA 3IXHA 4BL2A 1YT4A 3IXGA 4WEKA 3HLBA 3BLMA 3N8RA 5FAQA 1CEFA 1NYMA 2P9VA 3MZEA 1WYBA 4PM8A 3WS5A 1ES5A 5KZHA 2WADA 1PWGA 4MBFA 4O7DA 1DJAA 4BLMA 1PZOA 2I72A 4P85A 3UO9A 3M2KA 5F82A 4ZAMA 3G2ZA 4ZJ2A 2J8YA 1K54A 3EQVA 2EXBA 4B4ZA 1CEGA 4OQGA 2IWCA 5E2EA 3ZNTA 4S2PA 4R4RA 1YLTA 4S2OA 1MWRA 4UAAA 2WZXA 4S2NA 1K54C 4OQHA 1BLPA 1BTLA 1GHIA 1I5QA 1OMEA 1G68A 2HDSA 2PU2A 5HAPA 3NDEA 4WZ5C 3O87A 4R23A 5JYOA 2J9PA 2HDRA 1RGZA 1BLHA 3ZG8B 1JTDA 4K0XA 5E2FA 1KDSA 2Y4AA 4YFMA 4JXWA 4KG2A 2IWDA 1TVFA 4ZJ1A 5FI2A 4QY5A 3ZG0A 4MLLA 1I2SA 3IF5A 3CJMA 4N1XA 5CEBA 2EFXA 3WS2A 1E3UA 1Q2PA 1LL5A 2XD5A 2WGVA 5AQ7A 1E25A 4S2JA 2P74A 3DWZA 4KG6A 3VSLA 4E3OA 3BYDA 2XFSA 1WYCA 5A93A 3PAGA 4LV2A 3HUNA 4OVDA 5FAOA 5J8XA 3N4IA 5FQQA 1SKFA 4OH0A 3V3RA 5FSRA 5E43A 1K38A 3DW0A 3ZGAB 1CK3A 3VFHA 3VP0A 3G32A 5GHZA 5DTSA 3V5MA 2ZM2A 5HX9A 1MKIA 1VM1A 3HVFA 3O88A 4EWFA 4A5RA 4PPRA 1KE3A 1MWUA 2ZC5B 3IH8A 4BQMA 1E3UD 1O07A 2H10A 4WMCD 4C75A 2ZM0A 1LI9A 2OLVA 3LY4A 1K56A 3VP4A 3LO7A 4DKIA 4MEZA 4H8RA 4S2IA 3UE3A 5FQ9A 3GV9A 3NCKA 1ZG6A 1XPBA 3IH9A 5GHXA 3IHAA 4BD1A 3FYZA 4U0TA 2JCHA 3SH8A 4E3JA 1K56D 2C5WB 1AXBA 4X55A 2Y2MA 1ERMA 2IWBA 3V50A 4GOGA 1Z6FA 4JF6A 1RCJA 3MBZA 5HAIA 2V20A 2XH9A 1ESIA 1LLBA 4DE3A 2BG1A 4P6BA 1PW8A 2C6WB 1IKGA 5F1FA 3IWQA 1U60A 4OOYA 3ZVTA 1L2SA 5CRFA 5CEDA 2Y2LA 3W8KA 1XA1A 4DE2A 4R0QA 4EUZA 5GL9A 3UPNA 2J9OA 2Y2KA 1JWPA 3W4PA 3IT9A 4Y0TA 4OKPA 1I2WA 5M1AA 3PBQA 5FQKA 2BLSA 4NETA 1XGJA 1PI5A 1KGGA 5FDHA 3GRJA 2HDQA 4Z9QA 4ZTKA 5EUAA 3FKWA 3Q7ZA 4JLFA 4PM5A 1H8ZA 5TR7A 4QD4A 3UPOA 1MXOA 1FCMA 4R3BA 3G35A 5CHUA 1XP4A 1KDWA 1YLYA 3Q7VA 4PM9A 5CXWA 5EE8A 4OOMA 2WZZA 1CI9A 1K25A 3CMZA 4IBXA 4WELA 3IHBA 3DWKA 3UDFA 1BULA 5DF8A 5FI6A 3UN7A 4JXVA 4K0WA 4X68A 4KENB 1PZPA 4UA6A 3RJUA 1XKZA 2HP6A 2Y91A 4FSFA 2WAFA 4KZ6A 1NRFA 4OOLA 3G30A 4QHCA 4DE1A 3IQAA 3OPHA 4HESA 5CGXA 2ZLYA 1K57A 2WK0A 1IELA 4JPMA 3CG5A 3IXDA 1YQSA 5G18A 2CC1A 3C7UA 2EX2A 2Y2NA 3ZG5A 4OPQA 1O7EA 2Y2QA 2FFYA 5TGFA 3ZVWA 1BSGA 1J9MA 1PI4A 3HUOA 1JVJA 3BFGA 2PU4A 2ZQAA 3BM6A 5AQ9A 2E8IA 4KQOA 4U3TA 4RVAA 5HW3A 3DTMA 1GHMA 4HBTA 4DE0A 2VGKA 3TOIA 2XGNA 4GDNA 1MBLA 2WYXA 2X01A 2EFUA 3IWIA 4Y0UA 3MXRA 4OPYA 3UE0A 1FCOA 4KZ9A 3QNCA 5U47A 3JYIA 4WZ4A 2HPBA 3UPPA 5EVIA 4DF6A 2HP5A 1GCEA 2V2FF 4CPKA 1FQGA 1FOFA 3GVBA 3UE1A 5JYPA 1BLCA 1GHPA 4P0MA 1DJCA 2XR0A 1KGFA 2XF3A 5DF7A 5FATA 1ZG4A 3ZNYA 5I94A 1BUEA 4JF4A 4WZ5A 2A49A 3G31A 4U0XA 4PM7A 3LY3A 4WBGA 3TG9A 3NY4A 3OPRA 5CTNA 4E6WA 3N8LA 1M6KA 5CGSA 4Q8IA 2WAEA 3NIAA 3BFFA 3NBLA 3EQUA 3HBRA 1PWDA 1MWSA 3I7JA 4KZ3A 4EQIA 2XK1A 3GQZA 3IF6B 4GN2A 1ES4A 4XXRA 1Q2QA 5BOHA 3BFCA 4R3JA 4E3LA 4LV0A 1H8YA 1NXYA 3AGEA 3VP2A 4B88A 5EOOA 3BFDA 3BRMA 3PBSA 1YMSA 2Q9NA 2ZQ9A 3OC2A 3PBOA 4OONA 2P9VB 1FSWA 3A3FA 2Y2OA 3ZFZA 2ZQDA 3HLFA 1EWZA 2QPNA 2V1ZA 4UA9A 4X69A 3N7WA 5DF9A 3C4PA 1ES3A 1EI5A 2QZ6A 4KQQA 3VMAA 1IKIA 5CERA 3C4OA 3S1YA 1Y54A 2WGWA 3HLWA 3MKFA 3UDIA 3N6IA 4R1GA 1HVBA 4BD0A 2UWXA 2Y2PA 4KZ8A 2HP9A 5FASA 5EVIB 3V39A 4FCFA 4PM6A 1ZKJA 4EBNA 2XLNA 1NYYA 1K6SA 3ZDJA 1RGYA 5FQJA 5HL1A 3A3DA 3WS1A 4E3IA 3ZHHA 3ITBA 1IYPA 1IYOA 2HDUA 3B3XA 4N1HA 1ES2A 2OV5A 5L2FA 4FH4A 2JC7A 3SOIA 5GHYA 4E3NA 1NY0A 2R9XA 4MBHA 5CHJA 4HEFA 3M2JA 3QNBA 4N9KA 5GLCA 4FH2A 2OLUA 3HLCA 4OPRA 4K91A 1N9BA 3HLGA 3OZHA 2RCXA 2Y55A 1CI8A 4S2NC 3NDGA 3IF6C 5D3OA 1W7FA 5A90A 1IYQA 4JF5A 3E2KA 4E3KA 4E3MA 1DY6A 5AQBA 3UY6A 2Q9MA 4GD8A 4LV1A 1PYYA 2Y59A 4LENA 1GA0A 2XQZA 4CJNA 5M18A 4EV4A 2DCFA 1PWCA 1IEMA 1DJBA 3QHYA 3FKVA 3FZCA 1W5DA 2OSUA 4N9LA 3BFEA 2ZC3B 1WE4A 3IXBA 1LI0A 5DTKA 3Q82A 4WM9A 4BJPA 4X56A 3WWXA 2PBYA 3SH7A 3SS5A 1KE0A 1K4FA 4BENA 4YINA 1XX2A 4XUZA 5CTMA 1NZOA 1E4DA 4OP8A 5AQAA 5EPHA 3G2YA 4OLDA 3HLEA 2XDMA 2Y2HA 1JTGA 2J7VA 2ZM8A 1H5XA 3SS3A 3WRZA 2ZC6B 2XFTA 4D2OA 3OPLA 1BLSA 4QU3A 1FR6A 4WYYA 3PBRA 4QY6A 4RX3A 2WGIA 4RX2A 4HBUA 4DXCA 2ZQCA 3Q7VB 3HUMA 3VOYA 4GD6A 4LCLA 3HREA 4GB7A 4MBKA 3LCEA 2DRWA 4IBRA 3WS0A 3G4PA 3A3IA 4DRTA 2ZQ7A 2ZJ9A 4OQ0A 3D4FA 4UA7A 3A3EA 3ITAA 4KZ4A 2ZMAA 3HL9A 1N4OA 3PBTA 1W8YA 4UHUA 4NK3A 5A92A 5F1GA 3N8SA 4B4XA 3SS4A 3NI9A 3OPPA 1ERQA 4KZAA 3ZCZA 2EXAA 4IEDA 1FR1A 1PIOA 1EROA 1ZC2A 4IVKA 2Z2LB 1K55A 4LV3A 4Y0OA 5F83A 3C7VA 2B5RA 2X71A 5TFQA 4KZ7A 1FSYA 1KVMA 4P87A 1YM1A 3VP3A 2EX6A 3LEZA 1KE4A 3ZG7B 5DTTA 1K55C 1PW1A 2G2UA 4ZJ3A 5EVLA 1SDEA 1TDLA 4JKTA 2WKIA 4KZBA 3RXXA 3S4XA 1YLWA 4EBPA 3MKEA 4IVIA 4XUXA 1IYSA 3Q81A 5GLDA 1XXMA 4R4SA 2Y2IA 4OLGA 1KVLA 3PBNA 3MXSA 3VOZA 5DVAA 1GA9A 1ONHA 3BLSA 1SCWA 5IHVA 3MZFA 3O86A 2DNSA 4L0LA 3M6HA 3G34A 3E2LA 4PMAA 4OP5A 1S0WA 1L0FA 4F94A 2JE5A 4GDBA 2WGWB 3S22A 5HFOA 3GR2A 3IF6A 2WUQA 4N92A 2Y2GA 2ZD8A 3UDXA 1S6RA 4JBFA 1YLJA 4JXSA 5FAPA 5GLAA 2G2WA 1M40A 2H0TA 2H5SA 3GSGA 3Q1FA 1BZAA 4WEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX8 A;  4Y7P A;  1JWZ A;  1L0D A;  3AGD A;  1K57 C;  3FV7 A;  3W4Q A;  3IWO A;  2XEP A;  3NC8 A;  3V3S A;  1ALQ A;  5GLB A;  4S2L A;  2FFF B;  1RP5 A;  1SHV A;  1SDN A;  1HTZ A;  1MY8 A;  3ISG A;  4ID4 A;  4EBL A;  4LCM A;  1KGE A;  2XD1 A;  5EVI C;  5HAQ A;  5M19 A;  3BEC A;  2RL3 A;  4X53 A;  5FA7 A;  2A3U A;  5FI7 A;  2Z2M B;  3VP1 A;  4ZDX A;  5EEC A;  4M3K A;  3BEB A;  5EVI D;  3A3J A;  3PTE A;  3Q07 A;  3P98 A;  1YLZ A;  2GDN A;  3MFD A;  4BL3 A;  2X02 A;  1HZO A;  5KSH A;  1XGI A;  4GZB A;  3C5A A;  3M6B A;  3OCL A;  1TEM A;  4KG5 A;  4S2M A;  3VFF A;  1VQQ A;  4DDS A;  1HD8 A;  1C3B A;  4X6T A;  5HAR A;  1L0G A;  1W79 A;  4C3Q A;  4DXB A;  4DDY A;  5FQI A;  1ONG A;  1TDG A;  1FCN A;  2Y2J A;  1K4E A;  3AGF A;  4QJG A;  3OCN A;  5CGW A;  3PAE A;  2WKH A;  2ZC7 A;  2ZC4 B;  1K6R A;  3CZD A;  4GKU A;  1JWV A;  1QME A;  5A91 A;  2QMI A;  4OQI A;  1NZU A;  1BT5 A;  3RXW A;  4KZ5 A;  5EOE A;  4RYE A;  3GTC A;  2JBF A;  3UNW A;  2R9W A;  1G6A A;  5CEC A;  4GNU A;  1XA7 A;  5E2H A;  4QB8 A;  4OPZ A;  3ZG9 B;  3P09 A;  1MWT A;  1LHY A;  3VSK A;  4S2K A;  5E2G A;  4WMC A;  1QMF A;  4C6Y A;  4MNR A;  3WRT A;  3TSG A;  1L0E A;  3O3V A;  1W8Q A;  4FD8 A;  1LL9 A;  4KQR A;  2WKE A;  5KSC A;  4RA7 A;  4E6X A;  5CHM A;  3GMW A;  5FQM A;  2H0Y A;  4ZBE A;  3SH9 A;  3MZD A;  1YMX A;  1YLP A;  4JXG A;  2ZQ8 A;  1MPL A;  3HLD A;  3FWL A;  3WS4 A;  2VGJ A;  3W4O A;  2EX9 A;  1NJ4 A;  1ESU A;  5KMW A;  3IXH A;  4BL2 A;  1YT4 A;  3IXG A;  4WEK A;  3HLB A;  3BLM A;  3N8R A;  5FAQ A;  1CEF A;  1NYM A;  2P9V A;  3MZE A;  1WYB A;  4PM8 A;  3WS5 A;  1ES5 A;  5KZH A;  2WAD A;  1PWG A;  4MBF A;  4O7D A;  1DJA A;  4BLM A;  1PZO A;  2I72 A;  4P85 A;  3UO9 A;  3M2K A;  5F82 A;  4ZAM A;  3G2Z A;  4ZJ2 A;  2J8Y A;  1K54 A;  3EQV A;  2EXB A;  4B4Z A;  1CEG A;  4OQG A;  2IWC A;  5E2E A;  3ZNT A;  4S2P A;  4R4R A;  1YLT A;  4S2O A;  1MWR A;  4UAA A;  2WZX A;  4S2N A;  1K54 C;  4OQH A;  1BLP A;  1BTL A;  1GHI A;  1I5Q A;  1OME A;  1G68 A;  2HDS A;  2PU2 A;  5HAP A;  3NDE A;  4WZ5 C;  3O87 A;  4R23 A;  5JYO A;  2J9P A;  2HDR A;  1RGZ A;  1BLH A;  3ZG8 B;  1JTD A;  4K0X A;  5E2F A;  1KDS A;  2Y4A A;  4YFM A;  4JXW A;  4KG2 A;  2IWD A;  1TVF A;  4ZJ1 A;  5FI2 A;  4QY5 A;  3ZG0 A;  4MLL A;  1I2S A;  3IF5 A;  3CJM A;  4N1X A;  5CEB A;  2EFX A;  3WS2 A;  1E3U A;  1Q2P A;  1LL5 A;  2XD5 A;  2WGV A;  5AQ7 A;  1E25 A;  4S2J A;  2P74 A;  3DWZ A;  4KG6 A;  3VSL A;  4E3O A;  3BYD A;  2XFS A;  1WYC A;  5A93 A;  3PAG A;  4LV2 A;  3HUN A;  4OVD A;  5FAO A;  5J8X A;  3N4I A;  5FQQ A;  1SKF A;  4OH0 A;  3V3R A;  5FSR A;  5E43 A;  1K38 A;  3DW0 A;  3ZGA B;  1CK3 A;  3VFH A;  3VP0 A;  3G32 A;  5GHZ A;  5DTS A;  3V5M A;  2ZM2 A;  5HX9 A;  1MKI A;  1VM1 A;  3HVF A;  3O88 A;  4EWF A;  4A5R A;  4PPR A;  1KE3 A;  1MWU A;  2ZC5 B;  3IH8 A;  4BQM A;  1E3U D;  1O07 A;  2H10 A;  4WMC D;  4C75 A;  2ZM0 A;  1LI9 A;  2OLV A;  3LY4 A;  1K56 A;  3VP4 A;  3LO7 A;  4DKI A;  4MEZ A;  4H8R A;  4S2I A;  3UE3 A;  5FQ9 A;  3GV9 A;  3NCK A;  1ZG6 A;  1XPB A;  3IH9 A;  5GHX A;  3IHA A;  4BD1 A;  3FYZ A;  4U0T A;  2JCH A;  3SH8 A;  4E3J A;  1K56 D;  2C5W B;  1AXB A;  4X55 A;  2Y2M A;  1ERM A;  2IWB A;  3V50 A;  4GOG A;  1Z6F A;  4JF6 A;  1RCJ A;  3MBZ A;  5HAI A;  2V20 A;  2XH9 A;  1ESI A;  1LLB A;  4DE3 A;  2BG1 A;  4P6B A;  1PW8 A;  2C6W B;  1IKG A;  5F1F A;  3IWQ A;  1U60 A;  4OOY A;  3ZVT A;  1L2S A;  5CRF A;  5CED A;  2Y2L A;  3W8K A;  1XA1 A;  4DE2 A;  4R0Q A;  4EUZ A;  5GL9 A;  3UPN A;  2J9O A;  2Y2K A;  1JWP A;  3W4P A;  3IT9 A;  4Y0T A;  4OKP A;  1I2W A;  5M1A A;  3PBQ A;  5FQK A;  2BLS A;  4NET A;  1XGJ A;  1PI5 A;  1KGG A;  5FDH A;  3GRJ A;  2HDQ A;  4Z9Q A;  4ZTK A;  5EUA A;  3FKW A;  3Q7Z A;  4JLF A;  4PM5 A;  1H8Z A;  5TR7 A;  4QD4 A;  3UPO A;  1MXO A;  1FCM A;  4R3B A;  3G35 A;  5CHU A;  1XP4 A;  1KDW A;  1YLY A;  3Q7V A;  4PM9 A;  5CXW A;  5EE8 A;  4OOM A;  2WZZ A;  1CI9 A;  1K25 A;  3CMZ A;  4IBX A;  4WEL A;  3IHB A;  3DWK A;  3UDF A;  1BUL A;  5DF8 A;  5FI6 A;  3UN7 A;  4JXV A;  4K0W A;  4X68 A;  4KEN B;  1PZP A;  4UA6 A;  3RJU A;  1XKZ A;  2HP6 A;  2Y91 A;  4FSF A;  2WAF A;  4KZ6 A;  1NRF A;  4OOL A;  3G30 A;  4QHC A;  4DE1 A;  3IQA A;  3OPH A;  4HES A;  5CGX A;  2ZLY A;  1K57 A;  2WK0 A;  1IEL A;  4JPM A;  3CG5 A;  3IXD A;  1YQS A;  5G18 A;  2CC1 A;  3C7U A;  2EX2 A;  2Y2N A;  3ZG5 A;  4OPQ A;  1O7E A;  2Y2Q A;  2FFY A;  5TGF A;  3ZVW A;  1BSG A;  1J9M A;  1PI4 A;  3HUO A;  1JVJ A;  3BFG A;  2PU4 A;  2ZQA A;  3BM6 A;  5AQ9 A;  2E8I A;  4KQO A;  4U3T A;  4RVA A;  5HW3 A;  3DTM A;  1GHM A;  4HBT A;  4DE0 A;  2VGK A;  3TOI A;  2XGN A;  4GDN A;  1MBL A;  2WYX A;  2X01 A;  2EFU A;  3IWI A;  4Y0U A;  3MXR A;  4OPY A;  3UE0 A;  1FCO A;  4KZ9 A;  3QNC A;  5U47 A;  3JYI A;  4WZ4 A;  2HPB A;  3UPP A;  5EVI A;  4DF6 A;  2HP5 A;  1GCE A;  2V2F F;  4CPK A;  1FQG A;  1FOF A;  3GVB A;  3UE1 A;  5JYP A;  1BLC A;  1GHP A;  4P0M A;  1DJC A;  2XR0 A;  1KGF A;  2XF3 A;  5DF7 A;  5FAT A;  1ZG4 A;  3ZNY A;  5I94 A;  1BUE A;  4JF4 A;  4WZ5 A;  2A49 A;  3G31 A;  4U0X A;  4PM7 A;  3LY3 A;  4WBG A;  3TG9 A;  3NY4 A;  3OPR A;  5CTN A;  4E6W A;  3N8L A;  1M6K A;  5CGS A;  4Q8I A;  2WAE A;  3NIA A;  3BFF A;  3NBL A;  3EQU A;  3HBR A;  1PWD A;  1MWS A;  3I7J A;  4KZ3 A;  4EQI A;  2XK1 A;  3GQZ A;  3IF6 B;  4GN2 A;  1ES4 A;  4XXR A;  1Q2Q A;  5BOH A;  3BFC A;  4R3J A;  4E3L A;  4LV0 A;  1H8Y A;  1NXY A;  3AGE A;  3VP2 A;  4B88 A;  5EOO A;  3BFD A;  3BRM A;  3PBS A;  1YMS A;  2Q9N A;  2ZQ9 A;  3OC2 A;  3PBO A;  4OON A;  2P9V B;  1FSW A;  3A3F A;  2Y2O A;  3ZFZ A;  2ZQD A;  3HLF A;  1EWZ A;  2QPN A;  2V1Z A;  4UA9 A;  4X69 A;  3N7W A;  5DF9 A;  3C4P A;  1ES3 A;  1EI5 A;  2QZ6 A;  4KQQ A;  3VMA A;  1IKI A;  5CER A;  3C4O A;  3S1Y A;  1Y54 A;  2WGW A;  3HLW A;  3MKF A;  3UDI A;  3N6I A;  4R1G A;  1HVB A;  4BD0 A;  2UWX A;  2Y2P A;  4KZ8 A;  2HP9 A;  5FAS A;  5EVI B;  3V39 A;  4FCF A;  4PM6 A;  1ZKJ A;  4EBN A;  2XLN A;  1NYY A;  1K6S A;  3ZDJ A;  1RGY A;  5FQJ A;  5HL1 A;  3A3D A;  3WS1 A;  4E3I A;  3ZHH A;  3ITB A;  1IYP A;  1IYO A;  2HDU A;  3B3X A;  4N1H A;  1ES2 A;  2OV5 A;  5L2F A;  4FH4 A;  2JC7 A;  3SOI A;  5GHY A;  4E3N A;  1NY0 A;  2R9X A;  4MBH A;  5CHJ A;  4HEF A;  3M2J A;  3QNB A;  4N9K A;  5GLC A;  4FH2 A;  2OLU A;  3HLC A;  4OPR A;  4K91 A;  1N9B A;  3HLG A;  3OZH A;  2RCX A;  2Y55 A;  1CI8 A;  4S2N C;  3NDG A;  3IF6 C;  5D3O A;  1W7F A;  5A90 A;  1IYQ A;  4JF5 A;  3E2K A;  4E3K A;  4E3M A;  1DY6 A;  5AQB A;  3UY6 A;  2Q9M A;  4GD8 A;  4LV1 A;  1PYY A;  2Y59 A;  4LEN A;  1GA0 A;  2XQZ A;  4CJN A;  5M18 A;  4EV4 A;  2DCF A;  1PWC A;  1IEM A;  1DJB A;  3QHY A;  3FKV A;  3FZC A;  1W5D A;  2OSU A;  4N9L A;  3BFE A;  2ZC3 B;  1WE4 A;  3IXB A;  1LI0 A;  5DTK A;  3Q82 A;  4WM9 A;  4BJP A;  4X56 A;  3WWX A;  2PBY A;  3SH7 A;  3SS5 A;  1KE0 A;  1K4F A;  4BEN A;  4YIN A;  1XX2 A;  4XUZ A;  5CTM A;  1NZO A;  1E4D A;  4OP8 A;  5AQA A;  5EPH A;  3G2Y A;  4OLD A;  3HLE A;  2XDM A;  2Y2H A;  1JTG A;  2J7V A;  2ZM8 A;  1H5X A;  3SS3 A;  3WRZ A;  2ZC6 B;  2XFT A;  4D2O A;  3OPL A;  1BLS A;  4QU3 A;  1FR6 A;  4WYY A;  3PBR A;  4QY6 A;  4RX3 A;  2WGI A;  4RX2 A;  4HBU A;  4DXC A;  2ZQC A;  3Q7V B;  3HUM A;  3VOY A;  4GD6 A;  4LCL A;  3HRE A;  4GB7 A;  4MBK A;  3LCE A;  2DRW A;  4IBR A;  3WS0 A;  3G4P A;  3A3I A;  4DRT A;  2ZQ7 A;  2ZJ9 A;  4OQ0 A;  3D4F A;  4UA7 A;  3A3E A;  3ITA A;  4KZ4 A;  2ZMA A;  3HL9 A;  1N4O A;  3PBT A;  1W8Y A;  4UHU A;  4NK3 A;  5A92 A;  5F1G A;  3N8S A;  4B4X A;  3SS4 A;  3NI9 A;  3OPP A;  1ERQ A;  4KZA A;  3ZCZ A;  2EXA A;  4IED A;  1FR1 A;  1PIO A;  1ERO A;  1ZC2 A;  4IVK A;  2Z2L B;  1K55 A;  4LV3 A;  4Y0O A;  5F83 A;  3C7V A;  2B5R A;  2X71 A;  5TFQ A;  4KZ7 A;  1FSY A;  1KVM A;  4P87 A;  1YM1 A;  3VP3 A;  2EX6 A;  3LEZ A;  1KE4 A;  3ZG7 B;  5DTT A;  1K55 C;  1PW1 A;  2G2U A;  4ZJ3 A;  5EVL A;  1SDE A;  1TDL A;  4JKT A;  2WKI A;  4KZB A;  3RXX A;  3S4X A;  1YLW A;  4EBP A;  3MKE A;  4IVI A;  4XUX A;  1IYS A;  3Q81 A;  5GLD A;  1XXM A;  4R4S A;  2Y2I A;  4OLG A;  1KVL A;  3PBN A;  3MXS A;  3VOZ A;  5DVA A;  1GA9 A;  1ONH A;  3BLS A;  1SCW A;  5IHV A;  3MZF A;  3O86 A;  2DNS A;  4L0L A;  3M6H A;  3G34 A;  3E2L A;  4PMA A;  4OP5 A;  1S0W A;  1L0F A;  4F94 A;  2JE5 A;  4GDB A;  2WGW B;  3S22 A;  5HFO A;  3GR2 A;  3IF6 A;  2WUQ A;  4N92 A;  2Y2G A;  2ZD8 A;  3UDX A;  1S6R A;  4JBF A;  1YLJ A;  4JXS A;  5FAP A;  5GLA A;  2G2W A;  1M40 A;  2H0T A;  2H5S A;  3GSG A;  3Q1F A;  1BZA A;  4WEJ A; 
#chains in the Genus database with same CATH topology
 1JWZ A;  1L0D A;  3W4Q A;  5EM0 A;  1XFN A;  4GW9 A;  2XEP A;  1ALQ A;  1YSP A;  4ID4 A;  1HTZ A;  1MY8 A;  3K2N A;  1KGE A;  5EVI C;  5M19 A;  5IU1 A;  2RL3 A;  4PKY A;  5FA7 A;  1P97 A;  2Z2M B;  5EVI D;  3A3J A;  3LFV A;  3C38 A;  1YLZ A;  2PHY A;  4S2M A;  4KG5 A;  1TEM A;  4MN7 A;  5KIZ A;  2J3W A;  4X6T A;  4C3Q A;  4GJ4 A;  5MC7 A;  3UB8 A;  5FQI A;  2W1T A;  2GNX A;  5F68 A;  3CZD A;  4IHQ A;  1BT5 A;  3RXW A;  4KZ5 A;  4HIA A;  3UNW A;  1OTA A;  1A0K A;  4GNU A;  1XA7 A;  3PYP A;  2VKS A;  3P09 A;  3ZG9 B;  1VHM A;  1LHY A;  3VSK A;  3LR4 A;  4WMC A;  1QMF A;  1L0E A;  2O99 A;  4FD8 A;  3A0S A;  4CLC A;  4KQR A;  5DKL A;  4RA7 A;  4E6X A;  3MZD A;  4EER A;  3B42 A;  1CQA A;  3WS4 A;  4ARZ A;  4CLC B;  3W4O A;  1NJ4 A;  4BMW A;  3IXH A;  1CEF A;  2P9V A;  3MZE A;  4NXE A;  4P6Z M;  2OAQ 1;  4MBF A;  4JGR A;  5F82 A;  3MS6 A;  3G2Z A;  4ZJ2 A;  2J8Y A;  4NXF A;  4WN5 A;  2EXB A;  4B4Z A;  3ZNT A;  3NOP C;  4S2O A;  1MWR A;  3PR6 A;  4UAA A;  4S2N A;  1BTL A;  1I5Q A;  1MZU A;  2JKG A;  3NJA A;  5HAP A;  3NDE A;  3O87 A;  4I3A A;  4R23 A;  5JYO A;  2HDR A;  1JTD A;  2PDR A;  5E2F A;  1KDS A;  2Y4A A;  4JXW A;  5FI2 A;  3ZG0 A;  5IS1 A;  1I2S A;  3IF5 A;  5HWW A;  3D9Y A;  4N1X A;  5J3W A;  1CJF A;  2WGV A;  1LL5 A;  4S2J A;  3IX8 A;  4E3O A;  2A24 B;  3BYD A;  2L0W A;  3HUN A;  4OVD A;  4GS9 B;  3N4I A;  4OH0 A;  5E43 A;  2QJ7 A;  2Q0O A;  1P9R A;  1MKI A;  2ZC5 B;  3IH8 A;  4GLQ A;  1E3U D;  1O07 A;  3VP4 A;  2W3D A;  2VEA A;  3LO7 A;  3UE3 A;  1Z09 A;  4EXO A;  3T4S A;  4H6J A;  4E3J A;  1AXB A;  4X55 A;  2Y2M A;  2IWB A;  4JF6 A;  3RH8 B;  2V20 A;  1LLB A;  3R7W A;  4DE3 A;  1VEU B;  2B18 A;  3IWQ A;  1U60 A;  3ZVT A;  5HWT A;  4R70 A;  2JKR M;  1XA1 A;  4DE2 A;  5GL9 A;  3QP2 A;  4Y0T A;  4OKP A;  3PBQ A;  4CLC E;  1XGJ A;  4Z9Q A;  3QP5 A;  3GEC A;  1FCM A;  5CHU A;  1YLY A;  4ETZ A;  2O9A A;  4WEL A;  2V1B A;  1ZHH B;  3CHW P;  5FI6 A;  1IOU A;  4K0W A;  1PFL A;  2PBD P;  2W0N A;  1XKZ A;  5DJT A;  4HJ4 A;  4QHC A;  3IQA A;  1S1Y A;  2BAS A;  4II7 A;  3EGD C;  2EX2 A;  2Y2N A;  4PKY G;  1O7E A;  2Y2Q A;  1BSG A;  1HLU P;  3HUO A;  4BBU A;  2E8I A;  4I3J A;  1LSW A;  5HDS A;  3IWI A;  2NUP C;  3E0Y A;  4KZ9 A;  4HP9 A;  4ARZ B;  4DF6 A;  2V2F F;  2D01 A;  3T4K A;  3UE1 A;  4P0M A;  4O8G A;  1DJC A;  3L9K A;  1BUE A;  2HJE A;  4Y15 A;  3P01 A;  4JGP A;  1SKO B;  3F1P B;  4NXG A;  5K5B A;  5CGS A;  3NIA A;  3NBL A;  1MWS A;  3I7J A;  4B93 A;  4HHD A;  4KZ3 A;  4EQI A;  5FDS A;  1VET B;  5BOH A;  4K08 A;  4HJ6 A;  3KO6 A;  3ZYT A;  1NXY A;  4UQI M;  4B88 A;  4KQD A;  4EQ1 A;  3PBS A;  2Q9N A;  5TBM B;  2Y8H A;  3IBJ A;  2Y2O A;  4UA9 A;  3C4P A;  1T18 A;  3DAV A;  1Y54 A;  3HLW A;  3UDI A;  1XFQ A;  3H7W A;  5L10 A;  2UWX A;  5EVI B;  4FCF A;  1XJ4 A;  1NYY A;  2XLN A;  3A3D A;  4HJ3 A;  2JKT M;  3ITB A;  3SOI A;  4MBH A;  5CHJ A;  4N9K A;  4DJ3 A;  4K91 A;  5DTK A;  1L3L A;  3T1X A;  5EFW A;  1CI8 A;  3CUE A;  1W7F A;  4JF5 A;  3CPT B;  4KUO A;  5AQB A;  2ZMV A;  1N9N A;  2YKF A;  5LBR A;  3F1N A;  3MQQ A;  3D72 A;  2YKH A;  2DCF A;  4EV4 A;  1PWC A;  3FZC A;  1W5D A;  3BFE A;  2V8F A;  4I3I A;  1N9O A;  1OT6 A;  1J3W A;  4BEN A;  1XX2 A;  4XUZ A;  3T1Q B;  1E4D A;  5EPH A;  2D02 A;  4OLD A;  2L4R A;  3HLE A;  1D1J A;  2Y2H A;  1JTG A;  1H5X A;  3BW6 A;  3OPL A;  4QU3 A;  1TS6 A;  4Y13 A;  3PBR A;  4RX3 A;  3ULF A;  4DXC A;  1S4S A;  1DP8 A;  4YWZ A;  4GB7 A;  3A3I A;  2ZOI A;  4DRT A;  2ZQ7 A;  4UA7 A;  1OTE A;  5F1G A;  4B4X A;  3NI9 A;  4KZA A;  1ERQ A;  2XA7 M;  4MDZ A;  3ZCZ A;  1FR1 A;  2HF6 A;  1ZC2 A;  4AFI A;  2Z2L B;  1K55 A;  5L8M A;  4HH2 A;  5EVE A;  5F83 A;  5TFQ A;  4IUH A;  3ZG7 B;  1K55 C;  1TS0 A;  1TDL A;  3QP6 A;  3FG8 A;  3MKE A;  4IVI A;  4XUX A;  5GLD A;  3HCY A;  5DVA A;  1GA9 A;  1ONH A;  1SCW A;  4L9E A;  1TS7 A;  1NLY A;  4F94 A;  3GR2 A;  1Y28 A;  3UDX A;  2ZD8 A;  3IX4 A;  4JBF A;  5FAP A;  1M40 A;  2H5S A;  2EX8 A;  1K57 C;  3FV7 A;  2P08 A;  2VZW A;  4S2L A;  3JVV A;  3ISG A;  5HAQ A;  5G4Z A;  1YSQ A;  3LIE A;  1XGI A;  4GZB A;  1VQQ A;  1W79 A;  4DDY A;  1ONG A;  1TDG A;  2Y2J A;  4QJG A;  2WKH A;  2ZC7 A;  1ODV A;  4GKU A;  1QME A;  5A91 A;  4OQI A;  1NZU A;  4RYE A;  2JBF A;  1G6A A;  5E2H A;  4QB8 A;  2MJ6 A;  1MWT A;  3K3D A;  5E2G A;  1W8Q A;  5L09 A;  1F2K A;  2ZQ8 A;  3IBR A;  1MPL A;  3PHY A;  2V9A A;  2J3T D;  5KMW A;  3MMH A;  1YT4 A;  3IXG A;  4R38 A;  3N8R A;  3UB5 P;  2GZA A;  4BLM A;  1PZO A;  2I72 A;  4M4X A;  4YOF A;  4O01 A;  4EW7 A;  1CEG A;  2VA0 A;  4OQG A;  1DP9 A;  2WZX A;  1BLP A;  4G3W A;  4JGQ A;  1OME A;  1ACF A;  5HD5 A;  2HDS A;  2PU2 A;  1BLH A;  4I5S A;  3UB9 A;  1TVF A;  4QY5 A;  4MLL A;  3UME A;  1SZV A;  5FL3 A;  5CEB A;  2EFX A;  3LYX A;  2P74 A;  3DWZ A;  4G3V A;  4HI4 A;  3PAG A;  4LV2 A;  5FAO A;  4CLC C;  4IJG A;  5FQQ A;  1SKF A;  4ZRR A;  1K38 A;  3ZGA B;  4Y3I A;  3G32 A;  5GHZ A;  4CLC D;  2CMN A;  2ZM2 A;  3VE4 A;  3HVF A;  4PPR A;  4EES A;  1MWU A;  4C75 A;  2H10 A;  2HV1 A;  4DKI A;  2K31 A;  3S7O A;  1ZG6 A;  3IH9 A;  3KYZ A;  4BD1 A;  3FYZ A;  4U0T A;  2JCH A;  3MQ0 A;  2C5W B;  1ERM A;  4GOG A;  1Z6F A;  1RCJ A;  3VV4 A;  2BG1 A;  1L2S A;  2ZBB A;  5CRF A;  5AVE A;  2Y2K A;  2VK3 A;  3W4P A;  5M1A A;  3VE3 A;  2BLS A;  4L9F A;  1F5M A;  1PI5 A;  2HDQ A;  3FKW A;  3Q7Z A;  5TR7 A;  3LR0 A;  4O0P A;  1MXO A;  5CX7 A;  1KDW A;  3Q7V A;  4PM9 A;  5CXW A;  2JN7 A;  1K25 A;  3IHB A;  3IS2 A;  3UN7 A;  2ZL1 A;  3RJU A;  3KX0 X;  3NEC A;  3OPH A;  5CGX A;  2Z6D A;  3OOV A;  1IEL A;  2WK0 A;  4JPM A;  1YKD A;  5HD3 A;  3C7U A;  3B47 A;  3ZG5 A;  4NEE D;  5DFY A;  5TGF A;  3ZVW A;  3CLO A;  4Y5F A;  1JVJ A;  2PU4 A;  2ZQA A;  3BM6 A;  1GSX A;  3DTM A;  4HBT A;  3JPU A;  4DE0 A;  4GDN A;  1MBL A;  4DJ2 A;  3MXR A;  3U2A A;  5U47 A;  1BYW A;  3JYI A;  2NUT C;  1GCE A;  1FOF A;  3GVB A;  1KGF A;  3ZNY A;  2A49 A;  4U0X A;  1CF0 A;  4PM7 A;  2INW A;  3LY3 A;  4WBG A;  3NY4 A;  3OPR A;  1XJ3 A;  1S4R A;  3BFF A;  3EQU A;  3HBR A;  3PXP A;  4MCW A;  2XK1 A;  1ES4 A;  3KYE A;  1Q2Q A;  3BFC A;  3V67 A;  5A8B A;  3T4O A;  5EOO A;  1LSV A;  3BRM A;  1NLZ A;  4H6J B;  2P9V B;  1FSW A;  2ACG A;  2QPN A;  3N7W A;  5DF9 A;  3L7H A;  3T4L A;  1IKI A;  5HWV A;  5HDD A;  3S1Y A;  3F1N B;  4R1G A;  1W63 M;  3F1P A;  4BD0 A;  2JKF A;  2Y2P A;  4KZ8 A;  4EBN A;  1ZKJ A;  3OBF A;  3NHQ A;  1K6S A;  1RGY A;  3WS1 A;  2P04 A;  2PYR A;  1ES2 A;  4FH4 A;  1T1C A;  5GHY A;  4E3N A;  4HEF A;  3M2J A;  2OLU A;  1XJ6 A;  3OZH A;  4S2N C;  5D3O A;  4EEU A;  1IYQ A;  3EEA A;  3E2K A;  4NG2 A;  4E3M A;  3T12 B;  2XA7 S;  1DY6 A;  3MSH A;  3UY6 A;  2Q9M A;  1PYY A;  2VV6 A;  4LEN A;  3LIB A;  1GA0 A;  2XQZ A;  5M18 A;  3QHY A;  1DJB A;  3FKV A;  2VGL M;  2ZC3 B;  3IXB A;  4WM9 A;  4BJP A;  4X56 A;  3SS5 A;  3QP8 A;  2EWW A;  3EOI A;  4EEP A;  2GX5 A;  3WRZ A;  4D2O A;  1FR6 A;  4QY6 A;  2ZQC A;  3LEQ A;  3Q7V B;  3HUM A;  4LCL A;  1PNE A;  3WS0 A;  2ZJ9 A;  3D4F A;  3A3E A;  1ZTU A;  3BQA A;  2FH5 A;  3PBT A;  4NK3 A;  2LB9 A;  3OPP A;  2W3F A;  3FC7 A;  2EXA A;  4RQ9 A;  4IVK A;  4LV3 A;  4Y0O A;  3C7V A;  2B5R A;  2X71 A;  1FSY A;  1KE4 A;  3ICY A;  3A0V A;  5EVL A;  1TS8 A;  4XT2 B;  3CWF A;  4KZB A;  1YLW A;  2QHK A;  3Q81 A;  1XXM A;  5F6A A;  2Y2I A;  3VOZ A;  3BLS A;  4UEY A;  3M6H A;  3G34 A;  1S0W A;  1L0F A;  2OWH A;  4X25 A;  2WGW B;  3S22 A;  4HH3 A;  5HFO A;  5IT5 A;  1G5U A;  1S6R A;  3LR5 A;  1YLJ A;  3Q1F A;  4FUW A;  1BZA A;  3AGD A;  1JNU A;  3NC8 A;  2FFF B;  3D3O A;  3TE8 A;  3BY9 A;  1SHV A;  1SDN A;  4X1M A;  1FIK A;  4EBL A;  4LCM A;  2E8J A;  2XD1 A;  1F98 A;  3LIA A;  4X53 A;  3VP1 A;  4ZDX A;  4I38 A;  1HZO A;  3C5A A;  3OCL A;  3KSG A;  3VFF A;  2XRO A;  2XRN A;  1C3B A;  2ZC4 B;  4F3L A;  1JWV A;  2KLI A;  2QMI A;  3UB6 A;  5FEG A;  3GTC A;  5EM1 A;  5CEC A;  1LSX A;  3BY8 A;  3K3C A;  4OPZ A;  4CQH A;  4S2K A;  4WUJ A;  1P0Z A;  2W1T B;  4C6Y A;  4MNR A;  4Z1W A;  3TSG A;  3O3V A;  2WKE A;  2VGL S;  2WKR A;  3GMW A;  5CHM A;  2H0Y A;  1YMX A;  1YLP A;  4JXG A;  3HLD A;  5EV0 A;  3HJK A;  4BL2 A;  1TF1 A;  4WEK A;  3BLM A;  1T19 A;  1H8M A;  5FAQ A;  2PT7 A;  1N9L A;  2WAD A;  2B02 A;  4P85 A;  4R3A A;  3UO9 A;  4MMN A;  4ZAM A;  2W3H A;  4ETX A;  2JKR I;  4S2P A;  4R4R A;  3DTK A;  3CUE C;  3CIT A;  1K54 C;  4OQH A;  3P7N A;  1G68 A;  2Y79 A;  5J7E A;  2IA2 A;  1RGZ A;  4P6Z S;  3ZG8 B;  2ZL1 B;  4QWO A;  4MN6 A;  2IWD A;  4UQI S;  3CJM A;  2ZMF A;  1E3U A;  5AQ7 A;  2M7V A;  4LRX C;  1WYC A;  5A93 A;  5J8X A;  3V3R A;  1OPX A;  5FSR A;  1CK3 A;  3VP0 A;  2L1M A;  2KDK A;  3V5M A;  1NRJ A;  1VM1 A;  4EWF A;  3BQ8 A;  4A5R A;  1K0K A;  4BQM A;  4HP4 A;  1LI9 A;  2OLV A;  3LY4 A;  3ZQ5 A;  3CPT A;  2V8C A;  4H8R A;  4JGO A;  1OTD A;  3IHA A;  5AJG A;  1F9I A;  3SH8 A;  5F69 A;  3V50 A;  2VV7 A;  5F5Y A;  3VOL A;  2XH9 A;  3LGO A;  2PD7 A;  4P6B A;  1PW8 A;  3TRC A;  1IKG A;  5HPI A;  5FEF A;  4LGW A;  3H9W A;  2Y2L A;  3W8K A;  5HPF A;  4R0Q A;  4EUZ A;  3UPN A;  2J9O A;  1OTI A;  1JWP A;  5TJJ A;  4HOI A;  3KYQ A;  3G6O A;  5FQK A;  4NET A;  5FDH A;  4ZTK A;  4JLF A;  4PM5 A;  3G35 A;  1XP4 A;  1MC0 A;  4OOM A;  4ESP A;  1CI9 A;  4IBX A;  3DWK A;  3UDF A;  1BUL A;  5DF8 A;  4X68 A;  4KEN B;  1PZP A;  2P7J A;  2HP6 A;  2Y91 A;  4KZ6 A;  3G30 A;  4HES A;  3LI8 A;  3IXD A;  5G18 A;  2CC1 A;  4G3K A;  2FFY A;  2QYB A;  1J9M A;  3E4Q A;  1PI4 A;  3BFG A;  1GSW A;  4KQO A;  4RVA A;  1GHM A;  4QPR A;  5HZH A;  3TOI A;  2EFU A;  3MR0 A;  1SKO A;  3UE0 A;  1FCO A;  1GSV A;  3MF0 A;  5EVI A;  3H82 B;  1FQG A;  2PAV P;  4WZ5 A;  3TG9 A;  1H0M A;  5CTN A;  3N8L A;  1M6K A;  4Q8I A;  3F1O A;  5TBM A;  2DMW A;  3IF6 B;  4GN2 A;  2G7U A;  2W3G A;  4XXR A;  2WKP A;  1H8Y A;  4EET B;  1FIL A;  1D7E A;  2JKT I;  3HJI A;  3VP2 A;  3FPV A;  4DN0 A;  3FPW A;  3OC2 A;  3PBO A;  2QJ5 A;  3O5Y A;  3LUQ A;  2PR5 A;  3ZFZ A;  2ZQD A;  4DMZ A;  1EWZ A;  1VET A;  2HGV A;  3BJN A;  4KQQ A;  5HL6 A;  3VMA A;  5CER A;  3C4O A;  5DFX A;  2WGW A;  3N6I A;  1HVB A;  3V39 A;  5DJU A;  3ZDJ A;  1VEU A;  4E3I A;  2O9C A;  3ZHH A;  2HDU A;  4N1H A;  4PAU A;  2OV5 A;  3U4L P;  1NY0 A;  5GLC A;  4OPR A;  1N9B A;  1PRQ A;  2RCX A;  3NDG A;  1LT0 A;  5A90 A;  4E3K A;  3EGX C;  3S7N A;  4GD8 A;  4LV1 A;  1YAX A;  2WKQ A;  1IEM A;  2OSU A;  4Q0J A;  3Q82 A;  3UB7 A;  2PBY A;  3SH7 A;  1KE0 A;  1DRM A;  1K4F A;  4YIN A;  2K7S A;  3JVU A;  1P9W A;  4OP8 A;  5AQA A;  4D60 A;  4GS9 A;  3DBA A;  2J7V A;  3SZT A;  2XFT A;  1BLS A;  3T50 A;  2J80 A;  4WYY A;  4L9G A;  5I5L A;  4HBU A;  1EW0 A;  1OJ5 A;  3KSI A;  4GD6 A;  1VB6 A;  3NOT C;  4MBK A;  1IFQ A;  2DRW A;  3MQO A;  4OQ0 A;  2K2N A;  4KZ4 A;  2ZMA A;  3HL9 A;  1N4O A;  3R4K A;  5A92 A;  1NWZ A;  3SS4 A;  4IED A;  1ERO A;  4NXB A;  3C30 A;  4KZ7 A;  4P87 A;  1YM1 A;  3VP3 A;  2EX6 A;  3LEZ A;  3LIF A;  1OJG A;  1SDE A;  2WKI A;  4EBP A;  1IYS A;  4R4S A;  2QWS A;  4OLG A;  1KVL A;  3PBN A;  2GJ3 A;  3MZF A;  2R78 A;  4PMA A;  3E2L A;  4OP5 A;  4GDB A;  3IF6 A;  2WUQ A;  4N92 A;  4R6L A;  1T1A A;  4BWI A;  3GSG A;  2H0T A;  4NKP A;  4WEJ A;  1AWI A;  4Y7P A;  3IWO A;  3V3S A;  5GLB A;  1RP5 A;  2OAP 1;  3BEC A;  2A3U A;  5FI7 A;  3MXQ A;  5EEC A;  3UMD A;  4M3K A;  3BEB A;  3PTE A;  1WA9 A;  3P98 A;  3Q07 A;  2W27 A;  2GDN A;  3MFD A;  4BL3 A;  2H28 A;  2X02 A;  5KSH A;  3M6B A;  5HDC A;  1HD8 A;  4DDS A;  5HAR A;  1L0G A;  2V0U A;  4DXB A;  1H3Q A;  2VJW A;  1FCN A;  3AGF A;  1K4E A;  2AVX A;  3OCN A;  5CGW A;  3PAE A;  1K6R A;  3RFB A;  1UWN X;  5EOE A;  2R9W A;  3RTY A;  4X1L A;  4ME4 A;  3WRT A;  3IS2 B;  4GHI B;  1LL9 A;  1OTB A;  3LIC A;  5KSC A;  5FQM A;  4ZBE A;  3SH9 A;  3SW1 A;  2PRF A;  2KOI A;  3FWL A;  2VGJ A;  3QP1 A;  2EX9 A;  1ESU A;  3HLB A;  2OWJ A;  4MN5 A;  2O0Y A;  1NYM A;  1WYB A;  4PM8 A;  3WS5 A;  1ES5 A;  2J3T C;  5KZH A;  1PWG A;  4O7D A;  1DJA A;  3KSF A;  4KUK A;  3M2K A;  2PD8 A;  5AVF A;  3LID A;  3T4T A;  3DTE A;  1K54 A;  3EQV A;  2FZ0 A;  5E2E A;  3TJZ C;  2IWC A;  4LFU A;  1YLT A;  2OOL A;  3C8C A;  1GHI A;  1Y4O A;  4WZ5 C;  3T1R A;  2J9P A;  4K0X A;  1UWP X;  4YFM A;  4KG2 A;  4ZJ1 A;  4FTX A;  3KSH A;  3WS2 A;  1Q2P A;  2XD5 A;  1X0O A;  1E25 A;  3NUL A;  4KG6 A;  3VSL A;  2XFS A;  1STZ A;  5L07 A;  3B33 A;  3DW0 A;  3VFH A;  5DTS A;  5J4E A;  3E4P A;  4WL9 A;  5HX9 A;  3O88 A;  1KE3 A;  4WMC D;  2ZM0 A;  1K56 A;  4BBV A;  1G28 A;  4MEZ A;  4S2I A;  5FQ9 A;  3GV9 A;  3NCK A;  1XPB A;  3QP4 A;  5GHX A;  3IX3 A;  3DTI A;  2A2L A;  4LLO B;  3EWK A;  1K56 D;  2HZ5 A;  3S7P A;  3MBZ A;  5HAI A;  1ESI A;  1W63 Q;  2BTF P;  2ZOH A;  2PR6 A;  3H82 A;  3T4Q A;  2C6W B;  5F1F A;  3T4J A;  4OOY A;  1V9Y A;  2EWV A;  5CED A;  1LL8 A;  3IT9 A;  1I2W A;  3UE6 A;  4WF0 A;  1KGG A;  3GRJ A;  5EUA A;  1MKM A;  1H8Z A;  3UPO A;  4QD4 A;  4HY8 A;  4R3B A;  3OLO A;  5EE8 A;  2WZZ A;  3CMZ A;  3E4O A;  4JXV A;  5DKK A;  1DP6 A;  4UA6 A;  4FSF A;  2WAF A;  4OOL A;  1NRF A;  4DE1 A;  3LR3 A;  2ZLY A;  1K57 A;  4BBT A;  3CG5 A;  1YQS A;  1OT9 A;  2I9V A;  3NOU C;  4OPQ A;  1YPR A;  5AQ9 A;  4U3T A;  5HW3 A;  3F1O B;  2VGK A;  2XGN A;  2EA9 A;  2WYX A;  2X01 A;  4LRY C;  4Y0U A;  4OPY A;  3QNC A;  4WZ4 A;  2HPB A;  3UPP A;  2HP5 A;  4CPK A;  1D06 A;  5JYP A;  1BLC A;  1GHP A;  2XR0 A;  3C2W A;  2XF3 A;  5DF7 A;  5FAT A;  1ZG4 A;  4EUV A;  5I94 A;  4JF4 A;  3G31 A;  4GCZ A;  1TD5 A;  4E6W A;  3LI9 A;  2WAE A;  3S7Q A;  1PWD A;  3GQZ A;  4WLA A;  2LB5 A;  4FOF A;  4R3J A;  4E3L A;  1S1Z A;  4LV0 A;  3AGE A;  3BFD A;  4LPZ A;  1YMS A;  4EU0 A;  2ZQ9 A;  4OON A;  3R7W B;  3A3F A;  5G4Y A;  4F3L B;  1S66 L;  3HLF A;  2HJ9 C;  2V1Z A;  4X69 A;  1ES3 A;  4YNR A;  1EI5 A;  2O9B A;  2QZ6 A;  3EEH A;  3MKF A;  1KOU A;  2HP9 A;  4I39 A;  5FAS A;  4PM6 A;  1UGU A;  1S67 L;  3BWL A;  4HQA A;  2W1R A;  5FQJ A;  5HL1 A;  4LRZ E;  3MFX A;  4PHT A;  2VV8 A;  1IYP A;  1IYO A;  3B3X A;  5L2F A;  3W2Z A;  2JC7 A;  2R9X A;  3QNB A;  4FH2 A;  3HLC A;  2JHE A;  3HLG A;  2Y55 A;  3IF6 C;  2M7U A;  3GDI A;  5HSQ A;  5C5K A;  2Y59 A;  3TW8 A;  2M1C A;  4CJN A;  2Z6C A;  4N9L A;  1WE4 A;  1V9Z A;  1LI0 A;  2VLG A;  3WWX A;  2QKP A;  5CTM A;  1NZO A;  3G2Y A;  2XDM A;  4E04 A;  2ZM8 A;  2VX8 A;  3SS3 A;  2ZC6 B;  3E98 A;  2B95 A;  2V1A A;  2WGI A;  2V0W A;  4RX2 A;  3A0R A;  3VOY A;  3HRE A;  3MJQ A;  3LCE A;  4IBR A;  4B9O A;  3G4P A;  3H7W B;  4Q0I A;  3ITA A;  1W8Y A;  4UHU A;  4XT2 A;  3N8S A;  2A24 A;  1PIO A;  1XJ2 A;  3CI6 A;  1G6O A;  3CAX A;  4GHI A;  1KVM A;  4HNB A;  2XSS A;  5DTT A;  2PYP A;  1PW1 A;  2G2U A;  4ZJ3 A;  3S4X A;  3RXX A;  4JKT A;  1T1B A;  2UV0 E;  3MXS A;  4Q0H A;  2W3E A;  5IHV A;  3O86 A;  2DNS A;  4L0L A;  2KX6 A;  4Y17 A;  2JE5 A;  4Y2F A;  2Y2G A;  3T1S A;  4JXS A;  5GLA A;  2G2W A;  4IUK A; 
#chains in the Genus database with same CATH homology
 2EX8 A;  4Y7P A;  1JWZ A;  1L0D A;  3AGD A;  1K57 C;  3FV7 A;  3W4Q A;  3IWO A;  2XEP A;  3NC8 A;  3V3S A;  1ALQ A;  5GLB A;  4S2L A;  2FFF B;  1RP5 A;  1SHV A;  1SDN A;  1HTZ A;  1MY8 A;  3ISG A;  4ID4 A;  4EBL A;  4LCM A;  1KGE A;  2XD1 A;  5EVI C;  5HAQ A;  5M19 A;  3BEC A;  2RL3 A;  4X53 A;  5FA7 A;  2A3U A;  5FI7 A;  2Z2M B;  3VP1 A;  4ZDX A;  5EEC A;  4M3K A;  3BEB A;  5EVI D;  3A3J A;  3PTE A;  3Q07 A;  3P98 A;  1YLZ A;  2GDN A;  3MFD A;  4BL3 A;  2X02 A;  1HZO A;  5KSH A;  1XGI A;  4GZB A;  3C5A A;  3M6B A;  3OCL A;  1TEM A;  4KG5 A;  4S2M A;  3VFF A;  1VQQ A;  4DDS A;  1HD8 A;  1C3B A;  4X6T A;  5HAR A;  1L0G A;  1W79 A;  4C3Q A;  4DXB A;  4DDY A;  5FQI A;  1ONG A;  1TDG A;  1FCN A;  2Y2J A;  1K4E A;  3AGF A;  4QJG A;  3OCN A;  5CGW A;  3PAE A;  2WKH A;  2ZC7 A;  2ZC4 B;  1K6R A;  3CZD A;  4GKU A;  1JWV A;  1QME A;  5A91 A;  2QMI A;  4OQI A;  1NZU A;  1BT5 A;  3RXW A;  4KZ5 A;  5EOE A;  4RYE A;  3GTC A;  2JBF A;  3UNW A;  2R9W A;  1G6A A;  5CEC A;  4GNU A;  1XA7 A;  5E2H A;  4QB8 A;  4OPZ A;  3ZG9 B;  3P09 A;  1MWT A;  1LHY A;  3VSK A;  4S2K A;  5E2G A;  4WMC A;  1QMF A;  4C6Y A;  4MNR A;  3WRT A;  3TSG A;  1L0E A;  3O3V A;  1W8Q A;  4FD8 A;  1LL9 A;  4KQR A;  2WKE A;  5KSC A;  4RA7 A;  4E6X A;  5CHM A;  3GMW A;  5FQM A;  2H0Y A;  4ZBE A;  3SH9 A;  3MZD A;  1YMX A;  1YLP A;  4JXG A;  2ZQ8 A;  1MPL A;  3HLD A;  3FWL A;  3WS4 A;  2VGJ A;  3W4O A;  2EX9 A;  1NJ4 A;  1ESU A;  5KMW A;  3IXH A;  4BL2 A;  1YT4 A;  3IXG A;  4WEK A;  3HLB A;  3BLM A;  3N8R A;  5FAQ A;  1CEF A;  1NYM A;  2P9V A;  3MZE A;  1WYB A;  4PM8 A;  3WS5 A;  1ES5 A;  5KZH A;  2WAD A;  1PWG A;  4MBF A;  4O7D A;  1DJA A;  4BLM A;  1PZO A;  2I72 A;  4P85 A;  3UO9 A;  3M2K A;  5F82 A;  4ZAM A;  3G2Z A;  4ZJ2 A;  2J8Y A;  1K54 A;  3EQV A;  2EXB A;  4B4Z A;  1CEG A;  4OQG A;  2IWC A;  5E2E A;  3ZNT A;  4S2P A;  4R4R A;  1YLT A;  4S2O A;  1MWR A;  4UAA A;  2WZX A;  4S2N A;  1K54 C;  4OQH A;  1BLP A;  1BTL A;  1GHI A;  1I5Q A;  1OME A;  1G68 A;  2HDS A;  2PU2 A;  5HAP A;  3NDE A;  4WZ5 C;  3O87 A;  4R23 A;  5JYO A;  2J9P A;  2HDR A;  1RGZ A;  1BLH A;  3ZG8 B;  1JTD A;  4K0X A;  5E2F A;  1KDS A;  2Y4A A;  4YFM A;  4JXW A;  4KG2 A;  2IWD A;  1TVF A;  4ZJ1 A;  5FI2 A;  4QY5 A;  3ZG0 A;  4MLL A;  1I2S A;  3IF5 A;  3CJM A;  4N1X A;  5CEB A;  2EFX A;  3WS2 A;  1E3U A;  1Q2P A;  1LL5 A;  2XD5 A;  2WGV A;  5AQ7 A;  1E25 A;  4S2J A;  2P74 A;  3DWZ A;  4KG6 A;  3VSL A;  4E3O A;  3BYD A;  2XFS A;  1WYC A;  5A93 A;  3PAG A;  4LV2 A;  3HUN A;  4OVD A;  5FAO A;  5J8X A;  3N4I A;  5FQQ A;  1SKF A;  4OH0 A;  3V3R A;  5FSR A;  5E43 A;  1K38 A;  3DW0 A;  3ZGA B;  1CK3 A;  3VFH A;  3VP0 A;  3G32 A;  5GHZ A;  5DTS A;  3V5M A;  2ZM2 A;  5HX9 A;  1MKI A;  1VM1 A;  3HVF A;  3O88 A;  4EWF A;  4A5R A;  4PPR A;  1KE3 A;  1MWU A;  2ZC5 B;  3IH8 A;  4BQM A;  1E3U D;  1O07 A;  2H10 A;  4WMC D;  4C75 A;  2ZM0 A;  1LI9 A;  2OLV A;  3LY4 A;  1K56 A;  3VP4 A;  3LO7 A;  4DKI A;  4MEZ A;  4H8R A;  4S2I A;  3UE3 A;  5FQ9 A;  3GV9 A;  3NCK A;  1ZG6 A;  1XPB A;  3IH9 A;  5GHX A;  3IHA A;  4BD1 A;  3FYZ A;  4U0T A;  2JCH A;  3SH8 A;  4E3J A;  1K56 D;  2C5W B;  1AXB A;  4X55 A;  2Y2M A;  1ERM A;  2IWB A;  3V50 A;  4GOG A;  1Z6F A;  4JF6 A;  1RCJ A;  3MBZ A;  5HAI A;  2V20 A;  2XH9 A;  1ESI A;  1LLB A;  4DE3 A;  2BG1 A;  4P6B A;  1PW8 A;  2C6W B;  1IKG A;  5F1F A;  3IWQ A;  1U60 A;  4OOY A;  3ZVT A;  1L2S A;  5CRF A;  5CED A;  2Y2L A;  3W8K A;  1XA1 A;  4DE2 A;  4R0Q A;  4EUZ A;  5GL9 A;  3UPN A;  2J9O A;  2Y2K A;  1JWP A;  3W4P A;  3IT9 A;  4Y0T A;  4OKP A;  1I2W A;  5M1A A;  3PBQ A;  5FQK A;  2BLS A;  4NET A;  1XGJ A;  1PI5 A;  1KGG A;  5FDH A;  3GRJ A;  2HDQ A;  4Z9Q A;  4ZTK A;  5EUA A;  3FKW A;  3Q7Z A;  4JLF A;  4PM5 A;  1H8Z A;  5TR7 A;  4QD4 A;  3UPO A;  1MXO A;  1FCM A;  4R3B A;  3G35 A;  5CHU A;  1XP4 A;  1KDW A;  1YLY A;  3Q7V A;  4PM9 A;  5CXW A;  5EE8 A;  4OOM A;  2WZZ A;  1CI9 A;  1K25 A;  3CMZ A;  4IBX A;  4WEL A;  3IHB A;  3DWK A;  3UDF A;  1BUL A;  5DF8 A;  5FI6 A;  3UN7 A;  4JXV A;  4K0W A;  4X68 A;  4KEN B;  1PZP A;  4UA6 A;  3RJU A;  1XKZ A;  2HP6 A;  2Y91 A;  4FSF A;  2WAF A;  4KZ6 A;  1NRF A;  4OOL A;  3G30 A;  4QHC A;  4DE1 A;  3IQA A;  3OPH A;  4HES A;  5CGX A;  2ZLY A;  1K57 A;  2WK0 A;  1IEL A;  4JPM A;  3CG5 A;  3IXD A;  1YQS A;  5G18 A;  2CC1 A;  3C7U A;  2EX2 A;  2Y2N A;  3ZG5 A;  4OPQ A;  1O7E A;  2Y2Q A;  2FFY A;  5TGF A;  3ZVW A;  1BSG A;  1J9M A;  1PI4 A;  3HUO A;  1JVJ A;  3BFG A;  2PU4 A;  2ZQA A;  3BM6 A;  5AQ9 A;  2E8I A;  4KQO A;  4U3T A;  4RVA A;  5HW3 A;  3DTM A;  1GHM A;  4HBT A;  4DE0 A;  2VGK A;  3TOI A;  2XGN A;  4GDN A;  1MBL A;  2WYX A;  2X01 A;  2EFU A;  3IWI A;  4Y0U A;  3MXR A;  4OPY A;  3UE0 A;  1FCO A;  4KZ9 A;  3QNC A;  5U47 A;  3JYI A;  4WZ4 A;  2HPB A;  3UPP A;  5EVI A;  4DF6 A;  2HP5 A;  1GCE A;  2V2F F;  4CPK A;  1FQG A;  1FOF A;  3GVB A;  3UE1 A;  5JYP A;  1BLC A;  1GHP A;  4P0M A;  1DJC A;  2XR0 A;  1KGF A;  2XF3 A;  5DF7 A;  5FAT A;  1ZG4 A;  3ZNY A;  5I94 A;  1BUE A;  4JF4 A;  4WZ5 A;  2A49 A;  3G31 A;  4U0X A;  4PM7 A;  3LY3 A;  4WBG A;  3TG9 A;  3NY4 A;  3OPR A;  5CTN A;  4E6W A;  3N8L A;  1M6K A;  5CGS A;  4Q8I A;  2WAE A;  3NIA A;  3BFF A;  3NBL A;  3EQU A;  3HBR A;  1PWD A;  1MWS A;  3I7J A;  4KZ3 A;  4EQI A;  2XK1 A;  3GQZ A;  3IF6 B;  4GN2 A;  1ES4 A;  4XXR A;  1Q2Q A;  5BOH A;  3BFC A;  4R3J A;  4E3L A;  4LV0 A;  1H8Y A;  1NXY A;  3AGE A;  3VP2 A;  4B88 A;  5EOO A;  3BFD A;  3BRM A;  3PBS A;  1YMS A;  2Q9N A;  2ZQ9 A;  3OC2 A;  3PBO A;  4OON A;  2P9V B;  1FSW A;  3A3F A;  2Y2O A;  3ZFZ A;  2ZQD A;  3HLF A;  1EWZ A;  2QPN A;  2V1Z A;  4UA9 A;  4X69 A;  3N7W A;  5DF9 A;  3C4P A;  1ES3 A;  1EI5 A;  2QZ6 A;  4KQQ A;  3VMA A;  1IKI A;  5CER A;  3C4O A;  3S1Y A;  1Y54 A;  2WGW A;  3HLW A;  3MKF A;  3UDI A;  3N6I A;  4R1G A;  1HVB A;  4BD0 A;  2UWX A;  2Y2P A;  4KZ8 A;  2HP9 A;  5FAS A;  5EVI B;  3V39 A;  4FCF A;  4PM6 A;  1ZKJ A;  4EBN A;  2XLN A;  1NYY A;  1K6S A;  3ZDJ A;  1RGY A;  5FQJ A;  5HL1 A;  3A3D A;  3WS1 A;  4E3I A;  3ZHH A;  3ITB A;  1IYP A;  1IYO A;  2HDU A;  3B3X A;  4N1H A;  1ES2 A;  2OV5 A;  5L2F A;  4FH4 A;  2JC7 A;  3SOI A;  5GHY A;  4E3N A;  1NY0 A;  2R9X A;  4MBH A;  5CHJ A;  4HEF A;  3M2J A;  3QNB A;  4N9K A;  5GLC A;  4FH2 A;  2OLU A;  3HLC A;  4OPR A;  4K91 A;  1N9B A;  3HLG A;  3OZH A;  2RCX A;  2Y55 A;  1CI8 A;  4S2N C;  3NDG A;  3IF6 C;  5D3O A;  1W7F A;  5A90 A;  1IYQ A;  4JF5 A;  3E2K A;  4E3K A;  4E3M A;  1DY6 A;  5AQB A;  3UY6 A;  2Q9M A;  4GD8 A;  4LV1 A;  1PYY A;  2Y59 A;  4LEN A;  1GA0 A;  2XQZ A;  4CJN A;  5M18 A;  4EV4 A;  2DCF A;  1PWC A;  1IEM A;  1DJB A;  3QHY A;  3FKV A;  3FZC A;  1W5D A;  2OSU A;  4N9L A;  3BFE A;  2ZC3 B;  1WE4 A;  3IXB A;  1LI0 A;  5DTK A;  3Q82 A;  4WM9 A;  4BJP A;  4X56 A;  3WWX A;  2PBY A;  3SH7 A;  3SS5 A;  1KE0 A;  1K4F A;  4BEN A;  4YIN A;  1XX2 A;  4XUZ A;  5CTM A;  1NZO A;  1E4D A;  4OP8 A;  5AQA A;  5EPH A;  3G2Y A;  4OLD A;  3HLE A;  2XDM A;  2Y2H A;  1JTG A;  2J7V A;  2ZM8 A;  1H5X A;  3SS3 A;  3WRZ A;  2ZC6 B;  2XFT A;  4D2O A;  3OPL A;  1BLS A;  4QU3 A;  1FR6 A;  4WYY A;  3PBR A;  4QY6 A;  4RX3 A;  2WGI A;  4RX2 A;  4HBU A;  4DXC A;  2ZQC A;  3Q7V B;  3HUM A;  3VOY A;  4GD6 A;  4LCL A;  3HRE A;  4GB7 A;  4MBK A;  3LCE A;  2DRW A;  4IBR A;  3WS0 A;  3G4P A;  3A3I A;  4DRT A;  2ZQ7 A;  2ZJ9 A;  4OQ0 A;  3D4F A;  4UA7 A;  3A3E A;  3ITA A;  4KZ4 A;  2ZMA A;  3HL9 A;  1N4O A;  3PBT A;  1W8Y A;  4UHU A;  4NK3 A;  5A92 A;  5F1G A;  3N8S A;  4B4X A;  3SS4 A;  3NI9 A;  3OPP A;  1ERQ A;  4KZA A;  3ZCZ A;  2EXA A;  4IED A;  1FR1 A;  1PIO A;  1ERO A;  1ZC2 A;  4IVK A;  2Z2L B;  1K55 A;  4LV3 A;  4Y0O A;  5F83 A;  3C7V A;  2B5R A;  2X71 A;  5TFQ A;  4KZ7 A;  1FSY A;  1KVM A;  4P87 A;  1YM1 A;  3VP3 A;  2EX6 A;  3LEZ A;  1KE4 A;  3ZG7 B;  5DTT A;  1K55 C;  1PW1 A;  2G2U A;  4ZJ3 A;  5EVL A;  1SDE A;  1TDL A;  4JKT A;  2WKI A;  4KZB A;  3RXX A;  3S4X A;  1YLW A;  4EBP A;  3MKE A;  4IVI A;  4XUX A;  1IYS A;  3Q81 A;  5GLD A;  1XXM A;  4R4S A;  2Y2I A;  4OLG A;  1KVL A;  3PBN A;  3MXS A;  3VOZ A;  5DVA A;  1GA9 A;  1ONH A;  3BLS A;  1SCW A;  5IHV A;  3MZF A;  3O86 A;  2DNS A;  4L0L A;  3M6H A;  3G34 A;  3E2L A;  4PMA A;  4OP5 A;  1S0W A;  1L0F A;  4F94 A;  2JE5 A;  4GDB A;  2WGW B;  3S22 A;  5HFO A;  3GR2 A;  3IF6 A;  2WUQ A;  4N92 A;  2Y2G A;  2ZD8 A;  3UDX A;  1S6R A;  4JBF A;  1YLJ A;  4JXS A;  5FAP A;  5GLA A;  2G2W A;  1M40 A;  2H0T A;  2H5S A;  3GSG A;  3Q1F A;  1BZA A;  4WEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...