4U0TA

Crystal structure of adc-7 beta-lactamase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
357
structure length
357
Chain Sequence
TPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPTDIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTSGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYVVLNAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADC-7 beta-lactamase
publication title Biochemical and Structural Analysis of Inhibitors Targeting the ADC-7 Cephalosporinase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 123
structure length 357
sequence length 357
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4u0tA00
5IHVA 5AQ7A 2ZQCA 3IHAA 2XQZA 3HUOA 1FOFA 1ERMA 5DF7A 4C75A 1ES3A 5GHZA 1RP5A 1H5XA 1KVLA 1DY6A 5E43A 2EX6A 2Y2MA 2H10A 4FH2A 2ZJ9A 5EPHA 4X55A 1MBLA 1CEFA 4GD8A 3BFEA 4S2MA 4ZBEA 2ZM2A 4B4XA 3A3FA 1YMXA 4GDNA 3IXHA 3VP3A 4EWFA 4P0MA 1EWZA 2Y2HA 3GR2A 3OPPA 1KDWA 2Y2OA 2XGNA 4X53A 1NYMA 4BL3A 3IH9A 5DVAA 1BT5A 4PM8A 4R4SA 5HX9A 3HLGA 3GVBA 3IH8A 5D3OA 4U0XA 5HAPA 1IYPA 1Q2PA 1NXYA 4IVIA 3BM6A 4KQQA 2HDSA 4KZ4A 3ZVWA 4QD4A 4IEDA 4ZDXA 4JXWA 3PBSA 4DE2A 1K55A 2V20A 4GN2A 5EOOA 4C3QA 4OQGA 4K0XA 4QU3A 1YT4A 2Y2GA 1IKIA 3IWQA 5CXWA 1YLJA 4JF4A 5E2EA 1PZOA 5I94A 4JKTA 3I7JA 3V5MA 4DE0A 1W8QA 2CC1A 4H8RA 3E2LA 1ERQA 3B3XA 4KZAA 4UA7A 1YLZA 3SOIA 4OP5A 4DKIA 3GV9A 4PMAA 4ZTKA 2OLUA 3PBNA 5TFQA 1ALQA 3ITBA 1H8ZA 2ZC4B 5CGXA 4BD1A 4B4ZA 1SHVA 2V1ZA 4FH4A 4HBTA 4X6TA 5FAOA 5HARA 3SH8A 2XD1A 5EVIC 3ZG7B 1JWZA 3BYDA 1ZG4A 4LCLA 4P87A 4S2LA 5CRFA 2G2UA 5HAIA 3UNWA 3VFFA 2HDRA 2XF3A 4RX3A 5HAQA 3G34A 1PWCA 4Y0OA 4MLLA 5U47A 3MXRA 2PBYA 2FFFB 2DCFA 3PBRA 5E2HA 3LY4A 1YLTA 1LLBA 1K57C 4S2KA 4Z9QA 4PM5A 3IHBA 4FSFA 2Y2IA 2JBFA 3PBTA 3TG9A 5KZHA 3P09A 3OPRA 3EQVA 2J8YA 4KZ7A 4UHUA 1E25A 1TVFA 3TSGA 3G2ZA 5FSRA 3N8RA 1YLPA 1YLWA 4JF5A 1DJAA 4OOYA 5EUAA 1W5DA 4E3OA 1DJBA 5KSCA 1E3UA 1FCMA 5EVLA 2OSUA 3AGDA 4WEJA 1XXMA 3HLCA 3TOIA 2WK0A 1K6SA 4S2OA 4D2OA 4GB7A 5KSHA 1JTGA 1S6RA 1GA0A 2ZQAA 4QHCA 4ZJ1A 1BULA 3HBRA 4LV0A 2WUQA 4Y0UA 4MBFA 4K91A 3UPOA 4P85A 2OLVA 5GLAA 4A5RA 2WGVA 2WADA 1ZKJA 1NZOA 1LHYA 4R23A 1Q2QA 2G2WA 1LI0A 1K6RA 1LI9A 4IVKA 2JE5A 1PYYA 2RL3A 2GDNA 2WAEA 1SDEA 1MWTA 2Y2QA 1HTZA 5M1AA 4OQ0A 1HVBA 3BFCA 3IF6A 1KDSA 3V39A 4S2NA 4JXSA 3O86A 4MBKA 1CI8A 2EFXA 3W4OA 2FFYA 1XGJA 1BTLA 3IXDA 4MBHA 4OPYA 5FI6A 3SH9A 3UY6A 1Y54A 3A3JA 3MZEA 4ZAMA 1ES2A 2PU2A 1CI9A 4FCFA 4KG2A 3VP0A 2Y2NA 1GHPA 4DDYA 1RGZA 4LV3A 1NYYA 1L0DA 3OPHA 2EX2A 5EVID 4HESA 4E3KA 3CMZA 5CHJA 3IF6B 4WMCD 1KE0A 3PTEA 5CGWA 1K4FA 2I72A 5GHXA 2J7VA 4O7DA 1KE4A 4OQIA 4XUXA 4YFMA 2ZD8A 4LV2A 1FR6A 3Q81A 4PM6A 4BL2A 3OCNA 3QHYA 2QZ6A 1JTDA 2WGWA 1PWDA 3HLEA 3LEZA 2IWCA 2Y91A 3OPLA 3WS4A 4F94A 3ITAA 5DF9A 3VOYA 4HBUA 4E3IA 3PBQA 3N8SA 4CJNA 1L0FA 1M6KA 3M2JA 5FQ9A 5AQBA 3V50A 3BFDA 3MKEA 1XP4A 1I2WA 5EOEA 4OQHA 1WE4A 3ZGAB 5FQMA 2Y55A 4EBNA 4R3JA 3IWIA 5GHYA 1QMFA 4GNUA 1K25A 1XPBA 4HEFA 3UE1A 2ZC6B 3PBOA 2ZQ8A 3Q82A 3DTMA 5CTMA 3S22A 3UE0A 4N1XA 2XD5A 3NI9A 5JYPA 4QY5A 5GLDA 4C6YA 1HZOA 4OLGA 3IXBA 4JPMA 4WZ5A 3WS2A 4BJPA 1WYCA 4LENA 3BRMA 3C7VA 3FV7A 3V3RA 4E6XA 2DRWA 3BLSA 1XKZA 4P6BA 4E3JA 5CEDA 1JWPA 1PI4A 2QMIA 1MWUA 2ZC3B 3IWOA 3ZNYA 2EX8A 1K56D 1PZPA 4PM9A 2WYXA 3UDIA 3HUMA 3SS4A 4RA7A 2XR0A 3HLFA 4WYYA 1K54A 3A3IA 3W4QA 4ZJ3A 5M18A 5CTNA 5E2FA 5EVIA 5FI7A 3DWKA 4N9LA 1K55C 2X02A 5A92A 2XH9A 5HFOA 3Q7ZA 5CEBA 5CECA 2Y2PA 3WS1A 3MBZA 4BLMA 5CGSA 1KGFA 1ZG6A 3C4OA 5FATA 3RXXA 1H8YA 4KQOA 1TDGA 3QNBA 5FQQA 5FQIA 1K57A 1KE3A 4MEZA 4ZJ2A 5FAQA 3NDEA 2XK1A 3GQZA 4XXRA 2Q9MA 1BZAA 1CK3A 4EBLA 1RCJA 2BLSA 1LL5A 4OPQA 4GZBA 3OC2A 4S2IA 3S1YA 1YQSA 4RVAA 3PAEA 4X68A 1NRFA 3M2KA 1ES5A 4JBFA 1G68A 2WKHA 2J9OA 1IYSA 3Q1FA 1K38A 2HP6A 1GA9A 4N92A 4XUZA 1LL9A 1NJ4A 2X71A 3NBLA 1BLPA 2PU4A 3ZG8B 2XDMA 1C3BA 2C6WB 5BOHA 1M40A 4DRTA 1MPLA 2P74A 2WAFA 4MNRA 1PWGA 3A3DA 4YINA 1XA7A 1XA1A 4GKUA 4R0QA 1W7FA 3FWLA 4ID4A 3AGEA 4GD6A 3CZDA 2R9XA 1YLYA 1FCOA 1TEMA 1I5QA 4FD8A 4KZ9A 1ESIA 1AXBA 2HP9A 4U3TA 3BLMA 1ESUA 4X56A 5A90A 3MXSA 4WELA 5CHMA 3HL9A 4EUZA 3FZCA 1I2SA 4R4RA 2EXBA 3GRJA 3RXWA 1EI5A 1IYQA 2J9PA 5FQJA 4OPZA 4OONA 3G31A 5GLBA 3W4PA 4GOGA 5FASA 4OLDA 4E3MA 3A3EA 1KVMA 5CERA 5JYOA 4DF6A 4PPRA 2Y2KA 3WS0A 2JCHA 1PW1A 3E2KA 3FKVA 4OVDA 2XFSA 3N7WA 4BENA 5TR7A 3NIAA 1CEGA 2WZZA 2P9VA 1PIOA 3PAGA 3P98A 1FSYA 2HDQA 2ZQ9A 1XX2A 3IF6C 4KG6A 3LCEA 4LCMA 2Q9NA 3OCLA 4M3KA 1S0WA 5CHUA 3D4FA 3FYZA 1Z6FA 2Y4AA 4U0TA 1G6AA 3HREA 1O07A 4E3NA 2OV5A 1GHMA 1ZC2A 2Y59A 3UPNA 2P9VB 3NY4A 4DDSA 3O88A 4JXGA 1FQGA 4OP8A 2VGJA 4GDBA 4DE1A 4OOMA 4N9KA 4QJGA 5HW3A 2EXAA 5F82A 4KZ8A 3LY3A 2WZXA 2ZLYA 4IBRA 4EV4A 1SKFA 4OPRA 4BD0A 3HUNA 3EQUA 2WGWB 1KGGA 2WKIA 3BEBA 2ZC5B 3MFDA 1L0GA 4RYEA 3VMAA 2HPBA 3QNCA 3WS5A 1PW8A 3CG5A 1L2SA 3DW0A 4LV1A 1MWRA 1K4EA 3GTCA 5GLCA 3G4PA 3M6BA 5FI2A 1MXOA 3C5AA 2Y2JA 2ZM0A 1ONHA 3NDGA 3RJUA 3ZCZA 4KENB 3ZVTA 4R3BA 5AQ9A 1SCWA 5E2GA 5EE8A 4OKPA 2HDUA 4N1HA 3IT9A 2ZMAA 1E3UD 5EECA 3VP1A 3VSKA 3VOZA 1DJCA 4WEKA 1NY0A 4X69A 1VQQA 3IF5A 5FA7A 1L0EA 2DNSA 1BSGA 3MZDA 3O3VA 4PM7A 5G18A 2B5RA 4S2JA 4L0LA 1QMEA 1YMSA 2XFTA 1E4DA 4KZ5A 1BUEA 2VGKA 3JYIA 5DF8A 2WKEA 4WZ5C 3IXGA 1IEMA 1GCEA 4WMCA 4NETA 3UPPA 2XEPA 1XGIA 1HD8A 1NZUA 4BQMA 4Y7PA 3G30A 3HVFA 3WWXA 5HL1A 1J9MA 3ZDJA 1IYOA 4IBXA 3UDFA 1ONGA 2QPNA 3HLBA 3N4IA 4JF6A 3G2YA 3UO9A 3V3SA 3AGFA 4DXCA 2EFUA 3ZG0A 1MKIA 1K54C 4UA6A 2IWDA 1SDNA 1W79A 3Q07A 5EVIB 3Q7VA 2IWBA 1GHIA 3G32A 3MKFA 5A93A 3C7UA 4RX2A 3SS5A 1EROA 4Q8IA 4R1GA 3N8LA 1FR1A 1BLSA 3VP2A 2H5SA 1JWVA 5F1FA 3WRZA 5J8XA 3NCKA 1TDLA 1VM1A 4WZ4A 5AQAA 5FDHA 2EX9A 4OOLA 1PI5A 3ZFZA 4NK3A 4KZ6A 1KGEA 3GSGA 3Q7VB 3SH7A 4E6WA 4EQIA 4Y0TA 3N6IA 3LO7A 5TGFA 5L2FA 2ZC7A 1FCNA 2XLNA 2A3UA 4WM9A 4DE3A 1BLCA 1FSWA 4UA9A 4CPKA 3S4XA 1O7EA 2H0YA 1K56A 3BFGA 2R9WA 3GMWA 4B88A 4K0WA 5F83A 3WRTA 2ZQ7A 3ZHHA 5A91A 4EBPA 2ZM8A 2JC7A 2UWXA 3IQAA 2WGIA 1IELA 1U60A 4WBGA 3CJMA 3DWZA 1MY8A 3W8KA 3ZNTA 3M6HA 4KZBA 5DTKA 1ES4A 1IKGA 3UN7A 3BECA 2H0TA 5KMWA 2BG1A 3ZG5A 3OZHA 1MWSA 4KQRA 4KZ3A 3VSLA 2Z2MB 2A49A 5DTTA 5FQKA 4UAAA 1W8YA 4S2PA 1OMEA 2V2FF 2C5WB 3BFFA 4OH0A 2Z2LB 3C4PA 4KG5A 2ZQDA 1RGYA 5M19A 2HP5A 3NC8A 4QB8A 3O87A 1BLHA 5FAPA 2Y2LA 4S2NC 4DXBA 3VFHA 3HLDA 2X01A 3ZG9B 1WYBA 2E8IA 3MZFA 3UE3A 5F1GA 5GL9A 2RCXA 5DTSA 1JVJA 1N4OA 1YM1A 4JLFA 3ISGA 3FKWA 3HLWA 4E3LA 3G35A 3UDXA 4JXVA 3SS3A 4QY6A 1N9BA 3VP4A
chains in the Genus database with same CATH superfamily
5IHVA 4I38A 5AQ7A 1LL8A 3HUOA 5GHZA 4HHDA 1H5XA 4JGOA 4FH2A 1GSXA 1MBLA 3BFEA 5HDCA 4GDNA 3IXHA 1K0KA 3GR2A 3LIFA 5DVAA 2J3WA 3HLGA 4U0XA 5HAPA 1NXYA 4KQQA 3ZVWA 4IEDA 4JXWA 3PBSA 1K55A 2V20A 2H28A 4OQGA 1YT4A 5CXWA 5E2EA 3I7JA 5F68A 3V5MA 4H8RA 4QWOA 1CF0A 3GV9A 4PMAA 2OLUA 3PBNA 1ALQA 4MN5A 2ZC4B 1SHVA 4X6TA 4S2LA 2G2UA 3VFFA 1TS0A 4WN5A 2Y8HA 2GJ3A 3PBRA 4GS9A 4S2KA 3G6OA 1DP6A 2Y2IA 3TG9A 3P09A 3EQVA 2ZBBA 4EU0A 4E3OA 1DJBA 1N9LA 3K3DA 4CLCA 2WK0A 1K6SA 4QHCA 4ZJ1A 4LRZE 4LV0A 2WUQA 2Y79A 4MBFA 4P85A 2OLVA 3W2ZA 4A5RA 2WGVA 1LHYA 1LI0A 1K6RA 3T4QA 1GSWA 2WAEA 2LB5A 2QWSA 1MWTA 2M1CA 3IF6A 1KDSA 4S2NA 4JXSA 3O86A 1CI8A 3W4OA 5FI6A 4H6JB 3UY6A 4EW7A 3F1OB 1NYYA 4E3KA 5FEGA 3IX4A 4MN7A 4OQIA 5J4EA 4YFMA 5EM1A 3Q81A 3BQAA 2QZ6A 1JTDA 3LEZA 2IWCA 4DJ3A 3LR4A 3WS4A 4HBUA 4CJNA 1L0FA 2OWHA 3BWLA 3V50A 2I9VA 1WE4A 3ZGAB 1TD5A 4FOFA 5GHYA 1QMFA 2VX8A 1XPBA 3UE1A 2QHKA 2ZQ8A 3UE0A 1F2KA 5L8MA 5GLDA 3A0VA 1HZOA 3WS2A 4BJPA 1WYCA 1Z09A 2DRWA 4P6BA 1XKZA 4E3JA 2PYRA 2EX8A 3UDIA 4I3IA 3MMHA 4HI4A 4WYYA 3NOUC 3W4QA 2KLIA 3CITA 3DWKA 2X02A 2W0NA 5HFOA 5C5KA 3WS1A 3MBZA 4BLMA 1KGFA 1ZG6A 3C4OA 4F3LA 3MSHA 1H8YA 5FQQA 1KE3A 5FAQA 2Q9MA 3IBJA 4EBLA 1RCJA 4R38A 2BLSA 4NXEA 4OPQA 3OC2A 4RVAA 3PAEA 3T1SA 3C30A 2QYBA 1S4RA 4XUZA 3NBLA 1P9WA 2C6WB 5BOHA 3F1PA 1MPLA 2P74A 3MQQA 1ODVA 3A3DA 3NOPC 1XA7A 3H82A 4WUJA 4R0QA 3E4QA 3AGEA 5L10A 1I5QA 1AXBA 2HP9A 4U3TA 2PD7A 4X56A 3U4LP 3MXSA 4WELA 5CHMA 3UMDA 2EXBA 2YKHA 3JVVA 2VGLM 5FQJA 3G31A 5GLBA 4GOGA 1L3LA 5TBMA 4OVDA 2W27A 1LSXA 3NIAA 5FEFA 3P98A 2JKFA 5HWTA 1XX2A 4Y17A 4KG6A 2Q9NA 4Q0JA 2WKQA 4LLOB 4R70A 3D4FA 3FYZA 1Z6FA 2VJWA 1O07A 1GHMA 1ZC2A 3MJQA 3NY4A 4DDSA 4ESPA 4JXGA 4OP8A 1FQGA 2VGJA 4N9KA 5HW3A 4LRYC 2EXAA 2ZLYA 5IT5A 3EQUA 4BBUA 1TS7A 1KGGA 1YKDA 3T50A 2ZC5B 1L0GA 4RYEA 5HD3A 3VMAA 2HPBA 3CG5A 2A24B 2JKTM 3PXPA 3M6BA 2PYPA 1MXOA 3RJUA 3NDGA 4KENB 3BJNA 3KYEA 1MC0A 1E3UD 3VSKA 3VOZA 1DJCA 5FA7A 1BSGA 5G18A 1IOUA 1Y28A 2XFTA 3DTKA 1E4DA 4B93A 2VGKA 2WKEA 4WZ5C 2ZMVA 3BQ8A 3H7WB 1HD8A 1NZUA 3LUQA 3G30A 1IYOA 4G3KA 2UV0E 3P7NA 2J3TC 4GHIB 1MKIA 1SDNA 3OBFA 3Q07A 4ARZA 2O0YA 3RFBA 3LYXA 1FR1A 3VP2A 2NUTC 3WRZA 1TDLA 3HJKA 1PI5A 3LR5A 4KZ6A 4EQIA 1F9IA 1OTEA 3B47A 2XLNA 1SKOA 1JNUA 3TRCA 4DE3A 4UA9A 1O7EA 5HWWA 3BFGA 2R9WA 4K0WA 5DJUA 2ZQ7A 3ZHHA 1S67L 4EXOA 4KUOA 4EBPA 1IELA 4ME4A 5DTKA 3UN7A 4Y2FA 5L07A 3ZG5A 3OZHA 4KQRA 1S4SA 2WKPA 5HPIA 5DTTA 5FQKA 3LEQA 2C5WB 2Z2LB 1RGYA 2HP5A 3S7PA 5J7EA 2V8CA 2KDKA 3F1NB 2KX6A 3PHYA 3S7QA 5F1GA 3MQ0A 5GL9A 2BTFP 1N4OA 3HLWA 3UDXA 4JXVA 4QY6A 2ZQCA 3IHAA 2XQZA 3CHWP 1OTAA 1KVLA 5EV0A 1ZTUA 2Y2MA 3QP6A 5EPHA 1CEFA 4CLCE 4GD8A 4ZRRA 4B4XA 3A3FA 4EWFA 3LFVA 4II7A 3UB9A 3OPPA 4BL3A 4PM8A 5HX9A 2V8FA 2HDSA 2PT7A 3T4TA 4QD4A 1OTIA 4GN2A 4KUKA 5HPFA 5EOOA 4QU3A 5KIZA 3NHQA 3LR3A 4DE0A 3IS2B 1W8QA 2CC1A 3E2LA 4KZAA 4UA7A 3RH8B 1YLZA 3ITBA 3KSIA 4B4ZA 5FAOA 4HBTA 4WLAA 4ETZA 2XD1A 5EVIC 4P87A 5CRFA 3UNWA 3SZTA 4RX3A 5HAQA 3T1RA 1OJGA 2P7JA 2JHEA 4Y0OA 4MLLA 2QJ5A 3LY4A 1YLTA 1LLBA 4WL9A 5EVEA 3PBTA 5KZHA 3A0RA 4KZ7A 4XT2A 2PHYA 4GJ4A 3FPWA 3KSHA 4B9OA 5EUAA 4NG2A 3AGDA 3LI8A 4WEJA 1A0KA 4S2OA 1S6RA 1GA0A 1BULA 3HBRA 4I5SA 2GX5A 3R7WB 2WADA 1ZKJA 1NZOA 4HP9A 1Q2QA 2LB9A 1LI9A 4P6ZS 2JE5A 1PYYA 4X25A 1SDEA 5M1AA 2Y2QA 3CUEC 2XSSA 3GDIA 4YWZA 1HVBA 4Y3IA 1P9RA 3V39A 4MBKA 1XGJA 1BTLA 2Z6CA 3IXDA 4MBHA 3T1XA 3MZEA 3OLOA 1CI9A 3PTEA 2I72A 1OTBA 3H9WA 1KE4A 2ZD8A 4BL2A 3OCNA 3QHYA 3OPLA 5DF9A 2W1RA 3MKEA 3CI6A 1XP4A 2K2NA 4EBNA 5DKLA 1F5MA 2XA7S 2ZC6B 3DTMA 1D7EA 2XD5A 1CJFA 3K3CA 4JPMA 4I3JA 2W1TA 3BRMA 3C7VA 1YAXA 4LENA 3V3RA 3VE4A 5A8BA 5HSQA 1JWPA 1MWUA 2ZC3B 3H7WA 4PM9A 2WYXA 4NXGA 4FTXA 2A2LA 4RA7A 5AJGA 3HLFA 3TE8A 3UB8A 1YPRA 5CTNA 5FI7A 4N9LA 1K55C 5A92A 2XH9A 4UQIS 3E4OA 2QJ7A 5FATA 3QNBA 4AFIA 4ZJ2A 2XK1A 4XXRA 2K7SA 3S1YA 1PNEA 3M2KA 3GECA 2WKHA 3Q1FA 1K38A 1LL9A 2X71A 1BLPA 2VGLS 2P08A 2XDMA 5HDDA 1LSVA 1M40A 2V9AA 4ID4A 4GD6A 1V9YA 3CZDA 2R9XA 1FCOA 3EGDC 1ESUA 5A90A 2VK3A 4EUZA 4DN0A 3GRJA 3RXWA 5FASA 2VV8A 4E3MA 4BMWA 3A3EA 5JYOA 4PPRA 1S66L 5K5BA 3B42A 4BENA 1VEUA 5TR7A 1CEGA 2P9VA 4X1LA 2EWVA 1V9ZA 2HDQA 2ZQ9A 3IF6C 3A0SA 1NLZA 2FH5A 3E0YA 5CHUA 3RTYA 2DMWA 4U0TA 1G6AA 2OV5A 2Y59A 4X1MA 3O88A 3E98A 4GDBA 4HH3A 4JGQA 5F82A 4KZ8A 2WZXA 4EV4A 4OPRA 4BD0A 3ZQ5A 2WKIA 3BEBA 4LGWA 3QNCA 1MWRA 5GLCA 3G4PA 5FI2A 1VETB 3ZVTA 1ONHA 1S1YA 5AQ9A 1SCWA 3PYPA 4BBVA 5E2GA 2V0UA 4N1HA 3IT9A 5EECA 1VQQA 2YKFA 2PR5A 4Q0HA 4HQAA 2L0WA 3CWFA 3DBAA 3C38A 4S2JA 4L0LA 3JYIA 2ZL1A 2OAP1 3IXGA 3HCYA 2OOLA 2J80A 1DP8A 4BQMA 3WWXA 2BASA 4IBXA 3UDFA 1ONGA 3N4IA 4KQDA 3UO9A 2INWA 3FG8A 4UA6A 3SOIA 5EVIB 2IWDA 3Q7VA 3MKFA 5A93A 1EROA 1T1BA 4R1GA 3N8LA 2H5SA 4I39A 3BY8A 1JWVA 2B02A 3NCKA 1VM1A 4WZ4A 4OOLA 2PD8A 3SH7A 4E6WA 3N6IA 3LO7A 3C8CA 2O9CA 1DRMA 2QKPA 1FSWA 2D02A 3S4XA 2H0YA 4B88A 2WKRA 5F83A 4EERA 5TJJA 3IQAA 4WBGA 2L4RA 3DWZA 4HP4A 3M6HA 1IKGA 2XROA 3BECA 2O9BA 5KMWA 4G3VA 4QPRA 3CAXA 3VSLA 2Z2MB 4UEYA 1W8YA 3BFFA 3CPTA 3C4PA 3UB5P 1T19A 3O87A 1LT0A 3VFHA 5J3WA 2JKTI 2X01A 2E8IA 2J3TD 2RCXA 1DP9A 3KSGA 1JVJA 3MQOA 1NWZA 3FKWA 3VV4A 3VP4A 3SW1A 2W3HA 1ES3A 4EETB 5DFXA 1DY6A 3UE6A 2EX6A 3MS6A 2H10A 4X55A 1YSQA 4S2MA 5LBRA 2ZM2A 3VP3A 4P0MA 3LICA 1EWZA 2Y2OA 2XGNA 3QP8A 4R4SA 3IH8A 1IYPA 1Q2PA 4IVIA 3BM6A 3T1QB 1H8MA 4RQ9A 4HJ4A 4HIAA 2PAVP 4K0XA 2Y2GA 2L1MA 4YOFA 1PZOA 5I94A 3B3XA 4DKIA 4OP5A 4I3AA 5TFQA 4M4XA 4BD1A 2V1ZA 4FH4A 5HARA 3ZCZA 3ZG7B 2MJ6A 3BYDA 4L9GA 5HAIA 2XF3A 3G34A 1PWCA 3LIBA 4MCWA 2PBYA 1K57C 4LRXC 4PM5A 3D72A 4FSFA 2JBFA 2W3FA 1OTDA 1XFQA 4E04A 1E25A 3MFXA 3G2ZA 5FSRA 3N8RA 1YLPA 1YLWA 1DJAA 1W5DA 1E3UA 5EVLA 4PHTA 3HLCA 4D2OA 4GB7A 5KSHA 4K91A 2W3GA 5GLAA 5HZHA 4H6JA 2G2WA 3F1OA 4IVKA 2VLGA 2GDNA 4K08A 1HTZA 1D1JA 2EA9A 2EFXA 3SH9A 4OPYA 1Y54A 4IUHA 4ZAMA 1ES2A 2Y2NA 3P01A 1GHPA 4LPZA 4DDYA 1FILA 2FZ0A 3OPHA 5EVID 4R3AA 4HESA 5CHJA 3IF6B 1S1ZA 4WMCD 1KE0A 5CGWA 1K4FA 5GHXA 3JPUA 4XUXA 4PM6A 5HDSA 1PWDA 3HLEA 2Y91A 5IU1A 3QP4A 5G4ZA 4F94A 3ITAA 4E3IA 3N8SA 3M2JA 5FQ9A 2CMNA 3VOLA 1G5UA 1VETA 1UWPX 5FQMA 1T1CA 4JGRA 2KOIA 5EFWA 3Q82A 5MC7A 4N1XA 4O0PA 3NI9A 4QY5A 1MZUA 1SZVA 3IXBA 4E6XA 3D9YA 5CEDA 1PI4A 1MKMA 4BWIA 2QMIA 3IWOA 3LIDA 1K56D 3MF0A 1PZPA 3SS4A 1K54A 2Z6DA 5M18A 5E2FA 5EVIA 3Q7ZA 4EEUA 5CECA 3T4OA 5CGSA 3RXXA 4KQOA 1TDGA 3KO6A 5AVEA 1CK3A 5EM0A 4GW9A 1LL5A 4EQ1A 4S2IA 4X68A 1NRFA 4JBFA 4F3LB 2J9OA 1IYSA 1GA9A 3CLOA 3HJIA 2WAFA 1PWGA 4YINA 4GKUA 3FWLA 3EOIA 1YLYA 1ESIA 2V1BA 3KSFA 1YSPA 2JN7A 1P0ZA 3HL9A 3CUEA 1XFNA 1I2SA 3F1PB 3FZCA 2J9PA 4OPZA 3W4PA 1KVMA 2JCHA 3FKVA 5G4YA 3UMEA 2WZZA 3PAGA 1FSYA 1NRJA 2JKRI 3LCEA 4LCMA 2PBDP 5FL3A 3LR0A 4M3KA 1S0WA 5TBMB 2A24A 2O9AA 3TJZC 3UB6A 1W63Q 5L09A 3PR6A 2P04A 3LY3A 1SKFA 3HUNA 2JKRM 2WGWB 4IHQA 4ETXA 1XJ6A 1STZA 4LV1A 1L2SA 5HWVA 1K4EA 3NULA 1ZHHB 2Y2JA 2ZM0A 3ULFA 3ZYTA 1OJ5A 3BY9A 4OKPA 2HDUA 3T4KA 2ZMAA 2VKSA 4D60A 1XJ2A 1N9OA 4X69A 4WEKA 1NY0A 4Y13A 2PDRA 3L9KA 4CLCD 2DNSA 3MZDA 3O3VA 3IX8A 1YMSA 3IBRA 4KZ5A 4L9FA 4GHIA 2VA0A 4NETA 1XGIA 3C2WA 4Y7PA 3E4PA 3HLBA 4JF6A 3G2YA 2GNXA 2EFUA 3ZG0A 1W79A 1GHIA 3EEAA 3T12B 4RX2A 3SS5A 1BLSA 1H0MA 5F1FA 1FIKA 3FC7A 5AQAA 2EX9A 3ZFZA 4NK3A 1KGEA 4ARZB 4Y0TA 2ZC7A 1BYWA 5A91A 3O5YA 4CLCC 2ZM8A 2UWXA 2WGIA 3CJMA 2IA2A 1MY8A 2PRFA 1SKOB 1ES4A 3F1NA 1GSVA 2BG1A 1MWSA 2M7VA 5IS1A 2A49A 4LFUA 2JKGA 4OH0A 1TS6A 4KG5A 2ZQDA 4Z1WA 1G6OA 4QB8A 1BLHA 5DKKA 5FAPA 4S2NC 4HJ6A 5F69A 3HLDA 5AVFA 3MZFA 5DTSA 1YM1A 3G35A 4P6ZM 3DW0A 2D01A 3L7HA 1FOFA 1ERMA 5DF7A 4C75A 1RP5A 4IJGA 5E43A 3FPVA 2ZJ9A 3QP2A 1W63M 1ACFA 1TF1A 4ZBEA 1YMXA 1NLYA 2Y2HA 1KDWA 4X53A 1NYMA 3IH9A 3IS2A 1BT5A 1N9NA 3GVBA 5D3OA 2VEAA 5I5LA 4KZ4A 4ZDXA 4DE2A 4C3QA 1IKIA 3IWQA 1YLJA 4JF4A 1H3QA 4JKTA 3DTIA 2XA7M 4Q0IA 1ERQA 4ZTKA 4GCZA 1H8ZA 2K31A 5CGXA 3SH8A 1JWZA 1ZG4A 4LCLA 2HDRA 5U47A 3MXRA 5E2HA 2FFFB 2DCFA 3TW8A 4Z9QA 3IHBA 2R78A 4FUWA 3IX3A 3OPRA 2J8YA 4UHUA 1TVFA 3TSGA 3R7WA 1PFLA 1OT9A 4JF5A 4OOYA 1P97A 5KSCA 2HGVA 4UQIM 1FCMA 5DJTA 2OSUA 2G7UA 1XXMA 3TOIA 1UGUA 4PKYG 1JTGA 2ZQAA 3B33A 4XT2B 4Y0UA 3UPOA 2OAQ1 4R23A 3S7OA 2PR6A 3T4JA 2RL3A 4OQ0A 3NJAA 3BFCA 5FDSA 2VV7A 2FFYA 1LSWA 3A3JA 2PU2A 4FCFA 4KG2A 3VP0A 3QP1A 1RGZA 4LV3A 1L0DA 2EX2A 3CMZA 3EGXC 1TS8A 2J7VA 4O7DA 3LI9A 3U2AA 4EESA 4LV2A 1FR6A 4CQHA 2WGWA 4O8GA 2EWWA 4MDZA 3VOYA 1Y4OA 3PBQA 1M6KA 5AQBA 4NXBA 3BFDA 1VHMA 1I2WA 5EOEA 4OQHA 2ZMFA 2HF6A 3LGOA 2V1AA 2Y55A 3ICYA 4R3JA 3IWIA 2ZOIA 4GNUA 1K25A 4HEFA 3PBOA 1D06A 5CTMA 3S22A 3KYQA 4PKYA 5JYPA 1PRQA 4C6YA 4OLGA 4WZ5A 2ZOHA 5F6AA 3FV7A 2OWJA 3KX0X 3T4SA 3BLSA 3ZNYA 4MN6A 2GZAA 3HUMA 2XR0A 4JGPA 3K2NA 3V67A 3A3IA 4ZJ3A 2W1TB 3VE3A 1IFQA 1OPXA 5CEBA 2Y2PA 2ACGA 5FQIA 3NOTC 1K57A 4MEZA 3NDEA 3GQZA 1BZAA 4HJ3A 4GZBA 4DMZA 1YQSA 4GLQA 1ES5A 1G68A 3R4KA 2HP6A 4N92A 3OOVA 4GS9B 1NJ4A 2PU4A 3ZG8B 1C3BA 4DRTA 2VZWA 4MNRA 4DJ2A 3LIEA 1XA1A 3QP5A 1W7FA 3LIAA 1TEMA 4KZ9A 4FD8A 4BBTA 3BLMA 4MMNA 3DAVA 4O01A 4CLCB 1VB6A 4R4RA 1UWNX 1EI5A 1IYQA 4OONA 4EEPA 4OLDA 4HY8A 2HZ5A 5CERA 4DF6A 2Y2KA 2O99A 3WS0A 4NXFA 1PW1A 3E2KA 2XFSA 3N7WA 1T18A 1PIOA 4NKPA 3OCLA 5F5YA 3D3OA 2Y4AA 2NUPC 3HREA 1VEUB 4E3NA 3UPNA 2P9VB 2W3EA 4DE1A 4OOMA 5HD5A 3JVUA 4QJGA 1J3WA 1HLUP 4IBRA 2W3DA 4Y15A 3MFDA 3WS5A 3UB7A 5HL6A 1PW8A 3GTCA 3C5AA 2B18A 4R3BA 2HJ9C 5EE8A 2VV6A 4Y5FA 2HJEA 3BW6A 2HV1A 3DTEA 3VP1A 3IF5A 1L0EA 1EW0A 4PM7A 2XRNA 2B5RA 1QMEA 4R6LA 1BUEA 1XJ4A 2V0WA 5DF8A 1IEMA 1GCEA 4WMCA 3UPPA 2XEPA 2AVXA 3HVFA 4IUKA 3EEHA 5HL1A 1J9MA 3ZDJA 2QPNA 4NEED 3V3SA 3AGFA 4DXCA 3S7NA 2IWBA 1K54C 2ZL1B 3G32A 3C7UA 1XJ3A 4Q8IA 4HH2A 4HNBA 1KOUA 2E8JA 5J8XA 4WF0A 5FDHA 3GSGA 3Q7VB 5TGFA 5L2FA 1FCNA 4HOIA 3T4LA 2B95A 4YNRA 2A3UA 4WM9A 1BLCA 1X0OA 4CPKA 1K56A 3GMWA 3NECA 5DFYA 3WRTA 5CX7A 2JC7A 4EUVA 3H82B 1WA9A 1U60A 3EWKA 3W8KA 3ZNTA 4KZBA 3MXQA 2H0TA 1OT6A 4G3WA 4KZ3A 1G28A 1AWIA 3KYZA 4UAAA 4S2PA 1OMEA 2V2FF 4PAUA 5M19A 3NC8A 2Y2LA 4L9EA 3MR0A 4DXBA 3ZG9B 1T1AA 1WYBA 3UE3A 2Q0OA 1CQAA 2M7UA 1F98A 3CPTB 4JLFA 3ISGA 4E3LA 3SS3A 1N9BA
chains in the Genus database with same CATH topology
5IHVA 5AQ7A 2ZQCA 3IHAA 2XQZA 3HUOA 1FOFA 1ERMA 5DF7A 4C75A 1ES3A 5GHZA 1RP5A 1H5XA 1KVLA 1DY6A 5E43A 2EX6A 2Y2MA 2H10A 4FH2A 2ZJ9A 5EPHA 4X55A 1MBLA 1CEFA 4GD8A 3BFEA 4S2MA 4ZBEA 2ZM2A 4B4XA 3A3FA 1YMXA 4GDNA 3IXHA 3VP3A 4EWFA 4P0MA 1EWZA 2Y2HA 3GR2A 3OPPA 1KDWA 2Y2OA 2XGNA 4X53A 1NYMA 4BL3A 3IH9A 5DVAA 1BT5A 4PM8A 4R4SA 5HX9A 3HLGA 3GVBA 3IH8A 5D3OA 4U0XA 5HAPA 1IYPA 1Q2PA 1NXYA 4IVIA 3BM6A 4KQQA 2HDSA 4KZ4A 3ZVWA 4QD4A 4IEDA 4ZDXA 4JXWA 3PBSA 4DE2A 1K55A 2V20A 4GN2A 5EOOA 4C3QA 4OQGA 4K0XA 4QU3A 1YT4A 2Y2GA 1IKIA 3IWQA 5CXWA 1YLJA 4JF4A 5E2EA 1PZOA 5I94A 4JKTA 3I7JA 3V5MA 4DE0A 1W8QA 2CC1A 4H8RA 3E2LA 1ERQA 3B3XA 4KZAA 4UA7A 1YLZA 3SOIA 4OP5A 4DKIA 3GV9A 4PMAA 4ZTKA 2OLUA 3PBNA 5TFQA 1ALQA 3ITBA 1H8ZA 2ZC4B 5CGXA 4BD1A 4B4ZA 1SHVA 2V1ZA 4FH4A 4HBTA 4X6TA 5FAOA 5HARA 3SH8A 2XD1A 5EVIC 3ZG7B 1JWZA 3BYDA 1ZG4A 4LCLA 4P87A 4S2LA 5CRFA 2G2UA 5HAIA 3UNWA 3VFFA 2HDRA 2XF3A 4RX3A 5HAQA 3G34A 1PWCA 4Y0OA 4MLLA 5U47A 3MXRA 2PBYA 2FFFB 2DCFA 3PBRA 5E2HA 3LY4A 1YLTA 1LLBA 1K57C 4S2KA 4Z9QA 4PM5A 3IHBA 4FSFA 2Y2IA 2JBFA 3PBTA 3TG9A 5KZHA 3P09A 3OPRA 3EQVA 2J8YA 4KZ7A 4UHUA 1E25A 1TVFA 3TSGA 3G2ZA 5FSRA 3N8RA 1YLPA 1YLWA 4JF5A 1DJAA 4OOYA 5EUAA 1W5DA 4E3OA 1DJBA 5KSCA 1E3UA 1FCMA 5EVLA 2OSUA 3AGDA 4WEJA 1XXMA 3HLCA 3TOIA 2WK0A 1K6SA 4S2OA 4D2OA 4GB7A 5KSHA 1JTGA 1S6RA 1GA0A 2ZQAA 4QHCA 4ZJ1A 1BULA 3HBRA 4LV0A 2WUQA 4Y0UA 4MBFA 4K91A 3UPOA 4P85A 2OLVA 5GLAA 4A5RA 2WGVA 2WADA 1ZKJA 1NZOA 1LHYA 4R23A 1Q2QA 2G2WA 1LI0A 1K6RA 1LI9A 4IVKA 2JE5A 1PYYA 2RL3A 2GDNA 2WAEA 1SDEA 1MWTA 2Y2QA 1HTZA 5M1AA 4OQ0A 1HVBA 3BFCA 3IF6A 1KDSA 3V39A 4S2NA 4JXSA 3O86A 4MBKA 1CI8A 2EFXA 3W4OA 2FFYA 1XGJA 1BTLA 3IXDA 4MBHA 4OPYA 5FI6A 3SH9A 3UY6A 1Y54A 3A3JA 3MZEA 4ZAMA 1ES2A 2PU2A 1CI9A 4FCFA 4KG2A 3VP0A 2Y2NA 1GHPA 4DDYA 1RGZA 4LV3A 1NYYA 1L0DA 3OPHA 2EX2A 5EVID 4HESA 4E3KA 3CMZA 5CHJA 3IF6B 4WMCD 1KE0A 3PTEA 5CGWA 1K4FA 2I72A 5GHXA 2J7VA 4O7DA 1KE4A 4OQIA 4XUXA 4YFMA 2ZD8A 4LV2A 1FR6A 3Q81A 4PM6A 4BL2A 3OCNA 3QHYA 2QZ6A 1JTDA 2WGWA 1PWDA 3HLEA 3LEZA 2IWCA 2Y91A 3OPLA 3WS4A 4F94A 3ITAA 5DF9A 3VOYA 4HBUA 4E3IA 3PBQA 3N8SA 4CJNA 1L0FA 1M6KA 3M2JA 5FQ9A 5AQBA 3V50A 3BFDA 3MKEA 1XP4A 1I2WA 5EOEA 4OQHA 1WE4A 3ZGAB 5FQMA 2Y55A 4EBNA 4R3JA 3IWIA 5GHYA 1QMFA 4GNUA 1K25A 1XPBA 4HEFA 3UE1A 2ZC6B 3PBOA 2ZQ8A 3Q82A 3DTMA 5CTMA 3S22A 3UE0A 4N1XA 2XD5A 3NI9A 5JYPA 4QY5A 5GLDA 4C6YA 1HZOA 4OLGA 3IXBA 4JPMA 4WZ5A 3WS2A 4BJPA 1WYCA 4LENA 3BRMA 3C7VA 3FV7A 3V3RA 4E6XA 2DRWA 3BLSA 1XKZA 4P6BA 4E3JA 5CEDA 1JWPA 1PI4A 2QMIA 1MWUA 2ZC3B 3IWOA 3ZNYA 2EX8A 1K56D 1PZPA 4PM9A 2WYXA 3UDIA 3HUMA 3SS4A 4RA7A 2XR0A 3HLFA 4WYYA 1K54A 3A3IA 3W4QA 4ZJ3A 5M18A 5CTNA 5E2FA 5EVIA 5FI7A 3DWKA 4N9LA 1K55C 2X02A 5A92A 2XH9A 5HFOA 3Q7ZA 5CEBA 5CECA 2Y2PA 3WS1A 3MBZA 4BLMA 5CGSA 1KGFA 1ZG6A 3C4OA 5FATA 3RXXA 1H8YA 4KQOA 1TDGA 3QNBA 5FQQA 5FQIA 1K57A 1KE3A 4MEZA 4ZJ2A 5FAQA 3NDEA 2XK1A 3GQZA 4XXRA 2Q9MA 1BZAA 1CK3A 4EBLA 1RCJA 2BLSA 1LL5A 4OPQA 4GZBA 3OC2A 4S2IA 3S1YA 1YQSA 4RVAA 3PAEA 4X68A 1NRFA 3M2KA 1ES5A 4JBFA 1G68A 2WKHA 2J9OA 1IYSA 3Q1FA 1K38A 2HP6A 1GA9A 4N92A 4XUZA 1LL9A 1NJ4A 2X71A 3NBLA 1BLPA 2PU4A 3ZG8B 2XDMA 1C3BA 2C6WB 5BOHA 1M40A 4DRTA 1MPLA 2P74A 2WAFA 4MNRA 1PWGA 3A3DA 4YINA 1XA7A 1XA1A 4GKUA 4R0QA 1W7FA 3FWLA 4ID4A 3AGEA 4GD6A 3CZDA 2R9XA 1YLYA 1FCOA 1TEMA 1I5QA 4FD8A 4KZ9A 1ESIA 1AXBA 2HP9A 4U3TA 3BLMA 1ESUA 4X56A 5A90A 3MXSA 4WELA 5CHMA 3HL9A 4EUZA 3FZCA 1I2SA 4R4RA 2EXBA 3GRJA 3RXWA 1EI5A 1IYQA 2J9PA 5FQJA 4OPZA 4OONA 3G31A 5GLBA 3W4PA 4GOGA 5FASA 4OLDA 4E3MA 3A3EA 1KVMA 5CERA 5JYOA 4DF6A 4PPRA 2Y2KA 3WS0A 2JCHA 1PW1A 3E2KA 3FKVA 4OVDA 2XFSA 3N7WA 4BENA 5TR7A 3NIAA 1CEGA 2WZZA 2P9VA 1PIOA 3PAGA 3P98A 1FSYA 2HDQA 2ZQ9A 1XX2A 3IF6C 4KG6A 3LCEA 4LCMA 2Q9NA 3OCLA 4M3KA 1S0WA 5CHUA 3D4FA 3FYZA 1Z6FA 2Y4AA 4U0TA 1G6AA 3HREA 1O07A 4E3NA 2OV5A 1GHMA 1ZC2A 2Y59A 3UPNA 2P9VB 3NY4A 4DDSA 3O88A 4JXGA 1FQGA 4OP8A 2VGJA 4GDBA 4DE1A 4OOMA 4N9KA 4QJGA 5HW3A 2EXAA 5F82A 4KZ8A 3LY3A 2WZXA 2ZLYA 4IBRA 4EV4A 1SKFA 4OPRA 4BD0A 3HUNA 3EQUA 2WGWB 1KGGA 2WKIA 3BEBA 2ZC5B 3MFDA 1L0GA 4RYEA 3VMAA 2HPBA 3QNCA 3WS5A 1PW8A 3CG5A 1L2SA 3DW0A 4LV1A 1MWRA 1K4EA 3GTCA 5GLCA 3G4PA 3M6BA 5FI2A 1MXOA 3C5AA 2Y2JA 2ZM0A 1ONHA 3NDGA 3RJUA 3ZCZA 4KENB 3ZVTA 4R3BA 5AQ9A 1SCWA 5E2GA 5EE8A 4OKPA 2HDUA 4N1HA 3IT9A 2ZMAA 1E3UD 5EECA 3VP1A 3VSKA 3VOZA 1DJCA 4WEKA 1NY0A 4X69A 1VQQA 3IF5A 5FA7A 1L0EA 2DNSA 1BSGA 3MZDA 3O3VA 4PM7A 5G18A 2B5RA 4S2JA 4L0LA 1QMEA 1YMSA 2XFTA 1E4DA 4KZ5A 1BUEA 2VGKA 3JYIA 5DF8A 2WKEA 4WZ5C 3IXGA 1IEMA 1GCEA 4WMCA 4NETA 3UPPA 2XEPA 1XGIA 1HD8A 1NZUA 4BQMA 4Y7PA 3G30A 3HVFA 3WWXA 5HL1A 1J9MA 3ZDJA 1IYOA 4IBXA 3UDFA 1ONGA 2QPNA 3HLBA 3N4IA 4JF6A 3G2YA 3UO9A 3V3SA 3AGFA 4DXCA 2EFUA 3ZG0A 1MKIA 1K54C 4UA6A 2IWDA 1SDNA 1W79A 3Q07A 5EVIB 3Q7VA 2IWBA 1GHIA 3G32A 3MKFA 5A93A 3C7UA 4RX2A 3SS5A 1EROA 4Q8IA 4R1GA 3N8LA 1FR1A 1BLSA 3VP2A 2H5SA 1JWVA 5F1FA 3WRZA 5J8XA 3NCKA 1TDLA 1VM1A 4WZ4A 5AQAA 5FDHA 2EX9A 4OOLA 1PI5A 3ZFZA 4NK3A 4KZ6A 1KGEA 3GSGA 3Q7VB 3SH7A 4E6WA 4EQIA 4Y0TA 3N6IA 3LO7A 5TGFA 5L2FA 2ZC7A 1FCNA 2XLNA 2A3UA 4WM9A 4DE3A 1BLCA 1FSWA 4UA9A 4CPKA 3S4XA 1O7EA 2H0YA 1K56A 3BFGA 2R9WA 3GMWA 4B88A 4K0WA 5F83A 3WRTA 2ZQ7A 3ZHHA 5A91A 4EBPA 2ZM8A 2JC7A 2UWXA 3IQAA 2WGIA 1IELA 1U60A 4WBGA 3CJMA 3DWZA 1MY8A 3W8KA 3ZNTA 3M6HA 4KZBA 5DTKA 1ES4A 1IKGA 3UN7A 3BECA 2H0TA 5KMWA 2BG1A 3ZG5A 3OZHA 1MWSA 4KQRA 4KZ3A 3VSLA 2Z2MB 2A49A 5DTTA 5FQKA 4UAAA 1W8YA 4S2PA 1OMEA 2V2FF 2C5WB 3BFFA 4OH0A 2Z2LB 3C4PA 4KG5A 2ZQDA 1RGYA 5M19A 2HP5A 3NC8A 4QB8A 3O87A 1BLHA 5FAPA 2Y2LA 4S2NC 4DXBA 3VFHA 3HLDA 2X01A 3ZG9B 1WYBA 2E8IA 3MZFA 3UE3A 5F1GA 5GL9A 2RCXA 5DTSA 1JVJA 1N4OA 1YM1A 4JLFA 3ISGA 3FKWA 3HLWA 4E3LA 3G35A 3UDXA 4JXVA 3SS3A 4QY6A 1N9BA 3VP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHV A;  5AQ7 A;  2ZQC A;  3IHA A;  2XQZ A;  3HUO A;  1FOF A;  1ERM A;  5DF7 A;  4C75 A;  1ES3 A;  5GHZ A;  1RP5 A;  1H5X A;  1KVL A;  1DY6 A;  5E43 A;  2EX6 A;  2Y2M A;  2H10 A;  4FH2 A;  2ZJ9 A;  5EPH A;  4X55 A;  1MBL A;  1CEF A;  4GD8 A;  3BFE A;  4S2M A;  4ZBE A;  2ZM2 A;  4B4X A;  3A3F A;  1YMX A;  4GDN A;  3IXH A;  3VP3 A;  4EWF A;  4P0M A;  1EWZ A;  2Y2H A;  3GR2 A;  3OPP A;  1KDW A;  2Y2O A;  2XGN A;  4X53 A;  1NYM A;  4BL3 A;  3IH9 A;  5DVA A;  1BT5 A;  4PM8 A;  4R4S A;  5HX9 A;  3HLG A;  3GVB A;  3IH8 A;  5D3O A;  4U0X A;  5HAP A;  1IYP A;  1Q2P A;  1NXY A;  4IVI A;  3BM6 A;  4KQQ A;  2HDS A;  4KZ4 A;  3ZVW A;  4QD4 A;  4IED A;  4ZDX A;  4JXW A;  3PBS A;  4DE2 A;  1K55 A;  2V20 A;  4GN2 A;  5EOO A;  4C3Q A;  4OQG A;  4K0X A;  4QU3 A;  1YT4 A;  2Y2G A;  1IKI A;  3IWQ A;  5CXW A;  1YLJ A;  4JF4 A;  5E2E A;  1PZO A;  5I94 A;  4JKT A;  3I7J A;  3V5M A;  4DE0 A;  1W8Q A;  2CC1 A;  4H8R A;  3E2L A;  1ERQ A;  3B3X A;  4KZA A;  4UA7 A;  1YLZ A;  3SOI A;  4OP5 A;  4DKI A;  3GV9 A;  4PMA A;  4ZTK A;  2OLU A;  3PBN A;  5TFQ A;  1ALQ A;  3ITB A;  1H8Z A;  2ZC4 B;  5CGX A;  4BD1 A;  4B4Z A;  1SHV A;  2V1Z A;  4FH4 A;  4HBT A;  4X6T A;  5FAO A;  5HAR A;  3SH8 A;  2XD1 A;  5EVI C;  3ZG7 B;  1JWZ A;  3BYD A;  1ZG4 A;  4LCL A;  4P87 A;  4S2L A;  5CRF A;  2G2U A;  5HAI A;  3UNW A;  3VFF A;  2HDR A;  2XF3 A;  4RX3 A;  5HAQ A;  3G34 A;  1PWC A;  4Y0O A;  4MLL A;  5U47 A;  3MXR A;  2PBY A;  2FFF B;  2DCF A;  3PBR A;  5E2H A;  3LY4 A;  1YLT A;  1LLB A;  1K57 C;  4S2K A;  4Z9Q A;  4PM5 A;  3IHB A;  4FSF A;  2Y2I A;  2JBF A;  3PBT A;  3TG9 A;  5KZH A;  3P09 A;  3OPR A;  3EQV A;  2J8Y A;  4KZ7 A;  4UHU A;  1E25 A;  1TVF A;  3TSG A;  3G2Z A;  5FSR A;  3N8R A;  1YLP A;  1YLW A;  4JF5 A;  1DJA A;  4OOY A;  5EUA A;  1W5D A;  4E3O A;  1DJB A;  5KSC A;  1E3U A;  1FCM A;  5EVL A;  2OSU A;  3AGD A;  4WEJ A;  1XXM A;  3HLC A;  3TOI A;  2WK0 A;  1K6S A;  4S2O A;  4D2O A;  4GB7 A;  5KSH A;  1JTG A;  1S6R A;  1GA0 A;  2ZQA A;  4QHC A;  4ZJ1 A;  1BUL A;  3HBR A;  4LV0 A;  2WUQ A;  4Y0U A;  4MBF A;  4K91 A;  3UPO A;  4P85 A;  2OLV A;  5GLA A;  4A5R A;  2WGV A;  2WAD A;  1ZKJ A;  1NZO A;  1LHY A;  4R23 A;  1Q2Q A;  2G2W A;  1LI0 A;  1K6R A;  1LI9 A;  4IVK A;  2JE5 A;  1PYY A;  2RL3 A;  2GDN A;  2WAE A;  1SDE A;  1MWT A;  2Y2Q A;  1HTZ A;  5M1A A;  4OQ0 A;  1HVB A;  3BFC A;  3IF6 A;  1KDS A;  3V39 A;  4S2N A;  4JXS A;  3O86 A;  4MBK A;  1CI8 A;  2EFX A;  3W4O A;  2FFY A;  1XGJ A;  1BTL A;  3IXD A;  4MBH A;  4OPY A;  5FI6 A;  3SH9 A;  3UY6 A;  1Y54 A;  3A3J A;  3MZE A;  4ZAM A;  1ES2 A;  2PU2 A;  1CI9 A;  4FCF A;  4KG2 A;  3VP0 A;  2Y2N A;  1GHP A;  4DDY A;  1RGZ A;  4LV3 A;  1NYY A;  1L0D A;  3OPH A;  2EX2 A;  5EVI D;  4HES A;  4E3K A;  3CMZ A;  5CHJ A;  3IF6 B;  4WMC D;  1KE0 A;  3PTE A;  5CGW A;  1K4F A;  2I72 A;  5GHX A;  2J7V A;  4O7D A;  1KE4 A;  4OQI A;  4XUX A;  4YFM A;  2ZD8 A;  4LV2 A;  1FR6 A;  3Q81 A;  4PM6 A;  4BL2 A;  3OCN A;  3QHY A;  2QZ6 A;  1JTD A;  2WGW A;  1PWD A;  3HLE A;  3LEZ A;  2IWC A;  2Y91 A;  3OPL A;  3WS4 A;  4F94 A;  3ITA A;  5DF9 A;  3VOY A;  4HBU A;  4E3I A;  3PBQ A;  3N8S A;  4CJN A;  1L0F A;  1M6K A;  3M2J A;  5FQ9 A;  5AQB A;  3V50 A;  3BFD A;  3MKE A;  1XP4 A;  1I2W A;  5EOE A;  4OQH A;  1WE4 A;  3ZGA B;  5FQM A;  2Y55 A;  4EBN A;  4R3J A;  3IWI A;  5GHY A;  1QMF A;  4GNU A;  1K25 A;  1XPB A;  4HEF A;  3UE1 A;  2ZC6 B;  3PBO A;  2ZQ8 A;  3Q82 A;  3DTM A;  5CTM A;  3S22 A;  3UE0 A;  4N1X A;  2XD5 A;  3NI9 A;  5JYP A;  4QY5 A;  5GLD A;  4C6Y A;  1HZO A;  4OLG A;  3IXB A;  4JPM A;  4WZ5 A;  3WS2 A;  4BJP A;  1WYC A;  4LEN A;  3BRM A;  3C7V A;  3FV7 A;  3V3R A;  4E6X A;  2DRW A;  3BLS A;  1XKZ A;  4P6B A;  4E3J A;  5CED A;  1JWP A;  1PI4 A;  2QMI A;  1MWU A;  2ZC3 B;  3IWO A;  3ZNY A;  2EX8 A;  1K56 D;  1PZP A;  4PM9 A;  2WYX A;  3UDI A;  3HUM A;  3SS4 A;  4RA7 A;  2XR0 A;  3HLF A;  4WYY A;  1K54 A;  3A3I A;  3W4Q A;  4ZJ3 A;  5M18 A;  5CTN A;  5E2F A;  5EVI A;  5FI7 A;  3DWK A;  4N9L A;  1K55 C;  2X02 A;  5A92 A;  2XH9 A;  5HFO A;  3Q7Z A;  5CEB A;  5CEC A;  2Y2P A;  3WS1 A;  3MBZ A;  4BLM A;  5CGS A;  1KGF A;  1ZG6 A;  3C4O A;  5FAT A;  3RXX A;  1H8Y A;  4KQO A;  1TDG A;  3QNB A;  5FQQ A;  5FQI A;  1K57 A;  1KE3 A;  4MEZ A;  4ZJ2 A;  5FAQ A;  3NDE A;  2XK1 A;  3GQZ A;  4XXR A;  2Q9M A;  1BZA A;  1CK3 A;  4EBL A;  1RCJ A;  2BLS A;  1LL5 A;  4OPQ A;  4GZB A;  3OC2 A;  4S2I A;  3S1Y A;  1YQS A;  4RVA A;  3PAE A;  4X68 A;  1NRF A;  3M2K A;  1ES5 A;  4JBF A;  1G68 A;  2WKH A;  2J9O A;  1IYS A;  3Q1F A;  1K38 A;  2HP6 A;  1GA9 A;  4N92 A;  4XUZ A;  1LL9 A;  1NJ4 A;  2X71 A;  3NBL A;  1BLP A;  2PU4 A;  3ZG8 B;  2XDM A;  1C3B A;  2C6W B;  5BOH A;  1M40 A;  4DRT A;  1MPL A;  2P74 A;  2WAF A;  4MNR A;  1PWG A;  3A3D A;  4YIN A;  1XA7 A;  1XA1 A;  4GKU A;  4R0Q A;  1W7F A;  3FWL A;  4ID4 A;  3AGE A;  4GD6 A;  3CZD A;  2R9X A;  1YLY A;  1FCO A;  1TEM A;  1I5Q A;  4FD8 A;  4KZ9 A;  1ESI A;  1AXB A;  2HP9 A;  4U3T A;  3BLM A;  1ESU A;  4X56 A;  5A90 A;  3MXS A;  4WEL A;  5CHM A;  3HL9 A;  4EUZ A;  3FZC A;  1I2S A;  4R4R A;  2EXB A;  3GRJ A;  3RXW A;  1EI5 A;  1IYQ A;  2J9P A;  5FQJ A;  4OPZ A;  4OON A;  3G31 A;  5GLB A;  3W4P A;  4GOG A;  5FAS A;  4OLD A;  4E3M A;  3A3E A;  1KVM A;  5CER A;  5JYO A;  4DF6 A;  4PPR A;  2Y2K A;  3WS0 A;  2JCH A;  1PW1 A;  3E2K A;  3FKV A;  4OVD A;  2XFS A;  3N7W A;  4BEN A;  5TR7 A;  3NIA A;  1CEG A;  2WZZ A;  2P9V A;  1PIO A;  3PAG A;  3P98 A;  1FSY A;  2HDQ A;  2ZQ9 A;  1XX2 A;  3IF6 C;  4KG6 A;  3LCE A;  4LCM A;  2Q9N A;  3OCL A;  4M3K A;  1S0W A;  5CHU A;  3D4F A;  3FYZ A;  1Z6F A;  2Y4A A;  4U0T A;  1G6A A;  3HRE A;  1O07 A;  4E3N A;  2OV5 A;  1GHM A;  1ZC2 A;  2Y59 A;  3UPN A;  2P9V B;  3NY4 A;  4DDS A;  3O88 A;  4JXG A;  1FQG A;  4OP8 A;  2VGJ A;  4GDB A;  4DE1 A;  4OOM A;  4N9K A;  4QJG A;  5HW3 A;  2EXA A;  5F82 A;  4KZ8 A;  3LY3 A;  2WZX A;  2ZLY A;  4IBR A;  4EV4 A;  1SKF A;  4OPR A;  4BD0 A;  3HUN A;  3EQU A;  2WGW B;  1KGG A;  2WKI A;  3BEB A;  2ZC5 B;  3MFD A;  1L0G A;  4RYE A;  3VMA A;  2HPB A;  3QNC A;  3WS5 A;  1PW8 A;  3CG5 A;  1L2S A;  3DW0 A;  4LV1 A;  1MWR A;  1K4E A;  3GTC A;  5GLC A;  3G4P A;  3M6B A;  5FI2 A;  1MXO A;  3C5A A;  2Y2J A;  2ZM0 A;  1ONH A;  3NDG A;  3RJU A;  3ZCZ A;  4KEN B;  3ZVT A;  4R3B A;  5AQ9 A;  1SCW A;  5E2G A;  5EE8 A;  4OKP A;  2HDU A;  4N1H A;  3IT9 A;  2ZMA A;  1E3U D;  5EEC A;  3VP1 A;  3VSK A;  3VOZ A;  1DJC A;  4WEK A;  1NY0 A;  4X69 A;  1VQQ A;  3IF5 A;  5FA7 A;  1L0E A;  2DNS A;  1BSG A;  3MZD A;  3O3V A;  4PM7 A;  5G18 A;  2B5R A;  4S2J A;  4L0L A;  1QME A;  1YMS A;  2XFT A;  1E4D A;  4KZ5 A;  1BUE A;  2VGK A;  3JYI A;  5DF8 A;  2WKE A;  4WZ5 C;  3IXG A;  1IEM A;  1GCE A;  4WMC A;  4NET A;  3UPP A;  2XEP A;  1XGI A;  1HD8 A;  1NZU A;  4BQM A;  4Y7P A;  3G30 A;  3HVF A;  3WWX A;  5HL1 A;  1J9M A;  3ZDJ A;  1IYO A;  4IBX A;  3UDF A;  1ONG A;  2QPN A;  3HLB A;  3N4I A;  4JF6 A;  3G2Y A;  3UO9 A;  3V3S A;  3AGF A;  4DXC A;  2EFU A;  3ZG0 A;  1MKI A;  1K54 C;  4UA6 A;  2IWD A;  1SDN A;  1W79 A;  3Q07 A;  5EVI B;  3Q7V A;  2IWB A;  1GHI A;  3G32 A;  3MKF A;  5A93 A;  3C7U A;  4RX2 A;  3SS5 A;  1ERO A;  4Q8I A;  4R1G A;  3N8L A;  1FR1 A;  1BLS A;  3VP2 A;  2H5S A;  1JWV A;  5F1F A;  3WRZ A;  5J8X A;  3NCK A;  1TDL A;  1VM1 A;  4WZ4 A;  5AQA A;  5FDH A;  2EX9 A;  4OOL A;  1PI5 A;  3ZFZ A;  4NK3 A;  4KZ6 A;  1KGE A;  3GSG A;  3Q7V B;  3SH7 A;  4E6W A;  4EQI A;  4Y0T A;  3N6I A;  3LO7 A;  5TGF A;  5L2F A;  2ZC7 A;  1FCN A;  2XLN A;  2A3U A;  4WM9 A;  4DE3 A;  1BLC A;  1FSW A;  4UA9 A;  4CPK A;  3S4X A;  1O7E A;  2H0Y A;  1K56 A;  3BFG A;  2R9W A;  3GMW A;  4B88 A;  4K0W A;  5F83 A;  3WRT A;  2ZQ7 A;  3ZHH A;  5A91 A;  4EBP A;  2ZM8 A;  2JC7 A;  2UWX A;  3IQA A;  2WGI A;  1IEL A;  1U60 A;  4WBG A;  3CJM A;  3DWZ A;  1MY8 A;  3W8K A;  3ZNT A;  3M6H A;  4KZB A;  5DTK A;  1ES4 A;  1IKG A;  3UN7 A;  3BEC A;  2H0T A;  5KMW A;  2BG1 A;  3ZG5 A;  3OZH A;  1MWS A;  4KQR A;  4KZ3 A;  3VSL A;  2Z2M B;  2A49 A;  5DTT A;  5FQK A;  4UAA A;  1W8Y A;  4S2P A;  1OME A;  2V2F F;  2C5W B;  3BFF A;  4OH0 A;  2Z2L B;  3C4P A;  4KG5 A;  2ZQD A;  1RGY A;  5M19 A;  2HP5 A;  3NC8 A;  4QB8 A;  3O87 A;  1BLH A;  5FAP A;  2Y2L A;  4S2N C;  4DXB A;  3VFH A;  3HLD A;  2X01 A;  3ZG9 B;  1WYB A;  2E8I A;  3MZF A;  3UE3 A;  5F1G A;  5GL9 A;  2RCX A;  5DTS A;  1JVJ A;  1N4O A;  1YM1 A;  4JLF A;  3ISG A;  3FKW A;  3HLW A;  4E3L A;  3G35 A;  3UDX A;  4JXV A;  3SS3 A;  4QY6 A;  1N9B A;  3VP4 A; 
#chains in the Genus database with same CATH topology
 5IHV A;  4I38 A;  5AQ7 A;  1LL8 A;  3HUO A;  5GHZ A;  4HHD A;  1H5X A;  4JGO A;  4FH2 A;  1GSX A;  1MBL A;  3BFE A;  5HDC A;  4GDN A;  3IXH A;  1K0K A;  3GR2 A;  3LIF A;  5DVA A;  2J3W A;  3HLG A;  4U0X A;  5HAP A;  1NXY A;  4KQQ A;  3ZVW A;  4IED A;  4JXW A;  3PBS A;  1K55 A;  2V20 A;  2H28 A;  4OQG A;  1YT4 A;  5CXW A;  5E2E A;  3I7J A;  5F68 A;  3V5M A;  4H8R A;  4QWO A;  1CF0 A;  3GV9 A;  4PMA A;  2OLU A;  3PBN A;  1ALQ A;  4MN5 A;  2ZC4 B;  1SHV A;  4X6T A;  4S2L A;  2G2U A;  3VFF A;  1TS0 A;  4WN5 A;  2Y8H A;  2GJ3 A;  3PBR A;  4GS9 A;  4S2K A;  3G6O A;  1DP6 A;  2Y2I A;  3TG9 A;  3P09 A;  3EQV A;  2ZBB A;  4EU0 A;  4E3O A;  1DJB A;  1N9L A;  3K3D A;  4CLC A;  2WK0 A;  1K6S A;  4QHC A;  4ZJ1 A;  4LRZ E;  4LV0 A;  2WUQ A;  2Y79 A;  4MBF A;  4P85 A;  2OLV A;  3W2Z A;  4A5R A;  2WGV A;  1LHY A;  1LI0 A;  1K6R A;  3T4Q A;  1GSW A;  2WAE A;  2LB5 A;  2QWS A;  1MWT A;  2M1C A;  3IF6 A;  1KDS A;  4S2N A;  4JXS A;  3O86 A;  1CI8 A;  3W4O A;  5FI6 A;  4H6J B;  3UY6 A;  4EW7 A;  3F1O B;  1NYY A;  4E3K A;  5FEG A;  3IX4 A;  4MN7 A;  4OQI A;  5J4E A;  4YFM A;  5EM1 A;  3Q81 A;  3BQA A;  2QZ6 A;  1JTD A;  3LEZ A;  2IWC A;  4DJ3 A;  3LR4 A;  3WS4 A;  4HBU A;  4CJN A;  1L0F A;  2OWH A;  3BWL A;  3V50 A;  2I9V A;  1WE4 A;  3ZGA B;  1TD5 A;  4FOF A;  5GHY A;  1QMF A;  2VX8 A;  1XPB A;  3UE1 A;  2QHK A;  2ZQ8 A;  3UE0 A;  1F2K A;  5L8M A;  5GLD A;  3A0V A;  1HZO A;  3WS2 A;  4BJP A;  1WYC A;  1Z09 A;  2DRW A;  4P6B A;  1XKZ A;  4E3J A;  2PYR A;  2EX8 A;  3UDI A;  4I3I A;  3MMH A;  4HI4 A;  4WYY A;  3NOU C;  3W4Q A;  2KLI A;  3CIT A;  3DWK A;  2X02 A;  2W0N A;  5HFO A;  5C5K A;  3WS1 A;  3MBZ A;  4BLM A;  1KGF A;  1ZG6 A;  3C4O A;  4F3L A;  3MSH A;  1H8Y A;  5FQQ A;  1KE3 A;  5FAQ A;  2Q9M A;  3IBJ A;  4EBL A;  1RCJ A;  4R38 A;  2BLS A;  4NXE A;  4OPQ A;  3OC2 A;  4RVA A;  3PAE A;  3T1S A;  3C30 A;  2QYB A;  1S4R A;  4XUZ A;  3NBL A;  1P9W A;  2C6W B;  5BOH A;  3F1P A;  1MPL A;  2P74 A;  3MQQ A;  1ODV A;  3A3D A;  3NOP C;  1XA7 A;  3H82 A;  4WUJ A;  4R0Q A;  3E4Q A;  3AGE A;  5L10 A;  1I5Q A;  1AXB A;  2HP9 A;  4U3T A;  2PD7 A;  4X56 A;  3U4L P;  3MXS A;  4WEL A;  5CHM A;  3UMD A;  2EXB A;  2YKH A;  3JVV A;  2VGL M;  5FQJ A;  3G31 A;  5GLB A;  4GOG A;  1L3L A;  5TBM A;  4OVD A;  2W27 A;  1LSX A;  3NIA A;  5FEF A;  3P98 A;  2JKF A;  5HWT A;  1XX2 A;  4Y17 A;  4KG6 A;  2Q9N A;  4Q0J A;  2WKQ A;  4LLO B;  4R70 A;  3D4F A;  3FYZ A;  1Z6F A;  2VJW A;  1O07 A;  1GHM A;  1ZC2 A;  3MJQ A;  3NY4 A;  4DDS A;  4ESP A;  4JXG A;  4OP8 A;  1FQG A;  2VGJ A;  4N9K A;  5HW3 A;  4LRY C;  2EXA A;  2ZLY A;  5IT5 A;  3EQU A;  4BBU A;  1TS7 A;  1KGG A;  1YKD A;  3T50 A;  2ZC5 B;  1L0G A;  4RYE A;  5HD3 A;  3VMA A;  2HPB A;  3CG5 A;  2A24 B;  2JKT M;  3PXP A;  3M6B A;  2PYP A;  1MXO A;  3RJU A;  3NDG A;  4KEN B;  3BJN A;  3KYE A;  1MC0 A;  1E3U D;  3VSK A;  3VOZ A;  1DJC A;  5FA7 A;  1BSG A;  5G18 A;  1IOU A;  1Y28 A;  2XFT A;  3DTK A;  1E4D A;  4B93 A;  2VGK A;  2WKE A;  4WZ5 C;  2ZMV A;  3BQ8 A;  3H7W B;  1HD8 A;  1NZU A;  3LUQ A;  3G30 A;  1IYO A;  4G3K A;  2UV0 E;  3P7N A;  2J3T C;  4GHI B;  1MKI A;  1SDN A;  3OBF A;  3Q07 A;  4ARZ A;  2O0Y A;  3RFB A;  3LYX A;  1FR1 A;  3VP2 A;  2NUT C;  3WRZ A;  1TDL A;  3HJK A;  1PI5 A;  3LR5 A;  4KZ6 A;  4EQI A;  1F9I A;  1OTE A;  3B47 A;  2XLN A;  1SKO A;  1JNU A;  3TRC A;  4DE3 A;  4UA9 A;  1O7E A;  5HWW A;  3BFG A;  2R9W A;  4K0W A;  5DJU A;  2ZQ7 A;  3ZHH A;  1S67 L;  4EXO A;  4KUO A;  4EBP A;  1IEL A;  4ME4 A;  5DTK A;  3UN7 A;  4Y2F A;  5L07 A;  3ZG5 A;  3OZH A;  4KQR A;  1S4S A;  2WKP A;  5HPI A;  5DTT A;  5FQK A;  3LEQ A;  2C5W B;  2Z2L B;  1RGY A;  2HP5 A;  3S7P A;  5J7E A;  2V8C A;  2KDK A;  3F1N B;  2KX6 A;  3PHY A;  3S7Q A;  5F1G A;  3MQ0 A;  5GL9 A;  2BTF P;  1N4O A;  3HLW A;  3UDX A;  4JXV A;  4QY6 A;  2ZQC A;  3IHA A;  2XQZ A;  3CHW P;  1OTA A;  1KVL A;  5EV0 A;  1ZTU A;  2Y2M A;  3QP6 A;  5EPH A;  1CEF A;  4CLC E;  4GD8 A;  4ZRR A;  4B4X A;  3A3F A;  4EWF A;  3LFV A;  4II7 A;  3UB9 A;  3OPP A;  4BL3 A;  4PM8 A;  5HX9 A;  2V8F A;  2HDS A;  2PT7 A;  3T4T A;  4QD4 A;  1OTI A;  4GN2 A;  4KUK A;  5HPF A;  5EOO A;  4QU3 A;  5KIZ A;  3NHQ A;  3LR3 A;  4DE0 A;  3IS2 B;  1W8Q A;  2CC1 A;  3E2L A;  4KZA A;  4UA7 A;  3RH8 B;  1YLZ A;  3ITB A;  3KSI A;  4B4Z A;  5FAO A;  4HBT A;  4WLA A;  4ETZ A;  2XD1 A;  5EVI C;  4P87 A;  5CRF A;  3UNW A;  3SZT A;  4RX3 A;  5HAQ A;  3T1R A;  1OJG A;  2P7J A;  2JHE A;  4Y0O A;  4MLL A;  2QJ5 A;  3LY4 A;  1YLT A;  1LLB A;  4WL9 A;  5EVE A;  3PBT A;  5KZH A;  3A0R A;  4KZ7 A;  4XT2 A;  2PHY A;  4GJ4 A;  3FPW A;  3KSH A;  4B9O A;  5EUA A;  4NG2 A;  3AGD A;  3LI8 A;  4WEJ A;  1A0K A;  4S2O A;  1S6R A;  1GA0 A;  1BUL A;  3HBR A;  4I5S A;  2GX5 A;  3R7W B;  2WAD A;  1ZKJ A;  1NZO A;  4HP9 A;  1Q2Q A;  2LB9 A;  1LI9 A;  4P6Z S;  2JE5 A;  1PYY A;  4X25 A;  1SDE A;  5M1A A;  2Y2Q A;  3CUE C;  2XSS A;  3GDI A;  4YWZ A;  1HVB A;  4Y3I A;  1P9R A;  3V39 A;  4MBK A;  1XGJ A;  1BTL A;  2Z6C A;  3IXD A;  4MBH A;  3T1X A;  3MZE A;  3OLO A;  1CI9 A;  3PTE A;  2I72 A;  1OTB A;  3H9W A;  1KE4 A;  2ZD8 A;  4BL2 A;  3OCN A;  3QHY A;  3OPL A;  5DF9 A;  2W1R A;  3MKE A;  3CI6 A;  1XP4 A;  2K2N A;  4EBN A;  5DKL A;  1F5M A;  2XA7 S;  2ZC6 B;  3DTM A;  1D7E A;  2XD5 A;  1CJF A;  3K3C A;  4JPM A;  4I3J A;  2W1T A;  3BRM A;  3C7V A;  1YAX A;  4LEN A;  3V3R A;  3VE4 A;  5A8B A;  5HSQ A;  1JWP A;  1MWU A;  2ZC3 B;  3H7W A;  4PM9 A;  2WYX A;  4NXG A;  4FTX A;  2A2L A;  4RA7 A;  5AJG A;  3HLF A;  3TE8 A;  3UB8 A;  1YPR A;  5CTN A;  5FI7 A;  4N9L A;  1K55 C;  5A92 A;  2XH9 A;  4UQI S;  3E4O A;  2QJ7 A;  5FAT A;  3QNB A;  4AFI A;  4ZJ2 A;  2XK1 A;  4XXR A;  2K7S A;  3S1Y A;  1PNE A;  3M2K A;  3GEC A;  2WKH A;  3Q1F A;  1K38 A;  1LL9 A;  2X71 A;  1BLP A;  2VGL S;  2P08 A;  2XDM A;  5HDD A;  1LSV A;  1M40 A;  2V9A A;  4ID4 A;  4GD6 A;  1V9Y A;  3CZD A;  2R9X A;  1FCO A;  3EGD C;  1ESU A;  5A90 A;  2VK3 A;  4EUZ A;  4DN0 A;  3GRJ A;  3RXW A;  5FAS A;  2VV8 A;  4E3M A;  4BMW A;  3A3E A;  5JYO A;  4PPR A;  1S66 L;  5K5B A;  3B42 A;  4BEN A;  1VEU A;  5TR7 A;  1CEG A;  2P9V A;  4X1L A;  2EWV A;  1V9Z A;  2HDQ A;  2ZQ9 A;  3IF6 C;  3A0S A;  1NLZ A;  2FH5 A;  3E0Y A;  5CHU A;  3RTY A;  2DMW A;  4U0T A;  1G6A A;  2OV5 A;  2Y59 A;  4X1M A;  3O88 A;  3E98 A;  4GDB A;  4HH3 A;  4JGQ A;  5F82 A;  4KZ8 A;  2WZX A;  4EV4 A;  4OPR A;  4BD0 A;  3ZQ5 A;  2WKI A;  3BEB A;  4LGW A;  3QNC A;  1MWR A;  5GLC A;  3G4P A;  5FI2 A;  1VET B;  3ZVT A;  1ONH A;  1S1Y A;  5AQ9 A;  1SCW A;  3PYP A;  4BBV A;  5E2G A;  2V0U A;  4N1H A;  3IT9 A;  5EEC A;  1VQQ A;  2YKF A;  2PR5 A;  4Q0H A;  4HQA A;  2L0W A;  3CWF A;  3DBA A;  3C38 A;  4S2J A;  4L0L A;  3JYI A;  2ZL1 A;  2OAP 1;  3IXG A;  3HCY A;  2OOL A;  2J80 A;  1DP8 A;  4BQM A;  3WWX A;  2BAS A;  4IBX A;  3UDF A;  1ONG A;  3N4I A;  4KQD A;  3UO9 A;  2INW A;  3FG8 A;  4UA6 A;  3SOI A;  5EVI B;  2IWD A;  3Q7V A;  3MKF A;  5A93 A;  1ERO A;  1T1B A;  4R1G A;  3N8L A;  2H5S A;  4I39 A;  3BY8 A;  1JWV A;  2B02 A;  3NCK A;  1VM1 A;  4WZ4 A;  4OOL A;  2PD8 A;  3SH7 A;  4E6W A;  3N6I A;  3LO7 A;  3C8C A;  2O9C A;  1DRM A;  2QKP A;  1FSW A;  2D02 A;  3S4X A;  2H0Y A;  4B88 A;  2WKR A;  5F83 A;  4EER A;  5TJJ A;  3IQA A;  4WBG A;  2L4R A;  3DWZ A;  4HP4 A;  3M6H A;  1IKG A;  2XRO A;  3BEC A;  2O9B A;  5KMW A;  4G3V A;  4QPR A;  3CAX A;  3VSL A;  2Z2M B;  4UEY A;  1W8Y A;  3BFF A;  3CPT A;  3C4P A;  3UB5 P;  1T19 A;  3O87 A;  1LT0 A;  3VFH A;  5J3W A;  2JKT I;  2X01 A;  2E8I A;  2J3T D;  2RCX A;  1DP9 A;  3KSG A;  1JVJ A;  3MQO A;  1NWZ A;  3FKW A;  3VV4 A;  3VP4 A;  3SW1 A;  2W3H A;  1ES3 A;  4EET B;  5DFX A;  1DY6 A;  3UE6 A;  2EX6 A;  3MS6 A;  2H10 A;  4X55 A;  1YSQ A;  4S2M A;  5LBR A;  2ZM2 A;  3VP3 A;  4P0M A;  3LIC A;  1EWZ A;  2Y2O A;  2XGN A;  3QP8 A;  4R4S A;  3IH8 A;  1IYP A;  1Q2P A;  4IVI A;  3BM6 A;  3T1Q B;  1H8M A;  4RQ9 A;  4HJ4 A;  4HIA A;  2PAV P;  4K0X A;  2Y2G A;  2L1M A;  4YOF A;  1PZO A;  5I94 A;  3B3X A;  4DKI A;  4OP5 A;  4I3A A;  5TFQ A;  4M4X A;  4BD1 A;  2V1Z A;  4FH4 A;  5HAR A;  3ZCZ A;  3ZG7 B;  2MJ6 A;  3BYD A;  4L9G A;  5HAI A;  2XF3 A;  3G34 A;  1PWC A;  3LIB A;  4MCW A;  2PBY A;  1K57 C;  4LRX C;  4PM5 A;  3D72 A;  4FSF A;  2JBF A;  2W3F A;  1OTD A;  1XFQ A;  4E04 A;  1E25 A;  3MFX A;  3G2Z A;  5FSR A;  3N8R A;  1YLP A;  1YLW A;  1DJA A;  1W5D A;  1E3U A;  5EVL A;  4PHT A;  3HLC A;  4D2O A;  4GB7 A;  5KSH A;  4K91 A;  2W3G A;  5GLA A;  5HZH A;  4H6J A;  2G2W A;  3F1O A;  4IVK A;  2VLG A;  2GDN A;  4K08 A;  1HTZ A;  1D1J A;  2EA9 A;  2EFX A;  3SH9 A;  4OPY A;  1Y54 A;  4IUH A;  4ZAM A;  1ES2 A;  2Y2N A;  3P01 A;  1GHP A;  4LPZ A;  4DDY A;  1FIL A;  2FZ0 A;  3OPH A;  5EVI D;  4R3A A;  4HES A;  5CHJ A;  3IF6 B;  1S1Z A;  4WMC D;  1KE0 A;  5CGW A;  1K4F A;  5GHX A;  3JPU A;  4XUX A;  4PM6 A;  5HDS A;  1PWD A;  3HLE A;  2Y91 A;  5IU1 A;  3QP4 A;  5G4Z A;  4F94 A;  3ITA A;  4E3I A;  3N8S A;  3M2J A;  5FQ9 A;  2CMN A;  3VOL A;  1G5U A;  1VET A;  1UWP X;  5FQM A;  1T1C A;  4JGR A;  2KOI A;  5EFW A;  3Q82 A;  5MC7 A;  4N1X A;  4O0P A;  3NI9 A;  4QY5 A;  1MZU A;  1SZV A;  3IXB A;  4E6X A;  3D9Y A;  5CED A;  1PI4 A;  1MKM A;  4BWI A;  2QMI A;  3IWO A;  3LID A;  1K56 D;  3MF0 A;  1PZP A;  3SS4 A;  1K54 A;  2Z6D A;  5M18 A;  5E2F A;  5EVI A;  3Q7Z A;  4EEU A;  5CEC A;  3T4O A;  5CGS A;  3RXX A;  4KQO A;  1TDG A;  3KO6 A;  5AVE A;  1CK3 A;  5EM0 A;  4GW9 A;  1LL5 A;  4EQ1 A;  4S2I A;  4X68 A;  1NRF A;  4JBF A;  4F3L B;  2J9O A;  1IYS A;  1GA9 A;  3CLO A;  3HJI A;  2WAF A;  1PWG A;  4YIN A;  4GKU A;  3FWL A;  3EOI A;  1YLY A;  1ESI A;  2V1B A;  3KSF A;  1YSP A;  2JN7 A;  1P0Z A;  3HL9 A;  3CUE A;  1XFN A;  1I2S A;  3F1P B;  3FZC A;  2J9P A;  4OPZ A;  3W4P A;  1KVM A;  2JCH A;  3FKV A;  5G4Y A;  3UME A;  2WZZ A;  3PAG A;  1FSY A;  1NRJ A;  2JKR I;  3LCE A;  4LCM A;  2PBD P;  5FL3 A;  3LR0 A;  4M3K A;  1S0W A;  5TBM B;  2A24 A;  2O9A A;  3TJZ C;  3UB6 A;  1W63 Q;  5L09 A;  3PR6 A;  2P04 A;  3LY3 A;  1SKF A;  3HUN A;  2JKR M;  2WGW B;  4IHQ A;  4ETX A;  1XJ6 A;  1STZ A;  4LV1 A;  1L2S A;  5HWV A;  1K4E A;  3NUL A;  1ZHH B;  2Y2J A;  2ZM0 A;  3ULF A;  3ZYT A;  1OJ5 A;  3BY9 A;  4OKP A;  2HDU A;  3T4K A;  2ZMA A;  2VKS A;  4D60 A;  1XJ2 A;  1N9O A;  4X69 A;  4WEK A;  1NY0 A;  4Y13 A;  2PDR A;  3L9K A;  4CLC D;  2DNS A;  3MZD A;  3O3V A;  3IX8 A;  1YMS A;  3IBR A;  4KZ5 A;  4L9F A;  4GHI A;  2VA0 A;  4NET A;  1XGI A;  3C2W A;  4Y7P A;  3E4P A;  3HLB A;  4JF6 A;  3G2Y A;  2GNX A;  2EFU A;  3ZG0 A;  1W79 A;  1GHI A;  3EEA A;  3T12 B;  4RX2 A;  3SS5 A;  1BLS A;  1H0M A;  5F1F A;  1FIK A;  3FC7 A;  5AQA A;  2EX9 A;  3ZFZ A;  4NK3 A;  1KGE A;  4ARZ B;  4Y0T A;  2ZC7 A;  1BYW A;  5A91 A;  3O5Y A;  4CLC C;  2ZM8 A;  2UWX A;  2WGI A;  3CJM A;  2IA2 A;  1MY8 A;  2PRF A;  1SKO B;  1ES4 A;  3F1N A;  1GSV A;  2BG1 A;  1MWS A;  2M7V A;  5IS1 A;  2A49 A;  4LFU A;  2JKG A;  4OH0 A;  1TS6 A;  4KG5 A;  2ZQD A;  4Z1W A;  1G6O A;  4QB8 A;  1BLH A;  5DKK A;  5FAP A;  4S2N C;  4HJ6 A;  5F69 A;  3HLD A;  5AVF A;  3MZF A;  5DTS A;  1YM1 A;  3G35 A;  4P6Z M;  3DW0 A;  2D01 A;  3L7H A;  1FOF A;  1ERM A;  5DF7 A;  4C75 A;  1RP5 A;  4IJG A;  5E43 A;  3FPV A;  2ZJ9 A;  3QP2 A;  1W63 M;  1ACF A;  1TF1 A;  4ZBE A;  1YMX A;  1NLY A;  2Y2H A;  1KDW A;  4X53 A;  1NYM A;  3IH9 A;  3IS2 A;  1BT5 A;  1N9N A;  3GVB A;  5D3O A;  2VEA A;  5I5L A;  4KZ4 A;  4ZDX A;  4DE2 A;  4C3Q A;  1IKI A;  3IWQ A;  1YLJ A;  4JF4 A;  1H3Q A;  4JKT A;  3DTI A;  2XA7 M;  4Q0I A;  1ERQ A;  4ZTK A;  4GCZ A;  1H8Z A;  2K31 A;  5CGX A;  3SH8 A;  1JWZ A;  1ZG4 A;  4LCL A;  2HDR A;  5U47 A;  3MXR A;  5E2H A;  2FFF B;  2DCF A;  3TW8 A;  4Z9Q A;  3IHB A;  2R78 A;  4FUW A;  3IX3 A;  3OPR A;  2J8Y A;  4UHU A;  1TVF A;  3TSG A;  3R7W A;  1PFL A;  1OT9 A;  4JF5 A;  4OOY A;  1P97 A;  5KSC A;  2HGV A;  4UQI M;  1FCM A;  5DJT A;  2OSU A;  2G7U A;  1XXM A;  3TOI A;  1UGU A;  4PKY G;  1JTG A;  2ZQA A;  3B33 A;  4XT2 B;  4Y0U A;  3UPO A;  2OAQ 1;  4R23 A;  3S7O A;  2PR6 A;  3T4J A;  2RL3 A;  4OQ0 A;  3NJA A;  3BFC A;  5FDS A;  2VV7 A;  2FFY A;  1LSW A;  3A3J A;  2PU2 A;  4FCF A;  4KG2 A;  3VP0 A;  3QP1 A;  1RGZ A;  4LV3 A;  1L0D A;  2EX2 A;  3CMZ A;  3EGX C;  1TS8 A;  2J7V A;  4O7D A;  3LI9 A;  3U2A A;  4EES A;  4LV2 A;  1FR6 A;  4CQH A;  2WGW A;  4O8G A;  2EWW A;  4MDZ A;  3VOY A;  1Y4O A;  3PBQ A;  1M6K A;  5AQB A;  4NXB A;  3BFD A;  1VHM A;  1I2W A;  5EOE A;  4OQH A;  2ZMF A;  2HF6 A;  3LGO A;  2V1A A;  2Y55 A;  3ICY A;  4R3J A;  3IWI A;  2ZOI A;  4GNU A;  1K25 A;  4HEF A;  3PBO A;  1D06 A;  5CTM A;  3S22 A;  3KYQ A;  4PKY A;  5JYP A;  1PRQ A;  4C6Y A;  4OLG A;  4WZ5 A;  2ZOH A;  5F6A A;  3FV7 A;  2OWJ A;  3KX0 X;  3T4S A;  3BLS A;  3ZNY A;  4MN6 A;  2GZA A;  3HUM A;  2XR0 A;  4JGP A;  3K2N A;  3V67 A;  3A3I A;  4ZJ3 A;  2W1T B;  3VE3 A;  1IFQ A;  1OPX A;  5CEB A;  2Y2P A;  2ACG A;  5FQI A;  3NOT C;  1K57 A;  4MEZ A;  3NDE A;  3GQZ A;  1BZA A;  4HJ3 A;  4GZB A;  4DMZ A;  1YQS A;  4GLQ A;  1ES5 A;  1G68 A;  3R4K A;  2HP6 A;  4N92 A;  3OOV A;  4GS9 B;  1NJ4 A;  2PU4 A;  3ZG8 B;  1C3B A;  4DRT A;  2VZW A;  4MNR A;  4DJ2 A;  3LIE A;  1XA1 A;  3QP5 A;  1W7F A;  3LIA A;  1TEM A;  4KZ9 A;  4FD8 A;  4BBT A;  3BLM A;  4MMN A;  3DAV A;  4O01 A;  4CLC B;  1VB6 A;  4R4R A;  1UWN X;  1EI5 A;  1IYQ A;  4OON A;  4EEP A;  4OLD A;  4HY8 A;  2HZ5 A;  5CER A;  4DF6 A;  2Y2K A;  2O99 A;  3WS0 A;  4NXF A;  1PW1 A;  3E2K A;  2XFS A;  3N7W A;  1T18 A;  1PIO A;  4NKP A;  3OCL A;  5F5Y A;  3D3O A;  2Y4A A;  2NUP C;  3HRE A;  1VEU B;  4E3N A;  3UPN A;  2P9V B;  2W3E A;  4DE1 A;  4OOM A;  5HD5 A;  3JVU A;  4QJG A;  1J3W A;  1HLU P;  4IBR A;  2W3D A;  4Y15 A;  3MFD A;  3WS5 A;  3UB7 A;  5HL6 A;  1PW8 A;  3GTC A;  3C5A A;  2B18 A;  4R3B A;  2HJ9 C;  5EE8 A;  2VV6 A;  4Y5F A;  2HJE A;  3BW6 A;  2HV1 A;  3DTE A;  3VP1 A;  3IF5 A;  1L0E A;  1EW0 A;  4PM7 A;  2XRN A;  2B5R A;  1QME A;  4R6L A;  1BUE A;  1XJ4 A;  2V0W A;  5DF8 A;  1IEM A;  1GCE A;  4WMC A;  3UPP A;  2XEP A;  2AVX A;  3HVF A;  4IUK A;  3EEH A;  5HL1 A;  1J9M A;  3ZDJ A;  2QPN A;  4NEE D;  3V3S A;  3AGF A;  4DXC A;  3S7N A;  2IWB A;  1K54 C;  2ZL1 B;  3G32 A;  3C7U A;  1XJ3 A;  4Q8I A;  4HH2 A;  4HNB A;  1KOU A;  2E8J A;  5J8X A;  4WF0 A;  5FDH A;  3GSG A;  3Q7V B;  5TGF A;  5L2F A;  1FCN A;  4HOI A;  3T4L A;  2B95 A;  4YNR A;  2A3U A;  4WM9 A;  1BLC A;  1X0O A;  4CPK A;  1K56 A;  3GMW A;  3NEC A;  5DFY A;  3WRT A;  5CX7 A;  2JC7 A;  4EUV A;  3H82 B;  1WA9 A;  1U60 A;  3EWK A;  3W8K A;  3ZNT A;  4KZB A;  3MXQ A;  2H0T A;  1OT6 A;  4G3W A;  4KZ3 A;  1G28 A;  1AWI A;  3KYZ A;  4UAA A;  4S2P A;  1OME A;  2V2F F;  4PAU A;  5M19 A;  3NC8 A;  2Y2L A;  4L9E A;  3MR0 A;  4DXB A;  3ZG9 B;  1T1A A;  1WYB A;  3UE3 A;  2Q0O A;  1CQA A;  2M7U A;  1F98 A;  3CPT B;  4JLF A;  3ISG A;  4E3L A;  3SS3 A;  1N9B A; 
#chains in the Genus database with same CATH homology
 5IHV A;  5AQ7 A;  2ZQC A;  3IHA A;  2XQZ A;  3HUO A;  1FOF A;  1ERM A;  5DF7 A;  4C75 A;  1ES3 A;  5GHZ A;  1RP5 A;  1H5X A;  1KVL A;  1DY6 A;  5E43 A;  2EX6 A;  2Y2M A;  2H10 A;  4FH2 A;  2ZJ9 A;  5EPH A;  4X55 A;  1MBL A;  1CEF A;  4GD8 A;  3BFE A;  4S2M A;  4ZBE A;  2ZM2 A;  4B4X A;  3A3F A;  1YMX A;  4GDN A;  3IXH A;  3VP3 A;  4EWF A;  4P0M A;  1EWZ A;  2Y2H A;  3GR2 A;  3OPP A;  1KDW A;  2Y2O A;  2XGN A;  4X53 A;  1NYM A;  4BL3 A;  3IH9 A;  5DVA A;  1BT5 A;  4PM8 A;  4R4S A;  5HX9 A;  3HLG A;  3GVB A;  3IH8 A;  5D3O A;  4U0X A;  5HAP A;  1IYP A;  1Q2P A;  1NXY A;  4IVI A;  3BM6 A;  4KQQ A;  2HDS A;  4KZ4 A;  3ZVW A;  4QD4 A;  4IED A;  4ZDX A;  4JXW A;  3PBS A;  4DE2 A;  1K55 A;  2V20 A;  4GN2 A;  5EOO A;  4C3Q A;  4OQG A;  4K0X A;  4QU3 A;  1YT4 A;  2Y2G A;  1IKI A;  3IWQ A;  5CXW A;  1YLJ A;  4JF4 A;  5E2E A;  1PZO A;  5I94 A;  4JKT A;  3I7J A;  3V5M A;  4DE0 A;  1W8Q A;  2CC1 A;  4H8R A;  3E2L A;  1ERQ A;  3B3X A;  4KZA A;  4UA7 A;  1YLZ A;  3SOI A;  4OP5 A;  4DKI A;  3GV9 A;  4PMA A;  4ZTK A;  2OLU A;  3PBN A;  5TFQ A;  1ALQ A;  3ITB A;  1H8Z A;  2ZC4 B;  5CGX A;  4BD1 A;  4B4Z A;  1SHV A;  2V1Z A;  4FH4 A;  4HBT A;  4X6T A;  5FAO A;  5HAR A;  3SH8 A;  2XD1 A;  5EVI C;  3ZG7 B;  1JWZ A;  3BYD A;  1ZG4 A;  4LCL A;  4P87 A;  4S2L A;  5CRF A;  2G2U A;  5HAI A;  3UNW A;  3VFF A;  2HDR A;  2XF3 A;  4RX3 A;  5HAQ A;  3G34 A;  1PWC A;  4Y0O A;  4MLL A;  5U47 A;  3MXR A;  2PBY A;  2FFF B;  2DCF A;  3PBR A;  5E2H A;  3LY4 A;  1YLT A;  1LLB A;  1K57 C;  4S2K A;  4Z9Q A;  4PM5 A;  3IHB A;  4FSF A;  2Y2I A;  2JBF A;  3PBT A;  3TG9 A;  5KZH A;  3P09 A;  3OPR A;  3EQV A;  2J8Y A;  4KZ7 A;  4UHU A;  1E25 A;  1TVF A;  3TSG A;  3G2Z A;  5FSR A;  3N8R A;  1YLP A;  1YLW A;  4JF5 A;  1DJA A;  4OOY A;  5EUA A;  1W5D A;  4E3O A;  1DJB A;  5KSC A;  1E3U A;  1FCM A;  5EVL A;  2OSU A;  3AGD A;  4WEJ A;  1XXM A;  3HLC A;  3TOI A;  2WK0 A;  1K6S A;  4S2O A;  4D2O A;  4GB7 A;  5KSH A;  1JTG A;  1S6R A;  1GA0 A;  2ZQA A;  4QHC A;  4ZJ1 A;  1BUL A;  3HBR A;  4LV0 A;  2WUQ A;  4Y0U A;  4MBF A;  4K91 A;  3UPO A;  4P85 A;  2OLV A;  5GLA A;  4A5R A;  2WGV A;  2WAD A;  1ZKJ A;  1NZO A;  1LHY A;  4R23 A;  1Q2Q A;  2G2W A;  1LI0 A;  1K6R A;  1LI9 A;  4IVK A;  2JE5 A;  1PYY A;  2RL3 A;  2GDN A;  2WAE A;  1SDE A;  1MWT A;  2Y2Q A;  1HTZ A;  5M1A A;  4OQ0 A;  1HVB A;  3BFC A;  3IF6 A;  1KDS A;  3V39 A;  4S2N A;  4JXS A;  3O86 A;  4MBK A;  1CI8 A;  2EFX A;  3W4O A;  2FFY A;  1XGJ A;  1BTL A;  3IXD A;  4MBH A;  4OPY A;  5FI6 A;  3SH9 A;  3UY6 A;  1Y54 A;  3A3J A;  3MZE A;  4ZAM A;  1ES2 A;  2PU2 A;  1CI9 A;  4FCF A;  4KG2 A;  3VP0 A;  2Y2N A;  1GHP A;  4DDY A;  1RGZ A;  4LV3 A;  1NYY A;  1L0D A;  3OPH A;  2EX2 A;  5EVI D;  4HES A;  4E3K A;  3CMZ A;  5CHJ A;  3IF6 B;  4WMC D;  1KE0 A;  3PTE A;  5CGW A;  1K4F A;  2I72 A;  5GHX A;  2J7V A;  4O7D A;  1KE4 A;  4OQI A;  4XUX A;  4YFM A;  2ZD8 A;  4LV2 A;  1FR6 A;  3Q81 A;  4PM6 A;  4BL2 A;  3OCN A;  3QHY A;  2QZ6 A;  1JTD A;  2WGW A;  1PWD A;  3HLE A;  3LEZ A;  2IWC A;  2Y91 A;  3OPL A;  3WS4 A;  4F94 A;  3ITA A;  5DF9 A;  3VOY A;  4HBU A;  4E3I A;  3PBQ A;  3N8S A;  4CJN A;  1L0F A;  1M6K A;  3M2J A;  5FQ9 A;  5AQB A;  3V50 A;  3BFD A;  3MKE A;  1XP4 A;  1I2W A;  5EOE A;  4OQH A;  1WE4 A;  3ZGA B;  5FQM A;  2Y55 A;  4EBN A;  4R3J A;  3IWI A;  5GHY A;  1QMF A;  4GNU A;  1K25 A;  1XPB A;  4HEF A;  3UE1 A;  2ZC6 B;  3PBO A;  2ZQ8 A;  3Q82 A;  3DTM A;  5CTM A;  3S22 A;  3UE0 A;  4N1X A;  2XD5 A;  3NI9 A;  5JYP A;  4QY5 A;  5GLD A;  4C6Y A;  1HZO A;  4OLG A;  3IXB A;  4JPM A;  4WZ5 A;  3WS2 A;  4BJP A;  1WYC A;  4LEN A;  3BRM A;  3C7V A;  3FV7 A;  3V3R A;  4E6X A;  2DRW A;  3BLS A;  1XKZ A;  4P6B A;  4E3J A;  5CED A;  1JWP A;  1PI4 A;  2QMI A;  1MWU A;  2ZC3 B;  3IWO A;  3ZNY A;  2EX8 A;  1K56 D;  1PZP A;  4PM9 A;  2WYX A;  3UDI A;  3HUM A;  3SS4 A;  4RA7 A;  2XR0 A;  3HLF A;  4WYY A;  1K54 A;  3A3I A;  3W4Q A;  4ZJ3 A;  5M18 A;  5CTN A;  5E2F A;  5EVI A;  5FI7 A;  3DWK A;  4N9L A;  1K55 C;  2X02 A;  5A92 A;  2XH9 A;  5HFO A;  3Q7Z A;  5CEB A;  5CEC A;  2Y2P A;  3WS1 A;  3MBZ A;  4BLM A;  5CGS A;  1KGF A;  1ZG6 A;  3C4O A;  5FAT A;  3RXX A;  1H8Y A;  4KQO A;  1TDG A;  3QNB A;  5FQQ A;  5FQI A;  1K57 A;  1KE3 A;  4MEZ A;  4ZJ2 A;  5FAQ A;  3NDE A;  2XK1 A;  3GQZ A;  4XXR A;  2Q9M A;  1BZA A;  1CK3 A;  4EBL A;  1RCJ A;  2BLS A;  1LL5 A;  4OPQ A;  4GZB A;  3OC2 A;  4S2I A;  3S1Y A;  1YQS A;  4RVA A;  3PAE A;  4X68 A;  1NRF A;  3M2K A;  1ES5 A;  4JBF A;  1G68 A;  2WKH A;  2J9O A;  1IYS A;  3Q1F A;  1K38 A;  2HP6 A;  1GA9 A;  4N92 A;  4XUZ A;  1LL9 A;  1NJ4 A;  2X71 A;  3NBL A;  1BLP A;  2PU4 A;  3ZG8 B;  2XDM A;  1C3B A;  2C6W B;  5BOH A;  1M40 A;  4DRT A;  1MPL A;  2P74 A;  2WAF A;  4MNR A;  1PWG A;  3A3D A;  4YIN A;  1XA7 A;  1XA1 A;  4GKU A;  4R0Q A;  1W7F A;  3FWL A;  4ID4 A;  3AGE A;  4GD6 A;  3CZD A;  2R9X A;  1YLY A;  1FCO A;  1TEM A;  1I5Q A;  4FD8 A;  4KZ9 A;  1ESI A;  1AXB A;  2HP9 A;  4U3T A;  3BLM A;  1ESU A;  4X56 A;  5A90 A;  3MXS A;  4WEL A;  5CHM A;  3HL9 A;  4EUZ A;  3FZC A;  1I2S A;  4R4R A;  2EXB A;  3GRJ A;  3RXW A;  1EI5 A;  1IYQ A;  2J9P A;  5FQJ A;  4OPZ A;  4OON A;  3G31 A;  5GLB A;  3W4P A;  4GOG A;  5FAS A;  4OLD A;  4E3M A;  3A3E A;  1KVM A;  5CER A;  5JYO A;  4DF6 A;  4PPR A;  2Y2K A;  3WS0 A;  2JCH A;  1PW1 A;  3E2K A;  3FKV A;  4OVD A;  2XFS A;  3N7W A;  4BEN A;  5TR7 A;  3NIA A;  1CEG A;  2WZZ A;  2P9V A;  1PIO A;  3PAG A;  3P98 A;  1FSY A;  2HDQ A;  2ZQ9 A;  1XX2 A;  3IF6 C;  4KG6 A;  3LCE A;  4LCM A;  2Q9N A;  3OCL A;  4M3K A;  1S0W A;  5CHU A;  3D4F A;  3FYZ A;  1Z6F A;  2Y4A A;  4U0T A;  1G6A A;  3HRE A;  1O07 A;  4E3N A;  2OV5 A;  1GHM A;  1ZC2 A;  2Y59 A;  3UPN A;  2P9V B;  3NY4 A;  4DDS A;  3O88 A;  4JXG A;  1FQG A;  4OP8 A;  2VGJ A;  4GDB A;  4DE1 A;  4OOM A;  4N9K A;  4QJG A;  5HW3 A;  2EXA A;  5F82 A;  4KZ8 A;  3LY3 A;  2WZX A;  2ZLY A;  4IBR A;  4EV4 A;  1SKF A;  4OPR A;  4BD0 A;  3HUN A;  3EQU A;  2WGW B;  1KGG A;  2WKI A;  3BEB A;  2ZC5 B;  3MFD A;  1L0G A;  4RYE A;  3VMA A;  2HPB A;  3QNC A;  3WS5 A;  1PW8 A;  3CG5 A;  1L2S A;  3DW0 A;  4LV1 A;  1MWR A;  1K4E A;  3GTC A;  5GLC A;  3G4P A;  3M6B A;  5FI2 A;  1MXO A;  3C5A A;  2Y2J A;  2ZM0 A;  1ONH A;  3NDG A;  3RJU A;  3ZCZ A;  4KEN B;  3ZVT A;  4R3B A;  5AQ9 A;  1SCW A;  5E2G A;  5EE8 A;  4OKP A;  2HDU A;  4N1H A;  3IT9 A;  2ZMA A;  1E3U D;  5EEC A;  3VP1 A;  3VSK A;  3VOZ A;  1DJC A;  4WEK A;  1NY0 A;  4X69 A;  1VQQ A;  3IF5 A;  5FA7 A;  1L0E A;  2DNS A;  1BSG A;  3MZD A;  3O3V A;  4PM7 A;  5G18 A;  2B5R A;  4S2J A;  4L0L A;  1QME A;  1YMS A;  2XFT A;  1E4D A;  4KZ5 A;  1BUE A;  2VGK A;  3JYI A;  5DF8 A;  2WKE A;  4WZ5 C;  3IXG A;  1IEM A;  1GCE A;  4WMC A;  4NET A;  3UPP A;  2XEP A;  1XGI A;  1HD8 A;  1NZU A;  4BQM A;  4Y7P A;  3G30 A;  3HVF A;  3WWX A;  5HL1 A;  1J9M A;  3ZDJ A;  1IYO A;  4IBX A;  3UDF A;  1ONG A;  2QPN A;  3HLB A;  3N4I A;  4JF6 A;  3G2Y A;  3UO9 A;  3V3S A;  3AGF A;  4DXC A;  2EFU A;  3ZG0 A;  1MKI A;  1K54 C;  4UA6 A;  2IWD A;  1SDN A;  1W79 A;  3Q07 A;  5EVI B;  3Q7V A;  2IWB A;  1GHI A;  3G32 A;  3MKF A;  5A93 A;  3C7U A;  4RX2 A;  3SS5 A;  1ERO A;  4Q8I A;  4R1G A;  3N8L A;  1FR1 A;  1BLS A;  3VP2 A;  2H5S A;  1JWV A;  5F1F A;  3WRZ A;  5J8X A;  3NCK A;  1TDL A;  1VM1 A;  4WZ4 A;  5AQA A;  5FDH A;  2EX9 A;  4OOL A;  1PI5 A;  3ZFZ A;  4NK3 A;  4KZ6 A;  1KGE A;  3GSG A;  3Q7V B;  3SH7 A;  4E6W A;  4EQI A;  4Y0T A;  3N6I A;  3LO7 A;  5TGF A;  5L2F A;  2ZC7 A;  1FCN A;  2XLN A;  2A3U A;  4WM9 A;  4DE3 A;  1BLC A;  1FSW A;  4UA9 A;  4CPK A;  3S4X A;  1O7E A;  2H0Y A;  1K56 A;  3BFG A;  2R9W A;  3GMW A;  4B88 A;  4K0W A;  5F83 A;  3WRT A;  2ZQ7 A;  3ZHH A;  5A91 A;  4EBP A;  2ZM8 A;  2JC7 A;  2UWX A;  3IQA A;  2WGI A;  1IEL A;  1U60 A;  4WBG A;  3CJM A;  3DWZ A;  1MY8 A;  3W8K A;  3ZNT A;  3M6H A;  4KZB A;  5DTK A;  1ES4 A;  1IKG A;  3UN7 A;  3BEC A;  2H0T A;  5KMW A;  2BG1 A;  3ZG5 A;  3OZH A;  1MWS A;  4KQR A;  4KZ3 A;  3VSL A;  2Z2M B;  2A49 A;  5DTT A;  5FQK A;  4UAA A;  1W8Y A;  4S2P A;  1OME A;  2V2F F;  2C5W B;  3BFF A;  4OH0 A;  2Z2L B;  3C4P A;  4KG5 A;  2ZQD A;  1RGY A;  5M19 A;  2HP5 A;  3NC8 A;  4QB8 A;  3O87 A;  1BLH A;  5FAP A;  2Y2L A;  4S2N C;  4DXB A;  3VFH A;  3HLD A;  2X01 A;  3ZG9 B;  1WYB A;  2E8I A;  3MZF A;  3UE3 A;  5F1G A;  5GL9 A;  2RCX A;  5DTS A;  1JVJ A;  1N4O A;  1YM1 A;  4JLF A;  3ISG A;  3FKW A;  3HLW A;  4E3L A;  3G35 A;  3UDX A;  4JXV A;  3SS3 A;  4QY6 A;  1N9B A;  3VP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...