4U0TA

Crystal structure of adc-7 beta-lactamase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
357
structure length
357
Chain Sequence
b'TPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPTDIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTSGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYVVLNAIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADC-7 beta-lactamase
publication title Biochemical and Structural Analysis of Inhibitors Targeting the ADC-7 Cephalosporinase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 123
structure length 357
sequence length 357
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4u0tA00
5M19A 4OOYA 3LY4A 2XD5A 3MXRA 2Y2KA 3UE0A 3HLCA 3Q7VB 1L0EA 3UY6A 5D3OA 1Q2PA 1DY6A 1YQSA 3A3JA 3Q7ZA 4RX3A 5TR7A 4ZJ1A 1DJCA 1ES2A 3A3DA 1L0DA 1O7EA 2XLNA 3IF6A 3NC8A 4S2PA 3ZNTA 4IVKA 5A90A 1Y54A 2HP9A 3P09A 1K56D 1KGEA 1YLJA 3IWQA 4UHUA 3WRZA 1MKIA 2WZZA 1XA1A 4N92A 4X68A 1K55A 5EOEA 1ALQA 2Y91A 4WMCA 3WS5A 4BL3A 3MXSA 2Y2QA 4DF6A 1JWVA 4UA6A 3HLEA 1MWRA 5FQMA 1KE3A 5BOHA 5HW3A 2RL3A 4GDBA 4PM8A 3GR2A 3PBNA 1G68A 1NYMA 2QZ6A 3OPPA 1H8ZA 2EFXA 5F82A 1SDEA 1ZG4A 2R9WA 5KZHA 2EX2A 4P85A 2C6WB 4LCLA 4N9LA 3V3SA 1CI9A 4HEFA 1XA7A 1TDGA 1IYPA 1L2SA 5GL9A 4S2JA 1HVBA 1IELA 1SCWA 3BYDA 4OQIA 4R23A 5GHZA 4DE2A 3DWZA 3V3RA 1W5DA 3HUOA 4OP5A 5EVID 4R3BA 3VSLA 3QNCA 2WGIA 1LLBA 1NZUA 4YINA 5U47A 3OCLA 4E3JA 2J7VA 4MLLA 5M18A 5CHJA 4MEZA 4LV0A 4OQ0A 4OVDA 1BLPA 1N4OA 4MNRA 4N9KA 3V5MA 3W4PA 4EBNA 5A93A 4E3LA 1BTLA 4WMCD 5GLBA 3S1YA 2UWXA 4HBTA 4ZDXA 2ZC3B 1KVMA 1E4DA 2Y2MA 5CHMA 3MZDA 1K6RA 4GNUA 3BEBA 3GVBA 1KGFA 3BECA 1ZC2A 4JF6A 4K0XA 5FATA 5E43A 4Y0UA 1SKFA 3SS3A 5M1AA 4KZ4A 3RXXA 1HTZA 2P9VB 3A3FA 1PWGA 4B4ZA 4U0TA 4E3OA 1XXMA 3BFFA 4P0MA 1CI8A 5GLDA 2XF3A 4R0QA 5G18A 4DKIA 3A3IA 4X69A 2EXBA 4D2OA 1BT5A 3BFGA 3CZDA 1NJ4A 5E2HA 4K0WA 4PMAA 2VGJA 1O07A 1PW1A 3ISGA 4JPMA 3VSKA 3G30A 5HAQA 5CHUA 3UPPA 3V50A 5FDHA 3SOIA 1ONGA 2XDMA 5A92A 4JF5A 1PWDA 3UE3A 3N8RA 4RYEA 1GA9A 3FKWA 4PM7A 4OKPA 1J9MA 1WYCA 1WYBA 4HBUA 1FCNA 3C7UA 2XK1A 2EFUA 3AGDA 3G35A 1EROA 2E8IA 3HL9A 2WGWB 1I2WA 2ZJ9A 4QY5A 5FASA 2I72A 4LV1A 4L0LA 2ZQ9A 3GV9A 1YLZA 3IXGA 5EE8A 5FQJA 5EVIB 2OLUA 4KZ3A 3G4PA 3VOYA 1YT4A 5FI6A 1SHVA 1HD8A 3CMZA 2DNSA 5AQ9A 3ZG9B 5I94A 4EQIA 1ONHA 2BLSA 4CPKA 3PBTA 4LCMA 1U60A 2ZD8A 3SH9A 4WYYA 1N9BA 3GRJA 3TG9A 3B3XA 4JXSA 5CGXA 1Q2QA 3IHAA 3M2JA 4XUXA 3S22A 1FCOA 3BM6A 2VGKA 2JCHA 3HLWA 1BLSA 4GD8A 5EVLA 3CG5A 3G2ZA 2R9XA 3Q07A 2WZXA 2WUQA 4UA7A 4S2MA 4WZ4A 3EQVA 3ZNYA 3VP0A 3HUMA 1K38A 3O86A 4BD1A 3JYIA 5FAPA 4EBLA 1K57A 4E6WA 4WEJA 4WZ5A 1GHIA 1S0WA 2V2FF 5HARA 3ZHHA 2JE5A 4S2NA 3IHBA 1IEMA 1DJAA 4IVIA 3OZHA 1M6KA 3UE1A 2WKIA 2WAFA 1FQGA 3HLDA 2QMIA 5EVIC 3MBZA 3UDXA 3WRTA 5CGSA 2HDRA 3G31A 1H8YA 3QNBA 5CECA 1W79A 4O7DA 2G2UA 4CJNA 4MBFA 3QHYA 2HDQA 5HX9A 4P6BA 4ZJ2A 3HVFA 4HESA 2V1ZA 4EUZA 4JLFA 4ZBEA 3OC2A 3BRMA 5JYPA 1E3UD 1K55C 3OCNA 5AQAA 1K54A 3ZG7B 1ZKJA 3RXWA 5E2FA 1ERQA 4JBFA 3ZDJA 4C3QA 4EBPA 1K4EA 4QU3A 3ZGAB 5HAPA 3ZFZA 4OPRA 4EV4A 4UA9A 3PBSA 3OPRA 1S6RA 2ZLYA 1FSYA 4NK3A 5KSHA 1XP4A 1NY0A 4NETA 1GHPA 2P74A 2ZQAA 3ITAA 3PAGA 2CC1A 3Q81A 1YLTA 4OPQA 4WM9A 3VOZA 4DE0A 2EX9A 5DTKA 4PPRA 4B88A 3SH7A 3FZCA 4MBKA 5F1GA 3Q7VA 4KQRA 4QB8A 2IWCA 2GDNA 4GKUA 2QPNA 4JXWA 4OQHA 4WELA 5FAQA 1RGYA 3VP2A 2WKHA 3VFHA 1BULA 1I2SA 1MY8A 2Y59A 2Z2MB 3UDIA 5FQ9A 4BL2A 1FR6A 4IEDA 3EQUA 4FCFA 1LHYA 3G2YA 4ID4A 3G32A 2HPBA 3MKEA 1TEMA 2XFSA 2J9OA 4OONA 3D4FA 1VQQA 2H0YA 1PI5A 2Q9NA 2XEPA 3A3EA 3Q1FA 4S2IA 3GTCA 5EUAA 4R4SA 3BFCA 3LY3A 3LO7A 5GLAA 3UDFA 3IXHA 4QD4A 5DF9A 5TGFA 4JXGA 1L0GA 4KENB 4QHCA 2EX6A 2ZQ7A 3AGFA 2Y2JA 3P98A 5EECA 3OPHA 1GCEA 5E2GA 3UPNA 4GOGA 2IWBA 5IHVA 3VP4A 4H8RA 4IBXA 4LV3A 3VFFA 1JTGA 4R3JA 1MWUA 3MFDA 1CK3A 2WADA 2EXAA 1IKGA 1CEFA 1L0FA 3E2LA 1H5XA 4A5RA 2FFFB 1FR1A 4PM6A 4N1HA 5A91A 1FCMA 3PBQA 4KZAA 3N6IA 3C5AA 1PI4A 4X6TA 3BLSA 2XD1A 1QMFA 1YLPA 3IXDA 4X53A 2ZM8A 4OOMA 3SS5A 4LENA 4BJPA 2WKEA 2FFYA 5CTNA 1RP5A 1C3BA 4OQGA 3MZEA 2Y2GA 3GSGA 5EPHA 4PM5A 3PBOA 4JKTA 1W8YA 3VMAA 2B5RA 5AQBA 2HP5A 1KE0A 4GD6A 4Y7PA 3HLFA 2ZMAA 3E2KA 4S2LA 2BG1A 2XFTA 3BFEA 4FD8A 3DWKA 2IWDA 3IF6B 3O87A 1EI5A 4BLMA 4E3NA 2Y2NA 3FYZA 2ZC4B 1ESUA 3IH8A 3NCKA 1ESIA 2WK0A 4GN2A 4X55A 3WWXA 2X02A 3MZFA 4YFMA 5F83A 4OLGA 5CXWA 1YM1A 4FSFA 4KZ8A 3ZG8B 1VM1A 4DRTA 3O3VA 1K56A 2RCXA 4WEKA 1KGGA 5FI7A 1DJBA 1WE4A 1SDNA 1PW8A 4QY6A 1HZOA 1JWPA 2P9VA 2WGVA 3TOIA 3WS0A 3IT9A 1IYOA 4ZTKA 5TFQA 1LL5A 4KQOA 2ZQ8A 3NDEA 4QJGA 1IYQA 3ZCZA 5GHXA 2Q9MA 3CJMA 3C7VA 3HUNA 5FQIA 1JWZA 4R1GA 5DTTA 1W8QA 4RX2A 4BD0A 5FSRA 1RCJA 1K57C 1NRFA 2WYXA 1IYSA 2J9PA 3FKVA 4WZ5C 4FH4A 2ZC6B 1ERMA 3IH9A 4S2NC 4X56A 5EOOA 3HREA 3IF6C 2Y2OA 3V39A 3TSGA 5KMWA 2PU4A 4ZJ3A 1ES3A 2ZQDA 3C4PA 5FAOA 4EWFA 2WGWA 5L2FA 1NYYA 4KZ5A 1M40A 5JYOA 2Y2LA 1K6SA 4RVAA 4KG6A 1XKZA 3W4QA 4E3IA 5EVIA 4F94A 2HP6A 5CTMA 4ZAMA 1CEGA 3M6HA 4JF4A 2XR0A 4OPYA 1GA0A 1K54C 4IBRA 4XUZA 5E2EA 3ITBA 3NBLA 5KSCA 3HBRA 3BFDA 5CGWA 3W8KA 4BQMA 5HFOA 2OSUA 3NY4A 5J8XA 2ZC5B 3NDGA 3S4XA 1PYYA 3FWLA 4U0XA 1LI9A 1MWSA 3NI9A 1BLHA 3IWOA 3PTEA 1ES5A 1I5QA 1XX2A 2X71A 2JC7A 2J8YA 1FSWA 4KZ7A 4KG2A 4UAAA 3AGEA 1ES4A 4JXVA 1W7FA 1XPBA 2ZC7A 5DVAA 5HAIA 4E6XA 2DCFA 3OPLA 2G2WA 2HDUA 2XGNA 1K25A 4Z9QA 3WS1A 3IQAA 3HLGA 3M2KA 3UPOA 4DXBA 2XQZA 2XH9A 4OH0A 4Y0OA 3ZVWA 4OLDA 4E3KA 4DXCA 3I7JA 1NZOA 4K91A 1GHMA 1EWZA 2EX8A 1FOFA 4PM9A 5FQKA 1AXBA 3IWIA 3VP3A 1YMXA 3WS2A 3W4OA 4Y0TA 1YLWA 1KDWA 4DDYA 5CRFA 2A49A 5CEBA 2OV5A 4GB7A 1JTDA 3HLBA 1PZPA 2Z2LB 5GLCA 4DE1A 5GHYA 2ZQCA 5HL1A 1PWCA 1YLYA 3UO9A 3ZG5A 4E3MA 2ZM0A 2X01A 3N8LA 1BUEA 3UN7A 4LV2A 3G34A 4OP8A 1MBLA 4KZBA 2PBYA 1MPLA 1K4FA 3DW0A 1BSGA 1JVJA 5DTSA 1PZOA 2DRWA 2H10A 1OMEA 2HDSA 2Y2HA 4N1XA 5CERA 4KG5A 4WBGA 1Z6FA 3GQZA 2Y2PA 4KZ9A 3LCEA 1QMEA 5FI2A 3M6BA 2Y2IA 4XXRA 2WAEA 4OOLA 3N7WA 3O88A 2ZM2A 1BZAA 3GMWA 3ZVTA 1PIOA 4OPZA 3N4IA 2PU2A 1ZG6A 3N8SA 4M3KA 4S2OA 3FV7A 3PAEA 4P87A 1TVFA 2H0TA 5AQ7A 1XGJA 3SH8A 1YMSA 1TDLA 3NIAA 5CEDA 1KDSA 1KE4A 1IKIA 5DF7A 1MWTA 1BLCA 5FQQA 1XGIA 1G6AA 4C6YA 5F1FA 1MXOA 3WS4A 4GZBA 2OLVA 3ZG0A 4BENA 4GDNA 4DDSA 2H5SA 3DTMA 1NXYA 3Q82A 1E25A 3UNWA 3VP1A 3RJUA 1RGZA 4S2KA 2JBFA 4FH2A 4MBHA 2C5WB 3LEZA 4KZ6A 4RA7A 4KQQA 3BLMA 1LI0A 1E3UA 2Y4AA 4DE3A 2A3UA 4B4XA 3IXBA 3MKFA 4C75A 2Y55A 3C4OA 2V20A 3IF5A 5DF8A 3SS4A 3PBRA 1KVLA 4U3TA 4Q8IA 5FA7A 1LL9A 4R4RA
chains in the Genus database with same CATH superfamily
2XD5A 4LGWA 2Y2KA 2JN7A 3Q7VB 2FH5A 5D3OA 3A3JA 4RX3A 2QWSA 3IF6A 1Y54A 2HP9A 3P09A 1K56D 1YLJA 3WRZA 1MKIA 1XA1A 3MMHA 5K5BA 1T19A 1K55A 4X68A 1ACFA 2Y91A 3CAXA 2Y2QA 3RFBA 3OOVA 1MWRA 5FQMA 4GDBA 1NYMA 2Y8HA 5TJJA 5F82A 4PAUA 1DP6A 4MCWA 4P85A 4BBUA 3V3SA 2PD8A 5L8MA 1XA7A 4S2JA 4OQIA 1SCWA 3DWZA 2VGLM 3VSLA 2VEAA 3IBJA 2O9BA 1LLBA 3UB5P 3EEAA 4E3JA 4MLLA 5CHJA 1F5MA 3CI6A 2H28A 4R70A 4O8GA 4H6JA 3S1YA 4L9GA 2HJEA 2ZC3B 1E4DA 3GVBA 1KGFA 4JF6A 5E43A 4Y0UA 1SKFA 1UGUA 4KZ4A 1HTZA 3A3FA 4YOFA 4R0QA 5G18A 4DKIA 2EXBA 4D2OA 3BFGA 4X25A 5HPIA 2B18A 1O07A 3VSKA 4PKYA 5HAQA 5CHUA 1ONGA 3UE3A 3FKWA 4PM7A 4OKPA 4JGOA 3NHQA 3C7UA 3O5YA 2EFUA 3AGDA 1EROA 3HL9A 3SZTA 1I2WA 2ZJ9A 4WL9A 2I72A 4LV1A 3MQ0A 4CLCB 3IX3A 2OLUA 3T1XA 5AQ9A 1ONHA 4LCMA 3T4LA 1N9BA 3TG9A 3IHAA 4XUXA 3S22A 2UV0E 1MKMA 3BM6A 2VGKA 4GD8A 5DKKA 2R9XA 3Q07A 2WUQA 4WZ4A 3HUMA 1TS6A 5FAPA 3K3CA 4E6WA 1OJGA 1S0WA 2V2FF 5HARA 1T1CA 2VZWA 3IHBA 2YKFA 4S2NA 4IVIA 3OZHA 2WKIA 2K2NA 2QMIA 2VV7A 3WRTA 3MBZA 3G31A 1H8YA 3F1PA 5CECA 5HX9A 3LUQA 5JYPA 1S1YA 1E3UD 5J3WA 4JBFA 3ZDJA 4EBPA 1K4EA 3V67A 4QU3A 3ZFZA 4OPRA 4EV4A 3QP4A 1S6RA 5HL6A 3IS2A 1FSYA 5HZHA 1XP4A 2WKRA 2ZQAA 3PAGA 3Q81A 2CC1A 3MR0A 3A0RA 3TJZC 5J7EA 2EX9A 5DTKA 5HDCA 4PPRA 3T4OA 3KYZA 3FZCA 5F1GA 2IWCA 2MJ6A 4OQHA 1RGYA 1LSWA 1WA9A 1BULA 3E4PA 3G2YA 2HPBA 1OPXA 1TEMA 2XFSA 5AVEA 4OONA 2Q9NA 3A3EA 3GTCA 3MXQA 1N9NA 4NG2A 4HJ3A 3F1NA 4GS9B 4KENB 4QHCA 3W2ZA 3NJAA 2ZQ7A 4HP9A 5E2GA 3UPNA 1VETB 4GOGA 4II7A 3VP4A 1JTGA 4R3JA 4NXEA 3MFDA 4HHDA 2EXAA 1L0FA 1VB6A 4PM6A 5A91A 3N6IA 1QMFA 1YLPA 4ARZA 4OOMA 4XT2B 5CTNA 2J3TD 1XJ2A 3H7WB 5EPHA 3S7PA 3PBOA 4NXFA 4Y7PA 1IFQA 2BG1A 3HJKA 3E4OA 4E3NA 5F5YA 4BLMA 2VJWA 5G4ZA 2Y2NA 3IH8A 3WWXA 3KO6A 4I3JA 4OLGA 3VV4A 1S4SA 4FSFA 1VM1A 4HNBA 2RCXA 1TF1A 4IUHA 5HWVA 3GDIA 2W0NA 4KQOA 2PYRA 3NDEA 1IYQA 3MQOA 2GNXA 2O9CA 2Q9MA 2Z6CA 4R1GA 5DTTA 4BD0A 4JGRA 2OAP1 1K57C 4WZ5C 2E8JA 2L0WA 3IF6C 5KMWA 3A0VA 1ES3A 5FAOA 5L2FA 1VEUB 1K6SA 2AVXA 4RVAA 4PKYG 5EVIA 4I38A 4BMWA 1TS0A 2HP6A 2O99A 1K54C 3LIEA 4XUZA 5E2EA 2JHEA 2VV6A 4Y13A 2LB9A 3T4QA 2ZC5B 3FWLA 1V9ZA 3GECA 3KYQA 4U0XA 5IU1A 3NI9A 4EESA 1BLHA 3IWOA 2JC7A 4KZ7A 4KG2A 1CF0A 4JXVA 1W7FA 2ZC7A 3BY8A 2W3FA 1YKDA 4OH0A 2P04A 1GHMA 1AXBA 3KSIA 4ETZA 4HH3A 2K7SA 3HLBA 2Z2LB 5GHYA 3LEQA 2ZM0A 1ZTUA 3UN7A 3G34A 2ZL1B 4I3AA 1JVJA 1PZOA 2V1AA 3IBRA 3LCEA 5FI2A 3A0SA 2Y2IA 5HDDA 4XXRA 1S4RA 4Y15A 2WAEA 2VLGA 3O88A 2ZM2A 1XFQA 3LI9A 3IX8A 1PIOA 4I3IA 3N4IA 5EVEA 4M3KA 3FV7A 3PAEA 5AQ7A 1XGJA 1TDLA 3NIAA 2V0UA 1KDSA 1BLCA 5F1FA 1MXOA 4GZBA 2OLVA 4DDSA 1OTEA 3Q82A 3BWLA 1RGZA 4RA7A 2C5WB 2ZMVA 4DE3A 2A3UA 2INWA 4C75A 2XSSA 3LICA 2XA7M 3DBAA 4R4RA 5EV0A 5M19A 4OOYA 1L0EA 3UY6A 3VE4A 1Q2PA 2QHKA 1DY6A 1YQSA 2HF6A 4ZJ1A 1ES2A 1ZHHB 3IWQA 4UHUA 2WZZA 1OT6A 4BL3A 1JWVA 4UA6A 1NLYA 3GR2A 1H8ZA 2EFXA 3E98A 4LRXC 4EU0A 5DFYA 3ULFA 4LRZE 2EX2A 3LR3A 4GCZA 2C6WB 2W3GA 4N9LA 1TDGA 4F3LA 1L2SA 3CPTB 2WKPA 3BYDA 3ZYTA 2V8FA 3V3RA 2W1RA 4OP5A 4YINA 5U47A 5M18A 5HD5A 3W4PA 3T1SA 4E3LA 5GLBA 2HJ9C 1F98A 2Y2MA 4GNUA 1G28A 3BECA 1ZC2A 2JKGA 5FATA 4CLCE 5M1AA 3RXXA 4L9FA 4EW7A 3LI8A 4B4ZA 4E3OA 3BFFA 2GJ3A 1CI8A 4P0MA 5GLDA 2XF3A 4X69A 3D72A 1NJ4A 5E2HA 5L10A 5HD3A 3UPPA 4Q0HA 5FDHA 2XDMA 5A92A 2J80A 4JF5A 1PWDA 1PRQA 4RYEA 2QKPA 4HBUA 1FCNA 2XK1A 1P0ZA 5HWWA 4X1MA 4L0LA 3GV9A 4GJ4A 4KZ3A 5FI6A 2DNSA 4CPKA 1T1AA 3NOUC 2QJ7A 5EVLA 3T4TA 2WZXA 3ZNYA 3JYIA 4EBLA 1K57A 4WZ5A 3S7OA 3ZHHA 2JE5A 3KYEA 1IEMA 1DJAA 4NEED 2WAFA 3QP8A 3U2AA 1GSVA 3LIDA 5EVIC 3UDXA 4MN5A 1W79A 3QHYA 4FTXA 5LBRA 3R7WB 4ZJ2A 3OC2A 3BRMA 2KOIA 3OCNA 4WUJA 1K54A 5AQAA 1ERQA 3BY9A 4RQ9A 5HAPA 4UA9A 3EGDC 5KSHA 4DN0A 4NETA 2P74A 4WM9A 3C30A 3ITAA 3RH8B 1S67L 5DFXA 1S1ZA 4B88A 4MBKA 3Q7VA 4QB8A 2GDNA 2QPNA 2Q0OA 4JXWA 3VP2A 4DJ2A 1LT0A 3VFHA 1I2SA 3MFXA 2Y59A 3UDIA 3G32A 3P01A 5I5LA 3D4FA 3PHYA 1PI5A 4S2IA 4R4SA 3LO7A 4MMNA 5TGFA 1L0GA 4WF0A 4B9OA 2EX6A 3AGFA 4EUVA 2PD7A 3P98A 3FC7A 3OPHA 3OLOA 3MQQA 2IWBA 4HJ4A 4H8RA 2M7VA 3CUEC 2KLIA 1CK3A 2WADA 5HPFA 3PBQA 3DAVA 3BLSA 3L9KA 3SS5A 4LENA 3F1OB 1RP5A 1C3BA 4OQGA 2ZMFA 3ZQ5A 4HIAA 3MJQA 4PM5A 1X0OA 3K2NA 3VMAA 3HLFA 3E2KA 5TBMB 4S2LA 2JKRI 4FD8A 3BFEA 3HJIA 2IWDA 2V8CA 2ZC4B 4GN2A 1ESIA 2WK0A 3MZFA 4YFMA 5F83A 1YM1A 1DP8A 4LFUA 1HLUP 3O3VA 1DJBA 1WE4A 1SDNA 3C38A 1W63M 5TFQA 2ZQ8A 4QJGA 3ZCZA 3CJMA 3HUNA 4HQAA 1JWZA 4GHIB 4RX2A 1NRFA 2WYXA 4FH4A 1TD5A 1DP9A 1ERMA 3HREA 3V39A 3TSGA 2PU4A 2IA2A 3L7HA 1NYYA 3MSHA 1G5UA 4CLCA 4KG6A 3W4QA 4E3IA 1D1JA 1OTDA 1CEGA 3M6HA 4IBRA 2VGLS 3ITBA 1SKOB 2EWVA 3BFDA 5HFOA 3NDGA 3S4XA 1PYYA 2PR5A 5FEFA 1MWSA 3PTEA 3UB6A 4EERA 5DVAA 3NOPC 5HAIA 4R6LA 2DCFA 3OPLA 4IHQA 4Z9QA 3IQAA 3M2KA 4DXBA 2XH9A 4Y0OA 4E3KA 2W1TB 1EWZA 4KQDA 4PM9A 3IWIA 3WS2A 1KDWA 2A49A 3B42A 4G3KA 4ETXA 5HL1A 5GLCA 3FG8A 3UO9A 3ZG5A 3N8LA 1BUEA 4OP8A 1MBLA 4KZBA 3T4SA 3C8CA 5DTSA 2DRWA 4EEPA 2OOLA 2HDSA 4JGPA 2OWHA 3GQZA 1QMEA 4OPZA 2PU2A 1ZG6A 4Y17A 3CHWP 2VKSA 3BQ8A 4S2OA 3LYXA 5IT5A 4HP4A 4P87A 4GS9A 5CEDA 2JKRM 5FQQA 5AVFA 3ZG0A 3DTMA 1VETA 1E25A 3VP1A 3RJUA 1N9LA 4S2KA 4FH2A 4MBHA 1OT9A 3LEZA 4HH2A 1LI0A 2Y4AA 4BBTA 4B4XA 4G3WA 5DF8A 3H9WA 4Q8IA 2KDKA 4UQIS 4XT2A 4MN7A 5FA7A 4X1LA 4L9EA 2I9VA 3LY4A 3MXRA 1A0KA 3HLCA 3H7WA 3FPWA 1DJCA 1L0DA 4S2PA 1P9WA 4DMZA 1KGEA 1MZUA 4HJ6A 4N92A 1ALQA 4WMCA 3MXSA 3HLEA 5HW3A 1SZVA 2RL3A 3PBNA 1F2KA 2QZ6A 3OPPA 4LRYC 1ZG4A 1TS8A 5KZHA 2P08A 2G7UA 1CI9A 4HEFA 5GL9A 1IYPA 1LSXA 3UMDA 4KUKA 1J3WA 1IELA 5GHZA 3U4LP 5C5KA 3G6OA 5EVID 4EEUA 1VHMA 2WGIA 1NZUA 1VEUA 3OCLA 1H3QA 4LV0A 4OQ0A 3V5MA 4EBNA 4WMCD 4HBTA 1KVMA 5CHMA 3MZDA 4I5SA 1K6RA 3CWFA 3BEBA 2VV8A 3SS3A 3CUEA 3H82B 2EWWA 1OTBA 2PT7A 3QP6A 2P9VB 1PWGA 4U0TA 3LR5A 1BT5A 3CZDA 3B33A 4PMAA 1XFNA 2VGJA 3ISGA 3G30A 5KIZA 3SOIA 1YPRA 3N8RA 1GA9A 3NECA 1WYBA 2WGWB 5FASA 2ZQ9A 1YLZA 3IXGA 1ODVA 4KUOA 5CX7A 3VOYA 1YT4A 2WKQA 1SHVA 1HD8A 4EQIA 3MS6A 2ZL1A 3PBTA 2W3HA 3SH9A 4WYYA 3GRJA 1Q2QA 1FCOA 2JCHA 3HLWA 2O0YA 3G2ZA 4UA7A 3EQVA 3VP0A 1K38A 1P9RA 2NUPC 4WEJA 1PNEA 5HSQA 1M6KA 3UE1A 3TRCA 4CLCC 3QP5A 2XROA 3JVVA 4R3AA 5CGSA 2HDRA 3QNBA 4Y2FA 2G2UA 4HI4A 4P6BA 4EUZA 4JLFA 4FOFA 4ZBEA 2VA0A 2CMNA 5AJGA 4IJGA 3RXWA 5E2FA 4C3QA 3ZGAB 5DKLA 3PYPA 3NULA 3PBSA 3OPRA 2Y79A 4NXBA 4EQ1A 4OPQA 4AFIA 3JVUA 1YSPA 4WELA 4JGQA 3LR0A 1MY8A 2A24B 4IEDA 3EQUA 1STZA 1LHYA 4ID4A 3LIAA 2JKFA 3MKEA 1CQAA 2J9OA 1VQQA 4YNRA 2J3TC 5EUAA 5MC7A 4WN5A 1G6OA 4JXGA 5F6AA 1LL8A 2Y2JA 2HV1A 5EECA 1GCEA 3E0YA 5IHVA 5DJTA 4LV3A 2PDRA 1MWUA 1S66L 5F68A 1CEFA 3CPTA 3C5AA 4X6TA 2WKEA 4ME4A 1W8YA 3S7NA 5AQBA 2HP5A 2O9AA 4GD6A 3BW6A 4Q0JA 2XFTA 3IF6B 3O87A 2PRFA 4X55A 2X02A 2L4RA 4DRTA 1K56A 1PW8A 1HZOA 1JWPA 2WGVA 1IYOA 4ZTKA 1LL5A 3FPVA 5GHXA 5DJUA 3T1RA 2DMWA 3C7VA 1W8QA 5FSRA 1IYSA 2ACGA 1NWZA 2J9PA 2ZC6B 3IH9A 4X56A 1Z09A 5EOOA 3LIFA 4ZJ3A 3C4PA 1M40A 1XKZA 3UMEA 4Z1WA 4F94A 1CJFA 2B02A 3UB7A 1FILA 4JF4A 2XR0A 1GA0A 2OAQ1 4H6JB 5EM0A 3S7QA 5KSCA 1T18A 3HBRA 3W8KA 5CGWA 4HY8A 1ES5A 1I5QA 2X71A 4P6ZS 3KX0X 4UAAA 1ES4A 1XPBA 3KSGA 4EXOA 2G2WA 2XGNA 1Y4OA 1K25A 3HLGA 2XQZA 3ZVWA 3I7JA 3R7WA 4K91A 2OWJA 3VP3A 1T1BA 4QWOA 4Y0TA 3EGXC 1YLWA 5CRFA 5CEBA 4GLQA 1N9OA 4GB7A 1JTDA 1PZPA 4DE1A 1NRJA 2PYPA 1YLYA 4E3MA 2EA9A 4M4XA 2PBYA 1K4FA 5FEGA 1OJ5A 1YSQA 5CERA 1Z6FA 3UB9A 3M6BA 2GX5A 5FL3A 4DJ3A 4OOLA 3N7WA 3GMWA 3ZVTA 5EFWA 3N8SA 3TW8A 2H0TA 2PHYA 3F1PB 4EETB 1KE4A 1MWTA 4Q0IA 4C6YA 3WS4A 4GDNA 2B95A 3UNWA 1H0MA 1KOUA 4KZ6A 2D01A 4KQQA 2W3EA 3BLMA 1E3UA 3IXBA 2Y55A 2K31A 3C4OA 3VE3A 3IF5A 3IS2B 3SS4A 4WLAA 4ESPA 2V9AA 2XRNA 2VK3A 2M1CA 3F1OA 3D9YA 3UE0A 2V1BA 4QPRA 3CLOA 3Q7ZA 5TR7A 3R4KA 5TBMA 3A3DA 1O7EA 2XLNA 3NC8A 3ZNTA 4IVKA 5A90A 2R78A 5EOEA 3WS5A 2LB5A 3F1NB 4DF6A 1D06A 1UWPX 1KE3A 5BOHA 4PM8A 1G68A 4UQIM 4Y5FA 5G4YA 5IS1A 1SDEA 2R9WA 4GHIA 4LCLA 2PR6A 4NKPA 1HVBA 4R23A 4GW9A 5EM1A 4DE2A 4ARZB 1H8MA 1W5DA 3HUOA 4CLCD 4R3BA 3QNCA 3K3DA 2J7VA 3QP1A 4MEZA 4ZRRA 4OVDA 1BLPA 1N4OA 1JNUA 4MNRA 4N9KA 5A93A 1BTLA 2UWXA 4ZDXA 1IOUA 1SKOA 1OTIA 1GSXA 3ICYA 4K0XA 1V9YA 1XXMA 1F9IA 3A3IA 5FDSA 4K0WA 1PW1A 4JPMA 2BASA 4HOIA 3V50A 3NOTC 3KSFA 2W1TA 1J9MA 1WYCA 2JKTI 2PBDP 3G35A 2E8IA 4QY5A 2V0WA 1UWNX 4IUKA 3D3OA 5EE8A 5FQJA 3PR6A 5EVIB 3G4PA 3CITA 5HWTA 2W3DA 3CMZA 3ZG9B 5I94A 2BLSA 3SW1A 1U60A 2ZD8A 3B3XA 4JXSA 5CGXA 3M2JA 1BLSA 1MC0A 3CG5A 3DTIA 4S2MA 5L07A 4BD1A 3O86A 1NLZA 1GHIA 1D7EA 2FZ0A 2ZOIA 1P97A 3HLDA 1FQGA 3OBFA 4G3VA 4MDZA 3BQAA 4FUWA 4O7DA 4CJNA 4MBFA 2HDQA 4MN6A 2W27A 3HVFA 4HESA 2V1ZA 1K55C 3ZG7B 1ZKJA 2YKHA 4UEYA 2ZLYA 4NK3A 2Z6DA 1NY0A 1GHPA 1YLTA 3VOZA 4DE0A 1YAXA 3SH7A 4KQRA 4GKUA 4E04A 5FAQA 2WKHA 2Z2MB 5FQ9A 4BL2A 1FR6A 4FCFA 1L3LA 2H0YA 2J3WA 2XEPA 3Q1FA 5GLAA 3BFCA 3LY3A 3UDFA 3DTEA 4K08A 3IXHA 4QD4A 5DF9A 5HDSA 2HZ5A 3UB8A 3LFVA 1LSVA 5F69A 1GSWA 4IBXA 3VFFA 1IKGA 3P7NA 3E2LA 1H5XA 4A5RA 2FFFB 1FR1A 3T1QB 4N1HA 1FCMA 4KZAA 1PI4A 4R38A 2XD1A 3EEHA 3IXDA 3UE6A 4X53A 2ZM8A 4BJPA 3HCYA 2FFYA 3MZEA 4I39A 2Y2GA 4D60A 3GSGA 4JKTA 2B5RA 2JKTM 1KE0A 1Y28A 2ZMAA 3DWKA 1XJ4A 1OTAA 1EI5A 2A2LA 3FYZA 3NCKA 1ESUA 5CXWA 4KZ8A 3ZG8B 5A8BA 5L09A 4WEKA 1KGGA 1XJ6A 3H82A 5FI7A 3JPUA 4QY6A 2P9VA 3TOIA 3WS0A 3IT9A 1DRMA 2QYBA 1K0KA 5FQIA 1RCJA 3LIBA 3FKVA 4F3LB 3T4KA 4S2NC 3PXPA 3LGOA 2Y2OA 2ZQDA 4EWFA 2PAVP 2WGWA 3TE8A 4KZ5A 5JYOA 2Y2LA 3MF0A 5CTMA 4ZAMA 4NXGA 4OPYA 4CQHA 2ZBBA 3NBLA 4PHTA 1FIKA 2L1MA 4BQMA 3DTKA 2OSUA 3NY4A 5J8XA 3BJNA 1BYWA 1LI9A 2VX8A 1XX2A 1PFLA 3EWKA 2J8YA 1FSWA 3AGEA 3KSHA 2QJ5A 4B93A 4E6XA 2BTFP 3T12B 2HDUA 3WS1A 3UPOA 3C2WA 2M7UA 1W63Q 4OLDA 4DXCA 1NZOA 2EX8A 1FOFA 5FQKA 3RTYA 1YMXA 3W4OA 2GZAA 4DDYA 2OV5A 2ZQCA 1PWCA 2X01A 4P6ZM 4LV2A 5J4EA 1MPLA 2D02A 3DW0A 2P7JA 1BSGA 4N1XA 2H10A 2Y2HA 1OMEA 4KG5A 4WBGA 3E4QA 2Y2PA 4KZ9A 3B47A 1XJ3A 4LLOB 3T50A 2A24A 1BZAA 4Y3IA 2XA7S 2HGVA 3EOIA 1TVFA 4LPZA 3VOLA 3SH8A 1YMSA 3QP2A 2NUTC 5DF7A 1IKIA 1XGIA 1G6AA 3T4JA 4BENA 4O0PA 2H5SA 1NXYA 2JBFA 4BBVA 1TS7A 1AWIA 4YWZA 3LR4A 1EW0A 3MKFA 4BWIA 3IX4A 2V20A 2KX6A 3PBRA 1KVLA 4U3TA 4O01A 1LL9A 2ZOHA
chains in the Genus database with same CATH topology
5M19A 4OOYA 3LY4A 2XD5A 3MXRA 2Y2KA 3UE0A 3HLCA 3Q7VB 1L0EA 3UY6A 5D3OA 1Q2PA 1DY6A 1YQSA 3A3JA 3Q7ZA 4RX3A 5TR7A 4ZJ1A 1DJCA 1ES2A 3A3DA 1L0DA 1O7EA 2XLNA 3IF6A 3NC8A 4S2PA 3ZNTA 4IVKA 5A90A 1Y54A 2HP9A 3P09A 1K56D 1KGEA 1YLJA 3IWQA 4UHUA 3WRZA 1MKIA 2WZZA 1XA1A 4N92A 4X68A 1K55A 5EOEA 1ALQA 2Y91A 4WMCA 3WS5A 4BL3A 3MXSA 2Y2QA 4DF6A 1JWVA 4UA6A 3HLEA 1MWRA 5FQMA 1KE3A 5BOHA 5HW3A 2RL3A 4GDBA 4PM8A 3GR2A 3PBNA 1G68A 1NYMA 2QZ6A 3OPPA 1H8ZA 2EFXA 5F82A 1SDEA 1ZG4A 2R9WA 5KZHA 2EX2A 4P85A 2C6WB 4LCLA 4N9LA 3V3SA 1CI9A 4HEFA 1XA7A 1TDGA 1IYPA 1L2SA 5GL9A 4S2JA 1HVBA 1IELA 1SCWA 3BYDA 4OQIA 4R23A 5GHZA 4DE2A 3DWZA 3V3RA 1W5DA 3HUOA 4OP5A 5EVID 4R3BA 3VSLA 3QNCA 2WGIA 1LLBA 1NZUA 4YINA 5U47A 3OCLA 4E3JA 2J7VA 4MLLA 5M18A 5CHJA 4MEZA 4LV0A 4OQ0A 4OVDA 1BLPA 1N4OA 4MNRA 4N9KA 3V5MA 3W4PA 4EBNA 5A93A 4E3LA 1BTLA 4WMCD 5GLBA 3S1YA 2UWXA 4HBTA 4ZDXA 2ZC3B 1KVMA 1E4DA 2Y2MA 5CHMA 3MZDA 1K6RA 4GNUA 3BEBA 3GVBA 1KGFA 3BECA 1ZC2A 4JF6A 4K0XA 5FATA 5E43A 4Y0UA 1SKFA 3SS3A 5M1AA 4KZ4A 3RXXA 1HTZA 2P9VB 3A3FA 1PWGA 4B4ZA 4U0TA 4E3OA 1XXMA 3BFFA 4P0MA 1CI8A 5GLDA 2XF3A 4R0QA 5G18A 4DKIA 3A3IA 4X69A 2EXBA 4D2OA 1BT5A 3BFGA 3CZDA 1NJ4A 5E2HA 4K0WA 4PMAA 2VGJA 1O07A 1PW1A 3ISGA 4JPMA 3VSKA 3G30A 5HAQA 5CHUA 3UPPA 3V50A 5FDHA 3SOIA 1ONGA 2XDMA 5A92A 4JF5A 1PWDA 3UE3A 3N8RA 4RYEA 1GA9A 3FKWA 4PM7A 4OKPA 1J9MA 1WYCA 1WYBA 4HBUA 1FCNA 3C7UA 2XK1A 2EFUA 3AGDA 3G35A 1EROA 2E8IA 3HL9A 2WGWB 1I2WA 2ZJ9A 4QY5A 5FASA 2I72A 4LV1A 4L0LA 2ZQ9A 3GV9A 1YLZA 3IXGA 5EE8A 5FQJA 5EVIB 2OLUA 4KZ3A 3G4PA 3VOYA 1YT4A 5FI6A 1SHVA 1HD8A 3CMZA 2DNSA 5AQ9A 3ZG9B 5I94A 4EQIA 1ONHA 2BLSA 4CPKA 3PBTA 4LCMA 1U60A 2ZD8A 3SH9A 4WYYA 1N9BA 3GRJA 3TG9A 3B3XA 4JXSA 5CGXA 1Q2QA 3IHAA 3M2JA 4XUXA 3S22A 1FCOA 3BM6A 2VGKA 2JCHA 3HLWA 1BLSA 4GD8A 5EVLA 3CG5A 3G2ZA 2R9XA 3Q07A 2WZXA 2WUQA 4UA7A 4S2MA 4WZ4A 3EQVA 3ZNYA 3VP0A 3HUMA 1K38A 3O86A 4BD1A 3JYIA 5FAPA 4EBLA 1K57A 4E6WA 4WEJA 4WZ5A 1GHIA 1S0WA 2V2FF 5HARA 3ZHHA 2JE5A 4S2NA 3IHBA 1IEMA 1DJAA 4IVIA 3OZHA 1M6KA 3UE1A 2WKIA 2WAFA 1FQGA 3HLDA 2QMIA 5EVIC 3MBZA 3UDXA 3WRTA 5CGSA 2HDRA 3G31A 1H8YA 3QNBA 5CECA 1W79A 4O7DA 2G2UA 4CJNA 4MBFA 3QHYA 2HDQA 5HX9A 4P6BA 4ZJ2A 3HVFA 4HESA 2V1ZA 4EUZA 4JLFA 4ZBEA 3OC2A 3BRMA 5JYPA 1E3UD 1K55C 3OCNA 5AQAA 1K54A 3ZG7B 1ZKJA 3RXWA 5E2FA 1ERQA 4JBFA 3ZDJA 4C3QA 4EBPA 1K4EA 4QU3A 3ZGAB 5HAPA 3ZFZA 4OPRA 4EV4A 4UA9A 3PBSA 3OPRA 1S6RA 2ZLYA 1FSYA 4NK3A 5KSHA 1XP4A 1NY0A 4NETA 1GHPA 2P74A 2ZQAA 3ITAA 3PAGA 2CC1A 3Q81A 1YLTA 4OPQA 4WM9A 3VOZA 4DE0A 2EX9A 5DTKA 4PPRA 4B88A 3SH7A 3FZCA 4MBKA 5F1GA 3Q7VA 4KQRA 4QB8A 2IWCA 2GDNA 4GKUA 2QPNA 4JXWA 4OQHA 4WELA 5FAQA 1RGYA 3VP2A 2WKHA 3VFHA 1BULA 1I2SA 1MY8A 2Y59A 2Z2MB 3UDIA 5FQ9A 4BL2A 1FR6A 4IEDA 3EQUA 4FCFA 1LHYA 3G2YA 4ID4A 3G32A 2HPBA 3MKEA 1TEMA 2XFSA 2J9OA 4OONA 3D4FA 1VQQA 2H0YA 1PI5A 2Q9NA 2XEPA 3A3EA 3Q1FA 4S2IA 3GTCA 5EUAA 4R4SA 3BFCA 3LY3A 3LO7A 5GLAA 3UDFA 3IXHA 4QD4A 5DF9A 5TGFA 4JXGA 1L0GA 4KENB 4QHCA 2EX6A 2ZQ7A 3AGFA 2Y2JA 3P98A 5EECA 3OPHA 1GCEA 5E2GA 3UPNA 4GOGA 2IWBA 5IHVA 3VP4A 4H8RA 4IBXA 4LV3A 3VFFA 1JTGA 4R3JA 1MWUA 3MFDA 1CK3A 2WADA 2EXAA 1IKGA 1CEFA 1L0FA 3E2LA 1H5XA 4A5RA 2FFFB 1FR1A 4PM6A 4N1HA 5A91A 1FCMA 3PBQA 4KZAA 3N6IA 3C5AA 1PI4A 4X6TA 3BLSA 2XD1A 1QMFA 1YLPA 3IXDA 4X53A 2ZM8A 4OOMA 3SS5A 4LENA 4BJPA 2WKEA 2FFYA 5CTNA 1RP5A 1C3BA 4OQGA 3MZEA 2Y2GA 3GSGA 5EPHA 4PM5A 3PBOA 4JKTA 1W8YA 3VMAA 2B5RA 5AQBA 2HP5A 1KE0A 4GD6A 4Y7PA 3HLFA 2ZMAA 3E2KA 4S2LA 2BG1A 2XFTA 3BFEA 4FD8A 3DWKA 2IWDA 3IF6B 3O87A 1EI5A 4BLMA 4E3NA 2Y2NA 3FYZA 2ZC4B 1ESUA 3IH8A 3NCKA 1ESIA 2WK0A 4GN2A 4X55A 3WWXA 2X02A 3MZFA 4YFMA 5F83A 4OLGA 5CXWA 1YM1A 4FSFA 4KZ8A 3ZG8B 1VM1A 4DRTA 3O3VA 1K56A 2RCXA 4WEKA 1KGGA 5FI7A 1DJBA 1WE4A 1SDNA 1PW8A 4QY6A 1HZOA 1JWPA 2P9VA 2WGVA 3TOIA 3WS0A 3IT9A 1IYOA 4ZTKA 5TFQA 1LL5A 4KQOA 2ZQ8A 3NDEA 4QJGA 1IYQA 3ZCZA 5GHXA 2Q9MA 3CJMA 3C7VA 3HUNA 5FQIA 1JWZA 4R1GA 5DTTA 1W8QA 4RX2A 4BD0A 5FSRA 1RCJA 1K57C 1NRFA 2WYXA 1IYSA 2J9PA 3FKVA 4WZ5C 4FH4A 2ZC6B 1ERMA 3IH9A 4S2NC 4X56A 5EOOA 3HREA 3IF6C 2Y2OA 3V39A 3TSGA 5KMWA 2PU4A 4ZJ3A 1ES3A 2ZQDA 3C4PA 5FAOA 4EWFA 2WGWA 5L2FA 1NYYA 4KZ5A 1M40A 5JYOA 2Y2LA 1K6SA 4RVAA 4KG6A 1XKZA 3W4QA 4E3IA 5EVIA 4F94A 2HP6A 5CTMA 4ZAMA 1CEGA 3M6HA 4JF4A 2XR0A 4OPYA 1GA0A 1K54C 4IBRA 4XUZA 5E2EA 3ITBA 3NBLA 5KSCA 3HBRA 3BFDA 5CGWA 3W8KA 4BQMA 5HFOA 2OSUA 3NY4A 5J8XA 2ZC5B 3NDGA 3S4XA 1PYYA 3FWLA 4U0XA 1LI9A 1MWSA 3NI9A 1BLHA 3IWOA 3PTEA 1ES5A 1I5QA 1XX2A 2X71A 2JC7A 2J8YA 1FSWA 4KZ7A 4KG2A 4UAAA 3AGEA 1ES4A 4JXVA 1W7FA 1XPBA 2ZC7A 5DVAA 5HAIA 4E6XA 2DCFA 3OPLA 2G2WA 2HDUA 2XGNA 1K25A 4Z9QA 3WS1A 3IQAA 3HLGA 3M2KA 3UPOA 4DXBA 2XQZA 2XH9A 4OH0A 4Y0OA 3ZVWA 4OLDA 4E3KA 4DXCA 3I7JA 1NZOA 4K91A 1GHMA 1EWZA 2EX8A 1FOFA 4PM9A 5FQKA 1AXBA 3IWIA 3VP3A 1YMXA 3WS2A 3W4OA 4Y0TA 1YLWA 1KDWA 4DDYA 5CRFA 2A49A 5CEBA 2OV5A 4GB7A 1JTDA 3HLBA 1PZPA 2Z2LB 5GLCA 4DE1A 5GHYA 2ZQCA 5HL1A 1PWCA 1YLYA 3UO9A 3ZG5A 4E3MA 2ZM0A 2X01A 3N8LA 1BUEA 3UN7A 4LV2A 3G34A 4OP8A 1MBLA 4KZBA 2PBYA 1MPLA 1K4FA 3DW0A 1BSGA 1JVJA 5DTSA 1PZOA 2DRWA 2H10A 1OMEA 2HDSA 2Y2HA 4N1XA 5CERA 4KG5A 4WBGA 1Z6FA 3GQZA 2Y2PA 4KZ9A 3LCEA 1QMEA 5FI2A 3M6BA 2Y2IA 4XXRA 2WAEA 4OOLA 3N7WA 3O88A 2ZM2A 1BZAA 3GMWA 3ZVTA 1PIOA 4OPZA 3N4IA 2PU2A 1ZG6A 3N8SA 4M3KA 4S2OA 3FV7A 3PAEA 4P87A 1TVFA 2H0TA 5AQ7A 1XGJA 3SH8A 1YMSA 1TDLA 3NIAA 5CEDA 1KDSA 1KE4A 1IKIA 5DF7A 1MWTA 1BLCA 5FQQA 1XGIA 1G6AA 4C6YA 5F1FA 1MXOA 3WS4A 4GZBA 2OLVA 3ZG0A 4BENA 4GDNA 4DDSA 2H5SA 3DTMA 1NXYA 3Q82A 1E25A 3UNWA 3VP1A 3RJUA 1RGZA 4S2KA 2JBFA 4FH2A 4MBHA 2C5WB 3LEZA 4KZ6A 4RA7A 4KQQA 3BLMA 1LI0A 1E3UA 2Y4AA 4DE3A 2A3UA 4B4XA 3IXBA 3MKFA 4C75A 2Y55A 3C4OA 2V20A 3IF5A 5DF8A 3SS4A 3PBRA 1KVLA 4U3TA 4Q8IA 5FA7A 1LL9A 4R4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M19 A;  4OOY A;  3LY4 A;  2XD5 A;  3MXR A;  2Y2K A;  3UE0 A;  3HLC A;  3Q7V B;  1L0E A;  3UY6 A;  5D3O A;  1Q2P A;  1DY6 A;  1YQS A;  3A3J A;  3Q7Z A;  4RX3 A;  5TR7 A;  4ZJ1 A;  1DJC A;  1ES2 A;  3A3D A;  1L0D A;  1O7E A;  2XLN A;  3IF6 A;  3NC8 A;  4S2P A;  3ZNT A;  4IVK A;  5A90 A;  1Y54 A;  2HP9 A;  3P09 A;  1K56 D;  1KGE A;  1YLJ A;  3IWQ A;  4UHU A;  3WRZ A;  1MKI A;  2WZZ A;  1XA1 A;  4N92 A;  4X68 A;  1K55 A;  5EOE A;  1ALQ A;  2Y91 A;  4WMC A;  3WS5 A;  4BL3 A;  3MXS A;  2Y2Q A;  4DF6 A;  1JWV A;  4UA6 A;  3HLE A;  1MWR A;  5FQM A;  1KE3 A;  5BOH A;  5HW3 A;  2RL3 A;  4GDB A;  4PM8 A;  3GR2 A;  3PBN A;  1G68 A;  1NYM A;  2QZ6 A;  3OPP A;  1H8Z A;  2EFX A;  5F82 A;  1SDE A;  1ZG4 A;  2R9W A;  5KZH A;  2EX2 A;  4P85 A;  2C6W B;  4LCL A;  4N9L A;  3V3S A;  1CI9 A;  4HEF A;  1XA7 A;  1TDG A;  1IYP A;  1L2S A;  5GL9 A;  4S2J A;  1HVB A;  1IEL A;  1SCW A;  3BYD A;  4OQI A;  4R23 A;  5GHZ A;  4DE2 A;  3DWZ A;  3V3R A;  1W5D A;  3HUO A;  4OP5 A;  5EVI D;  4R3B A;  3VSL A;  3QNC A;  2WGI A;  1LLB A;  1NZU A;  4YIN A;  5U47 A;  3OCL A;  4E3J A;  2J7V A;  4MLL A;  5M18 A;  5CHJ A;  4MEZ A;  4LV0 A;  4OQ0 A;  4OVD A;  1BLP A;  1N4O A;  4MNR A;  4N9K A;  3V5M A;  3W4P A;  4EBN A;  5A93 A;  4E3L A;  1BTL A;  4WMC D;  5GLB A;  3S1Y A;  2UWX A;  4HBT A;  4ZDX A;  2ZC3 B;  1KVM A;  1E4D A;  2Y2M A;  5CHM A;  3MZD A;  1K6R A;  4GNU A;  3BEB A;  3GVB A;  1KGF A;  3BEC A;  1ZC2 A;  4JF6 A;  4K0X A;  5FAT A;  5E43 A;  4Y0U A;  1SKF A;  3SS3 A;  5M1A A;  4KZ4 A;  3RXX A;  1HTZ A;  2P9V B;  3A3F A;  1PWG A;  4B4Z A;  4U0T A;  4E3O A;  1XXM A;  3BFF A;  4P0M A;  1CI8 A;  5GLD A;  2XF3 A;  4R0Q A;  5G18 A;  4DKI A;  3A3I A;  4X69 A;  2EXB A;  4D2O A;  1BT5 A;  3BFG A;  3CZD A;  1NJ4 A;  5E2H A;  4K0W A;  4PMA A;  2VGJ A;  1O07 A;  1PW1 A;  3ISG A;  4JPM A;  3VSK A;  3G30 A;  5HAQ A;  5CHU A;  3UPP A;  3V50 A;  5FDH A;  3SOI A;  1ONG A;  2XDM A;  5A92 A;  4JF5 A;  1PWD A;  3UE3 A;  3N8R A;  4RYE A;  1GA9 A;  3FKW A;  4PM7 A;  4OKP A;  1J9M A;  1WYC A;  1WYB A;  4HBU A;  1FCN A;  3C7U A;  2XK1 A;  2EFU A;  3AGD A;  3G35 A;  1ERO A;  2E8I A;  3HL9 A;  2WGW B;  1I2W A;  2ZJ9 A;  4QY5 A;  5FAS A;  2I72 A;  4LV1 A;  4L0L A;  2ZQ9 A;  3GV9 A;  1YLZ A;  3IXG A;  5EE8 A;  5FQJ A;  5EVI B;  2OLU A;  4KZ3 A;  3G4P A;  3VOY A;  1YT4 A;  5FI6 A;  1SHV A;  1HD8 A;  3CMZ A;  2DNS A;  5AQ9 A;  3ZG9 B;  5I94 A;  4EQI A;  1ONH A;  2BLS A;  4CPK A;  3PBT A;  4LCM A;  1U60 A;  2ZD8 A;  3SH9 A;  4WYY A;  1N9B A;  3GRJ A;  3TG9 A;  3B3X A;  4JXS A;  5CGX A;  1Q2Q A;  3IHA A;  3M2J A;  4XUX A;  3S22 A;  1FCO A;  3BM6 A;  2VGK A;  2JCH A;  3HLW A;  1BLS A;  4GD8 A;  5EVL A;  3CG5 A;  3G2Z A;  2R9X A;  3Q07 A;  2WZX A;  2WUQ A;  4UA7 A;  4S2M A;  4WZ4 A;  3EQV A;  3ZNY A;  3VP0 A;  3HUM A;  1K38 A;  3O86 A;  4BD1 A;  3JYI A;  5FAP A;  4EBL A;  1K57 A;  4E6W A;  4WEJ A;  4WZ5 A;  1GHI A;  1S0W A;  2V2F F;  5HAR A;  3ZHH A;  2JE5 A;  4S2N A;  3IHB A;  1IEM A;  1DJA A;  4IVI A;  3OZH A;  1M6K A;  3UE1 A;  2WKI A;  2WAF A;  1FQG A;  3HLD A;  2QMI A;  5EVI C;  3MBZ A;  3UDX A;  3WRT A;  5CGS A;  2HDR A;  3G31 A;  1H8Y A;  3QNB A;  5CEC A;  1W79 A;  4O7D A;  2G2U A;  4CJN A;  4MBF A;  3QHY A;  2HDQ A;  5HX9 A;  4P6B A;  4ZJ2 A;  3HVF A;  4HES A;  2V1Z A;  4EUZ A;  4JLF A;  4ZBE A;  3OC2 A;  3BRM A;  5JYP A;  1E3U D;  1K55 C;  3OCN A;  5AQA A;  1K54 A;  3ZG7 B;  1ZKJ A;  3RXW A;  5E2F A;  1ERQ A;  4JBF A;  3ZDJ A;  4C3Q A;  4EBP A;  1K4E A;  4QU3 A;  3ZGA B;  5HAP A;  3ZFZ A;  4OPR A;  4EV4 A;  4UA9 A;  3PBS A;  3OPR A;  1S6R A;  2ZLY A;  1FSY A;  4NK3 A;  5KSH A;  1XP4 A;  1NY0 A;  4NET A;  1GHP A;  2P74 A;  2ZQA A;  3ITA A;  3PAG A;  2CC1 A;  3Q81 A;  1YLT A;  4OPQ A;  4WM9 A;  3VOZ A;  4DE0 A;  2EX9 A;  5DTK A;  4PPR A;  4B88 A;  3SH7 A;  3FZC A;  4MBK A;  5F1G A;  3Q7V A;  4KQR A;  4QB8 A;  2IWC A;  2GDN A;  4GKU A;  2QPN A;  4JXW A;  4OQH A;  4WEL A;  5FAQ A;  1RGY A;  3VP2 A;  2WKH A;  3VFH A;  1BUL A;  1I2S A;  1MY8 A;  2Y59 A;  2Z2M B;  3UDI A;  5FQ9 A;  4BL2 A;  1FR6 A;  4IED A;  3EQU A;  4FCF A;  1LHY A;  3G2Y A;  4ID4 A;  3G32 A;  2HPB A;  3MKE A;  1TEM A;  2XFS A;  2J9O A;  4OON A;  3D4F A;  1VQQ A;  2H0Y A;  1PI5 A;  2Q9N A;  2XEP A;  3A3E A;  3Q1F A;  4S2I A;  3GTC A;  5EUA A;  4R4S A;  3BFC A;  3LY3 A;  3LO7 A;  5GLA A;  3UDF A;  3IXH A;  4QD4 A;  5DF9 A;  5TGF A;  4JXG A;  1L0G A;  4KEN B;  4QHC A;  2EX6 A;  2ZQ7 A;  3AGF A;  2Y2J A;  3P98 A;  5EEC A;  3OPH A;  1GCE A;  5E2G A;  3UPN A;  4GOG A;  2IWB A;  5IHV A;  3VP4 A;  4H8R A;  4IBX A;  4LV3 A;  3VFF A;  1JTG A;  4R3J A;  1MWU A;  3MFD A;  1CK3 A;  2WAD A;  2EXA A;  1IKG A;  1CEF A;  1L0F A;  3E2L A;  1H5X A;  4A5R A;  2FFF B;  1FR1 A;  4PM6 A;  4N1H A;  5A91 A;  1FCM A;  3PBQ A;  4KZA A;  3N6I A;  3C5A A;  1PI4 A;  4X6T A;  3BLS A;  2XD1 A;  1QMF A;  1YLP A;  3IXD A;  4X53 A;  2ZM8 A;  4OOM A;  3SS5 A;  4LEN A;  4BJP A;  2WKE A;  2FFY A;  5CTN A;  1RP5 A;  1C3B A;  4OQG A;  3MZE A;  2Y2G A;  3GSG A;  5EPH A;  4PM5 A;  3PBO A;  4JKT A;  1W8Y A;  3VMA A;  2B5R A;  5AQB A;  2HP5 A;  1KE0 A;  4GD6 A;  4Y7P A;  3HLF A;  2ZMA A;  3E2K A;  4S2L A;  2BG1 A;  2XFT A;  3BFE A;  4FD8 A;  3DWK A;  2IWD A;  3IF6 B;  3O87 A;  1EI5 A;  4BLM A;  4E3N A;  2Y2N A;  3FYZ A;  2ZC4 B;  1ESU A;  3IH8 A;  3NCK A;  1ESI A;  2WK0 A;  4GN2 A;  4X55 A;  3WWX A;  2X02 A;  3MZF A;  4YFM A;  5F83 A;  4OLG A;  5CXW A;  1YM1 A;  4FSF A;  4KZ8 A;  3ZG8 B;  1VM1 A;  4DRT A;  3O3V A;  1K56 A;  2RCX A;  4WEK A;  1KGG A;  5FI7 A;  1DJB A;  1WE4 A;  1SDN A;  1PW8 A;  4QY6 A;  1HZO A;  1JWP A;  2P9V A;  2WGV A;  3TOI A;  3WS0 A;  3IT9 A;  1IYO A;  4ZTK A;  5TFQ A;  1LL5 A;  4KQO A;  2ZQ8 A;  3NDE A;  4QJG A;  1IYQ A;  3ZCZ A;  5GHX A;  2Q9M A;  3CJM A;  3C7V A;  3HUN A;  5FQI A;  1JWZ A;  4R1G A;  5DTT A;  1W8Q A;  4RX2 A;  4BD0 A;  5FSR A;  1RCJ A;  1K57 C;  1NRF A;  2WYX A;  1IYS A;  2J9P A;  3FKV A;  4WZ5 C;  4FH4 A;  2ZC6 B;  1ERM A;  3IH9 A;  4S2N C;  4X56 A;  5EOO A;  3HRE A;  3IF6 C;  2Y2O A;  3V39 A;  3TSG A;  5KMW A;  2PU4 A;  4ZJ3 A;  1ES3 A;  2ZQD A;  3C4P A;  5FAO A;  4EWF A;  2WGW A;  5L2F A;  1NYY A;  4KZ5 A;  1M40 A;  5JYO A;  2Y2L A;  1K6S A;  4RVA A;  4KG6 A;  1XKZ A;  3W4Q A;  4E3I A;  5EVI A;  4F94 A;  2HP6 A;  5CTM A;  4ZAM A;  1CEG A;  3M6H A;  4JF4 A;  2XR0 A;  4OPY A;  1GA0 A;  1K54 C;  4IBR A;  4XUZ A;  5E2E A;  3ITB A;  3NBL A;  5KSC A;  3HBR A;  3BFD A;  5CGW A;  3W8K A;  4BQM A;  5HFO A;  2OSU A;  3NY4 A;  5J8X A;  2ZC5 B;  3NDG A;  3S4X A;  1PYY A;  3FWL A;  4U0X A;  1LI9 A;  1MWS A;  3NI9 A;  1BLH A;  3IWO A;  3PTE A;  1ES5 A;  1I5Q A;  1XX2 A;  2X71 A;  2JC7 A;  2J8Y A;  1FSW A;  4KZ7 A;  4KG2 A;  4UAA A;  3AGE A;  1ES4 A;  4JXV A;  1W7F A;  1XPB A;  2ZC7 A;  5DVA A;  5HAI A;  4E6X A;  2DCF A;  3OPL A;  2G2W A;  2HDU A;  2XGN A;  1K25 A;  4Z9Q A;  3WS1 A;  3IQA A;  3HLG A;  3M2K A;  3UPO A;  4DXB A;  2XQZ A;  2XH9 A;  4OH0 A;  4Y0O A;  3ZVW A;  4OLD A;  4E3K A;  4DXC A;  3I7J A;  1NZO A;  4K91 A;  1GHM A;  1EWZ A;  2EX8 A;  1FOF A;  4PM9 A;  5FQK A;  1AXB A;  3IWI A;  3VP3 A;  1YMX A;  3WS2 A;  3W4O A;  4Y0T A;  1YLW A;  1KDW A;  4DDY A;  5CRF A;  2A49 A;  5CEB A;  2OV5 A;  4GB7 A;  1JTD A;  3HLB A;  1PZP A;  2Z2L B;  5GLC A;  4DE1 A;  5GHY A;  2ZQC A;  5HL1 A;  1PWC A;  1YLY A;  3UO9 A;  3ZG5 A;  4E3M A;  2ZM0 A;  2X01 A;  3N8L A;  1BUE A;  3UN7 A;  4LV2 A;  3G34 A;  4OP8 A;  1MBL A;  4KZB A;  2PBY A;  1MPL A;  1K4F A;  3DW0 A;  1BSG A;  1JVJ A;  5DTS A;  1PZO A;  2DRW A;  2H10 A;  1OME A;  2HDS A;  2Y2H A;  4N1X A;  5CER A;  4KG5 A;  4WBG A;  1Z6F A;  3GQZ A;  2Y2P A;  4KZ9 A;  3LCE A;  1QME A;  5FI2 A;  3M6B A;  2Y2I A;  4XXR A;  2WAE A;  4OOL A;  3N7W A;  3O88 A;  2ZM2 A;  1BZA A;  3GMW A;  3ZVT A;  1PIO A;  4OPZ A;  3N4I A;  2PU2 A;  1ZG6 A;  3N8S A;  4M3K A;  4S2O A;  3FV7 A;  3PAE A;  4P87 A;  1TVF A;  2H0T A;  5AQ7 A;  1XGJ A;  3SH8 A;  1YMS A;  1TDL A;  3NIA A;  5CED A;  1KDS A;  1KE4 A;  1IKI A;  5DF7 A;  1MWT A;  1BLC A;  5FQQ A;  1XGI A;  1G6A A;  4C6Y A;  5F1F A;  1MXO A;  3WS4 A;  4GZB A;  2OLV A;  3ZG0 A;  4BEN A;  4GDN A;  4DDS A;  2H5S A;  3DTM A;  1NXY A;  3Q82 A;  1E25 A;  3UNW A;  3VP1 A;  3RJU A;  1RGZ A;  4S2K A;  2JBF A;  4FH2 A;  4MBH A;  2C5W B;  3LEZ A;  4KZ6 A;  4RA7 A;  4KQQ A;  3BLM A;  1LI0 A;  1E3U A;  2Y4A A;  4DE3 A;  2A3U A;  4B4X A;  3IXB A;  3MKF A;  4C75 A;  2Y55 A;  3C4O A;  2V20 A;  3IF5 A;  5DF8 A;  3SS4 A;  3PBR A;  1KVL A;  4U3T A;  4Q8I A;  5FA7 A;  1LL9 A;  4R4R A; 
#chains in the Genus database with same CATH topology
 2XD5 A;  4LGW A;  2Y2K A;  2JN7 A;  3Q7V B;  2FH5 A;  5D3O A;  3A3J A;  4RX3 A;  2QWS A;  3IF6 A;  1Y54 A;  2HP9 A;  3P09 A;  1K56 D;  1YLJ A;  3WRZ A;  1MKI A;  1XA1 A;  3MMH A;  5K5B A;  1T19 A;  1K55 A;  4X68 A;  1ACF A;  2Y91 A;  3CAX A;  2Y2Q A;  3RFB A;  3OOV A;  1MWR A;  5FQM A;  4GDB A;  1NYM A;  2Y8H A;  5TJJ A;  5F82 A;  4PAU A;  1DP6 A;  4MCW A;  4P85 A;  4BBU A;  3V3S A;  2PD8 A;  5L8M A;  1XA7 A;  4S2J A;  4OQI A;  1SCW A;  3DWZ A;  2VGL M;  3VSL A;  2VEA A;  3IBJ A;  2O9B A;  1LLB A;  3UB5 P;  3EEA A;  4E3J A;  4MLL A;  5CHJ A;  1F5M A;  3CI6 A;  2H28 A;  4R70 A;  4O8G A;  4H6J A;  3S1Y A;  4L9G A;  2HJE A;  2ZC3 B;  1E4D A;  3GVB A;  1KGF A;  4JF6 A;  5E43 A;  4Y0U A;  1SKF A;  1UGU A;  4KZ4 A;  1HTZ A;  3A3F A;  4YOF A;  4R0Q A;  5G18 A;  4DKI A;  2EXB A;  4D2O A;  3BFG A;  4X25 A;  5HPI A;  2B18 A;  1O07 A;  3VSK A;  4PKY A;  5HAQ A;  5CHU A;  1ONG A;  3UE3 A;  3FKW A;  4PM7 A;  4OKP A;  4JGO A;  3NHQ A;  3C7U A;  3O5Y A;  2EFU A;  3AGD A;  1ERO A;  3HL9 A;  3SZT A;  1I2W A;  2ZJ9 A;  4WL9 A;  2I72 A;  4LV1 A;  3MQ0 A;  4CLC B;  3IX3 A;  2OLU A;  3T1X A;  5AQ9 A;  1ONH A;  4LCM A;  3T4L A;  1N9B A;  3TG9 A;  3IHA A;  4XUX A;  3S22 A;  2UV0 E;  1MKM A;  3BM6 A;  2VGK A;  4GD8 A;  5DKK A;  2R9X A;  3Q07 A;  2WUQ A;  4WZ4 A;  3HUM A;  1TS6 A;  5FAP A;  3K3C A;  4E6W A;  1OJG A;  1S0W A;  2V2F F;  5HAR A;  1T1C A;  2VZW A;  3IHB A;  2YKF A;  4S2N A;  4IVI A;  3OZH A;  2WKI A;  2K2N A;  2QMI A;  2VV7 A;  3WRT A;  3MBZ A;  3G31 A;  1H8Y A;  3F1P A;  5CEC A;  5HX9 A;  3LUQ A;  5JYP A;  1S1Y A;  1E3U D;  5J3W A;  4JBF A;  3ZDJ A;  4EBP A;  1K4E A;  3V67 A;  4QU3 A;  3ZFZ A;  4OPR A;  4EV4 A;  3QP4 A;  1S6R A;  5HL6 A;  3IS2 A;  1FSY A;  5HZH A;  1XP4 A;  2WKR A;  2ZQA A;  3PAG A;  3Q81 A;  2CC1 A;  3MR0 A;  3A0R A;  3TJZ C;  5J7E A;  2EX9 A;  5DTK A;  5HDC A;  4PPR A;  3T4O A;  3KYZ A;  3FZC A;  5F1G A;  2IWC A;  2MJ6 A;  4OQH A;  1RGY A;  1LSW A;  1WA9 A;  1BUL A;  3E4P A;  3G2Y A;  2HPB A;  1OPX A;  1TEM A;  2XFS A;  5AVE A;  4OON A;  2Q9N A;  3A3E A;  3GTC A;  3MXQ A;  1N9N A;  4NG2 A;  4HJ3 A;  3F1N A;  4GS9 B;  4KEN B;  4QHC A;  3W2Z A;  3NJA A;  2ZQ7 A;  4HP9 A;  5E2G A;  3UPN A;  1VET B;  4GOG A;  4II7 A;  3VP4 A;  1JTG A;  4R3J A;  4NXE A;  3MFD A;  4HHD A;  2EXA A;  1L0F A;  1VB6 A;  4PM6 A;  5A91 A;  3N6I A;  1QMF A;  1YLP A;  4ARZ A;  4OOM A;  4XT2 B;  5CTN A;  2J3T D;  1XJ2 A;  3H7W B;  5EPH A;  3S7P A;  3PBO A;  4NXF A;  4Y7P A;  1IFQ A;  2BG1 A;  3HJK A;  3E4O A;  4E3N A;  5F5Y A;  4BLM A;  2VJW A;  5G4Z A;  2Y2N A;  3IH8 A;  3WWX A;  3KO6 A;  4I3J A;  4OLG A;  3VV4 A;  1S4S A;  4FSF A;  1VM1 A;  4HNB A;  2RCX A;  1TF1 A;  4IUH A;  5HWV A;  3GDI A;  2W0N A;  4KQO A;  2PYR A;  3NDE A;  1IYQ A;  3MQO A;  2GNX A;  2O9C A;  2Q9M A;  2Z6C A;  4R1G A;  5DTT A;  4BD0 A;  4JGR A;  2OAP 1;  1K57 C;  4WZ5 C;  2E8J A;  2L0W A;  3IF6 C;  5KMW A;  3A0V A;  1ES3 A;  5FAO A;  5L2F A;  1VEU B;  1K6S A;  2AVX A;  4RVA A;  4PKY G;  5EVI A;  4I38 A;  4BMW A;  1TS0 A;  2HP6 A;  2O99 A;  1K54 C;  3LIE A;  4XUZ A;  5E2E A;  2JHE A;  2VV6 A;  4Y13 A;  2LB9 A;  3T4Q A;  2ZC5 B;  3FWL A;  1V9Z A;  3GEC A;  3KYQ A;  4U0X A;  5IU1 A;  3NI9 A;  4EES A;  1BLH A;  3IWO A;  2JC7 A;  4KZ7 A;  4KG2 A;  1CF0 A;  4JXV A;  1W7F A;  2ZC7 A;  3BY8 A;  2W3F A;  1YKD A;  4OH0 A;  2P04 A;  1GHM A;  1AXB A;  3KSI A;  4ETZ A;  4HH3 A;  2K7S A;  3HLB A;  2Z2L B;  5GHY A;  3LEQ A;  2ZM0 A;  1ZTU A;  3UN7 A;  3G34 A;  2ZL1 B;  4I3A A;  1JVJ A;  1PZO A;  2V1A A;  3IBR A;  3LCE A;  5FI2 A;  3A0S A;  2Y2I A;  5HDD A;  4XXR A;  1S4R A;  4Y15 A;  2WAE A;  2VLG A;  3O88 A;  2ZM2 A;  1XFQ A;  3LI9 A;  3IX8 A;  1PIO A;  4I3I A;  3N4I A;  5EVE A;  4M3K A;  3FV7 A;  3PAE A;  5AQ7 A;  1XGJ A;  1TDL A;  3NIA A;  2V0U A;  1KDS A;  1BLC A;  5F1F A;  1MXO A;  4GZB A;  2OLV A;  4DDS A;  1OTE A;  3Q82 A;  3BWL A;  1RGZ A;  4RA7 A;  2C5W B;  2ZMV A;  4DE3 A;  2A3U A;  2INW A;  4C75 A;  2XSS A;  3LIC A;  2XA7 M;  3DBA A;  4R4R A;  5EV0 A;  5M19 A;  4OOY A;  1L0E A;  3UY6 A;  3VE4 A;  1Q2P A;  2QHK A;  1DY6 A;  1YQS A;  2HF6 A;  4ZJ1 A;  1ES2 A;  1ZHH B;  3IWQ A;  4UHU A;  2WZZ A;  1OT6 A;  4BL3 A;  1JWV A;  4UA6 A;  1NLY A;  3GR2 A;  1H8Z A;  2EFX A;  3E98 A;  4LRX C;  4EU0 A;  5DFY A;  3ULF A;  4LRZ E;  2EX2 A;  3LR3 A;  4GCZ A;  2C6W B;  2W3G A;  4N9L A;  1TDG A;  4F3L A;  1L2S A;  3CPT B;  2WKP A;  3BYD A;  3ZYT A;  2V8F A;  3V3R A;  2W1R A;  4OP5 A;  4YIN A;  5U47 A;  5M18 A;  5HD5 A;  3W4P A;  3T1S A;  4E3L A;  5GLB A;  2HJ9 C;  1F98 A;  2Y2M A;  4GNU A;  1G28 A;  3BEC A;  1ZC2 A;  2JKG A;  5FAT A;  4CLC E;  5M1A A;  3RXX A;  4L9F A;  4EW7 A;  3LI8 A;  4B4Z A;  4E3O A;  3BFF A;  2GJ3 A;  1CI8 A;  4P0M A;  5GLD A;  2XF3 A;  4X69 A;  3D72 A;  1NJ4 A;  5E2H A;  5L10 A;  5HD3 A;  3UPP A;  4Q0H A;  5FDH A;  2XDM A;  5A92 A;  2J80 A;  4JF5 A;  1PWD A;  1PRQ A;  4RYE A;  2QKP A;  4HBU A;  1FCN A;  2XK1 A;  1P0Z A;  5HWW A;  4X1M A;  4L0L A;  3GV9 A;  4GJ4 A;  4KZ3 A;  5FI6 A;  2DNS A;  4CPK A;  1T1A A;  3NOU C;  2QJ7 A;  5EVL A;  3T4T A;  2WZX A;  3ZNY A;  3JYI A;  4EBL A;  1K57 A;  4WZ5 A;  3S7O A;  3ZHH A;  2JE5 A;  3KYE A;  1IEM A;  1DJA A;  4NEE D;  2WAF A;  3QP8 A;  3U2A A;  1GSV A;  3LID A;  5EVI C;  3UDX A;  4MN5 A;  1W79 A;  3QHY A;  4FTX A;  5LBR A;  3R7W B;  4ZJ2 A;  3OC2 A;  3BRM A;  2KOI A;  3OCN A;  4WUJ A;  1K54 A;  5AQA A;  1ERQ A;  3BY9 A;  4RQ9 A;  5HAP A;  4UA9 A;  3EGD C;  5KSH A;  4DN0 A;  4NET A;  2P74 A;  4WM9 A;  3C30 A;  3ITA A;  3RH8 B;  1S67 L;  5DFX A;  1S1Z A;  4B88 A;  4MBK A;  3Q7V A;  4QB8 A;  2GDN A;  2QPN A;  2Q0O A;  4JXW A;  3VP2 A;  4DJ2 A;  1LT0 A;  3VFH A;  1I2S A;  3MFX A;  2Y59 A;  3UDI A;  3G32 A;  3P01 A;  5I5L A;  3D4F A;  3PHY A;  1PI5 A;  4S2I A;  4R4S A;  3LO7 A;  4MMN A;  5TGF A;  1L0G A;  4WF0 A;  4B9O A;  2EX6 A;  3AGF A;  4EUV A;  2PD7 A;  3P98 A;  3FC7 A;  3OPH A;  3OLO A;  3MQQ A;  2IWB A;  4HJ4 A;  4H8R A;  2M7V A;  3CUE C;  2KLI A;  1CK3 A;  2WAD A;  5HPF A;  3PBQ A;  3DAV A;  3BLS A;  3L9K A;  3SS5 A;  4LEN A;  3F1O B;  1RP5 A;  1C3B A;  4OQG A;  2ZMF A;  3ZQ5 A;  4HIA A;  3MJQ A;  4PM5 A;  1X0O A;  3K2N A;  3VMA A;  3HLF A;  3E2K A;  5TBM B;  4S2L A;  2JKR I;  4FD8 A;  3BFE A;  3HJI A;  2IWD A;  2V8C A;  2ZC4 B;  4GN2 A;  1ESI A;  2WK0 A;  3MZF A;  4YFM A;  5F83 A;  1YM1 A;  1DP8 A;  4LFU A;  1HLU P;  3O3V A;  1DJB A;  1WE4 A;  1SDN A;  3C38 A;  1W63 M;  5TFQ A;  2ZQ8 A;  4QJG A;  3ZCZ A;  3CJM A;  3HUN A;  4HQA A;  1JWZ A;  4GHI B;  4RX2 A;  1NRF A;  2WYX A;  4FH4 A;  1TD5 A;  1DP9 A;  1ERM A;  3HRE A;  3V39 A;  3TSG A;  2PU4 A;  2IA2 A;  3L7H A;  1NYY A;  3MSH A;  1G5U A;  4CLC A;  4KG6 A;  3W4Q A;  4E3I A;  1D1J A;  1OTD A;  1CEG A;  3M6H A;  4IBR A;  2VGL S;  3ITB A;  1SKO B;  2EWV A;  3BFD A;  5HFO A;  3NDG A;  3S4X A;  1PYY A;  2PR5 A;  5FEF A;  1MWS A;  3PTE A;  3UB6 A;  4EER A;  5DVA A;  3NOP C;  5HAI A;  4R6L A;  2DCF A;  3OPL A;  4IHQ A;  4Z9Q A;  3IQA A;  3M2K A;  4DXB A;  2XH9 A;  4Y0O A;  4E3K A;  2W1T B;  1EWZ A;  4KQD A;  4PM9 A;  3IWI A;  3WS2 A;  1KDW A;  2A49 A;  3B42 A;  4G3K A;  4ETX A;  5HL1 A;  5GLC A;  3FG8 A;  3UO9 A;  3ZG5 A;  3N8L A;  1BUE A;  4OP8 A;  1MBL A;  4KZB A;  3T4S A;  3C8C A;  5DTS A;  2DRW A;  4EEP A;  2OOL A;  2HDS A;  4JGP A;  2OWH A;  3GQZ A;  1QME A;  4OPZ A;  2PU2 A;  1ZG6 A;  4Y17 A;  3CHW P;  2VKS A;  3BQ8 A;  4S2O A;  3LYX A;  5IT5 A;  4HP4 A;  4P87 A;  4GS9 A;  5CED A;  2JKR M;  5FQQ A;  5AVF A;  3ZG0 A;  3DTM A;  1VET A;  1E25 A;  3VP1 A;  3RJU A;  1N9L A;  4S2K A;  4FH2 A;  4MBH A;  1OT9 A;  3LEZ A;  4HH2 A;  1LI0 A;  2Y4A A;  4BBT A;  4B4X A;  4G3W A;  5DF8 A;  3H9W A;  4Q8I A;  2KDK A;  4UQI S;  4XT2 A;  4MN7 A;  5FA7 A;  4X1L A;  4L9E A;  2I9V A;  3LY4 A;  3MXR A;  1A0K A;  3HLC A;  3H7W A;  3FPW A;  1DJC A;  1L0D A;  4S2P A;  1P9W A;  4DMZ A;  1KGE A;  1MZU A;  4HJ6 A;  4N92 A;  1ALQ A;  4WMC A;  3MXS A;  3HLE A;  5HW3 A;  1SZV A;  2RL3 A;  3PBN A;  1F2K A;  2QZ6 A;  3OPP A;  4LRY C;  1ZG4 A;  1TS8 A;  5KZH A;  2P08 A;  2G7U A;  1CI9 A;  4HEF A;  5GL9 A;  1IYP A;  1LSX A;  3UMD A;  4KUK A;  1J3W A;  1IEL A;  5GHZ A;  3U4L P;  5C5K A;  3G6O A;  5EVI D;  4EEU A;  1VHM A;  2WGI A;  1NZU A;  1VEU A;  3OCL A;  1H3Q A;  4LV0 A;  4OQ0 A;  3V5M A;  4EBN A;  4WMC D;  4HBT A;  1KVM A;  5CHM A;  3MZD A;  4I5S A;  1K6R A;  3CWF A;  3BEB A;  2VV8 A;  3SS3 A;  3CUE A;  3H82 B;  2EWW A;  1OTB A;  2PT7 A;  3QP6 A;  2P9V B;  1PWG A;  4U0T A;  3LR5 A;  1BT5 A;  3CZD A;  3B33 A;  4PMA A;  1XFN A;  2VGJ A;  3ISG A;  3G30 A;  5KIZ A;  3SOI A;  1YPR A;  3N8R A;  1GA9 A;  3NEC A;  1WYB A;  2WGW B;  5FAS A;  2ZQ9 A;  1YLZ A;  3IXG A;  1ODV A;  4KUO A;  5CX7 A;  3VOY A;  1YT4 A;  2WKQ A;  1SHV A;  1HD8 A;  4EQI A;  3MS6 A;  2ZL1 A;  3PBT A;  2W3H A;  3SH9 A;  4WYY A;  3GRJ A;  1Q2Q A;  1FCO A;  2JCH A;  3HLW A;  2O0Y A;  3G2Z A;  4UA7 A;  3EQV A;  3VP0 A;  1K38 A;  1P9R A;  2NUP C;  4WEJ A;  1PNE A;  5HSQ A;  1M6K A;  3UE1 A;  3TRC A;  4CLC C;  3QP5 A;  2XRO A;  3JVV A;  4R3A A;  5CGS A;  2HDR A;  3QNB A;  4Y2F A;  2G2U A;  4HI4 A;  4P6B A;  4EUZ A;  4JLF A;  4FOF A;  4ZBE A;  2VA0 A;  2CMN A;  5AJG A;  4IJG A;  3RXW A;  5E2F A;  4C3Q A;  3ZGA B;  5DKL A;  3PYP A;  3NUL A;  3PBS A;  3OPR A;  2Y79 A;  4NXB A;  4EQ1 A;  4OPQ A;  4AFI A;  3JVU A;  1YSP A;  4WEL A;  4JGQ A;  3LR0 A;  1MY8 A;  2A24 B;  4IED A;  3EQU A;  1STZ A;  1LHY A;  4ID4 A;  3LIA A;  2JKF A;  3MKE A;  1CQA A;  2J9O A;  1VQQ A;  4YNR A;  2J3T C;  5EUA A;  5MC7 A;  4WN5 A;  1G6O A;  4JXG A;  5F6A A;  1LL8 A;  2Y2J A;  2HV1 A;  5EEC A;  1GCE A;  3E0Y A;  5IHV A;  5DJT A;  4LV3 A;  2PDR A;  1MWU A;  1S66 L;  5F68 A;  1CEF A;  3CPT A;  3C5A A;  4X6T A;  2WKE A;  4ME4 A;  1W8Y A;  3S7N A;  5AQB A;  2HP5 A;  2O9A A;  4GD6 A;  3BW6 A;  4Q0J A;  2XFT A;  3IF6 B;  3O87 A;  2PRF A;  4X55 A;  2X02 A;  2L4R A;  4DRT A;  1K56 A;  1PW8 A;  1HZO A;  1JWP A;  2WGV A;  1IYO A;  4ZTK A;  1LL5 A;  3FPV A;  5GHX A;  5DJU A;  3T1R A;  2DMW A;  3C7V A;  1W8Q A;  5FSR A;  1IYS A;  2ACG A;  1NWZ A;  2J9P A;  2ZC6 B;  3IH9 A;  4X56 A;  1Z09 A;  5EOO A;  3LIF A;  4ZJ3 A;  3C4P A;  1M40 A;  1XKZ A;  3UME A;  4Z1W A;  4F94 A;  1CJF A;  2B02 A;  3UB7 A;  1FIL A;  4JF4 A;  2XR0 A;  1GA0 A;  2OAQ 1;  4H6J B;  5EM0 A;  3S7Q A;  5KSC A;  1T18 A;  3HBR A;  3W8K A;  5CGW A;  4HY8 A;  1ES5 A;  1I5Q A;  2X71 A;  4P6Z S;  3KX0 X;  4UAA A;  1ES4 A;  1XPB A;  3KSG A;  4EXO A;  2G2W A;  2XGN A;  1Y4O A;  1K25 A;  3HLG A;  2XQZ A;  3ZVW A;  3I7J A;  3R7W A;  4K91 A;  2OWJ A;  3VP3 A;  1T1B A;  4QWO A;  4Y0T A;  3EGX C;  1YLW A;  5CRF A;  5CEB A;  4GLQ A;  1N9O A;  4GB7 A;  1JTD A;  1PZP A;  4DE1 A;  1NRJ A;  2PYP A;  1YLY A;  4E3M A;  2EA9 A;  4M4X A;  2PBY A;  1K4F A;  5FEG A;  1OJ5 A;  1YSQ A;  5CER A;  1Z6F A;  3UB9 A;  3M6B A;  2GX5 A;  5FL3 A;  4DJ3 A;  4OOL A;  3N7W A;  3GMW A;  3ZVT A;  5EFW A;  3N8S A;  3TW8 A;  2H0T A;  2PHY A;  3F1P B;  4EET B;  1KE4 A;  1MWT A;  4Q0I A;  4C6Y A;  3WS4 A;  4GDN A;  2B95 A;  3UNW A;  1H0M A;  1KOU A;  4KZ6 A;  2D01 A;  4KQQ A;  2W3E A;  3BLM A;  1E3U A;  3IXB A;  2Y55 A;  2K31 A;  3C4O A;  3VE3 A;  3IF5 A;  3IS2 B;  3SS4 A;  4WLA A;  4ESP A;  2V9A A;  2XRN A;  2VK3 A;  2M1C A;  3F1O A;  3D9Y A;  3UE0 A;  2V1B A;  4QPR A;  3CLO A;  3Q7Z A;  5TR7 A;  3R4K A;  5TBM A;  3A3D A;  1O7E A;  2XLN A;  3NC8 A;  3ZNT A;  4IVK A;  5A90 A;  2R78 A;  5EOE A;  3WS5 A;  2LB5 A;  3F1N B;  4DF6 A;  1D06 A;  1UWP X;  1KE3 A;  5BOH A;  4PM8 A;  1G68 A;  4UQI M;  4Y5F A;  5G4Y A;  5IS1 A;  1SDE A;  2R9W A;  4GHI A;  4LCL A;  2PR6 A;  4NKP A;  1HVB A;  4R23 A;  4GW9 A;  5EM1 A;  4DE2 A;  4ARZ B;  1H8M A;  1W5D A;  3HUO A;  4CLC D;  4R3B A;  3QNC A;  3K3D A;  2J7V A;  3QP1 A;  4MEZ A;  4ZRR A;  4OVD A;  1BLP A;  1N4O A;  1JNU A;  4MNR A;  4N9K A;  5A93 A;  1BTL A;  2UWX A;  4ZDX A;  1IOU A;  1SKO A;  1OTI A;  1GSX A;  3ICY A;  4K0X A;  1V9Y A;  1XXM A;  1F9I A;  3A3I A;  5FDS A;  4K0W A;  1PW1 A;  4JPM A;  2BAS A;  4HOI A;  3V50 A;  3NOT C;  3KSF A;  2W1T A;  1J9M A;  1WYC A;  2JKT I;  2PBD P;  3G35 A;  2E8I A;  4QY5 A;  2V0W A;  1UWN X;  4IUK A;  3D3O A;  5EE8 A;  5FQJ A;  3PR6 A;  5EVI B;  3G4P A;  3CIT A;  5HWT A;  2W3D A;  3CMZ A;  3ZG9 B;  5I94 A;  2BLS A;  3SW1 A;  1U60 A;  2ZD8 A;  3B3X A;  4JXS A;  5CGX A;  3M2J A;  1BLS A;  1MC0 A;  3CG5 A;  3DTI A;  4S2M A;  5L07 A;  4BD1 A;  3O86 A;  1NLZ A;  1GHI A;  1D7E A;  2FZ0 A;  2ZOI A;  1P97 A;  3HLD A;  1FQG A;  3OBF A;  4G3V A;  4MDZ A;  3BQA A;  4FUW A;  4O7D A;  4CJN A;  4MBF A;  2HDQ A;  4MN6 A;  2W27 A;  3HVF A;  4HES A;  2V1Z A;  1K55 C;  3ZG7 B;  1ZKJ A;  2YKH A;  4UEY A;  2ZLY A;  4NK3 A;  2Z6D A;  1NY0 A;  1GHP A;  1YLT A;  3VOZ A;  4DE0 A;  1YAX A;  3SH7 A;  4KQR A;  4GKU A;  4E04 A;  5FAQ A;  2WKH A;  2Z2M B;  5FQ9 A;  4BL2 A;  1FR6 A;  4FCF A;  1L3L A;  2H0Y A;  2J3W A;  2XEP A;  3Q1F A;  5GLA A;  3BFC A;  3LY3 A;  3UDF A;  3DTE A;  4K08 A;  3IXH A;  4QD4 A;  5DF9 A;  5HDS A;  2HZ5 A;  3UB8 A;  3LFV A;  1LSV A;  5F69 A;  1GSW A;  4IBX A;  3VFF A;  1IKG A;  3P7N A;  3E2L A;  1H5X A;  4A5R A;  2FFF B;  1FR1 A;  3T1Q B;  4N1H A;  1FCM A;  4KZA A;  1PI4 A;  4R38 A;  2XD1 A;  3EEH A;  3IXD A;  3UE6 A;  4X53 A;  2ZM8 A;  4BJP A;  3HCY A;  2FFY A;  3MZE A;  4I39 A;  2Y2G A;  4D60 A;  3GSG A;  4JKT A;  2B5R A;  2JKT M;  1KE0 A;  1Y28 A;  2ZMA A;  3DWK A;  1XJ4 A;  1OTA A;  1EI5 A;  2A2L A;  3FYZ A;  3NCK A;  1ESU A;  5CXW A;  4KZ8 A;  3ZG8 B;  5A8B A;  5L09 A;  4WEK A;  1KGG A;  1XJ6 A;  3H82 A;  5FI7 A;  3JPU A;  4QY6 A;  2P9V A;  3TOI A;  3WS0 A;  3IT9 A;  1DRM A;  2QYB A;  1K0K A;  5FQI A;  1RCJ A;  3LIB A;  3FKV A;  4F3L B;  3T4K A;  4S2N C;  3PXP A;  3LGO A;  2Y2O A;  2ZQD A;  4EWF A;  2PAV P;  2WGW A;  3TE8 A;  4KZ5 A;  5JYO A;  2Y2L A;  3MF0 A;  5CTM A;  4ZAM A;  4NXG A;  4OPY A;  4CQH A;  2ZBB A;  3NBL A;  4PHT A;  1FIK A;  2L1M A;  4BQM A;  3DTK A;  2OSU A;  3NY4 A;  5J8X A;  3BJN A;  1BYW A;  1LI9 A;  2VX8 A;  1XX2 A;  1PFL A;  3EWK A;  2J8Y A;  1FSW A;  3AGE A;  3KSH A;  2QJ5 A;  4B93 A;  4E6X A;  2BTF P;  3T12 B;  2HDU A;  3WS1 A;  3UPO A;  3C2W A;  2M7U A;  1W63 Q;  4OLD A;  4DXC A;  1NZO A;  2EX8 A;  1FOF A;  5FQK A;  3RTY A;  1YMX A;  3W4O A;  2GZA A;  4DDY A;  2OV5 A;  2ZQC A;  1PWC A;  2X01 A;  4P6Z M;  4LV2 A;  5J4E A;  1MPL A;  2D02 A;  3DW0 A;  2P7J A;  1BSG A;  4N1X A;  2H10 A;  2Y2H A;  1OME A;  4KG5 A;  4WBG A;  3E4Q A;  2Y2P A;  4KZ9 A;  3B47 A;  1XJ3 A;  4LLO B;  3T50 A;  2A24 A;  1BZA A;  4Y3I A;  2XA7 S;  2HGV A;  3EOI A;  1TVF A;  4LPZ A;  3VOL A;  3SH8 A;  1YMS A;  3QP2 A;  2NUT C;  5DF7 A;  1IKI A;  1XGI A;  1G6A A;  3T4J A;  4BEN A;  4O0P A;  2H5S A;  1NXY A;  2JBF A;  4BBV A;  1TS7 A;  1AWI A;  4YWZ A;  3LR4 A;  1EW0 A;  3MKF A;  4BWI A;  3IX4 A;  2V20 A;  2KX6 A;  3PBR A;  1KVL A;  4U3T A;  4O01 A;  1LL9 A;  2ZOH A; 
#chains in the Genus database with same CATH homology
 5M19 A;  4OOY A;  3LY4 A;  2XD5 A;  3MXR A;  2Y2K A;  3UE0 A;  3HLC A;  3Q7V B;  1L0E A;  3UY6 A;  5D3O A;  1Q2P A;  1DY6 A;  1YQS A;  3A3J A;  3Q7Z A;  4RX3 A;  5TR7 A;  4ZJ1 A;  1DJC A;  1ES2 A;  3A3D A;  1L0D A;  1O7E A;  2XLN A;  3IF6 A;  3NC8 A;  4S2P A;  3ZNT A;  4IVK A;  5A90 A;  1Y54 A;  2HP9 A;  3P09 A;  1K56 D;  1KGE A;  1YLJ A;  3IWQ A;  4UHU A;  3WRZ A;  1MKI A;  2WZZ A;  1XA1 A;  4N92 A;  4X68 A;  1K55 A;  5EOE A;  1ALQ A;  2Y91 A;  4WMC A;  3WS5 A;  4BL3 A;  3MXS A;  2Y2Q A;  4DF6 A;  1JWV A;  4UA6 A;  3HLE A;  1MWR A;  5FQM A;  1KE3 A;  5BOH A;  5HW3 A;  2RL3 A;  4GDB A;  4PM8 A;  3GR2 A;  3PBN A;  1G68 A;  1NYM A;  2QZ6 A;  3OPP A;  1H8Z A;  2EFX A;  5F82 A;  1SDE A;  1ZG4 A;  2R9W A;  5KZH A;  2EX2 A;  4P85 A;  2C6W B;  4LCL A;  4N9L A;  3V3S A;  1CI9 A;  4HEF A;  1XA7 A;  1TDG A;  1IYP A;  1L2S A;  5GL9 A;  4S2J A;  1HVB A;  1IEL A;  1SCW A;  3BYD A;  4OQI A;  4R23 A;  5GHZ A;  4DE2 A;  3DWZ A;  3V3R A;  1W5D A;  3HUO A;  4OP5 A;  5EVI D;  4R3B A;  3VSL A;  3QNC A;  2WGI A;  1LLB A;  1NZU A;  4YIN A;  5U47 A;  3OCL A;  4E3J A;  2J7V A;  4MLL A;  5M18 A;  5CHJ A;  4MEZ A;  4LV0 A;  4OQ0 A;  4OVD A;  1BLP A;  1N4O A;  4MNR A;  4N9K A;  3V5M A;  3W4P A;  4EBN A;  5A93 A;  4E3L A;  1BTL A;  4WMC D;  5GLB A;  3S1Y A;  2UWX A;  4HBT A;  4ZDX A;  2ZC3 B;  1KVM A;  1E4D A;  2Y2M A;  5CHM A;  3MZD A;  1K6R A;  4GNU A;  3BEB A;  3GVB A;  1KGF A;  3BEC A;  1ZC2 A;  4JF6 A;  4K0X A;  5FAT A;  5E43 A;  4Y0U A;  1SKF A;  3SS3 A;  5M1A A;  4KZ4 A;  3RXX A;  1HTZ A;  2P9V B;  3A3F A;  1PWG A;  4B4Z A;  4U0T A;  4E3O A;  1XXM A;  3BFF A;  4P0M A;  1CI8 A;  5GLD A;  2XF3 A;  4R0Q A;  5G18 A;  4DKI A;  3A3I A;  4X69 A;  2EXB A;  4D2O A;  1BT5 A;  3BFG A;  3CZD A;  1NJ4 A;  5E2H A;  4K0W A;  4PMA A;  2VGJ A;  1O07 A;  1PW1 A;  3ISG A;  4JPM A;  3VSK A;  3G30 A;  5HAQ A;  5CHU A;  3UPP A;  3V50 A;  5FDH A;  3SOI A;  1ONG A;  2XDM A;  5A92 A;  4JF5 A;  1PWD A;  3UE3 A;  3N8R A;  4RYE A;  1GA9 A;  3FKW A;  4PM7 A;  4OKP A;  1J9M A;  1WYC A;  1WYB A;  4HBU A;  1FCN A;  3C7U A;  2XK1 A;  2EFU A;  3AGD A;  3G35 A;  1ERO A;  2E8I A;  3HL9 A;  2WGW B;  1I2W A;  2ZJ9 A;  4QY5 A;  5FAS A;  2I72 A;  4LV1 A;  4L0L A;  2ZQ9 A;  3GV9 A;  1YLZ A;  3IXG A;  5EE8 A;  5FQJ A;  5EVI B;  2OLU A;  4KZ3 A;  3G4P A;  3VOY A;  1YT4 A;  5FI6 A;  1SHV A;  1HD8 A;  3CMZ A;  2DNS A;  5AQ9 A;  3ZG9 B;  5I94 A;  4EQI A;  1ONH A;  2BLS A;  4CPK A;  3PBT A;  4LCM A;  1U60 A;  2ZD8 A;  3SH9 A;  4WYY A;  1N9B A;  3GRJ A;  3TG9 A;  3B3X A;  4JXS A;  5CGX A;  1Q2Q A;  3IHA A;  3M2J A;  4XUX A;  3S22 A;  1FCO A;  3BM6 A;  2VGK A;  2JCH A;  3HLW A;  1BLS A;  4GD8 A;  5EVL A;  3CG5 A;  3G2Z A;  2R9X A;  3Q07 A;  2WZX A;  2WUQ A;  4UA7 A;  4S2M A;  4WZ4 A;  3EQV A;  3ZNY A;  3VP0 A;  3HUM A;  1K38 A;  3O86 A;  4BD1 A;  3JYI A;  5FAP A;  4EBL A;  1K57 A;  4E6W A;  4WEJ A;  4WZ5 A;  1GHI A;  1S0W A;  2V2F F;  5HAR A;  3ZHH A;  2JE5 A;  4S2N A;  3IHB A;  1IEM A;  1DJA A;  4IVI A;  3OZH A;  1M6K A;  3UE1 A;  2WKI A;  2WAF A;  1FQG A;  3HLD A;  2QMI A;  5EVI C;  3MBZ A;  3UDX A;  3WRT A;  5CGS A;  2HDR A;  3G31 A;  1H8Y A;  3QNB A;  5CEC A;  1W79 A;  4O7D A;  2G2U A;  4CJN A;  4MBF A;  3QHY A;  2HDQ A;  5HX9 A;  4P6B A;  4ZJ2 A;  3HVF A;  4HES A;  2V1Z A;  4EUZ A;  4JLF A;  4ZBE A;  3OC2 A;  3BRM A;  5JYP A;  1E3U D;  1K55 C;  3OCN A;  5AQA A;  1K54 A;  3ZG7 B;  1ZKJ A;  3RXW A;  5E2F A;  1ERQ A;  4JBF A;  3ZDJ A;  4C3Q A;  4EBP A;  1K4E A;  4QU3 A;  3ZGA B;  5HAP A;  3ZFZ A;  4OPR A;  4EV4 A;  4UA9 A;  3PBS A;  3OPR A;  1S6R A;  2ZLY A;  1FSY A;  4NK3 A;  5KSH A;  1XP4 A;  1NY0 A;  4NET A;  1GHP A;  2P74 A;  2ZQA A;  3ITA A;  3PAG A;  2CC1 A;  3Q81 A;  1YLT A;  4OPQ A;  4WM9 A;  3VOZ A;  4DE0 A;  2EX9 A;  5DTK A;  4PPR A;  4B88 A;  3SH7 A;  3FZC A;  4MBK A;  5F1G A;  3Q7V A;  4KQR A;  4QB8 A;  2IWC A;  2GDN A;  4GKU A;  2QPN A;  4JXW A;  4OQH A;  4WEL A;  5FAQ A;  1RGY A;  3VP2 A;  2WKH A;  3VFH A;  1BUL A;  1I2S A;  1MY8 A;  2Y59 A;  2Z2M B;  3UDI A;  5FQ9 A;  4BL2 A;  1FR6 A;  4IED A;  3EQU A;  4FCF A;  1LHY A;  3G2Y A;  4ID4 A;  3G32 A;  2HPB A;  3MKE A;  1TEM A;  2XFS A;  2J9O A;  4OON A;  3D4F A;  1VQQ A;  2H0Y A;  1PI5 A;  2Q9N A;  2XEP A;  3A3E A;  3Q1F A;  4S2I A;  3GTC A;  5EUA A;  4R4S A;  3BFC A;  3LY3 A;  3LO7 A;  5GLA A;  3UDF A;  3IXH A;  4QD4 A;  5DF9 A;  5TGF A;  4JXG A;  1L0G A;  4KEN B;  4QHC A;  2EX6 A;  2ZQ7 A;  3AGF A;  2Y2J A;  3P98 A;  5EEC A;  3OPH A;  1GCE A;  5E2G A;  3UPN A;  4GOG A;  2IWB A;  5IHV A;  3VP4 A;  4H8R A;  4IBX A;  4LV3 A;  3VFF A;  1JTG A;  4R3J A;  1MWU A;  3MFD A;  1CK3 A;  2WAD A;  2EXA A;  1IKG A;  1CEF A;  1L0F A;  3E2L A;  1H5X A;  4A5R A;  2FFF B;  1FR1 A;  4PM6 A;  4N1H A;  5A91 A;  1FCM A;  3PBQ A;  4KZA A;  3N6I A;  3C5A A;  1PI4 A;  4X6T A;  3BLS A;  2XD1 A;  1QMF A;  1YLP A;  3IXD A;  4X53 A;  2ZM8 A;  4OOM A;  3SS5 A;  4LEN A;  4BJP A;  2WKE A;  2FFY A;  5CTN A;  1RP5 A;  1C3B A;  4OQG A;  3MZE A;  2Y2G A;  3GSG A;  5EPH A;  4PM5 A;  3PBO A;  4JKT A;  1W8Y A;  3VMA A;  2B5R A;  5AQB A;  2HP5 A;  1KE0 A;  4GD6 A;  4Y7P A;  3HLF A;  2ZMA A;  3E2K A;  4S2L A;  2BG1 A;  2XFT A;  3BFE A;  4FD8 A;  3DWK A;  2IWD A;  3IF6 B;  3O87 A;  1EI5 A;  4BLM A;  4E3N A;  2Y2N A;  3FYZ A;  2ZC4 B;  1ESU A;  3IH8 A;  3NCK A;  1ESI A;  2WK0 A;  4GN2 A;  4X55 A;  3WWX A;  2X02 A;  3MZF A;  4YFM A;  5F83 A;  4OLG A;  5CXW A;  1YM1 A;  4FSF A;  4KZ8 A;  3ZG8 B;  1VM1 A;  4DRT A;  3O3V A;  1K56 A;  2RCX A;  4WEK A;  1KGG A;  5FI7 A;  1DJB A;  1WE4 A;  1SDN A;  1PW8 A;  4QY6 A;  1HZO A;  1JWP A;  2P9V A;  2WGV A;  3TOI A;  3WS0 A;  3IT9 A;  1IYO A;  4ZTK A;  5TFQ A;  1LL5 A;  4KQO A;  2ZQ8 A;  3NDE A;  4QJG A;  1IYQ A;  3ZCZ A;  5GHX A;  2Q9M A;  3CJM A;  3C7V A;  3HUN A;  5FQI A;  1JWZ A;  4R1G A;  5DTT A;  1W8Q A;  4RX2 A;  4BD0 A;  5FSR A;  1RCJ A;  1K57 C;  1NRF A;  2WYX A;  1IYS A;  2J9P A;  3FKV A;  4WZ5 C;  4FH4 A;  2ZC6 B;  1ERM A;  3IH9 A;  4S2N C;  4X56 A;  5EOO A;  3HRE A;  3IF6 C;  2Y2O A;  3V39 A;  3TSG A;  5KMW A;  2PU4 A;  4ZJ3 A;  1ES3 A;  2ZQD A;  3C4P A;  5FAO A;  4EWF A;  2WGW A;  5L2F A;  1NYY A;  4KZ5 A;  1M40 A;  5JYO A;  2Y2L A;  1K6S A;  4RVA A;  4KG6 A;  1XKZ A;  3W4Q A;  4E3I A;  5EVI A;  4F94 A;  2HP6 A;  5CTM A;  4ZAM A;  1CEG A;  3M6H A;  4JF4 A;  2XR0 A;  4OPY A;  1GA0 A;  1K54 C;  4IBR A;  4XUZ A;  5E2E A;  3ITB A;  3NBL A;  5KSC A;  3HBR A;  3BFD A;  5CGW A;  3W8K A;  4BQM A;  5HFO A;  2OSU A;  3NY4 A;  5J8X A;  2ZC5 B;  3NDG A;  3S4X A;  1PYY A;  3FWL A;  4U0X A;  1LI9 A;  1MWS A;  3NI9 A;  1BLH A;  3IWO A;  3PTE A;  1ES5 A;  1I5Q A;  1XX2 A;  2X71 A;  2JC7 A;  2J8Y A;  1FSW A;  4KZ7 A;  4KG2 A;  4UAA A;  3AGE A;  1ES4 A;  4JXV A;  1W7F A;  1XPB A;  2ZC7 A;  5DVA A;  5HAI A;  4E6X A;  2DCF A;  3OPL A;  2G2W A;  2HDU A;  2XGN A;  1K25 A;  4Z9Q A;  3WS1 A;  3IQA A;  3HLG A;  3M2K A;  3UPO A;  4DXB A;  2XQZ A;  2XH9 A;  4OH0 A;  4Y0O A;  3ZVW A;  4OLD A;  4E3K A;  4DXC A;  3I7J A;  1NZO A;  4K91 A;  1GHM A;  1EWZ A;  2EX8 A;  1FOF A;  4PM9 A;  5FQK A;  1AXB A;  3IWI A;  3VP3 A;  1YMX A;  3WS2 A;  3W4O A;  4Y0T A;  1YLW A;  1KDW A;  4DDY A;  5CRF A;  2A49 A;  5CEB A;  2OV5 A;  4GB7 A;  1JTD A;  3HLB A;  1PZP A;  2Z2L B;  5GLC A;  4DE1 A;  5GHY A;  2ZQC A;  5HL1 A;  1PWC A;  1YLY A;  3UO9 A;  3ZG5 A;  4E3M A;  2ZM0 A;  2X01 A;  3N8L A;  1BUE A;  3UN7 A;  4LV2 A;  3G34 A;  4OP8 A;  1MBL A;  4KZB A;  2PBY A;  1MPL A;  1K4F A;  3DW0 A;  1BSG A;  1JVJ A;  5DTS A;  1PZO A;  2DRW A;  2H10 A;  1OME A;  2HDS A;  2Y2H A;  4N1X A;  5CER A;  4KG5 A;  4WBG A;  1Z6F A;  3GQZ A;  2Y2P A;  4KZ9 A;  3LCE A;  1QME A;  5FI2 A;  3M6B A;  2Y2I A;  4XXR A;  2WAE A;  4OOL A;  3N7W A;  3O88 A;  2ZM2 A;  1BZA A;  3GMW A;  3ZVT A;  1PIO A;  4OPZ A;  3N4I A;  2PU2 A;  1ZG6 A;  3N8S A;  4M3K A;  4S2O A;  3FV7 A;  3PAE A;  4P87 A;  1TVF A;  2H0T A;  5AQ7 A;  1XGJ A;  3SH8 A;  1YMS A;  1TDL A;  3NIA A;  5CED A;  1KDS A;  1KE4 A;  1IKI A;  5DF7 A;  1MWT A;  1BLC A;  5FQQ A;  1XGI A;  1G6A A;  4C6Y A;  5F1F A;  1MXO A;  3WS4 A;  4GZB A;  2OLV A;  3ZG0 A;  4BEN A;  4GDN A;  4DDS A;  2H5S A;  3DTM A;  1NXY A;  3Q82 A;  1E25 A;  3UNW A;  3VP1 A;  3RJU A;  1RGZ A;  4S2K A;  2JBF A;  4FH2 A;  4MBH A;  2C5W B;  3LEZ A;  4KZ6 A;  4RA7 A;  4KQQ A;  3BLM A;  1LI0 A;  1E3U A;  2Y4A A;  4DE3 A;  2A3U A;  4B4X A;  3IXB A;  3MKF A;  4C75 A;  2Y55 A;  3C4O A;  2V20 A;  3IF5 A;  5DF8 A;  3SS4 A;  3PBR A;  1KVL A;  4U3T A;  4Q8I A;  5FA7 A;  1LL9 A;  4R4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...