4U0UA

Wild type eukaryotic fic domain containing protein with adp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
334
structure length
334
Chain Sequence
b'AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFATTEYSVALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u0uA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u0uA01
5HI7A 5CGLA 3OXLA 4JA7A 1PC2A 4G23A 3OXFA 1YA0A 2DBAA 4G25A 4J8DA 5G04J 2VQ2A 1NA3A 5FZSA 4XI8A 3RKVA 5EKQD 1NA0A 3KD7A 3VTYA 3LY9A 2HYZA 4BTBA 2PQRA 4GA2A 4M16A 4N67A 4UI9C 4GPKA 3GW4A 2VYIA 3ASGA 3N71A 4X2DA 3CV0A 5G05J 5EU0A 3AS5A 1W3BA 3FP3A 2F6SA 2Y4TA 4ME2A 2LSUA 4N2QA 3CKCA 4HOUA 4I2WA 4GZ5A 1FCHA 2XGSA 5DBKA 2YHCA 5JJTA 3QOUA 4G2VA 3ZC7A 3TG4A 3MKRA 5G04C 4LU4A 4UI9K 5BT1A 1Y8MA 4NPSA 3E4BA 3ASDA 3QWWA 3U4TA 2C0LA 3EDTB 5AYWD 2KC7A 4RG9A 2XPIA 3CVLA 2I6HA 3PE3A 4XIFA 4I17A 3RO3A 2VY3A 4W9RA 4AM9A 4U0ZA 4G1TA 3FWVA 1OUVA 2UWJG 2FO7A 3CEQA 5ARGA 2IF4A 4N2SA 5JJ6A 3IEGA 2XCBA 3SF4A 1ZBPA 4UQZA 2FBNA 2JLBA 2ONDA 2QFCA 3SE5A 3MA5A 1XNFA 4GCOA 2XCCA 1QZ2A 2BUGA 4B94A 5A7DB 5M72A 2KCKA 4ABNA 4YVQC 4ITRA 1IYGA 3CVNA 3AS8A 1A17A 2VSYA 3CK7A 3ESKA 1KT0A 4HORA 3CVPA 2VZAA 3ZN3A 3S7DA 3ZGQA 3ASHA 5JFFA 4AY6A 5EX3A 2JK8A 3LPZA 3RJVA 2C0MA 2FEZA 1TJCA 2FI7A 3O48A 4YNDA 3NF1A 3S7BA 5HQ8A 5ARFA 3TAXA 4EQFA 3RO2A 3Q15A 4GZ3A 5JJ7A 4N39A 3UUXA 4APOA 2LSVA 4HOSA 5A6CA 2FF4A 4G24A 5FZQA 5KJKA 3R9AB 3SN9A 4J0UA 2E2EA 4N3AA 4I2ZA 4WUYA 4N5CA 5FTPA 1HH8A 3CVQA 3Q47B 4GCNA 2J9QA 3LCAA 4PY3A 1ELRA 2V5FA 3S7FA 3ASFA 2OOEA 3CK8A 5G05C 4UQYA 5KJNA 3S7JA 3LYAA 5DIZA 4BT8A 4I9EA 4O6FA 3ZLMA 5CKLA 3GYZA 1ZU2A 1WAO1 2WPVA 2P58C 2G03A 5CCMA 3QWPA 1IHGA 2AVPA 4BTAA 4Y6CA 2XGMA 4CGVA 4KYOB 4GYYA 3TG5A 2PZIA 3LETA 5LCWJ 2KCLA 2R5SA 4GYWA 4I1AA 4LEUA 5KJMA 2HR2A 4NRHB 3ZFWA 5FJYA 4WNFA 5D0QD 1WM5A 3UQ3A 2LNIA 2VGXA 4A1SA 3GZ1A 4F3VA 2VGYA 2Y4UA 4UI9J 4AIFA 2UY1A 3QDNA 3ZPJA 3HYMB 4GZ6A 3CK9A 4XI0A 2XGOA 3PE4A 3QKYA 5BNWA 5KJLA 4WGJA 2VGXB 3GZ2A 4HOQA 4XI9A 3LY8A 5C1DA 2Q7FA 2YQ8A 2UY1B 4G26A 4I9CA 3QWVA 4KXKB 3BEEA 1NZNA 2KCVA 5LCWC 2MHKA 4J8EA 3URZA 3OXGA 1B89A 1KLXA 2HO1A 3PDNA 3WXXA 4GA1A 4J8FA 4JHRA 5D0OD 4KBQA 3SZ7A 3Q49B 2VSNA 1E96B 3Q5MA 2NC9A 3K9IA 2WQHA 4JA9A 4H7YA 3LKUA 4IN3B 5CCLA 3KS2A 5CMTA 4NQ0A 3RIBA 4X2EA 4WNGA 4Y6WA 4YVOA 2C2LA 5CHEE 3KAEA 4JL0A 4BT9A 3N3UA 3MV2B 3ULQA 5EX0A 4U04A 4CGWA 2L6JA 1HXIA 1P5QA 1ELWA 2PQNA 3MEKA 2KATA 4U07A 5BW8C 4H7XA 4X2CA 3Q4AB 3ZCBA 5JFZA 3RU0A 4CDRA 4RG6A 3MV3B 4N3CA 3TGOA 3ZHEA 4GYOA 4WNEA 5FZRA 2IFUA 4BWRA 4WNDA 2PL2A 4AY5A 3SHGA 3UPVA 4U0UA 3CUCA 1HZ4A 3LY7A 3VTXA 4UQXA 3FFLA 4U0SA 3U3WA 3ZHEB 3JYSA 4HOTA 4GA0A 2GW1A 3AS4A 3CKBA 1QQEA 2XEVA 3S6AA 5FT9A 1KT1A 4N3BA
chains in the Genus database with same CATH superfamily
5HI7A 3ASOE 3BG0B 2QYUA 3OXLA 4JA7A 3OXFA 3FEXA 3EHQA 3DSUA 2DBAA 4XX5A 4DJAA 2H6HA 2ILRA 4HI9A 3DXKG 4TUMA 1NA3A 1Q2ZA 5AQ7A 4XI8A 2WVIA 3CVWA 3V2XA 1NA0A 3LY9A 4BTBA 2VYIA 3JCKC 4FHJA 3CV0A 5BUZA 4GTMA 2PNNA 5EDSA 3FP3A 3SNXA 4GTQA 4ME2A 3FU6A 2LSUA 4J8YA 1LTXA 1OCOE 4GZ5A 3IHVA 3Q73A 1U3DA 2QZAA 2DIWA 2WMOA 4OVUA 2LXLA 3ZC7A 2GRRB 4HB5A 5D66A 2OEWA 2X6IA 3MKRA 4ANXA 5ENPD 3L82A 3VLDA 1DNPA 3CVYA 3PEVB 4UI9K 2WB2A 3AU5A 4BY6A 5BT1A 4U95D 3EHMA 3FUDA 5HS0A 3U4TA 3EDTB 1X5BA 3PE3A 4I17A 3ENEA 4U0ZA 4G1TA 3APCA 3L08A 5EYLA 2IF4A 4FP7A 4N2SA 3JXIA 2XPZA 2FULA 3DRAA 1L5JA 3SE5A 3MA5A 2MRIA 5ENSD 3UX4A 2DZOA 3E34A 1EDUA 4YDYA 3PNLB 5A7DB 5ANLA 4FJYA 4PS8A 4U96D 2AJAA 3QNKA 4B93B 4B8AA 3B7BA 1TEZA 3FUMA 3QC1A 4KMOA 5KNHD 4FA6A 1TN6A 4K5AB 4TUUA 3FUNA 4L2YA 4HORA 3FULA 4RVBA 1HFAA 3S7DA 1MHQA 3ASHA 3IV0A 3AG2E 1A5EA 3UKRG 2F0YA 2J08A 2X38A 3TXNA 3UIOC 3ZW3A 3LDZA 3ZKJA 4K03A 3O48A 4YNDA 3NF1A 5J90A 3S7BA 3ESLA 3RO2A 3MCXA 3ML9A 3NBNB 3Q15A 2GRNB 1XGWA 3UUXA 2LSVA 4HOSA 3FUFA 3F6QA 2FF4A 5KJKA 4HRLA 3WG7E 4JW1A 5FQ8A 3D9LA 4CDNA 2E2EA 2CFZA 5FTPA 1HH8A 4EECA 3CVQA 3DEPA 2H6IA 4LNUD 3Q47B 2J9QA 3LCAA 4PY3A 3EU9A 5G2NA 4ACKA 4AJWA 4BETA 2EIME 1E8ZA 2V5FA 2OOEA 1KZOA 4FC8A 5G05C 4DUIA 3S7JA 5DIZA 2AWIA 4I9EA 3D9IA 3ZLMA 3MGBA 4GZDA 4Q94A 3GYZA 2IEJA 1ZU2A 1AP7A 4P29A 2XEHA 2EQXA 3ML8A 5FQ4A 2P58C 3CR3A 1N0RA 1SVXA 4G8LA 2OEVA 4DI3A 2ETAA 4UWLA 4Y6CA 4L23A 3TG5A 4WWOA 3DSSA 3ZEFA 3C3QA 2R5SA 2F8YA 4GYWA 4I1AA 2XHEA 5AQBA 2Y1LE 4GTPA 2OVBA 3B95A 1OXJA 4NRHB 3C98A 5FJYA 4WNFA 2LNIA 3L22A 1TNOA 2KM4A 4AIFA 2ETBA 4TV3A 3ZPJA 4K0RA 3EIJA 3CK9A 5C2YA 2WXJA 5AIJA 4PDXA 3MX3A 3U9WA 4JHKA 3FY4A 2Q7FA 2YQ8A 2IO2C 1OWNA 4HLLA 4KXKB 1NL4A 2GGFA 3E30A 4FADA 4YDEA 1VDYA 2AW6A 1B89A 4ANVA 3RRUA 3L13A 4B0ZA 4U63A 1ELKA 3L17A 2CG3A 2DWZA 2F37A 4KBQA 5HKPA 1S70B 1E96B 3Q5MA 3Q7AA 3LEWA 3HXBA 4JEUA 4JA9A 3LKUA 2ZU6B 4IN3B 1FT1A 4RSYA 5CCLA 4Y6WA 2CHXA 4RLYA 4A55A 3KAEA 4MBGA 4V3IA 1DC2A 4U8HA 3BUAA 2WXIA 3C72A 4LNGA 1SA5A 5AAOA 3FTZA 2ZGGA 3ULQA 3HG0D 5HRYA 3S2AA 2LAHA 4CGWA 3PUJA 1P5QA 4BERA 2XRZA 2PQNA 4DLOA 4X2CA 3DWLG 1E7UA 3TWWA 3ZUVB 5BXOA 3ULYA 1E8WA 2P9NG 3I4GA 2DZNA 3ZNGA 5FZRA 3AJIA 4JVSA 4WNDA 3UT4A 2YHEA 3IKOB 3UPVA 4D10C 1E7VA 1OT8A 2P9SG 3TXMA 2R17C 3U3WA 4ANWA 5AENA 3MJWA 2V8SE 3DPDA 5AJLA 3DXMG 3CKBA 3C3RA 3D9KA 2WQHA 2A4ZA 4IYPA 1TNZA 2R05A 2WXHA 4KT6B 4G23A 4TXRA 1PAQA 3L16A 1IQRA 3CHMA 1O1SA 2R59A 3TWSA 3MKQA 4URKA 4MRUA 1X81A 2OVFA 5EKQD 4A63B 3KD7A 2HYZA 5KNGA 4N67A 3T8MA 4JZYA 3GW4A 3MKQB 1TN7A 3N71A 4DX6D 3KSLA 5T8IA 5EU0A 4M7CA 3AS5A 4HFGA 4GB9A 1S63A 5D2MC 3Q78A 4LERA 3G2VA 2XS1A 4M3OA 4I2WA 3IXEA 4GZCA 3TWTA 3ZVVA 4UUCA 4OYSA 2VTBB 1K8KG 1FCHA 2XGSA 4BX8A 3Q9UC 5DBKA 2J07A 2YHCA 4BEPA 1NP7A 4AV7A 1IQUA 3TWUA 2ZXWE 3HXEA 3U66A 1NH1A 3HRAA 3BQOA 2WXKA 1Y8MA 5E75A 3E4BA 4JPSA 2X6KA 3MZLB 3CLJA 3ZU7B 4APFA 2X6JA 5AYWD 1IXVA 5ANRA 5E76A 3CHPA 3APFA 1S64A 4RG9A 4HNAD 3D9MA 3RO3A 2VY3A 1H2TC 4PS7A 2UWJG 3PS6A 5FINA 3VLEA 2IOSA 3NZUA 2IU1A 1HE8A 3EU5A 3FU5A 5KWDA 2XZDG 4PUCA 3IEGA 3TWXA 3GZSA 4UQZA 1KZPA 3P1UA 4LCTA 5EYPF 2QFCA 5ENQD 1Z5SC 5IY5E 3EHNA 4ZFHA 5EIDA 4ITRA 3D9NA 1IYGA 3L9TA 3DSTA 2AXZA 2J4DA 3AS8A 3CQCB 4J8SA 4IRUA 4FU3A 3UM2A 1OWOA 3JUEA 3ZN3A 5CRVA 4DX2A 2PM6A 3ZIMA 1JUQA 2WM9A 4PS3A 3R9MA 3LPZA 3RJVA 4GTSA 2R03A 2CG2A 4EZKA 3FDHA 1TNUA 3NOGD 5HQ8A 3TAXA 5ITZF 3QARA 3DSWA 5CEAA 2NUNA 2XZTG 3JQ0A 4X8QA 4UWHA 4APOA 3HDXA 5A6CA 3LJNA 4G24A 1O5MA 3KEZA 2L0TB 2IQCA 2LO6A 3Q9NC 2DCPA 4XZ4A 3B7TA 4I2ZA 3Q75A 4N5CA 4K5BA 4GCNA 3B7SA 3DEOA 3ASFA 3HXFA 3CK8A 3VLFA 1E8YA 1YYHA 4FHKA 2YNQA 3D9OA 3CVXA 1MZCA 1RZ4A 1YCSB 1OWMA 3OAWA 4G8KA 1N4PA 2WQ6A 4QFVA 1N54A 4OVVA 3ONLA 3IBEA 2MYOA 4AP2A 4GMRA 3QWPA 2AVPA 3ABKE 1UG3A 4GYYA 4E85A 1K3ZD 1OWPA 2PZIA 3CGHA 1QNFA 5LCWJ 4I6GA 5EILA 1OWLA 2RFAA 5KJMA 2WXPA 1WM5A 3KEAA 4F3VA 2VGYA 3RK6A 2Y4UA 4UI9J 1BPOA 3IHYA 5EIBE 2Y0BG 3QDNA 3D9JA 3HYMB 2QY7A 4GZ6A 4J6IA 2H6FA 4FULA 3NB2A 4C48B 1WG0A 2GRMA 2XGOA 3PE4A 3QKYA 1UJKA 1FPPA 4ILHB 4XI9A 4HOQA 3LY8A 3PUKA 3QWVA 3HVEA 3BEEA 3MYVA 4XEIG 2KCVA 5LCWC 2DVWA 3UM0A 2HO1A 2GRLA 2I9CA 4DX7D 5EN5D 4WWNA 3L6AA 4K5CA 3G2SA 1D8EA 1O1TA 2BTDA 3K9IA 4H7YA 4HRMB 3KS2A 4NQ0A 1MX4A 3SD5A 3V31A 3DSXA 4YVOA 2C2LA 4C0EA 5CHEE 4L9PA 2AXUA 3B13A 4JL0A 3KSQA 2EIJE 4HQDA 3SBSA 2J09A 2WXLA 3NAWA 2BEDA 1BI8B 1UJJA 3FH8A 5ENTD 1SQMA 3JQ1A 1ELWA 4QQIA 1K1BA 1LF8A 2V5QC 2V0PA 4H7XA 5G55A 3I3NA 3ZCBA 3CHRA 4FLHA 5JFZA 3RU0A 4O60A 1D9SA 4I6JA 1SW6A 3CVVA 2KZTA 2VSOE 3MV3B 4N3CA 1PY1A 3FEYA 3RSEG 4FJZA 1D8DA 2PL2A 3QK0A 5CERB 3PREA 2KXPC 1HZ4A 4G11A 3LY7A 3VTXA 1Z3YA 2GROB 2KZTB 3FFLA 4Z68A 4C9BB 3JYSA 2J8SD 3UI2A 3FTYA 3AS4A 4OAVB 3I4RB 1MYOA 1QQEA 2WXQA 2XEVA 1KT1A 2RG8A 2MOWA 4N3BA 2A5UA 1PC2A 3Q79A 1OCCE 1YA0A 2KBXA 3E32A 5CBOA 3EUVA 4A1GA 1EYHA 3LS8A 2XEEA 1TNBA 4G25A 4J8DA 5BXUA 5BV0A 2QC9A 2I1KA 3FTWA 3AG1E 1H0AA 5G04J 4NACA 2VQ2A 5LOZA 3RKVA 3UT7A 2WQ7A 5LX8A 1UN8A 3I5PA 2PQRA 4GA2A 1JPLA 4HI8A 3X2QE 4X2DA 4OAUC 4MLPA 3T5VA 3ULEG 4U8YD 1HU3A 2F6SA 3QB2A 1UOHA 3OTNA 2Y4TA 4N2QA 3ABME 4EHMA 4KZCA 1V55E 3SHFA 4BFRA 4WWPA 2LUHA 2P9UG 2L9BA 2ZISA 1N52A 3TG4A 4WAFA 1TN8A 5G04C 1Z3XA 3D3MA 3D9HA 4EBAG 3V30A 3PZ2A 3QWWA 1V54E 2C0LA 4C0MA 5T4YA 1AWCB 4XIFA 5KCMA 1N0QA 4W9RA 2WXNA 4AM9A 1OUVA 1JCSA 1UN9A 3SI5A 3FU0A 2FO7A 3CEQA 4NIKA 2QYJA 2P2CP 5LP0A 5FQ6A 5BV1A 1KPSB 2FBNA 2JLBA 3G2UA 4U7EB 2ONDA 4O1PA 2V4LA 4MKTA 1MX6A 3Q7FA 2XCCA 1QZ2A 2BUGA 4BSXA 4B94A 4N5QA 5M72A 4TRQA 2KCKA 4YVQC 3L54A 3CVNA 4NURA 1A17A 2P9LG 3CQGB 4GTOA 3R7QA 3CK7A 3D9PA 4LRZA 1H2UA 1H6KA 1KT0A 1GW6A 5B1BE 3CVPA 3FTUA 2VZAA 3ZGQA 1BI7B 1WDYA 4AY6A 5EX3A 2JK8A 2C0MA 3ISMC 1TJCA 2CHWA 3CHSA 2ZGDA 2AXVA 3FTSA 3UM3A 3JXJA 3UIPC 4B8CB 2WXGA 5JJ7A 4N39A 4EPZA 1ZB1A 2B0OE 3PRZA 5FZQA 5FWQA 3SN9A 1TYQG 2B6CA 2WXOA 1HX8A 4F7AA 4WUYA 2OV8A 4JXTA 3FH7A 3O4ZA 4JC8A 1ELRA 3U64A 2A5EA 4GAAA 4CYMD 5KJNA 3QAQA 3W9FA 3SFXA 3LYAA 4GU5A 4O6FA 2XENA 2VJ8A 5CKLA 5J08A 2HE0A 5H7PA 3ZYMA 2WPVA 5CCMA 2LXMA 4DX5D 1IHGA 4YDWA 4CGVA 3CVUA 4KYOB 4HLEA 1HG2A 3LVQE 2JABA 3HXDA 2GRQB 3C5RA 3G2WA 4LEUA 2HR2A 3J5QB 4TXQA 4JEHA 1H2VC 2NXPA 4ILIA 3QJZA 4A1SA 4J7WA 4DPRA 3CHQA 2FO1E 4HS2A 3UXGA 2GRPB 4XI0A 4L1BA 1E90A 3B7UX 4R7LA 1BU9A 2NUDA 4ATGA 4L2LA 5KJLA 4WGJA 1YMPA 2CFUA 2EINE 2WXFA 4G26A 1OY3D 5CBNA 2X6HA 1H6OA 4DI4A 4U8VD 3TJPA 1NZNA 2MHKA 3URZA 3OXGA 1QYMA 1KLXA 3P2BA 2ZIRA 4GA1A 4LSZE 1HF8A 3UMVA 2YINA 5D0OD 4ANUA 3SZ7A 3Q49B 5ENRD 2VSNA 5CRUA 3E33A 3FH5A 1E8XA 3HXCA 5CMTA 3RIBA 4X2EA 4WNGA 3ZXSA 1DCQA 4E6HA 1HS6A 2I1JA 1K1AA 1O1RA 4BT9A 3N3UA 1N4RA 2WXRA 5EX0A 4F1SA 4U04A 2L6JA 1RW2A 2DYRE 1JWGA 5CMWA 1SA4A 4BSZB 5BW8C 4CCAA 3APDA 4A3TA 4CDRA 3ONKA 4KVOA 3AG3E 4RG6A 3TGOA 4Q96A 1IHBA 4B89A 4I43A 4BWRA 4U0UA 3PZ1A 1SZ9A 4U0SA 5CEDB 5ENNA 2GW1A 5ENOD 1BD8A 3SFYA 1MQSA 3NZSA 3EHRA 3DBSA 2ETCA 3S6AA 3TWRA 3FUJA 5CGLA 4HBDA 4AEZC 4IULA 4CRWA 3ZYLA 2P9IG 2E0IA 5A23A 2I2OA 4F1PA 4GPMA 3C3OA 4XKBA 3PVLA 2BF0X 5FZSA 1N4SA 4AVXA 5KBAA 3RRNB 1SZAA 3VTYA 3HVEB 4M16A 4UI9C 4GPKA 3JUIA 4CEMA 3BU8A 3V79K 3ASGA 4DLQA 5G05J 1W3BA 3UTMA 1EPUA 4JHJA 3CKCA 4HOUA 5JHBA 2R2LA 4CT4A 3FUHA 4RQIA 3LXUX 2P9PG 2IY0C 3FUEA 5JJTA 3QOUA 4G2VA 2OCCE 4HRNA 1S0PA 4JD2G 4LU4A 1BLXB 3LJ3A 4LNBA 3SO8A 4NPSA 1JCRA 2RD0A 1Z6TA 3ASDA 3AAAC 3FUIA 1EF1C 2KC7A 2RFMA 3SBTB 2XPIA 3CVLA 2I6HA 2V4HC 3CSTA 2BKKB 3CHOA 4I1OB 3FWVA 4GTRA 5AQAA 3J5PA 3TWQA 2NYJA 5ARGA 3FTXA 2J4BA 5JJ6A 2J49A 2XCBA 3SF4A 1ZBPA 1FVHA 3G2TA 1N11A 2VGEA 3ASNE 1XNFA 4GCOA 5CECB 5B1AE 4AOFA 4GMLA 1NFIE 4DRXE 3FHEA 4ABNA 2LAIA 4O1OA 4PH4B 3T8KA 2EILE 1INZA 2VSYA 2XPYA 1JWFA 3ESKA 3TWVA 2F8XK 4A3VA 4F53A 2CHZA 1OCZE 4L7TA 1LD7A 2BKGA 5JFFA 4EZLA 3NQPA 2PM7A 2JEKA 2FEZA 1OCRE 1H6PA 4EBAA 3ZYKA 2IJGX 3T9KA 2FI7A 5AARA 5ARFA 4EQFA 2WXMA 4GZ3A 2IONA 1FT2A 4TXPA 3R9AB 4I6EA 4J0UA 3SY2A 4CT0A 3CIAA 3UINC 5FIOA 4N3AA 5JMND 3DSVA 1HO8A 4XKCA 3NOCD 3UT8A 4ACLA 2Y69E 3S7FA 3W9GA 2M63A 4UQYA 2XS8A 3PH0C 4BT8A 1Y6IA 2IO3C 4MS6A 1LD8A 3FTVA 5CMYA 4HXIA 3SFZA 1WAO1 5FQ7A 2G03A 4BTAA 2XGMA 1N95A 3LETA 2KCLA 2L6BA 1N94A 2XRYA 3ZFWA 3ABLE 4CDMA 5D0QD 3UQ3A 3V2OA 3AU4A 3LVRE 5AN8A 2VGXA 3GZ1A 1N9AA 2UY1A 3R7RA 2P9KG 1TNYA 4YDOA 3PEUB 3B7RL 4KZ0A 4LUNU 5BNWA 2X3MA 3UM1A 1MJ0A 2VGXB 3GZ2A 3HHMA 4DK5A 5C1DA 4F6RD 2UY1B 4I9CA 3UKUG 4GTTA 3BG1B 3SQVA 3AG4E 1DCEA 5BPPA 4J8EA 3CSFA 3PZ4A 2DYSE 4JB8P 3PDNA 3RRMB 3DPYA 3PZ3A 3WXXA 5AJDA 1HG5A 4J8FA 4ATZD 4JHRA 4CZ2D 4GMJA 3PNTB 2NC9A 2VTBA 4AXHA 1U3CA 2XQ0A 4UWKA 1H19A 4FLBA 4UWGA 3T5XA 3HIZA 2WMNA 1FVFA 3SGHA 2VSXE 5LFAA 2NSZA 4GTVA 1G3NB 3MV2B 4BX9A 1MX2A 4DX1A 2H6GA 4XE0A 1U2VG 1N4QA 1HXIA 3MEKA 1TR4A 2KATA 3PZDA 4U07A 4KVMA 4Q69A 3RAUA 2Y3AA 3EIQC 2IOLA 3Q4AB 1NI1A 3FU3A 3ZRHA 1IKND 3E37A 5B3SE 5JHAA 2X6FA 4I1MA 2R02A 3ZHEA 4GYOA 1UW4B 1TJFA 1JCQA 2HM8A 4WNEA 2IFUA 2RKKA 3TL5A 1DVPA 3ZYQA 4AY5A 3SHGA 1QBQA 3FUKA 5T3RA 3CUCA 4BESA 1WY6A 4UQXA 3EJNA 3ZHEB 4UWFA 2EIKE 4ZHBA 4HOTA 5AQ9A 4GA0A 4HVBA 5JA4D 4LG6A 3ZXPA 4EZJA 4ILGA 5FT9A 2L0IA
chains in the Genus database with same CATH topology
5HI7A 4IYPA 2A5UA 3BG0B 5CGLA 2WXHA 3OXLA 4AEZC 4KT6B 4JA7A 1PC2A 4G23A 3OXFA 4IULA 1PAQA 3FEXA 3L16A 1YA0A 4CRWA 3ZYLA 2E0IA 5A23A 4A1GA 2I2OA 1EYHA 3LS8A 1IQRA 3CHMA 2R59A 2DBAA 3MKQA 4G25A 4J8DA 4XX5A 5BV0A 4DJAA 4URKA 4XKBA 2I1KA 4MRUA 3FTWA 2ILRA 1H0AA 5G04J 3PVLA 4NACA 2BF0X 2VQ2A 1NA3A 2OVFA 5FZSA 4XI8A 2WVIA 5LOZA 3RKVA 3UT7A 5EKQD 2WQ7A 5LX8A 3CVWA 1UN8A 4AVXA 1NA0A 1SZAA 3KD7A 3RRNB 3VTYA 3LY9A 3I5PA 2HYZA 4BTBA 2PQRA 3HVEB 4GA2A 4M16A 4N67A 4UI9C 3JUIA 4JZYA 3T8MA 3GW4A 4CEMA 2VYIA 3MKQB 4GPKA 1JPLA 3ASGA 3N71A 3JCKC 4X2DA 4FHJA 3CV0A 4MLPA 5BUZA 4DLQA 5G05J 5EU0A 5T8IA 5EDSA 3T5VA 3AS5A 4HFGA 4GB9A 1W3BA 3FP3A 3SNXA 1HU3A 2F6SA 3QB2A 4LERA 1EPUA 3G2VA 3OTNA 2Y4TA 3FU6A 2LSUA 4JHJA 4ME2A 4N2QA 4KZCA 3CKCA 4HOUA 3SHFA 4M3OA 4I2WA 4BFRA 5JHBA 4CT4A 3FUHA 4GZCA 4GZ5A 4WWPA 3IHVA 3ZVVA 3LXUX 4OYSA 2VTBB 1U3DA 2XGSA 1FCHA 4BX8A 2DIWA 2WMOA 2L9BA 5DBKA 2J07A 2YHCA 3FUEA 5JJTA 1NP7A 4OVUA 3QOUA 4G2VA 1N52A 3ZC7A 3TG4A 4AV7A 1IQUA 2X6IA 3MKRA 4WAFA 4ANXA 3VLDA 5G04C 1S0PA 1Z3XA 1DNPA 4LU4A 3U66A 3CVYA 3PEVB 3D3MA 4UI9K 2WB2A 4A1SA 2WXKA 4EBAG 3AU5A 3LJ3A 4BY6A 5BT1A 1Y8MA 5E75A 3EHMA 4NPSA 3E4BA 2RD0A 4JPSA 2X6KA 3FUDA 1Z6TA 3MZLB 3ASDA 3CLJA 3QWWA 3U4TA 3FUIA 2C0LA 4APFA 3EDTB 1EF1C 2X6JA 4C0MA 5AYWD 5ANRA 5E76A 3CHPA 1X5BA 2KC7A 3APFA 5T4YA 4RG9A 3SBTB 2XPIA 3CVLA 2I6HA 3PE3A 4XIFA 3CSTA 5KCMA 4I17A 3D9MA 3RO3A 2VY3A 3CHOA 4W9RA 2WXNA 3ENEA 4AM9A 4U0ZA 4G1TA 4I1OB 3FWVA 1OUVA 1H2TC 4PS7A 1UN9A 3SI5A 2UWJG 3PS6A 3APCA 3FU0A 2FO7A 3L08A 3VLEA 2IOSA 3CEQA 5ARGA 3FTXA 2IF4A 2IU1A 2J4BA 3NZUA 1HE8A 4FP7A 3FU5A 5LP0A 4N2SA 5JJ6A 2J49A 4PUCA 3IEGA 2XCBA 2XPZA 5FQ6A 3SF4A 5BV1A 2FULA 1ZBPA 3GZSA 4UQZA 2FBNA 2JLBA 3G2UA 3P1UA 1FVHA 1L5JA 2ONDA 2QFCA 2V4LA 3G2TA 4LCTA 3SE5A 4MKTA 3MA5A 1XNFA 4GCOA 2MRIA 3UX4A 2XCCA 1QZ2A 2BUGA 3EHNA 4BSXA 4B94A 1EDUA 3PNLB 5A7DB 5ANLA 4AOFA 4FJYA 4GMLA 5M72A 4PS8A 3FHEA 4TRQA 2KCKA 4ABNA 4YVQC 3L54A 4ITRA 2LAIA 3D9NA 3QNKA 1IYGA 4B8AA 3CVNA 2AXZA 2J4DA 3AS8A 4NURA 1TEZA 4PH4B 3FUMA 3QC1A 1A17A 3CQCB 4J8SA 4KMOA 1INZA 2VSYA 3CQGB 2XPYA 4IRUA 3R7QA 3CK7A 3D9PA 1JWFA 3ESKA 4LRZA 4FA6A 1H2UA 1H6KA 4FU3A 1KT0A 4TUUA 4A3VA 3FUNA 4L2YA 4HORA 4F53A 1OWOA 3FULA 1GW6A 3CVPA 2CHZA 3FTUA 2VZAA 3ZN3A 4RVBA 2PM6A 3ZIMA 4L7TA 1JUQA 2WM9A 1HFAA 4PS3A 3S7DA 3ZGQA 1MHQA 3ASHA 3IV0A 5JFFA 4EZLA 4AY6A 3NQPA 5EX3A 2JK8A 2PM7A 3LPZA 2JEKA 3RJVA 2J08A 2X38A 2C0MA 2FEZA 2CG2A 4EZKA 3TXNA 1TJCA 3FDHA 3ZW3A 3LDZA 4EBAA 2CHWA 4K03A 2IJGX 3CHSA 3ZYKA 2FI7A 3O48A 4YNDA 3NF1A 5J90A 2AXVA 3S7BA 3FTSA 5ARFA 3ESLA 3TAXA 2WXMA 3RO2A 3MCXA 4B8CB 4EQFA 2WXGA 3ML9A 3Q15A 3QARA 3JQ0A 4GZ3A 5JJ7A 4N39A 2IONA 1XGWA 4UWHA 3UUXA 4APOA 2LSVA 4EPZA 4HOSA 3HDXA 5A6CA 3FUFA 2FF4A 4G24A 3KEZA 3PRZA 5FZQA 5FWQA 3R9AB 4I6EA 5KJKA 2L0TB 3SN9A 2IQCA 2LO6A 4J0UA 4JW1A 5FQ8A 4CT0A 3CIAA 2DCPA 3D9LA 4CDNA 2E2EA 2WXOA 1HX8A 3B7TA 4N3AA 2OV8A 4I2ZA 4WUYA 4XZ4A 4F7AA 2CFZA 4N5CA 4JXTA 3FH7A 5FTPA 1HH8A 4EECA 3CVQA 3O4ZA 1HO8A 4XKCA 3Q47B 4GCNA 4JC8A 2J9QA 3LCAA 4PY3A 5G2NA 1ELRA 4ACKA 4AJWA 3U64A 1E8ZA 2V5FA 3UT8A 4ACLA 3B7SA 3S7FA 3ASFA 2OOEA 3CK8A 3VLFA 1E8YA 4FC8A 2M63A 4GAAA 4UQYA 5G05C 5KJNA 4FHKA 2YNQA 3D9OA 3QAQA 3PH0C 3S7JA 3LYAA 3CVXA 5DIZA 4GU5A 4BT8A 1Y6IA 2AWIA 4I9EA 4O6FA 1OWMA 3OAWA 3D9IA 4MS6A 2WQ6A 3ZLMA 2VJ8A 3MGBA 3FTVA 4QFVA 4GZDA 5CKLA 1N54A 4Q94A 5J08A 3GYZA 4OVVA 3ONLA 5CMYA 3IBEA 4HXIA 1ZU2A 3SFZA 4P29A 2EQXA 4AP2A 1WAO1 3ML8A 5FQ4A 3ZYMA 2WPVA 2P58C 5FQ7A 2G03A 5CCMA 3CR3A 3QWPA 1IHGA 2AVPA 4BTAA 4DI3A 1UG3A 4UWLA 2XGMA 4Y6CA 4CGVA 3CVUA 4KYOB 4GYYA 4E85A 4HLEA 1OWPA 1HG2A 4L23A 3TG5A 4WWOA 2PZIA 3CGHA 3LVQE 3ZEFA 3LETA 1QNFA 5LCWJ 2KCLA 2R5SA 4GYWA 3G2WA 4I1AA 4I6GA 2XHEA 1OWLA 2OVBA 4LEUA 5KJMA 2HR2A 2XRYA 4NRHB 2WXPA 3C98A 3ZFWA 5FJYA 4WNFA 4CDMA 5D0QD 1WM5A 3UQ3A 4JEHA 3AU4A 3LVRE 1H2VC 2NXPA 2LNIA 2VGXA 3L22A 3QJZA 4ILIA 3GZ1A 2KM4A 2VGYA 2Y4UA 3RK6A 4UI9J 1BPOA 3IHYA 4TV3A 4AIFA 4F3VA 2A4ZA 2UY1A 3QDNA 3ZPJA 4K0RA 4DPRA 3CHQA 3D9JA 3R7RA 3HYMB 2QY7A 3EIJA 4GZ6A 4J6IA 3CK9A 4HS2A 5C2YA 4FULA 3PEUB 3B7RL 4XI0A 4L1BA 1E90A 2WXJA 4KZ0A 3B7UX 2GRMA 4LUNU 4R7LA 4PDXA 2XGOA 3PE4A 3QKYA 5AIJA 5BNWA 3MX3A 2X3MA 4ATGA 1UJKA 4L2LA 5HQ8A 3U9WA 4ILHB 5KJLA 4WGJA 2VGXB 3GZ2A 3HHMA 4HOQA 3LY8A 4JHKA 4XI9A 2CFUA 4DK5A 5C1DA 3FY4A 2Q7FA 2YQ8A 2UY1B 3PUKA 2WXFA 4G26A 1OWNA 4I9CA 3QWVA 2X6HA 4DI4A 4KXKB 2GGFA 3TJPA 3BG1B 3HVEA 3BEEA 1NZNA 3MYVA 4FADA 2KCVA 5BPPA 5LCWC 2MHKA 4J8EA 3URZA 1VDYA 3OXGA 3CSFA 2AW6A 1B89A 1KLXA 4ANVA 2HO1A 2GRLA 2I9CA 3PDNA 3P2BA 3RRMB 3RRUA 3WXXA 5AJDA 3L13A 4B0ZA 4GA1A 1HG5A 4U63A 1ELKA 4J8FA 4WWNA 1HF8A 3L17A 4JHRA 3UMVA 2YINA 5D0OD 2CG3A 4KBQA 3SZ7A 4ANUA 3L6AA 3Q49B 4GMJA 2VSNA 3PNTB 1E96B 3Q5MA 2NC9A 3G2SA 2VTBA 4AXHA 3LEWA 1U3CA 4JEUA 3K9IA 2BTDA 4JA9A 2XQ0A 3FH5A 4H7YA 3LKUA 1E8XA 2ZU6B 4IN3B 1H19A 4FLBA 4RSYA 4UWKA 3KS2A 5CCLA 5CMTA 4NQ0A 4UWGA 3RIBA 3SD5A 4X2EA 4WNGA 3T5XA 4Y6WA 2CHXA 4YVOA 2C2LA 3ZXSA 4C0EA 5CHEE 3HIZA 2WMNA 4E6HA 1FVFA 1HS6A 2I1JA 4A55A 2AXUA 3B13A 3KAEA 4JL0A 3SGHA 4V3IA 4BT9A 4U8HA 2WXIA 2VSXE 5LFAA 2NSZA 2J09A 2WXLA 3N3UA 3SBSA 3MV2B 4BX9A 3FTZA 3ULQA 2WXRA 1UJJA 3FH8A 5EX0A 3S2AA 4XE0A 2LAHA 1SQMA 4U04A 4F1SA 3JQ1A 4CGWA 3PUJA 2L6JA 1HXIA 1P5QA 2XRZA 1ELWA 2PQNA 3MEKA 2KATA 1JWGA 3PZDA 4U07A 5CMWA 1LF8A 4DLOA 4KVMA 4Q69A 2V0PA 2Y3AA 4H7XA 5BW8C 3EIQC 5G55A 4X2CA 2IOLA 3I3NA 3Q4AB 4CCAA 3APDA 3FU3A 3ZCBA 1E7UA 3CHRA 3ZRHA 4A3TA 4FLHA 5JFZA 3RU0A 4CDRA 3ONKA 4KVOA 5JHAA 2X6FA 4I6JA 3CVVA 4I1MA 4RG6A 2KZTA 2VSOE 3MV3B 4N3CA 3TGOA 3ZHEA 1PY1A 3FEYA 1E8WA 4GYOA 4Q96A 1UW4B 1TJFA 2HM8A 3I4GA 4WNEA 4B89A 5FZRA 2IFUA 4FJZA 4JVSA 3TL5A 1DVPA 4I43A 3ZYQA 4N3BA 4BWRA 4WNDA 2PL2A 3QK0A 3SHGA 3UT4A 4AY5A 2YHEA 3FUKA 3IKOB 4U0UA 3PREA 3UPVA 5T3RA 4D10C 3CUCA 1HZ4A 4G11A 1SZ9A 3LY7A 1WY6A 1E7VA 3VTXA 4UQXA 1Z3YA 3TXMA 2KZTB 2R17C 3FFLA 4U0SA 3U3WA 3EJNA 3ZHEB 4C9BB 4ANWA 4UWFA 5AENA 3JYSA 4HOTA 5ENNA 4GA0A 4HVBA 3FTYA 3MJWA 2GW1A 2V8SE 3AS4A 3DPDA 1MQSA 5AJLA 3NZSA 4EZJA 3CKBA 4ILGA 3I4RB 1QQEA 2WXQA 3DBSA 2XEVA 3S6AA 3D9KA 5FT9A 1KT1A 2RG8A 2MOWA 2L0IA 2WQHA 3FUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HI7 A;  5CGL A;  3OXL A;  4JA7 A;  1PC2 A;  4G23 A;  3OXF A;  1YA0 A;  2DBA A;  4G25 A;  4J8D A;  5G04 J;  2VQ2 A;  1NA3 A;  5FZS A;  4XI8 A;  3RKV A;  5EKQ D;  1NA0 A;  3KD7 A;  3VTY A;  3LY9 A;  2HYZ A;  4BTB A;  2PQR A;  4GA2 A;  4M16 A;  4N67 A;  4UI9 C;  4GPK A;  3GW4 A;  2VYI A;  3ASG A;  3N71 A;  4X2D A;  3CV0 A;  5G05 J;  5EU0 A;  3AS5 A;  1W3B A;  3FP3 A;  2F6S A;  2Y4T A;  4ME2 A;  2LSU A;  4N2Q A;  3CKC A;  4HOU A;  4I2W A;  4GZ5 A;  1FCH A;  2XGS A;  5DBK A;  2YHC A;  5JJT A;  3QOU A;  4G2V A;  3ZC7 A;  3TG4 A;  3MKR A;  5G04 C;  4LU4 A;  4UI9 K;  5BT1 A;  1Y8M A;  4NPS A;  3E4B A;  3ASD A;  3QWW A;  3U4T A;  2C0L A;  3EDT B;  5AYW D;  2KC7 A;  4RG9 A;  2XPI A;  3CVL A;  2I6H A;  3PE3 A;  4XIF A;  4I17 A;  3RO3 A;  2VY3 A;  4W9R A;  4AM9 A;  4U0Z A;  4G1T A;  3FWV A;  1OUV A;  2UWJ G;  2FO7 A;  3CEQ A;  5ARG A;  2IF4 A;  4N2S A;  5JJ6 A;  3IEG A;  2XCB A;  3SF4 A;  1ZBP A;  4UQZ A;  2FBN A;  2JLB A;  2OND A;  2QFC A;  3SE5 A;  3MA5 A;  1XNF A;  4GCO A;  2XCC A;  1QZ2 A;  2BUG A;  4B94 A;  5A7D B;  5M72 A;  2KCK A;  4ABN A;  4YVQ C;  4ITR A;  1IYG A;  3CVN A;  3AS8 A;  1A17 A;  2VSY A;  3CK7 A;  3ESK A;  1KT0 A;  4HOR A;  3CVP A;  2VZA A;  3ZN3 A;  3S7D A;  3ZGQ A;  3ASH A;  5JFF A;  4AY6 A;  5EX3 A;  2JK8 A;  3LPZ A;  3RJV A;  2C0M A;  2FEZ A;  1TJC A;  2FI7 A;  3O48 A;  4YND A;  3NF1 A;  3S7B A;  5HQ8 A;  5ARF A;  3TAX A;  4EQF A;  3RO2 A;  3Q15 A;  4GZ3 A;  5JJ7 A;  4N39 A;  3UUX A;  4APO A;  2LSV A;  4HOS A;  5A6C A;  2FF4 A;  4G24 A;  5FZQ A;  5KJK A;  3R9A B;  3SN9 A;  4J0U A;  2E2E A;  4N3A A;  4I2Z A;  4WUY A;  4N5C A;  5FTP A;  1HH8 A;  3CVQ A;  3Q47 B;  4GCN A;  2J9Q A;  3LCA A;  4PY3 A;  1ELR A;  2V5F A;  3S7F A;  3ASF A;  2OOE A;  3CK8 A;  5G05 C;  4UQY A;  5KJN A;  3S7J A;  3LYA A;  5DIZ A;  4BT8 A;  4I9E A;  4O6F A;  3ZLM A;  5CKL A;  3GYZ A;  1ZU2 A;  1WAO 1;  2WPV A;  2P58 C;  2G03 A;  5CCM A;  3QWP A;  1IHG A;  2AVP A;  4BTA A;  4Y6C A;  2XGM A;  4CGV A;  4KYO B;  4GYY A;  3TG5 A;  2PZI A;  3LET A;  5LCW J;  2KCL A;  2R5S A;  4GYW A;  4I1A A;  4LEU A;  5KJM A;  2HR2 A;  4NRH B;  3ZFW A;  5FJY A;  4WNF A;  5D0Q D;  1WM5 A;  3UQ3 A;  2LNI A;  2VGX A;  4A1S A;  3GZ1 A;  4F3V A;  2VGY A;  2Y4U A;  4UI9 J;  4AIF A;  2UY1 A;  3QDN A;  3ZPJ A;  3HYM B;  4GZ6 A;  3CK9 A;  4XI0 A;  2XGO A;  3PE4 A;  3QKY A;  5BNW A;  5KJL A;  4WGJ A;  2VGX B;  3GZ2 A;  4HOQ A;  4XI9 A;  3LY8 A;  5C1D A;  2Q7F A;  2YQ8 A;  2UY1 B;  4G26 A;  4I9C A;  3QWV A;  4KXK B;  3BEE A;  1NZN A;  2KCV A;  5LCW C;  2MHK A;  4J8E A;  3URZ A;  3OXG A;  1B89 A;  1KLX A;  2HO1 A;  3PDN A;  3WXX A;  4GA1 A;  4J8F A;  4JHR A;  5D0O D;  4KBQ A;  3SZ7 A;  3Q49 B;  2VSN A;  1E96 B;  3Q5M A;  2NC9 A;  3K9I A;  2WQH A;  4JA9 A;  4H7Y A;  3LKU A;  4IN3 B;  5CCL A;  3KS2 A;  5CMT A;  4NQ0 A;  3RIB A;  4X2E A;  4WNG A;  4Y6W A;  4YVO A;  2C2L A;  5CHE E;  3KAE A;  4JL0 A;  4BT9 A;  3N3U A;  3MV2 B;  3ULQ A;  5EX0 A;  4U04 A;  4CGW A;  2L6J A;  1HXI A;  1P5Q A;  1ELW A;  2PQN A;  3MEK A;  2KAT A;  4U07 A;  5BW8 C;  4H7X A;  4X2C A;  3Q4A B;  3ZCB A;  5JFZ A;  3RU0 A;  4CDR A;  4RG6 A;  3MV3 B;  4N3C A;  3TGO A;  3ZHE A;  4GYO A;  4WNE A;  5FZR A;  2IFU A;  4BWR A;  4WND A;  2PL2 A;  4AY5 A;  3SHG A;  3UPV A;  4U0U A;  3CUC A;  1HZ4 A;  3LY7 A;  3VTX A;  4UQX A;  3FFL A;  4U0S A;  3U3W A;  3ZHE B;  3JYS A;  4HOT A;  4GA0 A;  2GW1 A;  3AS4 A;  3CKB A;  1QQE A;  2XEV A;  3S6A A;  5FT9 A;  1KT1 A;  4N3B A; 
#chains in the Genus database with same CATH topology
 5HI7 A;  3ASO E;  3BG0 B;  2QYU A;  3OXL A;  4JA7 A;  3OXF A;  3FEX A;  3EHQ A;  3DSU A;  2DBA A;  4XX5 A;  4DJA A;  2H6H A;  2ILR A;  4HI9 A;  3DXK G;  4TUM A;  1NA3 A;  1Q2Z A;  5AQ7 A;  4XI8 A;  2WVI A;  3CVW A;  3V2X A;  1NA0 A;  3LY9 A;  4BTB A;  2VYI A;  3JCK C;  4FHJ A;  3CV0 A;  5BUZ A;  4GTM A;  2PNN A;  5EDS A;  3FP3 A;  3SNX A;  4GTQ A;  4ME2 A;  3FU6 A;  2LSU A;  4J8Y A;  1LTX A;  1OCO E;  4GZ5 A;  3IHV A;  3Q73 A;  1U3D A;  2QZA A;  2DIW A;  2WMO A;  4OVU A;  2LXL A;  3ZC7 A;  2GRR B;  4HB5 A;  5D66 A;  2OEW A;  2X6I A;  3MKR A;  4ANX A;  5ENP D;  3L82 A;  3VLD A;  1DNP A;  3CVY A;  3PEV B;  4UI9 K;  2WB2 A;  3AU5 A;  4BY6 A;  5BT1 A;  4U95 D;  3EHM A;  3FUD A;  5HS0 A;  3U4T A;  3EDT B;  1X5B A;  3PE3 A;  4I17 A;  3ENE A;  4U0Z A;  4G1T A;  3APC A;  3L08 A;  5EYL A;  2IF4 A;  4FP7 A;  4N2S A;  3JXI A;  2XPZ A;  2FUL A;  3DRA A;  1L5J A;  3SE5 A;  3MA5 A;  2MRI A;  5ENS D;  3UX4 A;  2DZO A;  3E34 A;  1EDU A;  4YDY A;  3PNL B;  5A7D B;  5ANL A;  4FJY A;  4PS8 A;  4U96 D;  2AJA A;  3QNK A;  4B93 B;  4B8A A;  3B7B A;  1TEZ A;  3FUM A;  3QC1 A;  4KMO A;  5KNH D;  4FA6 A;  1TN6 A;  4K5A B;  4TUU A;  3FUN A;  4L2Y A;  4HOR A;  3FUL A;  4RVB A;  1HFA A;  3S7D A;  1MHQ A;  3ASH A;  3IV0 A;  3AG2 E;  1A5E A;  3UKR G;  2F0Y A;  2J08 A;  2X38 A;  3TXN A;  3UIO C;  3ZW3 A;  3LDZ A;  3ZKJ A;  4K03 A;  3O48 A;  4YND A;  3NF1 A;  5J90 A;  3S7B A;  3ESL A;  3RO2 A;  3MCX A;  3ML9 A;  3NBN B;  3Q15 A;  2GRN B;  1XGW A;  3UUX A;  2LSV A;  4HOS A;  3FUF A;  3F6Q A;  2FF4 A;  5KJK A;  4HRL A;  3WG7 E;  4JW1 A;  5FQ8 A;  3D9L A;  4CDN A;  2E2E A;  2CFZ A;  5FTP A;  1HH8 A;  4EEC A;  3CVQ A;  3DEP A;  2H6I A;  4LNU D;  3Q47 B;  2J9Q A;  3LCA A;  4PY3 A;  3EU9 A;  5G2N A;  4ACK A;  4AJW A;  4BET A;  2EIM E;  1E8Z A;  2V5F A;  2OOE A;  1KZO A;  4FC8 A;  5G05 C;  4DUI A;  3S7J A;  5DIZ A;  2AWI A;  4I9E A;  3D9I A;  3ZLM A;  3MGB A;  4GZD A;  4Q94 A;  3GYZ A;  2IEJ A;  1ZU2 A;  1AP7 A;  4P29 A;  2XEH A;  2EQX A;  3ML8 A;  5FQ4 A;  2P58 C;  3CR3 A;  1N0R A;  1SVX A;  4G8L A;  2OEV A;  4DI3 A;  2ETA A;  4UWL A;  4Y6C A;  4L23 A;  3TG5 A;  4WWO A;  3DSS A;  3ZEF A;  3C3Q A;  2R5S A;  2F8Y A;  4GYW A;  4I1A A;  2XHE A;  5AQB A;  2Y1L E;  4GTP A;  2OVB A;  3B95 A;  1OXJ A;  4NRH B;  3C98 A;  5FJY A;  4WNF A;  2LNI A;  3L22 A;  1TNO A;  2KM4 A;  4AIF A;  2ETB A;  4TV3 A;  3ZPJ A;  4K0R A;  3EIJ A;  3CK9 A;  5C2Y A;  2WXJ A;  5AIJ A;  4PDX A;  3MX3 A;  3U9W A;  4JHK A;  3FY4 A;  2Q7F A;  2YQ8 A;  2IO2 C;  1OWN A;  4HLL A;  4KXK B;  1NL4 A;  2GGF A;  3E30 A;  4FAD A;  4YDE A;  1VDY A;  2AW6 A;  1B89 A;  4ANV A;  3RRU A;  3L13 A;  4B0Z A;  4U63 A;  1ELK A;  3L17 A;  2CG3 A;  2DWZ A;  2F37 A;  4KBQ A;  5HKP A;  1S70 B;  1E96 B;  3Q5M A;  3Q7A A;  3LEW A;  3HXB A;  4JEU A;  4JA9 A;  3LKU A;  2ZU6 B;  4IN3 B;  1FT1 A;  4RSY A;  5CCL A;  4Y6W A;  2CHX A;  4RLY A;  4A55 A;  3KAE A;  4MBG A;  4V3I A;  1DC2 A;  4U8H A;  3BUA A;  2WXI A;  3C72 A;  4LNG A;  1SA5 A;  5AAO A;  3FTZ A;  2ZGG A;  3ULQ A;  3HG0 D;  5HRY A;  3S2A A;  2LAH A;  4CGW A;  3PUJ A;  1P5Q A;  4BER A;  2XRZ A;  2PQN A;  4DLO A;  4X2C A;  3DWL G;  1E7U A;  3TWW A;  3ZUV B;  5BXO A;  3ULY A;  1E8W A;  2P9N G;  3I4G A;  2DZN A;  3ZNG A;  5FZR A;  3AJI A;  4JVS A;  4WND A;  3UT4 A;  2YHE A;  3IKO B;  3UPV A;  4D10 C;  1E7V A;  1OT8 A;  2P9S G;  3TXM A;  2R17 C;  3U3W A;  4ANW A;  5AEN A;  3MJW A;  2V8S E;  3DPD A;  5AJL A;  3DXM G;  3CKB A;  3C3R A;  3D9K A;  2WQH A;  2A4Z A;  4IYP A;  1TNZ A;  2R05 A;  2WXH A;  4KT6 B;  4G23 A;  4TXR A;  1PAQ A;  3L16 A;  1IQR A;  3CHM A;  1O1S A;  2R59 A;  3TWS A;  3MKQ A;  4URK A;  4MRU A;  1X81 A;  2OVF A;  5EKQ D;  4A63 B;  3KD7 A;  2HYZ A;  5KNG A;  4N67 A;  3T8M A;  4JZY A;  3GW4 A;  3MKQ B;  1TN7 A;  3N71 A;  4DX6 D;  3KSL A;  5T8I A;  5EU0 A;  4M7C A;  3AS5 A;  4HFG A;  4GB9 A;  1S63 A;  5D2M C;  3Q78 A;  4LER A;  3G2V A;  2XS1 A;  4M3O A;  4I2W A;  3IXE A;  4GZC A;  3TWT A;  3ZVV A;  4UUC A;  4OYS A;  2VTB B;  1K8K G;  1FCH A;  2XGS A;  4BX8 A;  3Q9U C;  5DBK A;  2J07 A;  2YHC A;  4BEP A;  1NP7 A;  4AV7 A;  1IQU A;  3TWU A;  2ZXW E;  3HXE A;  3U66 A;  1NH1 A;  3HRA A;  3BQO A;  2WXK A;  1Y8M A;  5E75 A;  3E4B A;  4JPS A;  2X6K A;  3MZL B;  3CLJ A;  3ZU7 B;  4APF A;  2X6J A;  5AYW D;  1IXV A;  5ANR A;  5E76 A;  3CHP A;  3APF A;  1S64 A;  4RG9 A;  4HNA D;  3D9M A;  3RO3 A;  2VY3 A;  1H2T C;  4PS7 A;  2UWJ G;  3PS6 A;  5FIN A;  3VLE A;  2IOS A;  3NZU A;  2IU1 A;  1HE8 A;  3EU5 A;  3FU5 A;  5KWD A;  2XZD G;  4PUC A;  3IEG A;  3TWX A;  3GZS A;  4UQZ A;  1KZP A;  3P1U A;  4LCT A;  5EYP F;  2QFC A;  5ENQ D;  1Z5S C;  5IY5 E;  3EHN A;  4ZFH A;  5EID A;  4ITR A;  3D9N A;  1IYG A;  3L9T A;  3DST A;  2AXZ A;  2J4D A;  3AS8 A;  3CQC B;  4J8S A;  4IRU A;  4FU3 A;  3UM2 A;  1OWO A;  3JUE A;  3ZN3 A;  5CRV A;  4DX2 A;  2PM6 A;  3ZIM A;  1JUQ A;  2WM9 A;  4PS3 A;  3R9M A;  3LPZ A;  3RJV A;  4GTS A;  2R03 A;  2CG2 A;  4EZK A;  3FDH A;  1TNU A;  3NOG D;  5HQ8 A;  3TAX A;  5ITZ F;  3QAR A;  3DSW A;  5CEA A;  2NUN A;  2XZT G;  3JQ0 A;  4X8Q A;  4UWH A;  4APO A;  3HDX A;  5A6C A;  3LJN A;  4G24 A;  1O5M A;  3KEZ A;  2L0T B;  2IQC A;  2LO6 A;  3Q9N C;  2DCP A;  4XZ4 A;  3B7T A;  4I2Z A;  3Q75 A;  4N5C A;  4K5B A;  4GCN A;  3B7S A;  3DEO A;  3ASF A;  3HXF A;  3CK8 A;  3VLF A;  1E8Y A;  1YYH A;  4FHK A;  2YNQ A;  3D9O A;  3CVX A;  1MZC A;  1RZ4 A;  1YCS B;  1OWM A;  3OAW A;  4G8K A;  1N4P A;  2WQ6 A;  4QFV A;  1N54 A;  4OVV A;  3ONL A;  3IBE A;  2MYO A;  4AP2 A;  4GMR A;  3QWP A;  2AVP A;  3ABK E;  1UG3 A;  4GYY A;  4E85 A;  1K3Z D;  1OWP A;  2PZI A;  3CGH A;  1QNF A;  5LCW J;  4I6G A;  5EIL A;  1OWL A;  2RFA A;  5KJM A;  2WXP A;  1WM5 A;  3KEA A;  4F3V A;  2VGY A;  3RK6 A;  2Y4U A;  4UI9 J;  1BPO A;  3IHY A;  5EIB E;  2Y0B G;  3QDN A;  3D9J A;  3HYM B;  2QY7 A;  4GZ6 A;  4J6I A;  2H6F A;  4FUL A;  3NB2 A;  4C48 B;  1WG0 A;  2GRM A;  2XGO A;  3PE4 A;  3QKY A;  1UJK A;  1FPP A;  4ILH B;  4XI9 A;  4HOQ A;  3LY8 A;  3PUK A;  3QWV A;  3HVE A;  3BEE A;  3MYV A;  4XEI G;  2KCV A;  5LCW C;  2DVW A;  3UM0 A;  2HO1 A;  2GRL A;  2I9C A;  4DX7 D;  5EN5 D;  4WWN A;  3L6A A;  4K5C A;  3G2S A;  1D8E A;  1O1T A;  2BTD A;  3K9I A;  4H7Y A;  4HRM B;  3KS2 A;  4NQ0 A;  1MX4 A;  3SD5 A;  3V31 A;  3DSX A;  4YVO A;  2C2L A;  4C0E A;  5CHE E;  4L9P A;  2AXU A;  3B13 A;  4JL0 A;  3KSQ A;  2EIJ E;  4HQD A;  3SBS A;  2J09 A;  2WXL A;  3NAW A;  2BED A;  1BI8 B;  1UJJ A;  3FH8 A;  5ENT D;  1SQM A;  3JQ1 A;  1ELW A;  4QQI A;  1K1B A;  1LF8 A;  2V5Q C;  2V0P A;  4H7X A;  5G55 A;  3I3N A;  3ZCB A;  3CHR A;  4FLH A;  5JFZ A;  3RU0 A;  4O60 A;  1D9S A;  4I6J A;  1SW6 A;  3CVV A;  2KZT A;  2VSO E;  3MV3 B;  4N3C A;  1PY1 A;  3FEY A;  3RSE G;  4FJZ A;  1D8D A;  2PL2 A;  3QK0 A;  5CER B;  3PRE A;  2KXP C;  1HZ4 A;  4G11 A;  3LY7 A;  3VTX A;  1Z3Y A;  2GRO B;  2KZT B;  3FFL A;  4Z68 A;  4C9B B;  3JYS A;  2J8S D;  3UI2 A;  3FTY A;  3AS4 A;  4OAV B;  3I4R B;  1MYO A;  1QQE A;  2WXQ A;  2XEV A;  1KT1 A;  2RG8 A;  2MOW A;  4N3B A;  2A5U A;  1PC2 A;  3Q79 A;  1OCC E;  1YA0 A;  2KBX A;  3E32 A;  5CBO A;  3EUV A;  4A1G A;  1EYH A;  3LS8 A;  2XEE A;  1TNB A;  4G25 A;  4J8D A;  5BXU A;  5BV0 A;  2QC9 A;  2I1K A;  3FTW A;  3AG1 E;  1H0A A;  5G04 J;  4NAC A;  2VQ2 A;  5LOZ A;  3RKV A;  3UT7 A;  2WQ7 A;  5LX8 A;  1UN8 A;  3I5P A;  2PQR A;  4GA2 A;  1JPL A;  4HI8 A;  3X2Q E;  4X2D A;  4OAU C;  4MLP A;  3T5V A;  3ULE G;  4U8Y D;  1HU3 A;  2F6S A;  3QB2 A;  1UOH A;  3OTN A;  2Y4T A;  4N2Q A;  3ABM E;  4EHM A;  4KZC A;  1V55 E;  3SHF A;  4BFR A;  4WWP A;  2LUH A;  2P9U G;  2L9B A;  2ZIS A;  1N52 A;  3TG4 A;  4WAF A;  1TN8 A;  5G04 C;  1Z3X A;  3D3M A;  3D9H A;  4EBA G;  3V30 A;  3PZ2 A;  3QWW A;  1V54 E;  2C0L A;  4C0M A;  5T4Y A;  1AWC B;  4XIF A;  5KCM A;  1N0Q A;  4W9R A;  2WXN A;  4AM9 A;  1OUV A;  1JCS A;  1UN9 A;  3SI5 A;  3FU0 A;  2FO7 A;  3CEQ A;  4NIK A;  2QYJ A;  2P2C P;  5LP0 A;  5FQ6 A;  5BV1 A;  1KPS B;  2FBN A;  2JLB A;  3G2U A;  4U7E B;  2OND A;  4O1P A;  2V4L A;  4MKT A;  1MX6 A;  3Q7F A;  2XCC A;  1QZ2 A;  2BUG A;  4BSX A;  4B94 A;  4N5Q A;  5M72 A;  4TRQ A;  2KCK A;  4YVQ C;  3L54 A;  3CVN A;  4NUR A;  1A17 A;  2P9L G;  3CQG B;  4GTO A;  3R7Q A;  3CK7 A;  3D9P A;  4LRZ A;  1H2U A;  1H6K A;  1KT0 A;  1GW6 A;  5B1B E;  3CVP A;  3FTU A;  2VZA A;  3ZGQ A;  1BI7 B;  1WDY A;  4AY6 A;  5EX3 A;  2JK8 A;  2C0M A;  3ISM C;  1TJC A;  2CHW A;  3CHS A;  2ZGD A;  2AXV A;  3FTS A;  3UM3 A;  3JXJ A;  3UIP C;  4B8C B;  2WXG A;  5JJ7 A;  4N39 A;  4EPZ A;  1ZB1 A;  2B0O E;  3PRZ A;  5FZQ A;  5FWQ A;  3SN9 A;  1TYQ G;  2B6C A;  2WXO A;  1HX8 A;  4F7A A;  4WUY A;  2OV8 A;  4JXT A;  3FH7 A;  3O4Z A;  4JC8 A;  1ELR A;  3U64 A;  2A5E A;  4GAA A;  4CYM D;  5KJN A;  3QAQ A;  3W9F A;  3SFX A;  3LYA A;  4GU5 A;  4O6F A;  2XEN A;  2VJ8 A;  5CKL A;  5J08 A;  2HE0 A;  5H7P A;  3ZYM A;  2WPV A;  5CCM A;  2LXM A;  4DX5 D;  1IHG A;  4YDW A;  4CGV A;  3CVU A;  4KYO B;  4HLE A;  1HG2 A;  3LVQ E;  2JAB A;  3HXD A;  2GRQ B;  3C5R A;  3G2W A;  4LEU A;  2HR2 A;  3J5Q B;  4TXQ A;  4JEH A;  1H2V C;  2NXP A;  4ILI A;  3QJZ A;  4A1S A;  4J7W A;  4DPR A;  3CHQ A;  2FO1 E;  4HS2 A;  3UXG A;  2GRP B;  4XI0 A;  4L1B A;  1E90 A;  3B7U X;  4R7L A;  1BU9 A;  2NUD A;  4ATG A;  4L2L A;  5KJL A;  4WGJ A;  1YMP A;  2CFU A;  2EIN E;  2WXF A;  4G26 A;  1OY3 D;  5CBN A;  2X6H A;  1H6O A;  4DI4 A;  4U8V D;  3TJP A;  1NZN A;  2MHK A;  3URZ A;  3OXG A;  1QYM A;  1KLX A;  3P2B A;  2ZIR A;  4GA1 A;  4LSZ E;  1HF8 A;  3UMV A;  2YIN A;  5D0O D;  4ANU A;  3SZ7 A;  3Q49 B;  5ENR D;  2VSN A;  5CRU A;  3E33 A;  3FH5 A;  1E8X A;  3HXC A;  5CMT A;  3RIB A;  4X2E A;  4WNG A;  3ZXS A;  1DCQ A;  4E6H A;  1HS6 A;  2I1J A;  1K1A A;  1O1R A;  4BT9 A;  3N3U A;  1N4R A;  2WXR A;  5EX0 A;  4F1S A;  4U04 A;  2L6J A;  1RW2 A;  2DYR E;  1JWG A;  5CMW A;  1SA4 A;  4BSZ B;  5BW8 C;  4CCA A;  3APD A;  4A3T A;  4CDR A;  3ONK A;  4KVO A;  3AG3 E;  4RG6 A;  3TGO A;  4Q96 A;  1IHB A;  4B89 A;  4I43 A;  4BWR A;  4U0U A;  3PZ1 A;  1SZ9 A;  4U0S A;  5CED B;  5ENN A;  2GW1 A;  5ENO D;  1BD8 A;  3SFY A;  1MQS A;  3NZS A;  3EHR A;  3DBS A;  2ETC A;  3S6A A;  3TWR A;  3FUJ A;  5CGL A;  4HBD A;  4AEZ C;  4IUL A;  4CRW A;  3ZYL A;  2P9I G;  2E0I A;  5A23 A;  2I2O A;  4F1P A;  4GPM A;  3C3O A;  4XKB A;  3PVL A;  2BF0 X;  5FZS A;  1N4S A;  4AVX A;  5KBA A;  3RRN B;  1SZA A;  3VTY A;  3HVE B;  4M16 A;  4UI9 C;  4GPK A;  3JUI A;  4CEM A;  3BU8 A;  3V79 K;  3ASG A;  4DLQ A;  5G05 J;  1W3B A;  3UTM A;  1EPU A;  4JHJ A;  3CKC A;  4HOU A;  5JHB A;  2R2L A;  4CT4 A;  3FUH A;  4RQI A;  3LXU X;  2P9P G;  2IY0 C;  3FUE A;  5JJT A;  3QOU A;  4G2V A;  2OCC E;  4HRN A;  1S0P A;  4JD2 G;  4LU4 A;  1BLX B;  3LJ3 A;  4LNB A;  3SO8 A;  4NPS A;  1JCR A;  2RD0 A;  1Z6T A;  3ASD A;  3AAA C;  3FUI A;  1EF1 C;  2KC7 A;  2RFM A;  3SBT B;  2XPI A;  3CVL A;  2I6H A;  2V4H C;  3CST A;  2BKK B;  3CHO A;  4I1O B;  3FWV A;  4GTR A;  5AQA A;  3J5P A;  3TWQ A;  2NYJ A;  5ARG A;  3FTX A;  2J4B A;  5JJ6 A;  2J49 A;  2XCB A;  3SF4 A;  1ZBP A;  1FVH A;  3G2T A;  1N11 A;  2VGE A;  3ASN E;  1XNF A;  4GCO A;  5CEC B;  5B1A E;  4AOF A;  4GML A;  1NFI E;  4DRX E;  3FHE A;  4ABN A;  2LAI A;  4O1O A;  4PH4 B;  3T8K A;  2EIL E;  1INZ A;  2VSY A;  2XPY A;  1JWF A;  3ESK A;  3TWV A;  2F8X K;  4A3V A;  4F53 A;  2CHZ A;  1OCZ E;  4L7T A;  1LD7 A;  2BKG A;  5JFF A;  4EZL A;  3NQP A;  2PM7 A;  2JEK A;  2FEZ A;  1OCR E;  1H6P A;  4EBA A;  3ZYK A;  2IJG X;  3T9K A;  2FI7 A;  5AAR A;  5ARF A;  4EQF A;  2WXM A;  4GZ3 A;  2ION A;  1FT2 A;  4TXP A;  3R9A B;  4I6E A;  4J0U A;  3SY2 A;  4CT0 A;  3CIA A;  3UIN C;  5FIO A;  4N3A A;  5JMN D;  3DSV A;  1HO8 A;  4XKC A;  3NOC D;  3UT8 A;  4ACL A;  2Y69 E;  3S7F A;  3W9G A;  2M63 A;  4UQY A;  2XS8 A;  3PH0 C;  4BT8 A;  1Y6I A;  2IO3 C;  4MS6 A;  1LD8 A;  3FTV A;  5CMY A;  4HXI A;  3SFZ A;  1WAO 1;  5FQ7 A;  2G03 A;  4BTA A;  2XGM A;  1N95 A;  3LET A;  2KCL A;  2L6B A;  1N94 A;  2XRY A;  3ZFW A;  3ABL E;  4CDM A;  5D0Q D;  3UQ3 A;  3V2O A;  3AU4 A;  3LVR E;  5AN8 A;  2VGX A;  3GZ1 A;  1N9A A;  2UY1 A;  3R7R A;  2P9K G;  1TNY A;  4YDO A;  3PEU B;  3B7R L;  4KZ0 A;  4LUN U;  5BNW A;  2X3M A;  3UM1 A;  1MJ0 A;  2VGX B;  3GZ2 A;  3HHM A;  4DK5 A;  5C1D A;  4F6R D;  2UY1 B;  4I9C A;  3UKU G;  4GTT A;  3BG1 B;  3SQV A;  3AG4 E;  1DCE A;  5BPP A;  4J8E A;  3CSF A;  3PZ4 A;  2DYS E;  4JB8 P;  3PDN A;  3RRM B;  3DPY A;  3PZ3 A;  3WXX A;  5AJD A;  1HG5 A;  4J8F A;  4ATZ D;  4JHR A;  4CZ2 D;  4GMJ A;  3PNT B;  2NC9 A;  2VTB A;  4AXH A;  1U3C A;  2XQ0 A;  4UWK A;  1H19 A;  4FLB A;  4UWG A;  3T5X A;  3HIZ A;  2WMN A;  1FVF A;  3SGH A;  2VSX E;  5LFA A;  2NSZ A;  4GTV A;  1G3N B;  3MV2 B;  4BX9 A;  1MX2 A;  4DX1 A;  2H6G A;  4XE0 A;  1U2V G;  1N4Q A;  1HXI A;  3MEK A;  1TR4 A;  2KAT A;  3PZD A;  4U07 A;  4KVM A;  4Q69 A;  3RAU A;  2Y3A A;  3EIQ C;  2IOL A;  3Q4A B;  1NI1 A;  3FU3 A;  3ZRH A;  1IKN D;  3E37 A;  5B3S E;  5JHA A;  2X6F A;  4I1M A;  2R02 A;  3ZHE A;  4GYO A;  1UW4 B;  1TJF A;  1JCQ A;  2HM8 A;  4WNE A;  2IFU A;  2RKK A;  3TL5 A;  1DVP A;  3ZYQ A;  4AY5 A;  3SHG A;  1QBQ A;  3FUK A;  5T3R A;  3CUC A;  4BES A;  1WY6 A;  4UQX A;  3EJN A;  3ZHE B;  4UWF A;  2EIK E;  4ZHB A;  4HOT A;  5AQ9 A;  4GA0 A;  4HVB A;  5JA4 D;  4LG6 A;  3ZXP A;  4EZJ A;  4ILG A;  5FT9 A;  2L0I A; 
#chains in the Genus database with same CATH homology
 5HI7 A;  4IYP A;  2A5U A;  3BG0 B;  5CGL A;  2WXH A;  3OXL A;  4AEZ C;  4KT6 B;  4JA7 A;  1PC2 A;  4G23 A;  3OXF A;  4IUL A;  1PAQ A;  3FEX A;  3L16 A;  1YA0 A;  4CRW A;  3ZYL A;  2E0I A;  5A23 A;  4A1G A;  2I2O A;  1EYH A;  3LS8 A;  1IQR A;  3CHM A;  2R59 A;  2DBA A;  3MKQ A;  4G25 A;  4J8D A;  4XX5 A;  5BV0 A;  4DJA A;  4URK A;  4XKB A;  2I1K A;  4MRU A;  3FTW A;  2ILR A;  1H0A A;  5G04 J;  3PVL A;  4NAC A;  2BF0 X;  2VQ2 A;  1NA3 A;  2OVF A;  5FZS A;  4XI8 A;  2WVI A;  5LOZ A;  3RKV A;  3UT7 A;  5EKQ D;  2WQ7 A;  5LX8 A;  3CVW A;  1UN8 A;  4AVX A;  1NA0 A;  1SZA A;  3KD7 A;  3RRN B;  3VTY A;  3LY9 A;  3I5P A;  2HYZ A;  4BTB A;  2PQR A;  3HVE B;  4GA2 A;  4M16 A;  4N67 A;  4UI9 C;  3JUI A;  4JZY A;  3T8M A;  3GW4 A;  4CEM A;  2VYI A;  3MKQ B;  4GPK A;  1JPL A;  3ASG A;  3N71 A;  3JCK C;  4X2D A;  4FHJ A;  3CV0 A;  4MLP A;  5BUZ A;  4DLQ A;  5G05 J;  5EU0 A;  5T8I A;  5EDS A;  3T5V A;  3AS5 A;  4HFG A;  4GB9 A;  1W3B A;  3FP3 A;  3SNX A;  1HU3 A;  2F6S A;  3QB2 A;  4LER A;  1EPU A;  3G2V A;  3OTN A;  2Y4T A;  3FU6 A;  2LSU A;  4JHJ A;  4ME2 A;  4N2Q A;  4KZC A;  3CKC A;  4HOU A;  3SHF A;  4M3O A;  4I2W A;  4BFR A;  5JHB A;  4CT4 A;  3FUH A;  4GZC A;  4GZ5 A;  4WWP A;  3IHV A;  3ZVV A;  3LXU X;  4OYS A;  2VTB B;  1U3D A;  2XGS A;  1FCH A;  4BX8 A;  2DIW A;  2WMO A;  2L9B A;  5DBK A;  2J07 A;  2YHC A;  3FUE A;  5JJT A;  1NP7 A;  4OVU A;  3QOU A;  4G2V A;  1N52 A;  3ZC7 A;  3TG4 A;  4AV7 A;  1IQU A;  2X6I A;  3MKR A;  4WAF A;  4ANX A;  3VLD A;  5G04 C;  1S0P A;  1Z3X A;  1DNP A;  4LU4 A;  3U66 A;  3CVY A;  3PEV B;  3D3M A;  4UI9 K;  2WB2 A;  4A1S A;  2WXK A;  4EBA G;  3AU5 A;  3LJ3 A;  4BY6 A;  5BT1 A;  1Y8M A;  5E75 A;  3EHM A;  4NPS A;  3E4B A;  2RD0 A;  4JPS A;  2X6K A;  3FUD A;  1Z6T A;  3MZL B;  3ASD A;  3CLJ A;  3QWW A;  3U4T A;  3FUI A;  2C0L A;  4APF A;  3EDT B;  1EF1 C;  2X6J A;  4C0M A;  5AYW D;  5ANR A;  5E76 A;  3CHP A;  1X5B A;  2KC7 A;  3APF A;  5T4Y A;  4RG9 A;  3SBT B;  2XPI A;  3CVL A;  2I6H A;  3PE3 A;  4XIF A;  3CST A;  5KCM A;  4I17 A;  3D9M A;  3RO3 A;  2VY3 A;  3CHO A;  4W9R A;  2WXN A;  3ENE A;  4AM9 A;  4U0Z A;  4G1T A;  4I1O B;  3FWV A;  1OUV A;  1H2T C;  4PS7 A;  1UN9 A;  3SI5 A;  2UWJ G;  3PS6 A;  3APC A;  3FU0 A;  2FO7 A;  3L08 A;  3VLE A;  2IOS A;  3CEQ A;  5ARG A;  3FTX A;  2IF4 A;  2IU1 A;  2J4B A;  3NZU A;  1HE8 A;  4FP7 A;  3FU5 A;  5LP0 A;  4N2S A;  5JJ6 A;  2J49 A;  4PUC A;  3IEG A;  2XCB A;  2XPZ A;  5FQ6 A;  3SF4 A;  5BV1 A;  2FUL A;  1ZBP A;  3GZS A;  4UQZ A;  2FBN A;  2JLB A;  3G2U A;  3P1U A;  1FVH A;  1L5J A;  2OND A;  2QFC A;  2V4L A;  3G2T A;  4LCT A;  3SE5 A;  4MKT A;  3MA5 A;  1XNF A;  4GCO A;  2MRI A;  3UX4 A;  2XCC A;  1QZ2 A;  2BUG A;  3EHN A;  4BSX A;  4B94 A;  1EDU A;  3PNL B;  5A7D B;  5ANL A;  4AOF A;  4FJY A;  4GML A;  5M72 A;  4PS8 A;  3FHE A;  4TRQ A;  2KCK A;  4ABN A;  4YVQ C;  3L54 A;  4ITR A;  2LAI A;  3D9N A;  3QNK A;  1IYG A;  4B8A A;  3CVN A;  2AXZ A;  2J4D A;  3AS8 A;  4NUR A;  1TEZ A;  4PH4 B;  3FUM A;  3QC1 A;  1A17 A;  3CQC B;  4J8S A;  4KMO A;  1INZ A;  2VSY A;  3CQG B;  2XPY A;  4IRU A;  3R7Q A;  3CK7 A;  3D9P A;  1JWF A;  3ESK A;  4LRZ A;  4FA6 A;  1H2U A;  1H6K A;  4FU3 A;  1KT0 A;  4TUU A;  4A3V A;  3FUN A;  4L2Y A;  4HOR A;  4F53 A;  1OWO A;  3FUL A;  1GW6 A;  3CVP A;  2CHZ A;  3FTU A;  2VZA A;  3ZN3 A;  4RVB A;  2PM6 A;  3ZIM A;  4L7T A;  1JUQ A;  2WM9 A;  1HFA A;  4PS3 A;  3S7D A;  3ZGQ A;  1MHQ A;  3ASH A;  3IV0 A;  5JFF A;  4EZL A;  4AY6 A;  3NQP A;  5EX3 A;  2JK8 A;  2PM7 A;  3LPZ A;  2JEK A;  3RJV A;  2J08 A;  2X38 A;  2C0M A;  2FEZ A;  2CG2 A;  4EZK A;  3TXN A;  1TJC A;  3FDH A;  3ZW3 A;  3LDZ A;  4EBA A;  2CHW A;  4K03 A;  2IJG X;  3CHS A;  3ZYK A;  2FI7 A;  3O48 A;  4YND A;  3NF1 A;  5J90 A;  2AXV A;  3S7B A;  3FTS A;  5ARF A;  3ESL A;  3TAX A;  2WXM A;  3RO2 A;  3MCX A;  4B8C B;  4EQF A;  2WXG A;  3ML9 A;  3Q15 A;  3QAR A;  3JQ0 A;  4GZ3 A;  5JJ7 A;  4N39 A;  2ION A;  1XGW A;  4UWH A;  3UUX A;  4APO A;  2LSV A;  4EPZ A;  4HOS A;  3HDX A;  5A6C A;  3FUF A;  2FF4 A;  4G24 A;  3KEZ A;  3PRZ A;  5FZQ A;  5FWQ A;  3R9A B;  4I6E A;  5KJK A;  2L0T B;  3SN9 A;  2IQC A;  2LO6 A;  4J0U A;  4JW1 A;  5FQ8 A;  4CT0 A;  3CIA A;  2DCP A;  3D9L A;  4CDN A;  2E2E A;  2WXO A;  1HX8 A;  3B7T A;  4N3A A;  2OV8 A;  4I2Z A;  4WUY A;  4XZ4 A;  4F7A A;  2CFZ A;  4N5C A;  4JXT A;  3FH7 A;  5FTP A;  1HH8 A;  4EEC A;  3CVQ A;  3O4Z A;  1HO8 A;  4XKC A;  3Q47 B;  4GCN A;  4JC8 A;  2J9Q A;  3LCA A;  4PY3 A;  5G2N A;  1ELR A;  4ACK A;  4AJW A;  3U64 A;  1E8Z A;  2V5F A;  3UT8 A;  4ACL A;  3B7S A;  3S7F A;  3ASF A;  2OOE A;  3CK8 A;  3VLF A;  1E8Y A;  4FC8 A;  2M63 A;  4GAA A;  4UQY A;  5G05 C;  5KJN A;  4FHK A;  2YNQ A;  3D9O A;  3QAQ A;  3PH0 C;  3S7J A;  3LYA A;  3CVX A;  5DIZ A;  4GU5 A;  4BT8 A;  1Y6I A;  2AWI A;  4I9E A;  4O6F A;  1OWM A;  3OAW A;  3D9I A;  4MS6 A;  2WQ6 A;  3ZLM A;  2VJ8 A;  3MGB A;  3FTV A;  4QFV A;  4GZD A;  5CKL A;  1N54 A;  4Q94 A;  5J08 A;  3GYZ A;  4OVV A;  3ONL A;  5CMY A;  3IBE A;  4HXI A;  1ZU2 A;  3SFZ A;  4P29 A;  2EQX A;  4AP2 A;  1WAO 1;  3ML8 A;  5FQ4 A;  3ZYM A;  2WPV A;  2P58 C;  5FQ7 A;  2G03 A;  5CCM A;  3CR3 A;  3QWP A;  1IHG A;  2AVP A;  4BTA A;  4DI3 A;  1UG3 A;  4UWL A;  2XGM A;  4Y6C A;  4CGV A;  3CVU A;  4KYO B;  4GYY A;  4E85 A;  4HLE A;  1OWP A;  1HG2 A;  4L23 A;  3TG5 A;  4WWO A;  2PZI A;  3CGH A;  3LVQ E;  3ZEF A;  3LET A;  1QNF A;  5LCW J;  2KCL A;  2R5S A;  4GYW A;  3G2W A;  4I1A A;  4I6G A;  2XHE A;  1OWL A;  2OVB A;  4LEU A;  5KJM A;  2HR2 A;  2XRY A;  4NRH B;  2WXP A;  3C98 A;  3ZFW A;  5FJY A;  4WNF A;  4CDM A;  5D0Q D;  1WM5 A;  3UQ3 A;  4JEH A;  3AU4 A;  3LVR E;  1H2V C;  2NXP A;  2LNI A;  2VGX A;  3L22 A;  3QJZ A;  4ILI A;  3GZ1 A;  2KM4 A;  2VGY A;  2Y4U A;  3RK6 A;  4UI9 J;  1BPO A;  3IHY A;  4TV3 A;  4AIF A;  4F3V A;  2A4Z A;  2UY1 A;  3QDN A;  3ZPJ A;  4K0R A;  4DPR A;  3CHQ A;  3D9J A;  3R7R A;  3HYM B;  2QY7 A;  3EIJ A;  4GZ6 A;  4J6I A;  3CK9 A;  4HS2 A;  5C2Y A;  4FUL A;  3PEU B;  3B7R L;  4XI0 A;  4L1B A;  1E90 A;  2WXJ A;  4KZ0 A;  3B7U X;  2GRM A;  4LUN U;  4R7L A;  4PDX A;  2XGO A;  3PE4 A;  3QKY A;  5AIJ A;  5BNW A;  3MX3 A;  2X3M A;  4ATG A;  1UJK A;  4L2L A;  5HQ8 A;  3U9W A;  4ILH B;  5KJL A;  4WGJ A;  2VGX B;  3GZ2 A;  3HHM A;  4HOQ A;  3LY8 A;  4JHK A;  4XI9 A;  2CFU A;  4DK5 A;  5C1D A;  3FY4 A;  2Q7F A;  2YQ8 A;  2UY1 B;  3PUK A;  2WXF A;  4G26 A;  1OWN A;  4I9C A;  3QWV A;  2X6H A;  4DI4 A;  4KXK B;  2GGF A;  3TJP A;  3BG1 B;  3HVE A;  3BEE A;  1NZN A;  3MYV A;  4FAD A;  2KCV A;  5BPP A;  5LCW C;  2MHK A;  4J8E A;  3URZ A;  1VDY A;  3OXG A;  3CSF A;  2AW6 A;  1B89 A;  1KLX A;  4ANV A;  2HO1 A;  2GRL A;  2I9C A;  3PDN A;  3P2B A;  3RRM B;  3RRU A;  3WXX A;  5AJD A;  3L13 A;  4B0Z A;  4GA1 A;  1HG5 A;  4U63 A;  1ELK A;  4J8F A;  4WWN A;  1HF8 A;  3L17 A;  4JHR A;  3UMV A;  2YIN A;  5D0O D;  2CG3 A;  4KBQ A;  3SZ7 A;  4ANU A;  3L6A A;  3Q49 B;  4GMJ A;  2VSN A;  3PNT B;  1E96 B;  3Q5M A;  2NC9 A;  3G2S A;  2VTB A;  4AXH A;  3LEW A;  1U3C A;  4JEU A;  3K9I A;  2BTD A;  4JA9 A;  2XQ0 A;  3FH5 A;  4H7Y A;  3LKU A;  1E8X A;  2ZU6 B;  4IN3 B;  1H19 A;  4FLB A;  4RSY A;  4UWK A;  3KS2 A;  5CCL A;  5CMT A;  4NQ0 A;  4UWG A;  3RIB A;  3SD5 A;  4X2E A;  4WNG A;  3T5X A;  4Y6W A;  2CHX A;  4YVO A;  2C2L A;  3ZXS A;  4C0E A;  5CHE E;  3HIZ A;  2WMN A;  4E6H A;  1FVF A;  1HS6 A;  2I1J A;  4A55 A;  2AXU A;  3B13 A;  3KAE A;  4JL0 A;  3SGH A;  4V3I A;  4BT9 A;  4U8H A;  2WXI A;  2VSX E;  5LFA A;  2NSZ A;  2J09 A;  2WXL A;  3N3U A;  3SBS A;  3MV2 B;  4BX9 A;  3FTZ A;  3ULQ A;  2WXR A;  1UJJ A;  3FH8 A;  5EX0 A;  3S2A A;  4XE0 A;  2LAH A;  1SQM A;  4U04 A;  4F1S A;  3JQ1 A;  4CGW A;  3PUJ A;  2L6J A;  1HXI A;  1P5Q A;  2XRZ A;  1ELW A;  2PQN A;  3MEK A;  2KAT A;  1JWG A;  3PZD A;  4U07 A;  5CMW A;  1LF8 A;  4DLO A;  4KVM A;  4Q69 A;  2V0P A;  2Y3A A;  4H7X A;  5BW8 C;  3EIQ C;  5G55 A;  4X2C A;  2IOL A;  3I3N A;  3Q4A B;  4CCA A;  3APD A;  3FU3 A;  3ZCB A;  1E7U A;  3CHR A;  3ZRH A;  4A3T A;  4FLH A;  5JFZ A;  3RU0 A;  4CDR A;  3ONK A;  4KVO A;  5JHA A;  2X6F A;  4I6J A;  3CVV A;  4I1M A;  4RG6 A;  2KZT A;  2VSO E;  3MV3 B;  4N3C A;  3TGO A;  3ZHE A;  1PY1 A;  3FEY A;  1E8W A;  4GYO A;  4Q96 A;  1UW4 B;  1TJF A;  2HM8 A;  3I4G A;  4WNE A;  4B89 A;  5FZR A;  2IFU A;  4FJZ A;  4JVS A;  3TL5 A;  1DVP A;  4I43 A;  3ZYQ A;  4N3B A;  4BWR A;  4WND A;  2PL2 A;  3QK0 A;  3SHG A;  3UT4 A;  4AY5 A;  2YHE A;  3FUK A;  3IKO B;  4U0U A;  3PRE A;  3UPV A;  5T3R A;  4D10 C;  3CUC A;  1HZ4 A;  4G11 A;  1SZ9 A;  3LY7 A;  1WY6 A;  1E7V A;  3VTX A;  4UQX A;  1Z3Y A;  3TXM A;  2KZT B;  2R17 C;  3FFL A;  4U0S A;  3U3W A;  3EJN A;  3ZHE B;  4C9B B;  4ANW A;  4UWF A;  5AEN A;  3JYS A;  4HOT A;  5ENN A;  4GA0 A;  4HVB A;  3FTY A;  3MJW A;  2GW1 A;  2V8S E;  3AS4 A;  3DPD A;  1MQS A;  5AJL A;  3NZS A;  4EZJ A;  3CKB A;  4ILG A;  3I4R B;  1QQE A;  2WXQ A;  3DBS A;  2XEV A;  3S6A A;  3D9K A;  5FT9 A;  1KT1 A;  2RG8 A;  2MOW A;  2L0I A;  2WQH A;  3FUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...