4U0UA

Wild type eukaryotic fic domain containing protein with adp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
334
structure length
334
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFATTEYSVALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
total genus 127
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u0uA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u0uA01
3Q4AB 3UUXA 4BTBA 4RG9A 3CVLA 5A6CA 4GZ5A 5FZSA 4AY6A 2VZAA 4CDRA 1KT1A 3FFLA 2VSYA 3ZHEA 4YVQC 2E2EA 4WNGA 4X2EA 3WXXA 4JA7A 2FBNA 3SF4A 5JJ7A 5G05J 2KC7A 1ZBPA 1YA0A 2IF4A 5HQ8A 2VGYA 5CKLA 3LKUA 2FI7A 1FCHA 1ZU2A 5G05C 2XCCA 3GZ1A 3CK9A 5BT1A 4XIFA 2KCLA 4XI0A 3LETA 1W3BA 3Q5MA 2UY1B 4BTAA 4ABNA 2G03A 4UQXA 1NA3A 4B94A 4N5CA 4NRHB 3GZ2A 5ARFA 3ZGQA 2JK8A 5KJNA 3MEKA 3OXFA 1WM5A 5JFFA 4G24A 4UI9K 3ASHA 3MA5A 2J9QA 3CKBA 4KXKB 2FO7A 5D0QD 4X2DA 3Q47B 3IEGA 4BT9A 2VY3A 2PL2A 3Q49B 4GCNA 3LPZA 3RIBA 2VYIA 3KD7A 4UI9J 4GYYA 4WGJA 2ONDA 2KCKA 3PE4A 5KJLA 4U07A 2VGXB 4HOSA 4N2QA 1WAO1 3CUCA 1ELWA 3RO2A 4ME2A 3QOUA 5FTPA 2MHKA 3FP3A 2YQ8A 2UWJG 3SHGA 1PC2A 3ZC7A 4JA9A 3OXGA 3TAXA 5A7DB 2BUGA 1QZ2A 3CV0A 2PQRA 3QDNA 3RKVA 2I6HA 3TG4A 4X2CA 4F3VA 2LSVA 3LY9A 3MV3B 3QWPA 4BT8A 3GYZA 4JHRA 4W9RA 4APOA 2FF4A 2C0MA 2LNIA 2OOEA 3E4BA 3FWVA 1QQEA 1NA0A 2XPIA 4GA1A 4I9CA 2UY1A 4CGVA 3ZLMA 4GYOA 4G25A 4N2SA 3LYAA 5DBKA 3LY8A 4U04A 3CK7A 4RG6A 3OXLA 4I2ZA 2HO1A 3TGOA 1TJCA 3Q15A 3AS8A 3NF1A 4UQZA 3SZ7A 5FZQA 5M72A 4WNDA 3URZA 4AIFA 1Y8MA 2XGOA 2AVPA 3ASFA 5G04J 4M16A 5EX0A 2Y4TA 1B89A 3VTYA 4HOTA 4H7YA 2KCVA 3MKRA 4Y6WA 4GA0A 3ZFWA 2QFCA 4HORA 5KJKA 5LCWC 4AM9A 3ASDA 3RU0A 3CVPA 3ZCBA 3N71A 3CK8A 4ITRA 3K9IA 2WPVA 2XEVA 3S7FA 4N3CA 5D0OD 4PY3A 1IYGA 1HH8A 4JL0A 4I17A 2R5SA 3PDNA 4GCOA 4LEUA 5JJ6A 5CMTA 3ZHEB 5FT9A 4U0UA 4I9EA 4HOQA 4J8DA 2HYZA 3BEEA 3RJVA 3AS5A 4A1SA 5JJTA 3KS2A 4H7XA 5EKQD 4N39A 4WUYA 4IN3B 3LY7A 4KBQA 4G2VA 3ULQA 3HYMB 5CCMA 2NC9A 1KLXA 3U4TA 3S7JA 3U3WA 2YHCA 1P5QA 4HOUA 5CCLA 2KATA 3VTXA 3QWVA 4WNEA 5EU0A 3CEQA 4CGWA 3S6AA 1NZNA 2VGXA 4NQ0A 3QWWA 2P58C 2VQ2A 3CVNA 2XCBA 3UQ3A 4GPKA 4J8EA 3UPVA 2DBAA 5DIZA 3MV2B 3SE5A 4LU4A 5CGLA 4BWRA 4NPSA 3ASGA 4G26A 2WQHA 5JFZA 2HR2A 4GA2A 4G1TA 3PE3A 2PQNA 3RO3A 4YNDA 2C0LA 1XNFA 3CVQA 4XI8A 4EQFA 4G23A 2V5FA 1IHGA 3R9AB 1HXIA 3EDTB 4U0SA 3GW4A 2VSNA 5FJYA 3LCAA 2C2LA 4WNFA 5BNWA 4XI9A 2IFUA 4GYWA 3AS4A 2FEZA 1A17A 4YVOA 2JLBA 4KYOB 3QKYA 3TG5A 3ZN3A 2F6SA 5C1DA 5EX3A 3ZPJA 4Y6CA 1KT0A 4UQYA 4N67A 4U0ZA 3N3UA 5AYWD 2GW1A 1OUVA 4GZ3A 1HZ4A 4UI9C 3O48A 3ESKA 3S7BA 5ARGA 2Y4UA 3CKCA 4N3BA 3SN9A 2XGSA 5FZRA 2L6JA 5HI7A 5BW8C 2LSUA 4I2WA 4N3AA 2Q7FA 4GZ6A 5LCWJ 5KJMA 4AY5A 4J0UA 2XGMA 3JYSA 1E96B 3S7DA 2PZIA 3KAEA 5CHEE 4O6FA 1ELRA 4J8FA 5G04C 4I1AA
chains in the Genus database with same CATH superfamily
3Q4AB 2MOWA 3FH8A 1EF1C 4J7WA 1N52A 4J6IA 3ZHEA 4WNGA 4HI8A 3B7BA 3ML9A 3WXXA 1Q2ZA 2KC7A 4ILIA 3FTSA 3MYVA 5CKLA 2FI7A 5KCMA 2HM8A 3GZ1A 2CHWA 3CK9A 1HFAA 4E6HA 2CHXA 3FEXA 2X38A 1N4QA 5BT1A 4XIFA 4BEPA 3E34A 4HRMB 2WM9A 3D9HA 5T3RA 1U2VG 2LO6A 4ATGA 4ABNA 4YDEA 2G03A 4UQXA 2XS1A 1NP7A 3NOGD 1NA3A 4DLOA 4B94A 3J5PA 1QYMA 2EIME 3GZ2A 2OVFA 2XPZA 3LDZA 5LFAA 5JFFA 1BD8A 2J9QA 1TNZA 3CKBA 2FO7A 2FULA 3G2UA 3Q47B 5D66A 2WXOA 5FQ8A 2VYIA 4OAUC 4GZDA 3FUFA 4UI9J 3EHMA 4AP2A 3ASNE 2ONDA 2KCKA 2GGFA 2XEHA 4GMJA 4EECA 3L6AA 2WB2A 1ELWA 3B13A 5FQ6A 4ME2A 3CLJA 1H6KA 5FTPA 2MHKA 4FP7A 2YQ8A 2UWJG 1N9AA 4JEHA 5EN5D 5A23A 4BESA 4EHMA 1PC2A 3TWVA 4IYPA 3FUHA 4HVBA 3D3MA 5CRUA 1DC2A 4EZKA 1JUQA 3I3NA 2I6HA 5ENPD 1E8YA 4F3VA 1N11A 3QWPA 3CVUA 3CHMA 2ETAA 4CYMD 5G2NA 3ZYQA 3T5VA 3DPDA 3G2VA 2LNIA 2L9BA 1TR4A 1DCEA 4EZLA 4DX1A 4CDNA 3BU8A 5ENQD 1AP7A 2XPIA 3DSWA 4RLYA 4CGVA 3ZLMA 4WWNA 4AEZC 4DX6D 3FTXA 1Z5SC 4CT4A 5ENSD 3SZ7A 4GB9A 3RAUA 1TYQG 3URZA 4AIFA 5LOZA 3BUAA 4MRUA 2ZU6B 5AARA 4MS6A 4B93B 3ISMC 3ASFA 4I6JA 4GAAA 5E75A 1Z6TA 3PVLA 3VTYA 4HOTA 1O1RA 2KCVA 3MKRA 2GRPB 4A55A 3PZ4A 2OCCE 4A1GA 4CCAA 3RU0A 4Q69A 4JVSA 3CR3A 3CVPA 3EJNA 1TN8A 4GTTA 4ITRA 3K9IA 3L22A 5AAOA 2QZAA 2Y1LE 2R2LA 2EILE 3EIQC 3PDNA 3D9MA 3DEPA 3ULYA 4LEUA 2LXLA 2NUNA 3UKRG 1FT1A 5ANRA 3P1UA 4JC8A 1N95A 5KWDA 2DWZA 3MKQA 1OY3D 3C3QA 4JHJA 3AS5A 4U8VD 3T5XA 4G11A 5E76A 1OCZE 3HYMB 2NC9A 1KLXA 3U3WA 2GRQB 1P5QA 4N5QA 5LX8A 2KATA 3VTXA 3QWVA 4JB8P 3FTYA 4F53A 4WNEA 3EU5A 4A63B 4WAFA 1WG0A 2DVWA 3C5RA 5HS0A 2P58C 2A5EA 4J8EA 5DIZA 3SE5A 3DSVA 2XRYA 5JFZA 3ZIMA 4HI9A 1D8EA 3BG1B 4FADA 2P9KG 4U95D 5KNGA 2DYRE 4YNDA 1D8DA 3CQCB 4RSYA 4G23A 4MLPA 5HKPA 3R9AB 3B7RL 1MX6A 3FUJA 2AW6A 5J08A 4D10C 2L0TB 3B7SA 3KSQA 2FEZA 3MJWA 4KYOB 3SD5A 2EIJE 3TG5A 5EDSA 5C1DA 4BSXA 4YDWA 3LJNA 1HG5A 2WMNA 4N67A 2V4HC 4U0ZA 3N3UA 3UXGA 1OUVA 3HVEA 4K5BA 3DEOA 3O48A 3ESLA 2Y4UA 3SY2A 4DX7D 3U66A 2WXNA 2XGSA 5FZRA 4GTSA 3W9FA 4DI4A 2L6JA 3D9PA 1U3DA 3CSTA 1N0QA 3PEVB 5CBOA 5LCWJ 3SBSA 5KJMA 5EYLA 1O5MA 2ZIRA 4J0UA 5CMYA 3S7DA 4YDYA 4DX5D 4FHJA 5CHEE 4L2YA 3MGBA 3OAWA 5AQAA 4FHKA 2PM7A 2JEKA 2L0IA 2H6GA 4A3VA 3UT4A 3AG2E 2IO3C 2M63A 3C3RA 4RG9A 5FZSA 1TNOA 2RFMA 3PZ1A 3CQGB 3CSFA 2E2EA 2Y3AA 1GW6A 4I6EA 2FBNA 3SF4A 1X5BA 1DCQA 4HFGA 3B7TA 1OWNA 5AQ9A 3U9WA 2GROB 3LKUA 3RRUA 1S63A 1ZU2A 3UIOC 2XCCA 4BFRA 2KCLA 4XI0A 3WG7E 4U96D 4HLLA 4JEUA 4Q96A 3RSEG 3FH7A 3HXDA 2CG2A 2WXKA 4BTAA 4Q94A 2PNNA 1SZ9A 4LNBA 3JXJA 4N5CA 4NRHB 3PZ3A 3FUNA 1RW2A 3QNKA 3MEKA 1BLXB 4E85A 1XGWA 5H7PA 3OXFA 3ZNGA 1WM5A 3HXFA 4UI9K 4QQIA 3ASHA 4X2DA 2LXMA 4BT9A 2F8YA 3Q49B 4GCNA 1PAQA 4K5AB 3RIBA 4JPSA 3O4ZA 2ILRA 2DYSE 4I6GA 1O1TA 2FO1E 3OTNA 4F1SA 5KJLA 4YDOA 4GTRA 4BX9A 2VGXB 3B7UX 3SO8A 5J90A 3AAAC 2WQ7A 2BF0X 3FY4A 5AQ7A 3FUMA 1A5EA 4DRXE 4L2LA 3ONLA 4ANVA 4M7CA 3OXGA 4KZCA 5A7DB 2KZTA 1Z3XA 4FU3A 2P9UG 3BG0B 3RKVA 2HE0A 2WVIA 3TG4A 4X2CA 4RQIA 5ITZF 3JXIA 3HIZA 3SFZA 4GTPA 3NZUA 3MV3B 2B0OE 4APOA 2CFUA 2FF4A 5D2MC 3IV0A 5T4YA 1SW6A 2P9IG 3CVXA 2OOEA 2VSOE 3E4BA 3JCKC 3HXCA 4TXPA 4EBAG 3L54A 1NA0A 1IHBA 5JHBA 1E8XA 4GYOA 3U64A 4IULA 4C0EA 4FJZA 4JHKA 4N2SA 3LYAA 1FPPA 4C48B 3LS8A 3HDXA 4U04A 1LTXA 1OWMA 2GRMA 4RG6A 3D9KA 4I2ZA 2HO1A 1TJCA 3Q15A 4J8SA 2B6CA 4UQZA 4A3TA 2J08A 2BTDA 4UWHA 3ASOE 2OEVA 4DJAA 4O1OA 1SA4A 2XGOA 2AXVA 2QYJA 2X3MA 2NSZA 3D9OA 2EIKE 3W9GA 3C3OA 4O60A 1KZPA 2KZTB 1B89A 2H6IA 4H7YA 1OWPA 3C72A 4HORA 5KJKA 4B0ZA 1INZA 2ZXWE 5IY5E 4KT6B 3TWWA 1WDYA 3CK8A 3MKQB 1HG2A 2WPVA 2XEVA 2I9CA 5D0OD 3FU5A 4PY3A 3DPYA 3X2QE 3T9KA 2ETBA 1IYGA 3FTWA 5FIOA 1AWCB 5ENNA 5BV0A 2QY7A 3FDHA 3ZHEB 2XEEA 4I1OB 3CHQA 4OVVA 5C2YA 4I9EA 4HOQA 2X6JA 4J8DA 4TV3A 1E7UA 3BEEA 4A1SA 5EKQD 4N39A 4WUYA 3TWTA 3PZ2A 3LY7A 3T8KA 3KEZA 3ULQA 5CCMA 3APDA 4ANXA 3D9LA 5ANLA 3SQVA 5CEDB 3BQOA 4UWLA 4CGWA 5EU0A 1NZNA 3QWWA 4HLEA 2VQ2A 3HVEB 4GPKA 3UPVA 5FQ7A 3MV2B 5CMWA 4LU4A 4BWRA 3E37A 4NPSA 3NZSA 4U8YD 2KM4A 4G1TA 2PQNA 2F37A 2J4DA 1XNFA 1LD7A 4EQFA 4C9BB 2J8SD 3PS6A 2GRRB 2V5FA 1O1SA 2R59A 1HXIA 4JW1A 1LD8A 4HS2A 3QC1A 2VTBB 2ZGGA 3I4RB 4WNFA 1KPSB 1WY6A 2YINA 1PY1A 2WXMA 2X6HA 2I1KA 2XQ0A 1A17A 4R7LA 1BPOA 3JUIA 1SQMA 4Y6CA 1RZ4A 1ELKA 2I1JA 3SNXA 5AJLA 2GW1A 1HX8A 1HZ4A 3UM0A 1OXJA 1OCOE 3P2BA 1EYHA 2KXPC 3DSXA 4CDMA 4L9PA 5BXUA 2LSUA 4N3AA 4P29A 1G3NB 4GZ6A 4HRLA 4X8QA 2V4LA 3EU9A 4B89A 4TUMA 2PM6A 4O6FA 4EBAA 3I5PA 1H2UA 2DZOA 4J8FA 5G55A 2AXZA 3J5QB 1UJKA 4UWGA 3UUXA 3CVLA 2NXPA 4AY6A 1V54E 4OAVB 1BU9A 4ANUA 3VLDA 2VZAA 4CDRA 1KT1A 1K3ZD 2VSYA 3V30A 4YVQC 1IKND 5CECB 4KVMA 3G2TA 1ZBPA 1YA0A 2IF4A 3DSSA 4JZYA 5HQ8A 2VGYA 4DK5A 1N4SA 1HS6A 5G05C 1UW4B 3ZVVA 1TN7A 3IHYA 2OVBA 3LETA 3Q5MA 3E30A 1MYOA 3SBTB 3QARA 3C98A 5BUZA 5KJNA 1S0PA 4GMLA 3DXMG 1MZCA 3FU6A 1JWFA 4JD2G 4G24A 2P2CP 3MZLB 2Y69E 3G2SA 3MA5A 4CRWA 1MHQA 5D0QD 5EYPF 3Q7FA 2VY3A 4F1PA 2IY0C 2DZNA 3KD7A 3Q9UC 2F8XK 3CHRA 4GYYA 4TXRA 3JQ1A 4WGJA 3PE4A 5EILA 4U07A 3Q79A 2J09A 4KZ0A 2J4BA 1V55E 4HOSA 1SZAA 3TJPA 1WAO1 3CUCA 3SHFA 2R17C 2IOSA 2YHEA 4GTQA 2I2OA 5FWQA 3DXKG 3AG4E 3RO2A 3APFA 1YMPA 3QOUA 4G8LA 4AV7A 4RVBA 2WQ6A 3FP3A 3LVQE 2BEDA 3L17A 3SHGA 2LAIA 3ZYLA 4TXQA 1JCRA 4PDXA 3KSLA 1HU3A 3SI5A 3ABKE 3RRNB 4BY6A 2BUGA 1QZ2A 1HE8A 3EUVA 1H2TC 3RK6A 2PQRA 3QDNA 4HBDA 1H0AA 2AJAA 2XZTG 5ENTD 4MBGA 2LAHA 3LY9A 4QFVA 4BT8A 3GYZA 4DLQA 1S70B 1YYHA 2C0MA 3SFXA 3ZYKA 3PREA 4AJWA 3FTUA 5JMND 4GA1A 2UY1A 1SA5A 4K0RA 2XZDG 3ONKA 2VSXE 4TRQA 4XKCA 5DBKA 3HG0D 4TUUA 2ETCA 3E33A 1LF8A 3TGOA 3FUDA 3AS8A 3NF1A 3FUKA 5FZQA 5M72A 4WNDA 3ZUVB 3HRAA 3DWLG 3FU3A 4GPMA 1IXVA 2R05A 4AVXA 2EINE 5KNHD 2KBXA 3UINC 5EX0A 5B1BE 3VLFA 4Y6WA 3ZFWA 4XKBA 3CGHA 3HHMA 1MX4A 3CHSA 1HF8A 3EIJA 3LJ3A 2IEJA 3ASDA 2MYOA 3CVYA 3LEWA 3T8MA 3ZCBA 4CT0A 2XENA 3TWRA 5KBAA 4N3CA 4EPZA 4PUCA 4JL0A 3FTVA 2R5SA 3DSUA 4GCOA 5JJ6A 4MKTA 2DIWA 1JCQA 5B1AE 4HNAD 3D9JA 1MJ0A 2NYJA 4I43A 2HYZA 3RJVA 5JJTA 1S64A 1TJFA 3APCA 2YNQA 3Q75A 5BPPA 4KBQA 1H6PA 4PS8A 2P9SG 4FJYA 4LERA 3FU0A 2OV8A 3U4TA 2VGEA 2IU1A 1KZOA 4HOUA 2BKGA 5LP0A 3CEQA 4WWPA 3S6AA 3ZEFA 2A4ZA 3UX4A 4NQ0A 3CVNA 4XEIG 2XCBA 3FULA 2DBAA 4O1PA 4CEMA 3L13A 3FEYA 3ASGA 4GA2A 3PE3A 2BKKB 3RO3A 4NIKA 2LUHA 1UJJA 3CVQA 4XI8A 2P9PG 3UM3A 1IHGA 4URKA 3ZXPA 3Q78A 2IQCA 4IRUA 2VSNA 4L23A 5BXOA 3QB2A 5FJYA 4ILHB 2C2LA 5BNWA 4XI9A 4B8AA 2XPYA 2X6KA 3AS4A 4ATZD 3R7QA 3UI2A 4YVOA 2JLBA 2EQXA 4NACA 1N94A 2P9LG 4UQYA 1EPUA 5EIDA 4ZFHA 4UI9C 2L6BA 2RKKA 3ZXSA 3Q7AA 3KEAA 2GRLA 4DUIA 4GTMA 5BV1A 3EHQA 5ENRD 5HI7A 5BW8C 4LCTA 3F6QA 2IOLA 4AY5A 2H6FA 1E8WA 2WXHA 1E96B 1OWOA 3KAEA 1K1AA 1MX2A 1UN9A 3HXEA 5G04C 4JXTA 2WXRA 2ZISA 3G2WA 1HO8A 2X6FA 4BTBA 3L9TA 2NUDA 3QAQA 5A6CA 4GZ5A 3JQ0A 2A5UA 3CIAA 2WXIA 3JUEA 2QYUA 1N54A 4KVOA 2X6IA 3FFLA 4F6RD 4K5CA 4UWFA 3R7RA 4X2EA 2H6HA 1H19A 3UT8A 3AG3E 4JA7A 4C0MA 1NH1A 5JJ7A 4U8HA 3FUEA 3Q9NC 5G05J 1JPLA 1FT2A 3ML8A 4BSZB 1H2VC 1FCHA 2RD0A 1ZB1A 3L16A 4DX2A 2V0PA 3DRAA 3L08A 3R9MA 1UN8A 1BI7B 2RG8A 1QBQA 1W3BA 3DBSA 1Z3YA 3IXEA 2UY1B 4FA6A 3D9IA 2WXJA 1MQSA 1SVXA 2P9NG 5FINA 5ARFA 4OYSA 3ZGQA 3TWUA 2JK8A 4HB5A 3ABME 1L5JA 2R02A 3PEUB 3ZRHA 4FLHA 4GTOA 4HQDA 4KXKB 2CG3A 3IEGA 2PL2A 4FULA 1OCCE 4AXHA 3LPZA 4PS7A 1D9SA 2WMOA 4UUCA 1NFIE 4N2QA 5CBNA 3LVRE 5ENOD 4LNGA 5FQ4A 1OWLA 2IJGX 4GTVA 2E0IA 2XHEA 1JCSA 2VTBA 1FVHA 2WXPA 3ZC7A 3NB2A 4JA9A 3TAXA 4PH4B 3DSTA 4HRNA 2IONA 3NQPA 3CV0A 3EHNA 4CZ2D 3V2OA 1TEZA 5CRVA 2LSVA 2GRNB 4UWKA 2XS8A 4HXIA 4JHRA 3B95A 4W9RA 1N4RA 4ILGA 1TNBA 5CEAA 1DNPA 1N4PA 2R03A 4M3OA 3S2AA 4NURA 3ENEA 4U7EB 5B3SE 1FVFA 3FWVA 3V31A 1QQEA 1UG3A 4FC8A 4I9CA 3TXNA 4L7TA 4G8KA 3NAWA 4G25A 3TL5A 2RFAA 4FLBA 3FH5A 3LY8A 3CK7A 4GZCA 3OXLA 1N0RA 2CHZA 5HRYA 3GZSA 2AWIA 3PUKA 4ACKA 5T8IA 1Y8MA 1K1BA 3AU5A 2AVPA 1IQRA 3PH0C 5G04J 3Q73A 3QJZA 4BX8A 2J49A 4M16A 2Y4TA 4ACLA 5AENA 3RRMB 2JABA 3V79K 3EHRA 4J8YA 4DI3A 4GA0A 1IQUA 2V8SE 4PS3A 1DVPA 2QFCA 2F0YA 2J07A 5LCWC 1OCRE 1E7VA 2DCPA 4AM9A 1EDUA 3UM2A 4V3IA 3N71A 4WWOA 2OEWA 4BETA 3ULEG 3TWQA 3S7FA 4ZHBA 4GMRA 3MX3A 1TNYA 4I1MA 1U3CA 4XX5A 2WXFA 3PZDA 4AOFA 1HH8A 1UOHA 3TXMA 4U63A 1E8ZA 4I17A 3PUJA 4Z68A 3I4GA 3NBNB 3UMVA 3ZW3A 3TWXA 3AU4A 3UIPC 4LG6A 5CMTA 3NOCD 3PRZA 5FT9A 3ZYMA 4U0UA 3TWSA 4LSZE 4KMOA 5JA4D 2CFZA 3KS2A 4H7XA 3FHEA 3PNTB 4XE0A 4IN3B 3IBEA 1TNUA 3IHVA 2XRZA 4G2VA 5AJDA 5EIBE 3FTZA 5CERB 4LUNU 2WXGA 2V5QC 1OT8A 4DPRA 3S7JA 2YHCA 4OVUA 5CCLA 3CVWA 2IO2C 1BI8B 3UT7A 4LNUD 1QNFA 3MCXA 1NI1A 2VGXA 3HXBA 3D9NA 2QC9A 3UQ3A 1E90A 3AG1E 2VJ8A 1JWGA 4K03A 5CGLA 4LRZA 4G26A 2WQHA 2HR2A 1NL4A 3CHPA 2MRIA 4XZ4A 2C0LA 1Y6IA 3UM1A 3LXUX 5JHAA 3EDTB 4U0SA 3SFYA 3GW4A 2WXLA 3CVVA 3LCAA 3L82A 2IFUA 4GYWA 3QK0A 4F7AA 4ANWA 3ABLE 3IKOB 3VLEA 2WXQA 3FUIA 4EZJA 3QKYA 3ZN3A 2F6SA 5EX3A 3ZPJA 5AQBA 3AJIA 1KT0A 2AXUA 2Y0BG 4GU5A 3UTMA 3ZU7B 3ZKJA 3PNLB 5AYWD 4GZ3A 1YCSB 3ESKA 3S7BA 5ARGA 1VDYA 3CKCA 4L1BA 4N3BA 5AIJA 3SN9A 5AN8A 3UKUG 4I2WA 4APFA 2Q7FA 3E32A 1H6OA 4BERA 1TN6A 1K8KG 1X81A 4B8CB 2XGMA 3JYSA 2PZIA 3CHOA 2ZGDA 3V2XA 1ELRA 3SGHA 4I1AA
chains in the Genus database with same CATH topology
3Q4AB 4A3VA 3UT4A 4UWGA 3G2WA 1HO8A 3UUXA 2X6FA 2M63A 4BTBA 4RG9A 3CVLA 2NXPA 3QAQA 5A6CA 2MOWA 4GZ5A 5FZSA 4AY6A 3JQ0A 2A5UA 3CIAA 2WXIA 3FH8A 4ANUA 3VLDA 1N54A 2VZAA 4CDRA 1KT1A 1EF1C 3CQGB 4KVOA 1N52A 2X6IA 2VSYA 3FFLA 4J6IA 3CSFA 3ZHEA 4YVQC 2E2EA 2Y3AA 4UWFA 4WNGA 3R7RA 4X2EA 1GW6A 1H19A 3ML9A 4I6EA 4KVMA 4JA7A 3UT8A 3WXXA 2FBNA 3SF4A 3G2TA 4C0MA 4U8HA 5JJ7A 3FUEA 5G05J 1X5BA 2KC7A 1ZBPA 4ILIA 1YA0A 1JPLA 3FTSA 2IF4A 3ML8A 3MYVA 4JZYA 4HFGA 5HQ8A 3B7TA 1OWNA 2VGYA 5CKLA 1H2VC 2FI7A 1FCHA 3LKUA 2RD0A 5G04C 3RRUA 1ZU2A 3U9WA 4DK5A 1HS6A 5G05C 3L16A 5KCMA 2V0PA 2XCCA 4BFRA 2HM8A 3GZ1A 1UW4B 2CHWA 3ZVVA 3CK9A 1HFAA 4E6HA 2CHXA 3L08A 3FEXA 3IHYA 2X38A 1UN8A 5BT1A 4XIFA 2KCLA 2RG8A 2OVBA 4XI0A 3LETA 2WM9A 1W3BA 3Q5MA 4JEUA 4Q96A 5T3RA 3DBSA 3FH7A 1Z3YA 2CG2A 2WXKA 2UY1B 4BTAA 4Q94A 2LO6A 4ATGA 3D9IA 4ABNA 4FA6A 2G03A 4UQXA 1NP7A 2WXJA 1SZ9A 1MQSA 1NA3A 4DLOA 4B94A 3SBTB 3QARA 3C98A 4N5CA 4NRHB 3GZ2A 4OYSA 5ARFA 3ZGQA 2JK8A 2OVFA 5BUZA 3FUNA 2XPZA 5KJNA 1S0PA 3LDZA 4GMLA 3QNKA 3MEKA 5LFAA 4E85A 3FU6A 1XGWA 3OXFA 1JWFA 1L5JA 1WM5A 3PEUB 5JFFA 4G24A 4UI9K 3ZRHA 3ASHA 3G2SA 3MZLB 3MA5A 4FLHA 2J9QA 4CRWA 1MHQA 3CKBA 4KXKB 2FO7A 5D0QD 4X2DA 2FULA 3G2UA 2CG3A 3Q47B 2WXOA 3IEGA 5FQ8A 4BT9A 2VY3A 2PL2A 3Q49B 4FULA 4GCNA 4AXHA 1PAQA 3LPZA 2VYIA 3RIBA 4JPSA 3KD7A 3O4ZA 4PS7A 4GZDA 2ILRA 3CHRA 3FUFA 4GYYA 4UI9J 3EHMA 3JQ1A 4AP2A 4I6GA 4WGJA 2ONDA 3OTNA 2KCKA 2WMOA 3PE4A 2GGFA 4F1SA 5KJLA 4U07A 4BX9A 2VGXB 2J09A 4KZ0A 2J4BA 4GMJA 3B7UX 4HOSA 4N2QA 4EECA 3L6AA 1SZAA 3TJPA 1WAO1 3LVRE 5J90A 3CUCA 2BF0X 3SHFA 2WQ7A 2WB2A 2R17C 1ELWA 3FY4A 3B13A 5FQ6A 2IOSA 2YHEA 2I2OA 5FWQA 3RO2A 3APFA 4ME2A 3QOUA 5FQ4A 1OWLA 4AV7A 4RVBA 3CLJA 1H6KA 5FTPA 2MHKA 3FP3A 2WQ6A 4FP7A 3LVQE 2IJGX 2YQ8A 2UWJG 3FUMA 3L17A 2E0IA 4JEHA 2XHEA 3SHGA 2LAIA 3ZYLA 4L2LA 5A23A 2VTBA 3ONLA 1FVHA 2WXPA 4PDXA 4ANVA 1PC2A 3ZC7A 4JA9A 4IYPA 3OXGA 1HU3A 4KZCA 3SI5A 3TAXA 3FUHA 4PH4B 5A7DB 3RRNB 4BY6A 4HVBA 2BUGA 1QZ2A 3D3MA 2KZTA 1HE8A 2IONA 1H2TC 3NQPA 1Z3XA 1JUQA 3CV0A 4FU3A 3RK6A 4EZKA 3BG0B 2PQRA 3EHNA 3QDNA 3RKVA 3I3NA 2WVIA 2I6HA 1H0AA 4X2CA 3TG4A 1E8YA 1TEZA 4F3VA 2LAHA 3HIZA 3SFZA 3NZUA 2LSVA 3LY9A 3MV3B 4UWKA 4QFVA 3QWPA 4BT8A 4HXIA 3GYZA 4JHRA 3CVUA 4W9RA 3CHMA 4APOA 2CFUA 4DLQA 4ILGA 5G2NA 2FF4A 3ZYQA 1DNPA 2C0MA 3T5VA 3IV0A 5T4YA 3ZYKA 4M3OA 3S2AA 3CVXA 3DPDA 3G2VA 2LNIA 3PREA 4NURA 2OOEA 2L9BA 2VSOE 3E4BA 3ENEA 4AJWA 1FVFA 3FWVA 3JCKC 3FTUA 4EZLA 4CDNA 4EBAG 1QQEA 3L54A 1NA0A 1UG3A 2XPIA 5JHBA 4FC8A 4GA1A 4I9CA 2UY1A 4CGVA 3ZLMA 3TXNA 4WWNA 1E8XA 4GYOA 4K0RA 4L7TA 3U64A 4AEZC 3FTXA 4IULA 3ONKA 2VSXE 4TRQA 4G25A 3TL5A 4C0EA 4FJZA 4JHKA 4N2SA 3LYAA 4FLBA 4XKCA 4JXTA 3FH5A 5DBKA 3LS8A 3HDXA 3LY8A 4U04A 3CK7A 4TUUA 1OWMA 2GRMA 4GZCA 4RG6A 3D9KA 1LF8A 2HO1A 3OXLA 4I2ZA 1TJCA 4CT4A 3FUDA 3AS8A 3NF1A 3Q15A 4J8SA 3TGOA 4UQZA 2CHZA 3SZ7A 3FUKA 4GB9A 5FZQA 3GZSA 5M72A 4WNDA 2AWIA 4A3TA 2J08A 3URZA 4AIFA 3PUKA 4ACKA 2BTDA 5LOZA 5T8IA 4UWHA 4MRUA 4DJAA 1Y8MA 2XGOA 2ZU6B 4MS6A 3AU5A 2AVPA 1IQRA 2AXVA 3ASFA 2X3MA 4I6JA 3PH0C 2NSZA 3FU3A 3D9OA 5G04J 4AVXA 3QJZA 4BX8A 4GAAA 2J49A 4M16A 5E75A 5EX0A 2Y4TA 4ACLA 5AENA 3RRMB 1Z6TA 2KZTB 1B89A 3PVLA 3VTYA 3VLFA 4HOTA 4H7YA 2KCVA 4DI3A 3MKRA 4Y6WA 4GA0A 1OWPA 3ZFWA 4XKBA 1IQUA 3CGHA 2V8SE 4PS3A 1DVPA 2QFCA 3HHMA 4A55A 2J07A 5KJKA 4HORA 4B0ZA 2DCPA 1E7VA 1HF8A 3CHSA 3EIJA 3LJ3A 4AM9A 3ASDA 5LCWC 1INZA 1EDUA 3CVYA 4A1GA 4CCAA 3RU0A 4Q69A 4KT6B 3LEWA 3T8MA 4JVSA 4V3IA 3CR3A 3ZCBA 3CVPA 3N71A 3CK8A 3EJNA 4WWOA 4CT0A 4ITRA 3K9IA 3L22A 3MKQB 1HG2A 2WPVA 2XEVA 3S7FA 2I9CA 3MX3A 4N3CA 4I1MA 3FU5A 4PUCA 5D0OD 1U3CA 4XX5A 4PY3A 4EPZA 2WXFA 3PZDA 4AOFA 1IYGA 1HH8A 3FTWA 3EIQC 3TXMA 4U63A 4JL0A 1E8ZA 4I17A 3FTVA 2R5SA 3PUJA 3PDNA 3D9MA 3I4GA 4GCOA 5ENNA 4LEUA 3UMVA 2QY7A 3ZW3A 5BV0A 3AU4A 5JJ6A 4MKTA 5CMTA 3FDHA 3PRZA 5ANRA 4I1OB 2DIWA 3P1UA 5FT9A 3ZHEB 3CHQA 4JC8A 3ZYMA 4OVVA 3MKQA 5C2YA 4U0UA 3D9JA 4I9EA 4HOQA 4KMOA 2X6JA 4I43A 4J8DA 4TV3A 2HYZA 1E7UA 3BEEA 2CFZA 3AS5A 4JHJA 3RJVA 4A1SA 3KS2A 4H7XA 5JJTA 1TJFA 3FHEA 3PNTB 4XE0A 4N39A 5EKQD 3T5XA 3APCA 4WUYA 2YNQA 4IN3B 3LY7A 3IBEA 3IHVA 5BPPA 4KBQA 2XRZA 4G11A 4PS8A 5E76A 3KEZA 4G2VA 3ULQA 4FJYA 5AJDA 4LERA 3FTZA 3HYMB 4LUNU 5CCMA 2NC9A 1KLXA 2WXGA 3APDA 3FU0A 4DPRA 2OV8A 4ANXA 3U4TA 3S7JA 3U3WA 2IU1A 2YHCA 3D9LA 1P5QA 4HOUA 4OVUA 5ANLA 5CCLA 5LX8A 3CVWA 2KATA 3UT7A 3VTXA 3QWVA 1QNFA 3FTYA 3MCXA 4UWLA 4F53A 4WNEA 5EU0A 3CEQA 4WAFA 4CGWA 5LP0A 4WWPA 3S6AA 3ZEFA 1NZNA 2A4ZA 2VGXA 3D9NA 4NQ0A 3QWWA 2P58C 2VQ2A 3CVNA 3HVEB 2XCBA 3UQ3A 3FULA 4HLEA 4J8EA 4GPKA 1E90A 3UPVA 5FQ7A 2DBAA 5DIZA 2VJ8A 1JWGA 3MV2B 4CEMA 3SE5A 5CMWA 3L13A 4K03A 4LU4A 5CGLA 3FEYA 4BWRA 4NPSA 4LRZA 3NZSA 3ASGA 4G26A 2WQHA 2XRYA 5JFZA 2HR2A 3ZIMA 4GA2A 3BG1B 4FADA 2KM4A 3CHPA 2MRIA 4G1TA 3PE3A 2PQNA 3RO3A 4XZ4A 2J4DA 2C0LA 4YNDA 1XNFA 3CQCB 4RSYA 1UJJA 3CVQA 4XI8A 4EQFA 4C9BB 3PS6A 4G23A 4MLPA 1Y6IA 2V5FA 1IHGA 3R9AB 4URKA 2R59A 3LXUX 2IQCA 5JHAA 1HXIA 3EDTB 4IRUA 4U0SA 4JW1A 3B7RL 3GW4A 2VSNA 3FUJA 2AW6A 3QC1A 2WXLA 4HS2A 2VTBB 4L23A 3QB2A 3CVVA 5FJYA 4ILHB 3LCAA 2C2LA 3I4RB 4WNFA 5BNWA 5J08A 4D10C 2L0TB 4XI9A 4B8AA 1WY6A 2YINA 2IFUA 4GYWA 1PY1A 3QK0A 3B7SA 4F7AA 2WXMA 2X6HA 2XPYA 2X6KA 2I1KA 3AS4A 4ANWA 3R7QA 3IKOB 2FEZA 2XQ0A 1A17A 4R7LA 3MJWA 2WXQA 3FUIA 3VLEA 4YVOA 2JLBA 2EQXA 4KYOB 4EZJA 1BPOA 3SD5A 3QKYA 3TG5A 5EDSA 3JUIA 3ZN3A 2F6SA 5C1DA 5EX3A 3ZPJA 1SQMA 4BSXA 4NACA 4Y6CA 1KT0A 1ELKA 1HG5A 2I1JA 2WMNA 2AXUA 4GU5A 4UQYA 4N67A 3SNXA 4U0ZA 1EPUA 3PNLB 3N3UA 5AYWD 5AJLA 2GW1A 1HX8A 1OUVA 3HVEA 1HZ4A 4GZ3A 4UI9C 3O48A 3ESLA 3ESKA 3S7BA 5ARGA 1VDYA 3ZXSA 2Y4UA 3P2BA 3CKCA 4L1BA 3U66A 4N3BA 1EYHA 2WXNA 5AIJA 3SN9A 2GRLA 2XGSA 4CDMA 5FZRA 5BV1A 4DI4A 2L6JA 3D9PA 1U3DA 5HI7A 5BW8C 2LSUA 4I2WA 4N3AA 3CSTA 4P29A 4APFA 3PEVB 2Q7FA 4GZ6A 4LCTA 5LCWJ 3SBSA 2IOLA 4AY5A 5KJMA 3UX4A 4J0UA 5CMYA 1E8WA 2V4LA 4B8CB 2WXHA 2XGMA 3JYSA 1E96B 3S7DA 2PZIA 1OWOA 3CHOA 4B89A 4FHJA 2PM6A 3KAEA 5CHEE 4L2YA 4O6FA 4EBAA 3I5PA 1H2UA 1UN9A 1ELRA 3MGBA 3OAWA 4FHKA 4J8FA 2PM7A 2AXZA 5G55A 2JEKA 1UJKA 2L0IA 3SGHA 2WXRA 4I1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4A B;  3UUX A;  4BTB A;  4RG9 A;  3CVL A;  5A6C A;  4GZ5 A;  5FZS A;  4AY6 A;  2VZA A;  4CDR A;  1KT1 A;  3FFL A;  2VSY A;  3ZHE A;  4YVQ C;  2E2E A;  4WNG A;  4X2E A;  3WXX A;  4JA7 A;  2FBN A;  3SF4 A;  5JJ7 A;  5G05 J;  2KC7 A;  1ZBP A;  1YA0 A;  2IF4 A;  5HQ8 A;  2VGY A;  5CKL A;  3LKU A;  2FI7 A;  1FCH A;  1ZU2 A;  5G05 C;  2XCC A;  3GZ1 A;  3CK9 A;  5BT1 A;  4XIF A;  2KCL A;  4XI0 A;  3LET A;  1W3B A;  3Q5M A;  2UY1 B;  4BTA A;  4ABN A;  2G03 A;  4UQX A;  1NA3 A;  4B94 A;  4N5C A;  4NRH B;  3GZ2 A;  5ARF A;  3ZGQ A;  2JK8 A;  5KJN A;  3MEK A;  3OXF A;  1WM5 A;  5JFF A;  4G24 A;  4UI9 K;  3ASH A;  3MA5 A;  2J9Q A;  3CKB A;  4KXK B;  2FO7 A;  5D0Q D;  4X2D A;  3Q47 B;  3IEG A;  4BT9 A;  2VY3 A;  2PL2 A;  3Q49 B;  4GCN A;  3LPZ A;  3RIB A;  2VYI A;  3KD7 A;  4UI9 J;  4GYY A;  4WGJ A;  2OND A;  2KCK A;  3PE4 A;  5KJL A;  4U07 A;  2VGX B;  4HOS A;  4N2Q A;  1WAO 1;  3CUC A;  1ELW A;  3RO2 A;  4ME2 A;  3QOU A;  5FTP A;  2MHK A;  3FP3 A;  2YQ8 A;  2UWJ G;  3SHG A;  1PC2 A;  3ZC7 A;  4JA9 A;  3OXG A;  3TAX A;  5A7D B;  2BUG A;  1QZ2 A;  3CV0 A;  2PQR A;  3QDN A;  3RKV A;  2I6H A;  3TG4 A;  4X2C A;  4F3V A;  2LSV A;  3LY9 A;  3MV3 B;  3QWP A;  4BT8 A;  3GYZ A;  4JHR A;  4W9R A;  4APO A;  2FF4 A;  2C0M A;  2LNI A;  2OOE A;  3E4B A;  3FWV A;  1QQE A;  1NA0 A;  2XPI A;  4GA1 A;  4I9C A;  2UY1 A;  4CGV A;  3ZLM A;  4GYO A;  4G25 A;  4N2S A;  3LYA A;  5DBK A;  3LY8 A;  4U04 A;  3CK7 A;  4RG6 A;  3OXL A;  4I2Z A;  2HO1 A;  3TGO A;  1TJC A;  3Q15 A;  3AS8 A;  3NF1 A;  4UQZ A;  3SZ7 A;  5FZQ A;  5M72 A;  4WND A;  3URZ A;  4AIF A;  1Y8M A;  2XGO A;  2AVP A;  3ASF A;  5G04 J;  4M16 A;  5EX0 A;  2Y4T A;  1B89 A;  3VTY A;  4HOT A;  4H7Y A;  2KCV A;  3MKR A;  4Y6W A;  4GA0 A;  3ZFW A;  2QFC A;  4HOR A;  5KJK A;  5LCW C;  4AM9 A;  3ASD A;  3RU0 A;  3CVP A;  3ZCB A;  3N71 A;  3CK8 A;  4ITR A;  3K9I A;  2WPV A;  2XEV A;  3S7F A;  4N3C A;  5D0O D;  4PY3 A;  1IYG A;  1HH8 A;  4JL0 A;  4I17 A;  2R5S A;  3PDN A;  4GCO A;  4LEU A;  5JJ6 A;  5CMT A;  3ZHE B;  5FT9 A;  4U0U A;  4I9E A;  4HOQ A;  4J8D A;  2HYZ A;  3BEE A;  3RJV A;  3AS5 A;  4A1S A;  5JJT A;  3KS2 A;  4H7X A;  5EKQ D;  4N39 A;  4WUY A;  4IN3 B;  3LY7 A;  4KBQ A;  4G2V A;  3ULQ A;  3HYM B;  5CCM A;  2NC9 A;  1KLX A;  3U4T A;  3S7J A;  3U3W A;  2YHC A;  1P5Q A;  4HOU A;  5CCL A;  2KAT A;  3VTX A;  3QWV A;  4WNE A;  5EU0 A;  3CEQ A;  4CGW A;  3S6A A;  1NZN A;  2VGX A;  4NQ0 A;  3QWW A;  2P58 C;  2VQ2 A;  3CVN A;  2XCB A;  3UQ3 A;  4GPK A;  4J8E A;  3UPV A;  2DBA A;  5DIZ A;  3MV2 B;  3SE5 A;  4LU4 A;  5CGL A;  4BWR A;  4NPS A;  3ASG A;  4G26 A;  2WQH A;  5JFZ A;  2HR2 A;  4GA2 A;  4G1T A;  3PE3 A;  2PQN A;  3RO3 A;  4YND A;  2C0L A;  1XNF A;  3CVQ A;  4XI8 A;  4EQF A;  4G23 A;  2V5F A;  1IHG A;  3R9A B;  1HXI A;  3EDT B;  4U0S A;  3GW4 A;  2VSN A;  5FJY A;  3LCA A;  2C2L A;  4WNF A;  5BNW A;  4XI9 A;  2IFU A;  4GYW A;  3AS4 A;  2FEZ A;  1A17 A;  4YVO A;  2JLB A;  4KYO B;  3QKY A;  3TG5 A;  3ZN3 A;  2F6S A;  5C1D A;  5EX3 A;  3ZPJ A;  4Y6C A;  1KT0 A;  4UQY A;  4N67 A;  4U0Z A;  3N3U A;  5AYW D;  2GW1 A;  1OUV A;  4GZ3 A;  1HZ4 A;  4UI9 C;  3O48 A;  3ESK A;  3S7B A;  5ARG A;  2Y4U A;  3CKC A;  4N3B A;  3SN9 A;  2XGS A;  5FZR A;  2L6J A;  5HI7 A;  5BW8 C;  2LSU A;  4I2W A;  4N3A A;  2Q7F A;  4GZ6 A;  5LCW J;  5KJM A;  4AY5 A;  4J0U A;  2XGM A;  3JYS A;  1E96 B;  3S7D A;  2PZI A;  3KAE A;  5CHE E;  4O6F A;  1ELR A;  4J8F A;  5G04 C;  4I1A A; 
#chains in the Genus database with same CATH topology
 3Q4A B;  2MOW A;  3FH8 A;  1EF1 C;  4J7W A;  1N52 A;  4J6I A;  3ZHE A;  4WNG A;  4HI8 A;  3B7B A;  3ML9 A;  3WXX A;  1Q2Z A;  2KC7 A;  4ILI A;  3FTS A;  3MYV A;  5CKL A;  2FI7 A;  5KCM A;  2HM8 A;  3GZ1 A;  2CHW A;  3CK9 A;  1HFA A;  4E6H A;  2CHX A;  3FEX A;  2X38 A;  1N4Q A;  5BT1 A;  4XIF A;  4BEP A;  3E34 A;  4HRM B;  2WM9 A;  3D9H A;  5T3R A;  1U2V G;  2LO6 A;  4ATG A;  4ABN A;  4YDE A;  2G03 A;  4UQX A;  2XS1 A;  1NP7 A;  3NOG D;  1NA3 A;  4DLO A;  4B94 A;  3J5P A;  1QYM A;  2EIM E;  3GZ2 A;  2OVF A;  2XPZ A;  3LDZ A;  5LFA A;  5JFF A;  1BD8 A;  2J9Q A;  1TNZ A;  3CKB A;  2FO7 A;  2FUL A;  3G2U A;  3Q47 B;  5D66 A;  2WXO A;  5FQ8 A;  2VYI A;  4OAU C;  4GZD A;  3FUF A;  4UI9 J;  3EHM A;  4AP2 A;  3ASN E;  2OND A;  2KCK A;  2GGF A;  2XEH A;  4GMJ A;  4EEC A;  3L6A A;  2WB2 A;  1ELW A;  3B13 A;  5FQ6 A;  4ME2 A;  3CLJ A;  1H6K A;  5FTP A;  2MHK A;  4FP7 A;  2YQ8 A;  2UWJ G;  1N9A A;  4JEH A;  5EN5 D;  5A23 A;  4BES A;  4EHM A;  1PC2 A;  3TWV A;  4IYP A;  3FUH A;  4HVB A;  3D3M A;  5CRU A;  1DC2 A;  4EZK A;  1JUQ A;  3I3N A;  2I6H A;  5ENP D;  1E8Y A;  4F3V A;  1N11 A;  3QWP A;  3CVU A;  3CHM A;  2ETA A;  4CYM D;  5G2N A;  3ZYQ A;  3T5V A;  3DPD A;  3G2V A;  2LNI A;  2L9B A;  1TR4 A;  1DCE A;  4EZL A;  4DX1 A;  4CDN A;  3BU8 A;  5ENQ D;  1AP7 A;  2XPI A;  3DSW A;  4RLY A;  4CGV A;  3ZLM A;  4WWN A;  4AEZ C;  4DX6 D;  3FTX A;  1Z5S C;  4CT4 A;  5ENS D;  3SZ7 A;  4GB9 A;  3RAU A;  1TYQ G;  3URZ A;  4AIF A;  5LOZ A;  3BUA A;  4MRU A;  2ZU6 B;  5AAR A;  4MS6 A;  4B93 B;  3ISM C;  3ASF A;  4I6J A;  4GAA A;  5E75 A;  1Z6T A;  3PVL A;  3VTY A;  4HOT A;  1O1R A;  2KCV A;  3MKR A;  2GRP B;  4A55 A;  3PZ4 A;  2OCC E;  4A1G A;  4CCA A;  3RU0 A;  4Q69 A;  4JVS A;  3CR3 A;  3CVP A;  3EJN A;  1TN8 A;  4GTT A;  4ITR A;  3K9I A;  3L22 A;  5AAO A;  2QZA A;  2Y1L E;  2R2L A;  2EIL E;  3EIQ C;  3PDN A;  3D9M A;  3DEP A;  3ULY A;  4LEU A;  2LXL A;  2NUN A;  3UKR G;  1FT1 A;  5ANR A;  3P1U A;  4JC8 A;  1N95 A;  5KWD A;  2DWZ A;  3MKQ A;  1OY3 D;  3C3Q A;  4JHJ A;  3AS5 A;  4U8V D;  3T5X A;  4G11 A;  5E76 A;  1OCZ E;  3HYM B;  2NC9 A;  1KLX A;  3U3W A;  2GRQ B;  1P5Q A;  4N5Q A;  5LX8 A;  2KAT A;  3VTX A;  3QWV A;  4JB8 P;  3FTY A;  4F53 A;  4WNE A;  3EU5 A;  4A63 B;  4WAF A;  1WG0 A;  2DVW A;  3C5R A;  5HS0 A;  2P58 C;  2A5E A;  4J8E A;  5DIZ A;  3SE5 A;  3DSV A;  2XRY A;  5JFZ A;  3ZIM A;  4HI9 A;  1D8E A;  3BG1 B;  4FAD A;  2P9K G;  4U95 D;  5KNG A;  2DYR E;  4YND A;  1D8D A;  3CQC B;  4RSY A;  4G23 A;  4MLP A;  5HKP A;  3R9A B;  3B7R L;  1MX6 A;  3FUJ A;  2AW6 A;  5J08 A;  4D10 C;  2L0T B;  3B7S A;  3KSQ A;  2FEZ A;  3MJW A;  4KYO B;  3SD5 A;  2EIJ E;  3TG5 A;  5EDS A;  5C1D A;  4BSX A;  4YDW A;  3LJN A;  1HG5 A;  2WMN A;  4N67 A;  2V4H C;  4U0Z A;  3N3U A;  3UXG A;  1OUV A;  3HVE A;  4K5B A;  3DEO A;  3O48 A;  3ESL A;  2Y4U A;  3SY2 A;  4DX7 D;  3U66 A;  2WXN A;  2XGS A;  5FZR A;  4GTS A;  3W9F A;  4DI4 A;  2L6J A;  3D9P A;  1U3D A;  3CST A;  1N0Q A;  3PEV B;  5CBO A;  5LCW J;  3SBS A;  5KJM A;  5EYL A;  1O5M A;  2ZIR A;  4J0U A;  5CMY A;  3S7D A;  4YDY A;  4DX5 D;  4FHJ A;  5CHE E;  4L2Y A;  3MGB A;  3OAW A;  5AQA A;  4FHK A;  2PM7 A;  2JEK A;  2L0I A;  2H6G A;  4A3V A;  3UT4 A;  3AG2 E;  2IO3 C;  2M63 A;  3C3R A;  4RG9 A;  5FZS A;  1TNO A;  2RFM A;  3PZ1 A;  3CQG B;  3CSF A;  2E2E A;  2Y3A A;  1GW6 A;  4I6E A;  2FBN A;  3SF4 A;  1X5B A;  1DCQ A;  4HFG A;  3B7T A;  1OWN A;  5AQ9 A;  3U9W A;  2GRO B;  3LKU A;  3RRU A;  1S63 A;  1ZU2 A;  3UIO C;  2XCC A;  4BFR A;  2KCL A;  4XI0 A;  3WG7 E;  4U96 D;  4HLL A;  4JEU A;  4Q96 A;  3RSE G;  3FH7 A;  3HXD A;  2CG2 A;  2WXK A;  4BTA A;  4Q94 A;  2PNN A;  1SZ9 A;  4LNB A;  3JXJ A;  4N5C A;  4NRH B;  3PZ3 A;  3FUN A;  1RW2 A;  3QNK A;  3MEK A;  1BLX B;  4E85 A;  1XGW A;  5H7P A;  3OXF A;  3ZNG A;  1WM5 A;  3HXF A;  4UI9 K;  4QQI A;  3ASH A;  4X2D A;  2LXM A;  4BT9 A;  2F8Y A;  3Q49 B;  4GCN A;  1PAQ A;  4K5A B;  3RIB A;  4JPS A;  3O4Z A;  2ILR A;  2DYS E;  4I6G A;  1O1T A;  2FO1 E;  3OTN A;  4F1S A;  5KJL A;  4YDO A;  4GTR A;  4BX9 A;  2VGX B;  3B7U X;  3SO8 A;  5J90 A;  3AAA C;  2WQ7 A;  2BF0 X;  3FY4 A;  5AQ7 A;  3FUM A;  1A5E A;  4DRX E;  4L2L A;  3ONL A;  4ANV A;  4M7C A;  3OXG A;  4KZC A;  5A7D B;  2KZT A;  1Z3X A;  4FU3 A;  2P9U G;  3BG0 B;  3RKV A;  2HE0 A;  2WVI A;  3TG4 A;  4X2C A;  4RQI A;  5ITZ F;  3JXI A;  3HIZ A;  3SFZ A;  4GTP A;  3NZU A;  3MV3 B;  2B0O E;  4APO A;  2CFU A;  2FF4 A;  5D2M C;  3IV0 A;  5T4Y A;  1SW6 A;  2P9I G;  3CVX A;  2OOE A;  2VSO E;  3E4B A;  3JCK C;  3HXC A;  4TXP A;  4EBA G;  3L54 A;  1NA0 A;  1IHB A;  5JHB A;  1E8X A;  4GYO A;  3U64 A;  4IUL A;  4C0E A;  4FJZ A;  4JHK A;  4N2S A;  3LYA A;  1FPP A;  4C48 B;  3LS8 A;  3HDX A;  4U04 A;  1LTX A;  1OWM A;  2GRM A;  4RG6 A;  3D9K A;  4I2Z A;  2HO1 A;  1TJC A;  3Q15 A;  4J8S A;  2B6C A;  4UQZ A;  4A3T A;  2J08 A;  2BTD A;  4UWH A;  3ASO E;  2OEV A;  4DJA A;  4O1O A;  1SA4 A;  2XGO A;  2AXV A;  2QYJ A;  2X3M A;  2NSZ A;  3D9O A;  2EIK E;  3W9G A;  3C3O A;  4O60 A;  1KZP A;  2KZT B;  1B89 A;  2H6I A;  4H7Y A;  1OWP A;  3C72 A;  4HOR A;  5KJK A;  4B0Z A;  1INZ A;  2ZXW E;  5IY5 E;  4KT6 B;  3TWW A;  1WDY A;  3CK8 A;  3MKQ B;  1HG2 A;  2WPV A;  2XEV A;  2I9C A;  5D0O D;  3FU5 A;  4PY3 A;  3DPY A;  3X2Q E;  3T9K A;  2ETB A;  1IYG A;  3FTW A;  5FIO A;  1AWC B;  5ENN A;  5BV0 A;  2QY7 A;  3FDH A;  3ZHE B;  2XEE A;  4I1O B;  3CHQ A;  4OVV A;  5C2Y A;  4I9E A;  4HOQ A;  2X6J A;  4J8D A;  4TV3 A;  1E7U A;  3BEE A;  4A1S A;  5EKQ D;  4N39 A;  4WUY A;  3TWT A;  3PZ2 A;  3LY7 A;  3T8K A;  3KEZ A;  3ULQ A;  5CCM A;  3APD A;  4ANX A;  3D9L A;  5ANL A;  3SQV A;  5CED B;  3BQO A;  4UWL A;  4CGW A;  5EU0 A;  1NZN A;  3QWW A;  4HLE A;  2VQ2 A;  3HVE B;  4GPK A;  3UPV A;  5FQ7 A;  3MV2 B;  5CMW A;  4LU4 A;  4BWR A;  3E37 A;  4NPS A;  3NZS A;  4U8Y D;  2KM4 A;  4G1T A;  2PQN A;  2F37 A;  2J4D A;  1XNF A;  1LD7 A;  4EQF A;  4C9B B;  2J8S D;  3PS6 A;  2GRR B;  2V5F A;  1O1S A;  2R59 A;  1HXI A;  4JW1 A;  1LD8 A;  4HS2 A;  3QC1 A;  2VTB B;  2ZGG A;  3I4R B;  4WNF A;  1KPS B;  1WY6 A;  2YIN A;  1PY1 A;  2WXM A;  2X6H A;  2I1K A;  2XQ0 A;  1A17 A;  4R7L A;  1BPO A;  3JUI A;  1SQM A;  4Y6C A;  1RZ4 A;  1ELK A;  2I1J A;  3SNX A;  5AJL A;  2GW1 A;  1HX8 A;  1HZ4 A;  3UM0 A;  1OXJ A;  1OCO E;  3P2B A;  1EYH A;  2KXP C;  3DSX A;  4CDM A;  4L9P A;  5BXU A;  2LSU A;  4N3A A;  4P29 A;  1G3N B;  4GZ6 A;  4HRL A;  4X8Q A;  2V4L A;  3EU9 A;  4B89 A;  4TUM A;  2PM6 A;  4O6F A;  4EBA A;  3I5P A;  1H2U A;  2DZO A;  4J8F A;  5G55 A;  2AXZ A;  3J5Q B;  1UJK A;  4UWG A;  3UUX A;  3CVL A;  2NXP A;  4AY6 A;  1V54 E;  4OAV B;  1BU9 A;  4ANU A;  3VLD A;  2VZA A;  4CDR A;  1KT1 A;  1K3Z D;  2VSY A;  3V30 A;  4YVQ C;  1IKN D;  5CEC B;  4KVM A;  3G2T A;  1ZBP A;  1YA0 A;  2IF4 A;  3DSS A;  4JZY A;  5HQ8 A;  2VGY A;  4DK5 A;  1N4S A;  1HS6 A;  5G05 C;  1UW4 B;  3ZVV A;  1TN7 A;  3IHY A;  2OVB A;  3LET A;  3Q5M A;  3E30 A;  1MYO A;  3SBT B;  3QAR A;  3C98 A;  5BUZ A;  5KJN A;  1S0P A;  4GML A;  3DXM G;  1MZC A;  3FU6 A;  1JWF A;  4JD2 G;  4G24 A;  2P2C P;  3MZL B;  2Y69 E;  3G2S A;  3MA5 A;  4CRW A;  1MHQ A;  5D0Q D;  5EYP F;  3Q7F A;  2VY3 A;  4F1P A;  2IY0 C;  2DZN A;  3KD7 A;  3Q9U C;  2F8X K;  3CHR A;  4GYY A;  4TXR A;  3JQ1 A;  4WGJ A;  3PE4 A;  5EIL A;  4U07 A;  3Q79 A;  2J09 A;  4KZ0 A;  2J4B A;  1V55 E;  4HOS A;  1SZA A;  3TJP A;  1WAO 1;  3CUC A;  3SHF A;  2R17 C;  2IOS A;  2YHE A;  4GTQ A;  2I2O A;  5FWQ A;  3DXK G;  3AG4 E;  3RO2 A;  3APF A;  1YMP A;  3QOU A;  4G8L A;  4AV7 A;  4RVB A;  2WQ6 A;  3FP3 A;  3LVQ E;  2BED A;  3L17 A;  3SHG A;  2LAI A;  3ZYL A;  4TXQ A;  1JCR A;  4PDX A;  3KSL A;  1HU3 A;  3SI5 A;  3ABK E;  3RRN B;  4BY6 A;  2BUG A;  1QZ2 A;  1HE8 A;  3EUV A;  1H2T C;  3RK6 A;  2PQR A;  3QDN A;  4HBD A;  1H0A A;  2AJA A;  2XZT G;  5ENT D;  4MBG A;  2LAH A;  3LY9 A;  4QFV A;  4BT8 A;  3GYZ A;  4DLQ A;  1S70 B;  1YYH A;  2C0M A;  3SFX A;  3ZYK A;  3PRE A;  4AJW A;  3FTU A;  5JMN D;  4GA1 A;  2UY1 A;  1SA5 A;  4K0R A;  2XZD G;  3ONK A;  2VSX E;  4TRQ A;  4XKC A;  5DBK A;  3HG0 D;  4TUU A;  2ETC A;  3E33 A;  1LF8 A;  3TGO A;  3FUD A;  3AS8 A;  3NF1 A;  3FUK A;  5FZQ A;  5M72 A;  4WND A;  3ZUV B;  3HRA A;  3DWL G;  3FU3 A;  4GPM A;  1IXV A;  2R05 A;  4AVX A;  2EIN E;  5KNH D;  2KBX A;  3UIN C;  5EX0 A;  5B1B E;  3VLF A;  4Y6W A;  3ZFW A;  4XKB A;  3CGH A;  3HHM A;  1MX4 A;  3CHS A;  1HF8 A;  3EIJ A;  3LJ3 A;  2IEJ A;  3ASD A;  2MYO A;  3CVY A;  3LEW A;  3T8M A;  3ZCB A;  4CT0 A;  2XEN A;  3TWR A;  5KBA A;  4N3C A;  4EPZ A;  4PUC A;  4JL0 A;  3FTV A;  2R5S A;  3DSU A;  4GCO A;  5JJ6 A;  4MKT A;  2DIW A;  1JCQ A;  5B1A E;  4HNA D;  3D9J A;  1MJ0 A;  2NYJ A;  4I43 A;  2HYZ A;  3RJV A;  5JJT A;  1S64 A;  1TJF A;  3APC A;  2YNQ A;  3Q75 A;  5BPP A;  4KBQ A;  1H6P A;  4PS8 A;  2P9S G;  4FJY A;  4LER A;  3FU0 A;  2OV8 A;  3U4T A;  2VGE A;  2IU1 A;  1KZO A;  4HOU A;  2BKG A;  5LP0 A;  3CEQ A;  4WWP A;  3S6A A;  3ZEF A;  2A4Z A;  3UX4 A;  4NQ0 A;  3CVN A;  4XEI G;  2XCB A;  3FUL A;  2DBA A;  4O1P A;  4CEM A;  3L13 A;  3FEY A;  3ASG A;  4GA2 A;  3PE3 A;  2BKK B;  3RO3 A;  4NIK A;  2LUH A;  1UJJ A;  3CVQ A;  4XI8 A;  2P9P G;  3UM3 A;  1IHG A;  4URK A;  3ZXP A;  3Q78 A;  2IQC A;  4IRU A;  2VSN A;  4L23 A;  5BXO A;  3QB2 A;  5FJY A;  4ILH B;  2C2L A;  5BNW A;  4XI9 A;  4B8A A;  2XPY A;  2X6K A;  3AS4 A;  4ATZ D;  3R7Q A;  3UI2 A;  4YVO A;  2JLB A;  2EQX A;  4NAC A;  1N94 A;  2P9L G;  4UQY A;  1EPU A;  5EID A;  4ZFH A;  4UI9 C;  2L6B A;  2RKK A;  3ZXS A;  3Q7A A;  3KEA A;  2GRL A;  4DUI A;  4GTM A;  5BV1 A;  3EHQ A;  5ENR D;  5HI7 A;  5BW8 C;  4LCT A;  3F6Q A;  2IOL A;  4AY5 A;  2H6F A;  1E8W A;  2WXH A;  1E96 B;  1OWO A;  3KAE A;  1K1A A;  1MX2 A;  1UN9 A;  3HXE A;  5G04 C;  4JXT A;  2WXR A;  2ZIS A;  3G2W A;  1HO8 A;  2X6F A;  4BTB A;  3L9T A;  2NUD A;  3QAQ A;  5A6C A;  4GZ5 A;  3JQ0 A;  2A5U A;  3CIA A;  2WXI A;  3JUE A;  2QYU A;  1N54 A;  4KVO A;  2X6I A;  3FFL A;  4F6R D;  4K5C A;  4UWF A;  3R7R A;  4X2E A;  2H6H A;  1H19 A;  3UT8 A;  3AG3 E;  4JA7 A;  4C0M A;  1NH1 A;  5JJ7 A;  4U8H A;  3FUE A;  3Q9N C;  5G05 J;  1JPL A;  1FT2 A;  3ML8 A;  4BSZ B;  1H2V C;  1FCH A;  2RD0 A;  1ZB1 A;  3L16 A;  4DX2 A;  2V0P A;  3DRA A;  3L08 A;  3R9M A;  1UN8 A;  1BI7 B;  2RG8 A;  1QBQ A;  1W3B A;  3DBS A;  1Z3Y A;  3IXE A;  2UY1 B;  4FA6 A;  3D9I A;  2WXJ A;  1MQS A;  1SVX A;  2P9N G;  5FIN A;  5ARF A;  4OYS A;  3ZGQ A;  3TWU A;  2JK8 A;  4HB5 A;  3ABM E;  1L5J A;  2R02 A;  3PEU B;  3ZRH A;  4FLH A;  4GTO A;  4HQD A;  4KXK B;  2CG3 A;  3IEG A;  2PL2 A;  4FUL A;  1OCC E;  4AXH A;  3LPZ A;  4PS7 A;  1D9S A;  2WMO A;  4UUC A;  1NFI E;  4N2Q A;  5CBN A;  3LVR E;  5ENO D;  4LNG A;  5FQ4 A;  1OWL A;  2IJG X;  4GTV A;  2E0I A;  2XHE A;  1JCS A;  2VTB A;  1FVH A;  2WXP A;  3ZC7 A;  3NB2 A;  4JA9 A;  3TAX A;  4PH4 B;  3DST A;  4HRN A;  2ION A;  3NQP A;  3CV0 A;  3EHN A;  4CZ2 D;  3V2O A;  1TEZ A;  5CRV A;  2LSV A;  2GRN B;  4UWK A;  2XS8 A;  4HXI A;  4JHR A;  3B95 A;  4W9R A;  1N4R A;  4ILG A;  1TNB A;  5CEA A;  1DNP A;  1N4P A;  2R03 A;  4M3O A;  3S2A A;  4NUR A;  3ENE A;  4U7E B;  5B3S E;  1FVF A;  3FWV A;  3V31 A;  1QQE A;  1UG3 A;  4FC8 A;  4I9C A;  3TXN A;  4L7T A;  4G8K A;  3NAW A;  4G25 A;  3TL5 A;  2RFA A;  4FLB A;  3FH5 A;  3LY8 A;  3CK7 A;  4GZC A;  3OXL A;  1N0R A;  2CHZ A;  5HRY A;  3GZS A;  2AWI A;  3PUK A;  4ACK A;  5T8I A;  1Y8M A;  1K1B A;  3AU5 A;  2AVP A;  1IQR A;  3PH0 C;  5G04 J;  3Q73 A;  3QJZ A;  4BX8 A;  2J49 A;  4M16 A;  2Y4T A;  4ACL A;  5AEN A;  3RRM B;  2JAB A;  3V79 K;  3EHR A;  4J8Y A;  4DI3 A;  4GA0 A;  1IQU A;  2V8S E;  4PS3 A;  1DVP A;  2QFC A;  2F0Y A;  2J07 A;  5LCW C;  1OCR E;  1E7V A;  2DCP A;  4AM9 A;  1EDU A;  3UM2 A;  4V3I A;  3N71 A;  4WWO A;  2OEW A;  4BET A;  3ULE G;  3TWQ A;  3S7F A;  4ZHB A;  4GMR A;  3MX3 A;  1TNY A;  4I1M A;  1U3C A;  4XX5 A;  2WXF A;  3PZD A;  4AOF A;  1HH8 A;  1UOH A;  3TXM A;  4U63 A;  1E8Z A;  4I17 A;  3PUJ A;  4Z68 A;  3I4G A;  3NBN B;  3UMV A;  3ZW3 A;  3TWX A;  3AU4 A;  3UIP C;  4LG6 A;  5CMT A;  3NOC D;  3PRZ A;  5FT9 A;  3ZYM A;  4U0U A;  3TWS A;  4LSZ E;  4KMO A;  5JA4 D;  2CFZ A;  3KS2 A;  4H7X A;  3FHE A;  3PNT B;  4XE0 A;  4IN3 B;  3IBE A;  1TNU A;  3IHV A;  2XRZ A;  4G2V A;  5AJD A;  5EIB E;  3FTZ A;  5CER B;  4LUN U;  2WXG A;  2V5Q C;  1OT8 A;  4DPR A;  3S7J A;  2YHC A;  4OVU A;  5CCL A;  3CVW A;  2IO2 C;  1BI8 B;  3UT7 A;  4LNU D;  1QNF A;  3MCX A;  1NI1 A;  2VGX A;  3HXB A;  3D9N A;  2QC9 A;  3UQ3 A;  1E90 A;  3AG1 E;  2VJ8 A;  1JWG A;  4K03 A;  5CGL A;  4LRZ A;  4G26 A;  2WQH A;  2HR2 A;  1NL4 A;  3CHP A;  2MRI A;  4XZ4 A;  2C0L A;  1Y6I A;  3UM1 A;  3LXU X;  5JHA A;  3EDT B;  4U0S A;  3SFY A;  3GW4 A;  2WXL A;  3CVV A;  3LCA A;  3L82 A;  2IFU A;  4GYW A;  3QK0 A;  4F7A A;  4ANW A;  3ABL E;  3IKO B;  3VLE A;  2WXQ A;  3FUI A;  4EZJ A;  3QKY A;  3ZN3 A;  2F6S A;  5EX3 A;  3ZPJ A;  5AQB A;  3AJI A;  1KT0 A;  2AXU A;  2Y0B G;  4GU5 A;  3UTM A;  3ZU7 B;  3ZKJ A;  3PNL B;  5AYW D;  4GZ3 A;  1YCS B;  3ESK A;  3S7B A;  5ARG A;  1VDY A;  3CKC A;  4L1B A;  4N3B A;  5AIJ A;  3SN9 A;  5AN8 A;  3UKU G;  4I2W A;  4APF A;  2Q7F A;  3E32 A;  1H6O A;  4BER A;  1TN6 A;  1K8K G;  1X81 A;  4B8C B;  2XGM A;  3JYS A;  2PZI A;  3CHO A;  2ZGD A;  3V2X A;  1ELR A;  3SGH A;  4I1A A; 
#chains in the Genus database with same CATH homology
 3Q4A B;  4A3V A;  3UT4 A;  4UWG A;  3G2W A;  1HO8 A;  3UUX A;  2X6F A;  2M63 A;  4BTB A;  4RG9 A;  3CVL A;  2NXP A;  3QAQ A;  5A6C A;  2MOW A;  4GZ5 A;  5FZS A;  4AY6 A;  3JQ0 A;  2A5U A;  3CIA A;  2WXI A;  3FH8 A;  4ANU A;  3VLD A;  1N54 A;  2VZA A;  4CDR A;  1KT1 A;  1EF1 C;  3CQG B;  4KVO A;  1N52 A;  2X6I A;  2VSY A;  3FFL A;  4J6I A;  3CSF A;  3ZHE A;  4YVQ C;  2E2E A;  2Y3A A;  4UWF A;  4WNG A;  3R7R A;  4X2E A;  1GW6 A;  1H19 A;  3ML9 A;  4I6E A;  4KVM A;  4JA7 A;  3UT8 A;  3WXX A;  2FBN A;  3SF4 A;  3G2T A;  4C0M A;  4U8H A;  5JJ7 A;  3FUE A;  5G05 J;  1X5B A;  2KC7 A;  1ZBP A;  4ILI A;  1YA0 A;  1JPL A;  3FTS A;  2IF4 A;  3ML8 A;  3MYV A;  4JZY A;  4HFG A;  5HQ8 A;  3B7T A;  1OWN A;  2VGY A;  5CKL A;  1H2V C;  2FI7 A;  1FCH A;  3LKU A;  2RD0 A;  5G04 C;  3RRU A;  1ZU2 A;  3U9W A;  4DK5 A;  1HS6 A;  5G05 C;  3L16 A;  5KCM A;  2V0P A;  2XCC A;  4BFR A;  2HM8 A;  3GZ1 A;  1UW4 B;  2CHW A;  3ZVV A;  3CK9 A;  1HFA A;  4E6H A;  2CHX A;  3L08 A;  3FEX A;  3IHY A;  2X38 A;  1UN8 A;  5BT1 A;  4XIF A;  2KCL A;  2RG8 A;  2OVB A;  4XI0 A;  3LET A;  2WM9 A;  1W3B A;  3Q5M A;  4JEU A;  4Q96 A;  5T3R A;  3DBS A;  3FH7 A;  1Z3Y A;  2CG2 A;  2WXK A;  2UY1 B;  4BTA A;  4Q94 A;  2LO6 A;  4ATG A;  3D9I A;  4ABN A;  4FA6 A;  2G03 A;  4UQX A;  1NP7 A;  2WXJ A;  1SZ9 A;  1MQS A;  1NA3 A;  4DLO A;  4B94 A;  3SBT B;  3QAR A;  3C98 A;  4N5C A;  4NRH B;  3GZ2 A;  4OYS A;  5ARF A;  3ZGQ A;  2JK8 A;  2OVF A;  5BUZ A;  3FUN A;  2XPZ A;  5KJN A;  1S0P A;  3LDZ A;  4GML A;  3QNK A;  3MEK A;  5LFA A;  4E85 A;  3FU6 A;  1XGW A;  3OXF A;  1JWF A;  1L5J A;  1WM5 A;  3PEU B;  5JFF A;  4G24 A;  4UI9 K;  3ZRH A;  3ASH A;  3G2S A;  3MZL B;  3MA5 A;  4FLH A;  2J9Q A;  4CRW A;  1MHQ A;  3CKB A;  4KXK B;  2FO7 A;  5D0Q D;  4X2D A;  2FUL A;  3G2U A;  2CG3 A;  3Q47 B;  2WXO A;  3IEG A;  5FQ8 A;  4BT9 A;  2VY3 A;  2PL2 A;  3Q49 B;  4FUL A;  4GCN A;  4AXH A;  1PAQ A;  3LPZ A;  2VYI A;  3RIB A;  4JPS A;  3KD7 A;  3O4Z A;  4PS7 A;  4GZD A;  2ILR A;  3CHR A;  3FUF A;  4GYY A;  4UI9 J;  3EHM A;  3JQ1 A;  4AP2 A;  4I6G A;  4WGJ A;  2OND A;  3OTN A;  2KCK A;  2WMO A;  3PE4 A;  2GGF A;  4F1S A;  5KJL A;  4U07 A;  4BX9 A;  2VGX B;  2J09 A;  4KZ0 A;  2J4B A;  4GMJ A;  3B7U X;  4HOS A;  4N2Q A;  4EEC A;  3L6A A;  1SZA A;  3TJP A;  1WAO 1;  3LVR E;  5J90 A;  3CUC A;  2BF0 X;  3SHF A;  2WQ7 A;  2WB2 A;  2R17 C;  1ELW A;  3FY4 A;  3B13 A;  5FQ6 A;  2IOS A;  2YHE A;  2I2O A;  5FWQ A;  3RO2 A;  3APF A;  4ME2 A;  3QOU A;  5FQ4 A;  1OWL A;  4AV7 A;  4RVB A;  3CLJ A;  1H6K A;  5FTP A;  2MHK A;  3FP3 A;  2WQ6 A;  4FP7 A;  3LVQ E;  2IJG X;  2YQ8 A;  2UWJ G;  3FUM A;  3L17 A;  2E0I A;  4JEH A;  2XHE A;  3SHG A;  2LAI A;  3ZYL A;  4L2L A;  5A23 A;  2VTB A;  3ONL A;  1FVH A;  2WXP A;  4PDX A;  4ANV A;  1PC2 A;  3ZC7 A;  4JA9 A;  4IYP A;  3OXG A;  1HU3 A;  4KZC A;  3SI5 A;  3TAX A;  3FUH A;  4PH4 B;  5A7D B;  3RRN B;  4BY6 A;  4HVB A;  2BUG A;  1QZ2 A;  3D3M A;  2KZT A;  1HE8 A;  2ION A;  1H2T C;  3NQP A;  1Z3X A;  1JUQ A;  3CV0 A;  4FU3 A;  3RK6 A;  4EZK A;  3BG0 B;  2PQR A;  3EHN A;  3QDN A;  3RKV A;  3I3N A;  2WVI A;  2I6H A;  1H0A A;  4X2C A;  3TG4 A;  1E8Y A;  1TEZ A;  4F3V A;  2LAH A;  3HIZ A;  3SFZ A;  3NZU A;  2LSV A;  3LY9 A;  3MV3 B;  4UWK A;  4QFV A;  3QWP A;  4BT8 A;  4HXI A;  3GYZ A;  4JHR A;  3CVU A;  4W9R A;  3CHM A;  4APO A;  2CFU A;  4DLQ A;  4ILG A;  5G2N A;  2FF4 A;  3ZYQ A;  1DNP A;  2C0M A;  3T5V A;  3IV0 A;  5T4Y A;  3ZYK A;  4M3O A;  3S2A A;  3CVX A;  3DPD A;  3G2V A;  2LNI A;  3PRE A;  4NUR A;  2OOE A;  2L9B A;  2VSO E;  3E4B A;  3ENE A;  4AJW A;  1FVF A;  3FWV A;  3JCK C;  3FTU A;  4EZL A;  4CDN A;  4EBA G;  1QQE A;  3L54 A;  1NA0 A;  1UG3 A;  2XPI A;  5JHB A;  4FC8 A;  4GA1 A;  4I9C A;  2UY1 A;  4CGV A;  3ZLM A;  3TXN A;  4WWN A;  1E8X A;  4GYO A;  4K0R A;  4L7T A;  3U64 A;  4AEZ C;  3FTX A;  4IUL A;  3ONK A;  2VSX E;  4TRQ A;  4G25 A;  3TL5 A;  4C0E A;  4FJZ A;  4JHK A;  4N2S A;  3LYA A;  4FLB A;  4XKC A;  4JXT A;  3FH5 A;  5DBK A;  3LS8 A;  3HDX A;  3LY8 A;  4U04 A;  3CK7 A;  4TUU A;  1OWM A;  2GRM A;  4GZC A;  4RG6 A;  3D9K A;  1LF8 A;  2HO1 A;  3OXL A;  4I2Z A;  1TJC A;  4CT4 A;  3FUD A;  3AS8 A;  3NF1 A;  3Q15 A;  4J8S A;  3TGO A;  4UQZ A;  2CHZ A;  3SZ7 A;  3FUK A;  4GB9 A;  5FZQ A;  3GZS A;  5M72 A;  4WND A;  2AWI A;  4A3T A;  2J08 A;  3URZ A;  4AIF A;  3PUK A;  4ACK A;  2BTD A;  5LOZ A;  5T8I A;  4UWH A;  4MRU A;  4DJA A;  1Y8M A;  2XGO A;  2ZU6 B;  4MS6 A;  3AU5 A;  2AVP A;  1IQR A;  2AXV A;  3ASF A;  2X3M A;  4I6J A;  3PH0 C;  2NSZ A;  3FU3 A;  3D9O A;  5G04 J;  4AVX A;  3QJZ A;  4BX8 A;  4GAA A;  2J49 A;  4M16 A;  5E75 A;  5EX0 A;  2Y4T A;  4ACL A;  5AEN A;  3RRM B;  1Z6T A;  2KZT B;  1B89 A;  3PVL A;  3VTY A;  3VLF A;  4HOT A;  4H7Y A;  2KCV A;  4DI3 A;  3MKR A;  4Y6W A;  4GA0 A;  1OWP A;  3ZFW A;  4XKB A;  1IQU A;  3CGH A;  2V8S E;  4PS3 A;  1DVP A;  2QFC A;  3HHM A;  4A55 A;  2J07 A;  5KJK A;  4HOR A;  4B0Z A;  2DCP A;  1E7V A;  1HF8 A;  3CHS A;  3EIJ A;  3LJ3 A;  4AM9 A;  3ASD A;  5LCW C;  1INZ A;  1EDU A;  3CVY A;  4A1G A;  4CCA A;  3RU0 A;  4Q69 A;  4KT6 B;  3LEW A;  3T8M A;  4JVS A;  4V3I A;  3CR3 A;  3ZCB A;  3CVP A;  3N71 A;  3CK8 A;  3EJN A;  4WWO A;  4CT0 A;  4ITR A;  3K9I A;  3L22 A;  3MKQ B;  1HG2 A;  2WPV A;  2XEV A;  3S7F A;  2I9C A;  3MX3 A;  4N3C A;  4I1M A;  3FU5 A;  4PUC A;  5D0O D;  1U3C A;  4XX5 A;  4PY3 A;  4EPZ A;  2WXF A;  3PZD A;  4AOF A;  1IYG A;  1HH8 A;  3FTW A;  3EIQ C;  3TXM A;  4U63 A;  4JL0 A;  1E8Z A;  4I17 A;  3FTV A;  2R5S A;  3PUJ A;  3PDN A;  3D9M A;  3I4G A;  4GCO A;  5ENN A;  4LEU A;  3UMV A;  2QY7 A;  3ZW3 A;  5BV0 A;  3AU4 A;  5JJ6 A;  4MKT A;  5CMT A;  3FDH A;  3PRZ A;  5ANR A;  4I1O B;  2DIW A;  3P1U A;  5FT9 A;  3ZHE B;  3CHQ A;  4JC8 A;  3ZYM A;  4OVV A;  3MKQ A;  5C2Y A;  4U0U A;  3D9J A;  4I9E A;  4HOQ A;  4KMO A;  2X6J A;  4I43 A;  4J8D A;  4TV3 A;  2HYZ A;  1E7U A;  3BEE A;  2CFZ A;  3AS5 A;  4JHJ A;  3RJV A;  4A1S A;  3KS2 A;  4H7X A;  5JJT A;  1TJF A;  3FHE A;  3PNT B;  4XE0 A;  4N39 A;  5EKQ D;  3T5X A;  3APC A;  4WUY A;  2YNQ A;  4IN3 B;  3LY7 A;  3IBE A;  3IHV A;  5BPP A;  4KBQ A;  2XRZ A;  4G11 A;  4PS8 A;  5E76 A;  3KEZ A;  4G2V A;  3ULQ A;  4FJY A;  5AJD A;  4LER A;  3FTZ A;  3HYM B;  4LUN U;  5CCM A;  2NC9 A;  1KLX A;  2WXG A;  3APD A;  3FU0 A;  4DPR A;  2OV8 A;  4ANX A;  3U4T A;  3S7J A;  3U3W A;  2IU1 A;  2YHC A;  3D9L A;  1P5Q A;  4HOU A;  4OVU A;  5ANL A;  5CCL A;  5LX8 A;  3CVW A;  2KAT A;  3UT7 A;  3VTX A;  3QWV A;  1QNF A;  3FTY A;  3MCX A;  4UWL A;  4F53 A;  4WNE A;  5EU0 A;  3CEQ A;  4WAF A;  4CGW A;  5LP0 A;  4WWP A;  3S6A A;  3ZEF A;  1NZN A;  2A4Z A;  2VGX A;  3D9N A;  4NQ0 A;  3QWW A;  2P58 C;  2VQ2 A;  3CVN A;  3HVE B;  2XCB A;  3UQ3 A;  3FUL A;  4HLE A;  4J8E A;  4GPK A;  1E90 A;  3UPV A;  5FQ7 A;  2DBA A;  5DIZ A;  2VJ8 A;  1JWG A;  3MV2 B;  4CEM A;  3SE5 A;  5CMW A;  3L13 A;  4K03 A;  4LU4 A;  5CGL A;  3FEY A;  4BWR A;  4NPS A;  4LRZ A;  3NZS A;  3ASG A;  4G26 A;  2WQH A;  2XRY A;  5JFZ A;  2HR2 A;  3ZIM A;  4GA2 A;  3BG1 B;  4FAD A;  2KM4 A;  3CHP A;  2MRI A;  4G1T A;  3PE3 A;  2PQN A;  3RO3 A;  4XZ4 A;  2J4D A;  2C0L A;  4YND A;  1XNF A;  3CQC B;  4RSY A;  1UJJ A;  3CVQ A;  4XI8 A;  4EQF A;  4C9B B;  3PS6 A;  4G23 A;  4MLP A;  1Y6I A;  2V5F A;  1IHG A;  3R9A B;  4URK A;  2R59 A;  3LXU X;  2IQC A;  5JHA A;  1HXI A;  3EDT B;  4IRU A;  4U0S A;  4JW1 A;  3B7R L;  3GW4 A;  2VSN A;  3FUJ A;  2AW6 A;  3QC1 A;  2WXL A;  4HS2 A;  2VTB B;  4L23 A;  3QB2 A;  3CVV A;  5FJY A;  4ILH B;  3LCA A;  2C2L A;  3I4R B;  4WNF A;  5BNW A;  5J08 A;  4D10 C;  2L0T B;  4XI9 A;  4B8A A;  1WY6 A;  2YIN A;  2IFU A;  4GYW A;  1PY1 A;  3QK0 A;  3B7S A;  4F7A A;  2WXM A;  2X6H A;  2XPY A;  2X6K A;  2I1K A;  3AS4 A;  4ANW A;  3R7Q A;  3IKO B;  2FEZ A;  2XQ0 A;  1A17 A;  4R7L A;  3MJW A;  2WXQ A;  3FUI A;  3VLE A;  4YVO A;  2JLB A;  2EQX A;  4KYO B;  4EZJ A;  1BPO A;  3SD5 A;  3QKY A;  3TG5 A;  5EDS A;  3JUI A;  3ZN3 A;  2F6S A;  5C1D A;  5EX3 A;  3ZPJ A;  1SQM A;  4BSX A;  4NAC A;  4Y6C A;  1KT0 A;  1ELK A;  1HG5 A;  2I1J A;  2WMN A;  2AXU A;  4GU5 A;  4UQY A;  4N67 A;  3SNX A;  4U0Z A;  1EPU A;  3PNL B;  3N3U A;  5AYW D;  5AJL A;  2GW1 A;  1HX8 A;  1OUV A;  3HVE A;  1HZ4 A;  4GZ3 A;  4UI9 C;  3O48 A;  3ESL A;  3ESK A;  3S7B A;  5ARG A;  1VDY A;  3ZXS A;  2Y4U A;  3P2B A;  3CKC A;  4L1B A;  3U66 A;  4N3B A;  1EYH A;  2WXN A;  5AIJ A;  3SN9 A;  2GRL A;  2XGS A;  4CDM A;  5FZR A;  5BV1 A;  4DI4 A;  2L6J A;  3D9P A;  1U3D A;  5HI7 A;  5BW8 C;  2LSU A;  4I2W A;  4N3A A;  3CST A;  4P29 A;  4APF A;  3PEV B;  2Q7F A;  4GZ6 A;  4LCT A;  5LCW J;  3SBS A;  2IOL A;  4AY5 A;  5KJM A;  3UX4 A;  4J0U A;  5CMY A;  1E8W A;  2V4L A;  4B8C B;  2WXH A;  2XGM A;  3JYS A;  1E96 B;  3S7D A;  2PZI A;  1OWO A;  3CHO A;  4B89 A;  4FHJ A;  2PM6 A;  3KAE A;  5CHE E;  4L2Y A;  4O6F A;  4EBA A;  3I5P A;  1H2U A;  1UN9 A;  1ELR A;  3MGB A;  3OAW A;  4FHK A;  4J8F A;  2PM7 A;  2AXZ A;  5G55 A;  2JEK A;  1UJK A;  2L0I A;  3SGH A;  2WXR A;  4I1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...