4U0UA

Wild type eukaryotic fic domain containing protein with adp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
334
structure length
334
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFATTEYSVALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u0uA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u0uA01
5JJ7A 4CDRA 2C2LA 3LPZA 3ZHEB 2LNIA 4B94A 4LEUA 1PC2A 5BT1A 3S6AA 2G03A 3MV3B 2KC7A 4BWRA 5KJNA 4BTBA 3S7JA 4CGWA 4W9RA 3TG4A 2XCBA 4H7XA 4GZ5A 4I1AA 2YQ8A 2L6JA 4I2ZA 5A7DB 1WM5A 3TAXA 3RU0A 4J8DA 5BNWA 3KAEA 3Q4AB 3QOUA 4M16A 4GA0A 4N2SA 5DBKA 5G05J 3CKBA 4GZ3A 2FEZA 4WUYA 3CK7A 4XIFA 3SF4A 2GW1A 4HOQA 4G25A 5EU0A 5HQ8A 3FFLA 3Q47B 5JFZA 3RIBA 3ASHA 1ZBPA 3QWWA 3KD7A 5LCWJ 4JA7A 2YHCA 5KJKA 5JJ6A 4J8FA 5G04J 4I9CA 2AVPA 4U04A 5M72A 2Y4TA 3CKCA 2Q7FA 4J0UA 1E96B 4BTAA 2UY1A 1ELRA 1ELWA 2MHKA 4U0SA 3O48A 2IF4A 4G1TA 3CV0A 3SZ7A 3ZCBA 4J8EA 2Y4UA 3CVQA 1A17A 3ZC7A 2VSNA 4U0UA 5HI7A 3LETA 3GZ1A 4X2EA 4GA2A 4ME2A 2LSVA 2HR2A 4GYOA 3N71A 4JA9A 1HH8A 4U0ZA 4XI0A 4Y6CA 4CGVA 5D0OD 2JLBA 4YVQC 3ASFA 4O6FA 3CEQA 3MV2B 5DIZA 4AM9A 3OXLA 2IFUA 2LSUA 3FWVA 3IEGA 3ZPJA 3Q5MA 2XGOA 1QQEA 1IHGA 1KLXA 2UWJG 4GZ6A 4NQ0A 2KCKA 4G24A 3NF1A 2QFCA 4JL0A 3ZN3A 2UY1B 5KJLA 2XCCA 3QKYA 1P5QA 2C0MA 4G2VA 4N2QA 3JYSA 5CKLA 4NRHB 3HYMB 1IYGA 4IN3B 2BUGA 4N67A 3R9AB 3UUXA 1OUVA 3ASGA 4BT8A 2VSYA 3CVNA 2P58C 3WXXA 4WGJA 2PQNA 4I2WA 1NA3A 3AS8A 5C1DA 3CVLA 2FI7A 2WPVA 2VZAA 1NZNA 3LY9A 3LYAA 3GW4A 3UQ3A 5FTPA 3QWPA 2HYZA 3MA5A 1W3BA 4HORA 1QZ2A 5FZSA 1HZ4A 4UQXA 3ASDA 2FO7A 2PL2A 1WAO1 1XNFA 4GYYA 2VYIA 3CVPA 3LKUA 4AIFA 3CK8A 1HXIA 3URZA 5D0QD 4WNDA 4AY6A 4GPKA 3SHGA 3SE5A 4H7YA 3BEEA 2VY3A 3CK9A 5FZRA 3U3WA 3KS2A 4WNFA 3GZ2A 4X2CA 5G05C 1YA0A 5EX0A 4UQZA 1Y8MA 3Q15A 3ZLMA 1ZU2A 4JHRA 4GYWA 4A1SA 5AYWD 3E4BA 3TG5A 2KCLA 5LCWC 5CCMA 4HOSA 2KCVA 2V5FA 3AS4A 5CCLA 4GCNA 1TJCA 4UI9K 5KJMA 1KT1A 4EQFA 3ULQA 3LY7A 3ZGQA 3PE4A 4GCOA 3ZFWA 2ONDA 2HO1A 3RO2A 2KATA 4AY5A 1NA0A 5A6CA 4Y6WA 2WQHA 4UI9C 3RJVA 4NPSA 3SN9A 3MKRA 3FP3A 5BW8C 4YNDA 5EKQD 4HOTA 4YVOA 4WNGA 3RO3A 3K9IA 5ARFA 2I6HA 4N3CA 2VGXA 2NC9A 3VTYA 2J9QA 1KT0A 4KXKB 2XPIA 3U4TA 5FJYA 4BT9A 2DBAA 2XGMA 3UPVA 2OOEA 5JFFA 4XI8A 4KYOB 1FCHA 3MEKA 2FF4A 3S7BA 4HOUA 3OXGA 5CGLA 4N39A 4N5CA 3EDTB 3ZHEA 4PY3A 5FZQA 2PQRA 4N3BA 3GYZA 3TGOA 4G26A 3CUCA 3N3UA 3PE3A 2JK8A 3S7DA 2R5SA 3RKVA 2FBNA 4GA1A 3S7FA 3AS5A 4UI9J 2C0LA 3VTXA 2VGYA 2E2EA 4G23A 5CHEE 4XI9A 4WNEA 5FT9A 3PDNA 4KBQA 2F6SA 4I9EA 2VQ2A 3QWVA 2XEVA 2PZIA 2VGXB 4N3AA 1B89A 4RG6A 4I17A 3OXFA 5JJTA 4U07A 4ITRA 3ESKA 5ARGA 4LU4A 2XGSA 5EX3A 4ABNA 3Q49B 4X2DA 4RG9A 5CMTA 3LY8A 5G04C 4APOA 4F3VA 3QDNA 4UQYA 3LCAA
chains in the Genus database with same CATH superfamily
5JJ7A 3LJ3A 3ZYQA 3MGBA 4LEUA 5E76A 2BEDA 4L9PA 5ENSD 2ZU6B 4A1GA 4EBAA 5HRYA 4C0EA 2EINE 3FTZA 4U8YD 4I1AA 1K1BA 2YQ8A 4WWPA 3C3OA 3UKUG 1WM5A 3CHPA 3FUIA 3HVEB 3T9KA 4M16A 5AARA 4GZ3A 2I2OA 4G25A 1EF1C 4IRUA 3FFLA 4ATGA 3FHEA 1SZAA 1HG2A 1OWOA 1E8XA 2YHCA 3Q73A 3U64A 5G04J 4I9CA 4EHMA 2NXPA 3TWWA 4U04A 1Y6IA 5B1BE 4XEIG 3DPYA 2XHEA 3NOGD 1KZPA 2X6KA 3G2TA 4A3TA 3SI5A 4QFVA 1H6OA 5ANLA 5EYPF 3SZ7A 1Q2ZA 2P9SG 3ZC7A 1KPSB 5HI7A 4X2EA 5E75A 5EYLA 2P2CP 4OVUA 3HHMA 4B8CB 3L13A 2HR2A 4KT6B 3N71A 4JA9A 3CHOA 4U0ZA 1D8DA 2JLBA 3NB2A 4YVQC 2X6FA 2XZDG 3MV2B 3W9GA 3X2QE 3FWVA 3UKRG 3IEGA 3UT7A 3ZPJA 4RSYA 1IHGA 3AG1E 3JUEA 4XE0A 5G55A 2KCKA 1H2VC 4GTPA 4ANUA 2XEEA 4UWHA 2WXKA 3IXEA 1NL4A 3FH5A 3CHMA 2ETAA 3ZN3A 2WXMA 3EUVA 5AQ9A 3AU5A 4I1OB 3QKYA 1WY6A 5JHBA 2MRIA 4GZCA 3P1UA 2GRLA 3KSQA 5CKLA 5LFAA 4GAAA 2WXIA 4NRHB 4HI9A 4DX6D 5CBNA 1IYGA 1V55E 2BUGA 1BU9A 3LJNA 3UUXA 4P29A 5AN8A 2YINA 4UWGA 3FUEA 4BY6A 3OAWA 3FUFA 4DK5A 3I4GA 5BXOA 1QBQA 4BEPA 3PS6A 4DRXE 5C1DA 2KM4A 3Q9NC 3CVLA 2FI7A 2PM6A 3Q9UC 1ELKA 2HYZA 1UJKA 4HRMB 4EBAG 4HORA 1BI7B 5CBOA 1QZ2A 5FZSA 2H6IA 4Z68A 1HZ4A 2X6HA 2HM8A 3BG1B 2ZIRA 4JB8P 3IKOB 5CMYA 3ASDA 3ZXSA 1N4PA 2KXPC 4GYYA 2VYIA 1MZCA 1NI1A 3UT4A 3LKUA 4HI8A 4AIFA 4KVMA 1HXIA 3URZA 5HS0A 4RLYA 3LEWA 4GPKA 3SHGA 4FADA 3IHVA 1EPUA 2CG2A 3BEEA 5FZRA 4WWNA 3KS2A 5CEDB 4X2CA 2DZNA 1Y8MA 3Q15A 4K5CA 4FJYA 2ETBA 3ZLMA 5CMWA 4URKA 3D9NA 3FU5A 4L2YA 2AJAA 4TRQA 3NAWA 1YYHA 3TG5A 3ZUVB 3BU8A 2X38A 3B7UX 5LCWC 1LF8A 1OWMA 3FDHA 1N0QA 4PS8A 4GCNA 1H0AA 4BX8A 2Y3AA 3DSVA 4JZYA 3PZ4A 1TNUA 3AG4E 3ULQA 4M7CA 5H7PA 5AENA 3ZFWA 2ONDA 2HO1A 3RO2A 4NURA 2KATA 4AY5A 1NA0A 1TN7A 2X3MA 3D9MA 4UWFA 3ZW3A 3SN9A 4APFA 1LD8A 4AOFA 1AP7A 2JEKA 2V5QC 3RO3A 3FUHA 3CLJA 1DCEA 2VGXA 3UINC 1N11A 4U95D 2VSXE 4DUIA 3AG3E 5ENNA 3CQGB 4OAUC 2OEVA 1FCHA 3T5XA 2FF4A 3S7BA 1SA5A 1BPOA 2BKKB 3CHQA 5BXUA 5FZQA 1OCZE 3TGOA 4G26A 1O1TA 3PE3A 3L08A 1S64A 2R5SA 2AXUA 3RKVA 4MKTA 4J8SA 4LNBA 2C0LA 3V2XA 4ZFHA 3C72A 2E2EA 3QNKA 4ATZD 4JEUA 1DCQA 1K1AA 3FH7A 5CHEE 2DVWA 5FQ8A 2OCCE 4WNEA 5T3RA 4BERA 3FUDA 2VQ2A 1E90A 3L54A 1TNOA 4RQIA 2RD0A 3QWVA 3ASNE 1UN9A 2GRMA 2VGXB 2AXZA 2J4BA 1B89A 3Q78A 3B95A 2CFZA 4OYSA 1UJJA 3FTWA 5EX3A 3Q49B 2RFAA 2CHXA 2QC9A 3ESLA 4EZJA 2DYSE 4TUMA 5CMTA 4GPMA 3LY8A 5AJDA 3DEPA 3RRUA 4AJWA 1PY1A 1ZB1A 2WMNA 3R9MA 2LNIA 4LCTA 2NSZA 2WVIA 1K8KG 1X5BA 3NZUA 4AVXA 2G03A 3FULA 3UMVA 3MV3B 2KC7A 3RAUA 5KJNA 4CZ2D 4MRUA 3EU5A 3NOCD 3SHFA 2XCBA 4H7XA 2ZGDA 3ONLA 4I2ZA 1N4RA 4JEHA 5A7DB 2WXLA 4CT0A 3L22A 3D9KA 3QOUA 3F6QA 1BD8A 4N2SA 3HXFA 3MX3A 4FLHA 4A63B 5G05J 3TWVA 3PUKA 3R7RA 4GZDA 3FU6A 2V4HC 4WUYA 4XIFA 5EILA 2R17C 3MCXA 5KCMA 4XZ4A 4AP2A 3O4ZA 3RIBA 4JA7A 2J09A 3AG2E 3RRMB 2Y4TA 4F53A 4U8VD 3ZYKA 3I3NA 5J08A 5ANRA 5FQ7A 1SA4A 2MHKA 3O48A 2IF4A 1DC2A 3ENEA 4FULA 3ULYA 3ZCBA 2Y4UA 3ZVVA 2H6HA 2VSNA 4N5QA 2R59A 2XS1A 4F6RD 4ME2A 2LSVA 3UT8A 3ISMC 3HRAA 3L17A 3HIZA 5D0OD 3SBSA 2WB2A 3EHQA 4KMOA 4F1SA 3CEQA 5DIZA 3APFA 3CIAA 2A5UA 4G8LA 1JWGA 5T8IA 2E0IA 2LSUA 4ANXA 4U96D 3UM0A 1O1SA 3Q5MA 2XGOA 1QQEA 3T8MA 1MX6A 4L23A 1KLXA 4GZ6A 4F1PA 3VLEA 5BV0A 4GTQA 3MZLB 4DLOA 5EIDA 5KJLA 2XCCA 4A55A 3ONKA 2BKGA 3E37A 2WXFA 1P5QA 2F37A 5AJLA 2R05A 3CSTA 1QNFA 1E7UA 2EILE 3PRZA 2Y0BG 4FLBA 4N67A 1N95A 3R9AB 4YDOA 2H6GA 1DVPA 2WXJA 2WM9A 1H19A 4CDMA 3ASGA 4BT8A 2P58C 3SFYA 4FU3A 2PQNA 3DXMG 4I2WA 4OAVB 3E30A 2CHZA 3ASOE 4BSZB 4B0ZA 2F8YA 2VGEA 4D10C 2XPYA 4YDYA 2VZAA 3LYAA 2FULA 2CHWA 3GW4A 4HNAD 3L82A 3TL5A 1TNYA 2H6FA 3D9LA 3QWPA 1Z5SC 3MA5A 1W3BA 3ZKJA 3NQPA 1Z3YA 1UG3A 3MYVA 3FH8A 4UQXA 2I1KA 3QJZA 2NYJA 1G3NB 1NP7A 4GTTA 4I6GA 3BQOA 2GROB 1TNZA 3UTMA 3DSXA 2FO1E 4J6IA 3HDXA 1MX2A 2LXLA 3ML8A 4WNDA 3PZ3A 3D9HA 4L7TA 2QY7A 4AV7A 3CK9A 3TWUA 2IU1A 3FU0A 2X6IA 4UQZA 3LVQE 3JQ1A 1ZU2A 2EIJE 4JHRA 1LTXA 2AXVA 4DPRA 1JWFA 5AYWD 2WXRA 2Y1LE 2KCLA 3QB2A 2KCVA 3ZRHA 3CHRA 1KZOA 4FP7A 2RG8A 3E34A 4G8KA 4EQFA 4E6HA 2XS8A 3B7TA 3ZGQA 2J08A 5HKPA 3AJIA 1A5EA 3PNTB 4Y6WA 1N4SA 5C2YA 4KZ0A 3PUJA 4NPSA 3MKRA 1L5JA 5BW8C 3L16A 4AXHA 5EKQD 1U3CA 5EDSA 5JA4D 4WNGA 4JXTA 4Q94A 3BG0B 2I6HA 3EHMA 4N3CA 3TWQA 3AU4A 4K5AB 2NC9A 1FPPA 4JHJA 4KXKB 4JW1A 3EHNA 3VLFA 2XGMA 3J5PA 3UPVA 2B0OE 3R7QA 1GW6A 4XI8A 1HFAA 2VJ8A 3D9JA 5IY5E 2LO6A 2IOLA 2CFUA 4N39A 3FEXA 5JHAA 1Z6TA 4N5CA 3EDTB 4CT4A 4YDEA 3T5VA 2JK8A 1FVHA 2YHEA 1MJ0A 3I4RB 2A4ZA 4JC8A 4GA1A 3S7FA 2GRQB 3AS5A 4WWOA 2VGYA 5JMND 4G23A 2IO3C 2F6SA 4I9EA 2XEHA 2IEJA 3UM2A 2IO2C 4V3IA 4N3AA 4RG6A 2WXPA 5JJTA 4OVVA 3EU9A 5ENOD 4ITRA 2VTBA 4TUUA 2P9LG 2J07A 4X2DA 2AWIA 1S63A 1HS6A 4M3OA 4APOA 4F3VA 1SVXA 3MKQA 4UQYA 1TN8A 5B3SE 1K3ZD 3ZYLA 3LPZA 5LOZA 2EQXA 5BT1A 4AEZC 3S6AA 4U8HA 1INZA 1D9SA 3TXMA 2PNNA 3TG4A 2WXHA 2L0TB 1YCSB 2V0PA 3APDA 2L9BA 3RU0A 4BX9A 1EDUA 1H6PA 5BNWA 3Q4AB 4GA0A 1BLXB 4HFGA 1OWNA 2WXQA 3CK7A 3SF4A 4HOQA 5G2NA 5EU0A 3DSTA 1JCRA 5HQ8A 3HG0D 2VTBB 3PNLB 3C5RA 1ZBPA 5AQ7A 3L6AA 4ACLA 4TXPA 5LCWJ 4JVSA 4J8FA 2IONA 3DWLG 3PZDA 3ZEFA 1OCRE 3MKQB 2V8SE 2AVPA 2GRPB 5M72A 4MLPA 4GTMA 3SFZA 3CQCB 2Q7FA 3Q7AA 3LVRE 4J0UA 5FINA 4BTAA 2UY1A 1ELWA 3T8KA 2NUNA 3QK0A 4G1TA 3V2OA 3UIOC 3HXDA 3KEAA 4EECA 1A17A 3KEZA 3GZ1A 4GTSA 2LUHA 4GB9A 4GA2A 3G2VA 4LG6A 1HH8A 3EHRA 3EIJA 1DNPA 3B7SA 3Q7FA 3ASFA 5ENPD 4O6FA 4BSXA 4XX5A 2DCPA 3OXLA 1HF8A 4PS3A 3CVVA 1RZ4A 1TEZA 4GTOA 2X6JA 5FQ4A 3RK6A 4NQ0A 3NF1A 3G2UA 4UUCA 2QFCA 1PAQA 4DI3A 4JL0A 3DBSA 3ABLE 1N9AA 1MHQA 2UY1B 5EN5D 4L1BA 3IV0A 3DPDA 3BUAA 3JYSA 3ABME 3HYMB 4IN3B 3MJWA 4O1PA 5B1AE 1OUVA 3APCA 3UI2A 2QYJA 3SGHA 2LXMA 3I5PA 2VSYA 3WXXA 4WGJA 1JCSA 4HQDA 4GTRA 1MX4A 1N52A 3RRNB 2CG3A 2WPVA 1MYOA 5FWQA 4FC8A 2MYOA 3ML9A 2IQCA 5FTPA 2I1JA 2WMOA 3LS8A 3U9WA 4PUCA 1TNBA 3G2SA 2R02A 3B7RL 4IYPA 4F7AA 4U7EB 3WG7E 2FO7A 5KWDA 3CVPA 1HX8A 2J49A 1HE8A 4CRWA 2J4DA 1E8WA 2HE0A 5LX8A 5T4YA 1OWLA 4AY6A 2MOWA 3SE5A 3SFXA 4CEMA 2P9NG 3V79K 2VY3A 4L2LA 3JUIA 3U3WA 4XKBA 4ANVA 1OCCE 1H2TC 3FU3A 2ZISA 1RW2A 1JCQA 5LP0A 3PZ2A 1N0RA 1S70B 3E4BA 2Y69E 4HVBA 1QYMA 4JD2G 2A5EA 3GZSA 5CCMA 3FTUA 3AS4A 5CRUA 3PVLA 4GU5A 5KJMA 1E8ZA 1KT1A 2F0YA 3PEVB 5ENTD 1OY3D 2RFMA 3QC1A 3PE4A 4C9BB 5CEAA 4I43A 1V54E 2WXOA 4DX1A 1NH1A 5A23A 1HG5A 4UI9C 3RJVA 4CCAA 1IQRA 3FP3A 2IOSA 4YVOA 2WQ6A 2XRYA 3VTYA 4NACA 3CVYA 1KT0A 4R7LA 4TXRA 4O60A 3U4TA 1TR4A 3V31A 4BT9A 2DBAA 5D66A 2OOEA 4FHKA 5EIBE 4KYOB 1EYHA 3DSSA 3MEKA 4HOUA 1WDYA 1E8YA 4BFRA 3LXUX 3ZHEA 4PY3A 4N3BA 2GRRB 3DRAA 3ZU7B 3N3UA 4EZKA 4MS6A 3VLDA 4KZCA 1MQSA 3Q79A 2FBNA 3CVWA 4UI9J 3VTXA 3RSEG 2PM7A 1OCOE 4HB5A 1IXVA 2M63A 4KVOA 4KBQA 3OTNA 2QYUA 3JXJA 1SW6A 4QQIA 2XRZA 2PZIA 2JABA 2I9CA 4B8AA 4HRLA 3OXFA 3PREA 5KNGA 3ESKA 4LU4A 2P9KG 2XGSA 1UOHA 5AQAA 3NZSA 3C98A 4YDWA 2LAHA 3QDNA 2OV8A 5FIOA 4J7WA 4CDRA 1S0PA 2C2LA 2L6BA 3ZHEB 1AWCB 4B89A 4BESA 4B94A 1O5MA 1PC2A 4DJAA 3Q75A 3UX4A 3CVUA 3EIQC 4BWRA 2XENA 4BTBA 3D9OA 3S7JA 4DX2A 4CGWA 3V30A 3U66A 1E7VA 4W9RA 3CHSA 4EZLA 4GZ5A 3FY4A 2WXNA 2L6JA 3TAXA 3SQVA 1HO8A 4J8DA 3KAEA 5DBKA 3CKBA 4CDNA 2FEZA 5ITZF 4K03A 1SQMA 1XGWA 2GW1A 1OXJA 4ACKA 1TJFA 3Q47B 5JFZA 3C3QA 2DZOA 3ASHA 3QWWA 3KD7A 3DSWA 5KJKA 5JJ6A 5AAOA 1FT2A 1Z3XA 5AQBA 3PEUB 1U2VG 3CKCA 2GGFA 1E96B 1OWPA 3HXCA 1ELRA 1VDYA 3ABKE 1IKND 2WXGA 4U0SA 3D3MA 3CV0A 4J8EA 3CVQA 3ULEG 4U0UA 3LETA 2KZTA 3C3RA 2L0IA 4HLLA 4K5BA 1H2UA 3LDZA 4I6JA 5AIJA 1IQUA 3B7BA 4GYOA 4XI0A 3TWSA 1FT1A 4IULA 5J90A 4Y6CA 3CR3A 4CGVA 3SO8A 4C0MA 3UXGA 1H6KA 4GMJA 1TYQG 2GRNB 4AM9A 2IFUA 3QAQA 3PH0C 4JPSA 2OVFA 3FUNA 4GMRA 3L9TA 2R03A 3JQ0A 2UWJG 4J8YA 4G24A 4HRNA 2XZTG 3UM3A 3P2BA 2V4LA 2F8XK 3FTSA 3DXKG 3FUMA 4ILIA 1YMPA 4A3VA 2RKKA 5BPPA 2C0MA 4G2VA 4N2QA 2P9PG 2DIWA 4ZHBA 3E32A 4LERA 2KZTB 1HU3A 1U3DA 3IBEA 2YNQA 1FVFA 2P9IG 2BF0X 4XKCA 5CRVA 4C48B 3CVNA 2ETCA 4FA6A 4PS7A 4BETA 4LNUD 1NA3A 3AS8A 3UIPC 3TWTA 2KBXA 1NZNA 3LY9A 4GMLA 2EIKE 2XPZA 1UW4B 2P9UG 3UQ3A 4EPZA 3UM1A 3S2AA 4JHKA 3AAAC 1JUQA 2IY0C 2NUDA 2QZAA 2LAIA 1X81A 4I6EA 2BTDA 3HXEA 3G2WA 3FTVA 4LUNU 2PL2A 4UWLA 1WAO1 4LSZE 1XNFA 4DX5D 2ILRA 4I1MA 4LNGA 1TN6A 3FTYA 5CERB 4MBGA 3FEYA 3CK8A 3SBTB 5BV1A 3ZIMA 5D0QD 3J5QB 2AW6A 3SNXA 4H7YA 3FUKA 3W9FA 2DWZA 4ANWA 4WNFA 3GZ2A 5G05C 1YA0A 4PH4B 5EX0A 3CGHA 4HBDA 3FTXA 1NFIE 4GYWA 5ENRD 4A1SA 4RVBA 3QARA 3TJPA 3SY2A 4FJZA 1N94A 4Q69A 3NBNB 4HOSA 2V5FA 2DYRE 3TWRA 5CCLA 2B6CA 1TJCA 4UI9K 4G11A 3CSFA 4U63A 1LD7A 3LY7A 3E33A 4GCOA 4FHJA 5A6CA 1OT8A 2WQHA 4GTVA 4CYMD 1JPLA 2EIME 4YNDA 4WAFA 4HOTA 1N54A 2OVBA 3K9IA 3FUJA 3IHYA 4DI4A 3ZXPA 5ARFA 4NIKA 5KBAA 2J9QA 1SZ9A 2XPIA 5FJYA 2ZXWE 4ILGA 3ZYMA 5D2MC 2VSOE 4X8QA 5JFFA 4TXQA 4UWKA 3OXGA 5CGLA 3JXIA 4TV3A 1D8EA 3KSLA 5FQ6A 3SD5A 3JCKC 2PQRA 3DSUA 3GYZA 4K0RA 2J8SD 3CUCA 3D9PA 4O1OA 3DEOA 3S7DA 3ZNGA 2ZGGA 3B13A 2OEWA 1IHBA 2R2LA 4B93B 3CVXA 4XI9A 2XQ0A 3TWXA 3D9IA 5FT9A 3TXNA 5KNHD 3PDNA 3HXBA 3HVEA 4HXIA 2WQ7A 4HS2A 1BI8B 2XEVA 4Q96A 5CECB 1WG0A 5BUZA 1O1RA 4I17A 4DX7D 4U07A 3PZ1A 5ARGA 4LRZA 4PDXA 4ABNA 1N4QA 2IJGX 4RG9A 3EJNA 4DLQA 4E85A 1UN8A 5G04C 4ILHB 4HLEA 3LCAA 5ENQD
chains in the Genus database with same CATH topology
5JJ7A 3LJ3A 3ZYLA 4CDRA 1S0PA 2C2LA 2WMNA 3LPZA 3ZHEB 3ZYQA 2LNIA 5LOZA 3MGBA 4B89A 2EQXA 4LEUA 1PC2A 4B94A 4LCTA 5BT1A 4DJAA 2NSZA 2WVIA 3UX4A 4AEZC 3S6AA 4U8HA 1X5BA 5E76A 3CVUA 3EIQC 3NZUA 4AVXA 2G03A 1INZA 2ZU6B 3FULA 3UMVA 3TXMA 3MV3B 2KC7A 4BWRA 5KJNA 4BTBA 3D9OA 3S7JA 4A1GA 4EBAA 4CGWA 4C0EA 3FTZA 3U66A 1E7VA 4MRUA 4W9RA 3CHSA 3SHFA 3TG4A 4EZLA 2XCBA 3FY4A 4H7XA 4GZ5A 4I1AA 3ONLA 2WXNA 2WXHA 2L0TB 2YQ8A 2L6JA 4I2ZA 4WWPA 4JEHA 5A7DB 2WXLA 2V0PA 3APDA 1WM5A 3TAXA 4CT0A 2L9BA 3L22A 3RU0A 3CHPA 3FUIA 1EDUA 1HO8A 4J8DA 4B8CB 3D9KA 4BX9A 3HVEB 5BNWA 3KAEA 3Q4AB 3QOUA 4M16A 4GA0A 4N2SA 5DBKA 3MX3A 4FLHA 5G05J 3CKBA 3PUKA 4HFGA 3R7RA 1OWNA 2WXQA 3FU6A 4GZDA 4GZ3A 4CDNA 2FEZA 4WUYA 3CK7A 4XIFA 4K03A 1SQMA 3SF4A 1XGWA 2GW1A 2I2OA 2R17C 4HOQA 4G25A 3MCXA 5G2NA 1EF1C 5EU0A 1TJFA 4IRUA 4XZ4A 3FFLA 3Q47B 5KCMA 3O4ZA 4AP2A 5JFZA 2VTBB 3RIBA 4ATGA 3ASHA 3FHEA 3PNLB 1SZAA 1ZBPA 3QWWA 1HG2A 1OWOA 1E8XA 3KD7A 3L6AA 4ACLA 5LCWJ 4JA7A 2J09A 2YHCA 4JVSA 5JJ6A 5KJKA 4J8FA 2IONA 3RRMB 3U64A 3PZDA 3ZEFA 5G04J 4I9CA 1Z3XA 3MKQB 2V8SE 2NXPA 5HQ8A 2AVPA 4U04A 1Y6IA 5M72A 2Y4TA 3PEUB 4MLPA 4F53A 3SFZA 3CQCB 3CKCA 2GGFA 3ZYKA 2XHEA 3I3NA 2Q7FA 3LVRE 4J0UA 1E96B 1OWPA 4BTAA 2UY1A 2X6KA 1ELRA 1VDYA 5J08A 1ELWA 5ANRA 3G2TA 5FQ7A 2WXGA 3QK0A 2MHKA 4U0SA 3O48A 2IF4A 4A3TA 3D3MA 3ENEA 3SI5A 4G1TA 4QFVA 4FULA 3CV0A 5ANLA 3SZ7A 3ZCBA 4J8EA 2Y4UA 3CVQA 3ZVVA 4EECA 1A17A 3ZC7A 2VSNA 3KEZA 4U0UA 5HI7A 3LETA 3GZ1A 2KZTA 2L0IA 4X2EA 5E75A 4GB9A 2R59A 1H2UA 3LDZA 4GA2A 4I6JA 3G2VA 2LSVA 3HHMA 4ME2A 3L13A 1IQUA 4OVUA 3UT8A 2HR2A 4GYOA 4KT6B 5AIJA 3N71A 4JA9A 3CHOA 1HH8A 4U0ZA 4XI0A 3L17A 3EIJA 4IULA 5J90A 4Y6CA 3CR3A 4CGVA 3HIZA 1DNPA 4C0MA 3B7SA 5D0OD 3SBSA 1H6KA 2JLBA 4YVQC 2WB2A 2X6FA 4GMJA 3ASFA 4KMOA 4O6FA 4F1SA 3CEQA 3MV2B 5DIZA 3APFA 3CIAA 2A5UA 4AM9A 4XX5A 4BSXA 2DCPA 1JWGA 3OXLA 2IFUA 3QAQA 3PH0C 5T8IA 4JPSA 2E0IA 2LSUA 1HF8A 2OVFA 3FWVA 3FUNA 4ANXA 4PS3A 3IEGA 3CVVA 1TEZA 3UT7A 3ZPJA 3Q5MA 2XGOA 4RSYA 1QQEA 2X6JA 5FQ4A 4L23A 1IHGA 3JQ0A 3RK6A 3T8MA 1KLXA 2UWJG 4GZ6A 4XE0A 4NQ0A 5G55A 2KCKA 4G24A 3NF1A 3G2UA 1H2VC 3VLEA 5BV0A 4ANUA 2QFCA 4UWHA 2WXKA 3P2BA 1PAQA 3FH5A 4DI3A 2V4LA 3MZLB 4JL0A 3CHMA 3DBSA 3ZN3A 2WXMA 3FTSA 4DLOA 1MHQA 2UY1B 3FUMA 5KJLA 2XCCA 4ILIA 3AU5A 4I1OB 3QKYA 4L1BA 1WY6A 4A3VA 5JHBA 4A55A 2MRIA 3IV0A 3ONKA 4GZCA 3DPDA 3P1UA 2WXFA 1P5QA 5BPPA 2GRLA 2C0MA 4G2VA 4N2QA 5AJLA 2DIWA 3JYSA 3CSTA 1QNFA 5CKLA 5LFAA 4GAAA 4LERA 2KZTB 2WXIA 1E7UA 4NRHB 3PRZA 1HU3A 3HYMB 1U3DA 3IBEA 1IYGA 2YNQA 1FVFA 4IN3B 3MJWA 2BUGA 4FLBA 4N67A 3R9AB 2BF0X 4XKCA 1DVPA 2WXJA 3UUXA 4P29A 1OUVA 2YINA 3APCA 4UWGA 3FUEA 2WM9A 4BY6A 3OAWA 1H19A 3SGHA 4CDMA 3ASGA 3FUFA 3I5PA 4BT8A 2VSYA 3CVNA 4DK5A 2P58C 4FU3A 3WXXA 4FA6A 4WGJA 3I4GA 4PS7A 2PQNA 4I2WA 1NA3A 3PS6A 3AS8A 2CHZA 1N52A 3RRNB 5C1DA 4B0ZA 2CG3A 2KM4A 3CVLA 2FI7A 2WPVA 4D10C 2XPYA 5FWQA 2VZAA 1NZNA 3LY9A 3LYAA 2FULA 2PM6A 4GMLA 2XPZA 4FC8A 2CHWA 1UW4B 3GW4A 3ML9A 3TL5A 3UQ3A 4EPZA 2IQCA 5FTPA 3D9LA 3S2AA 2I1JA 3QWPA 1ELKA 4JHKA 2WMOA 1JUQA 2HYZA 3LS8A 3MA5A 1UJKA 1W3BA 3U9WA 4EBAG 4PUCA 4HORA 3G2SA 3NQPA 1QZ2A 5FZSA 2LAIA 1Z3YA 3B7RL 1UG3A 4IYPA 1HZ4A 2X6HA 4I6EA 4F7AA 2BTDA 2HM8A 3BG1B 3MYVA 3FH8A 4UQXA 3IKOB 5CMYA 3ASDA 2I1KA 3G2WA 3QJZA 2FO7A 3FTVA 4LUNU 2PL2A 4UWLA 3ZXSA 1WAO1 1XNFA 4GYYA 2VYIA 2ILRA 3CVPA 1NP7A 4I1MA 4I6GA 1HX8A 3UT4A 2J49A 3LKUA 1HE8A 4CRWA 3FTYA 2J4DA 4AIFA 3FEYA 1E8WA 3CK8A 3SBTB 4J6IA 4KVMA 3ZIMA 5BV1A 5T4YA 5LX8A 1HXIA 1OWLA 3HDXA 3URZA 5D0QD 3ML8A 3LEWA 4WNDA 4AY6A 4GPKA 3SHGA 4FADA 2MOWA 3SE5A 4CEMA 3IHVA 2AW6A 3SNXA 4H7YA 1EPUA 3FUKA 4L7TA 2QY7A 4AV7A 2CG2A 3BEEA 2VY3A 3CK9A 4L2LA 5FZRA 3JUIA 4WWNA 2IU1A 3KS2A 3FU0A 4ANWA 3U3WA 4WNFA 3GZ2A 4XKBA 4ANVA 4X2CA 5G05C 1YA0A 2X6IA 4PH4B 5EX0A 4UQZA 3LVQE 3CGHA 1Y8MA 3JQ1A 3Q15A 4FJYA 3ZLMA 1ZU2A 1H2TC 3FTXA 3FU3A 5CMWA 4URKA 3D9NA 3FU5A 4JHRA 4L2YA 4GYWA 4TRQA 4A1SA 2AXVA 4DPRA 4RVBA 5LP0A 1JWFA 3QARA 2WXRA 3E4BA 5AYWD 3TG5A 3TJPA 2KCLA 3QB2A 2X38A 3B7UX 4HVBA 5LCWC 4FJZA 3GZSA 4Q69A 5CCMA 1LF8A 1OWMA 4HOSA 2KCVA 2V5FA 3FDHA 3ZRHA 3FTUA 3AS4A 5CCLA 3CHRA 3PVLA 4GU5A 4PS8A 4GCNA 1H0AA 1TJCA 4FP7A 2RG8A 4UI9K 4G11A 5KJMA 4BX8A 1E8ZA 1KT1A 3PEVB 2Y3AA 4JZYA 3CSFA 4U63A 4EQFA 3ULQA 4E6HA 3B7TA 3LY7A 3ZGQA 3QC1A 3PE4A 4GCOA 4C9BB 2J08A 3ZFWA 2ONDA 5AENA 2HO1A 3RO2A 4I43A 2KATA 4NURA 4AY5A 1NA0A 2WXOA 4FHJA 3PNTB 5A6CA 4Y6WA 2X3MA 5C2YA 5A23A 2WQHA 1HG5A 3D9MA 4KZ0A 4UI9C 4UWFA 3RJVA 3ZW3A 4CCAA 3PUJA 1IQRA 4NPSA 3SN9A 3MKRA 4APFA 3FP3A 1JPLA 1L5JA 4AOFA 5BW8C 3L16A 4YNDA 4WAFA 4AXHA 5EKQD 1U3CA 2JEKA 4HOTA 5EDSA 2IOSA 4YVOA 1N54A 4WNGA 3RO3A 4JXTA 2OVBA 4Q94A 3K9IA 3BG0B 3FUJA 3CLJA 3FUHA 3IHYA 4DI4A 2WQ6A 2XRYA 5ARFA 2I6HA 3EHMA 4N3CA 3AU4A 2VGXA 2NC9A 3VTYA 4NACA 2J9QA 3CVYA 1KT0A 4JHJA 4KXKB 4R7LA 1SZ9A 2XPIA 4JW1A 2VSXE 5FJYA 3U4TA 4BT9A 3EHNA 4ILGA 2DBAA 5ENNA 3VLFA 3ZYMA 2XGMA 3UPVA 3CQGB 3R7QA 1GW6A 2OOEA 4FHKA 2VSOE 5JFFA 4XI8A 1HFAA 4KYOB 2VJ8A 1FCHA 3D9JA 1EYHA 2LO6A 2IOLA 2CFUA 4UWKA 3MEKA 2FF4A 3S7BA 4HOUA 3T5XA 3OXGA 5CGLA 4N39A 1BPOA 3FEXA 1E8YA 4TV3A 5JHAA 1Z6TA 4N5CA 3CHQA 5FQ6A 4BFRA 3EDTB 3LXUX 3SD5A 3ZHEA 4PY3A 3JCKC 2PQRA 4N3BA 5FZQA 3GYZA 4K0RA 3TGOA 4G26A 4CT4A 3T5VA 3CUCA 3N3UA 3PE3A 3D9PA 2JK8A 4EZKA 1FVHA 2YHEA 3S7DA 3I4RB 3L08A 4MS6A 3VLDA 4KZCA 2A4ZA 1MQSA 2R5SA 2AXUA 3RKVA 2FBNA 4MKTA 4JC8A 3B13A 4J8SA 4GA1A 3CVWA 3CVXA 3S7FA 3AS5A 4WWOA 4UI9J 2C0LA 3VTXA 2VGYA 2E2EA 3QNKA 4JEUA 2PM7A 3FH7A 4G23A 5CHEE 5FQ8A 4XI9A 2XQ0A 4WNEA 3D9IA 5FT9A 3TXNA 5T3RA 2M63A 4KVOA 3PDNA 3FUDA 4KBQA 2F6SA 3OTNA 2VQ2A 1E90A 3L54A 4I9EA 3HVEA 4HXIA 2WQ7A 4HS2A 2RD0A 3QWVA 4ACKA 2XRZA 1UN9A 2XEVA 2GRMA 2PZIA 2VGXB 2AXZA 2J4BA 4Q96A 2I9CA 4V3IA 4N3AA 4B8AA 1B89A 4RG6A 5BUZA 2WXPA 3OXFA 4I17A 5JJTA 4OVVA 2CFZA 4U07A 3PREA 4OYSA 1UJJA 4ITRA 3ESKA 5ARGA 2VTBA 4LU4A 4LRZA 2XGSA 3FTWA 4PDXA 4TUUA 5EX3A 4ABNA 2J07A 2IJGX 3Q49B 4X2DA 2AWIA 2CHXA 4RG9A 3EJNA 3ESLA 4EZJA 4DLQA 4E85A 1UN8A 1HS6A 5CMTA 3NZSA 3LY8A 3C98A 5G04C 4M3OA 2LAHA 4APOA 4ILHB 5AJDA 3MKQA 3RRUA 4AJWA 4F3VA 4HLEA 3QDNA 4UQYA 2OV8A 1PY1A 3LCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ7 A;  4CDR A;  2C2L A;  3LPZ A;  3ZHE B;  2LNI A;  4B94 A;  4LEU A;  1PC2 A;  5BT1 A;  3S6A A;  2G03 A;  3MV3 B;  2KC7 A;  4BWR A;  5KJN A;  4BTB A;  3S7J A;  4CGW A;  4W9R A;  3TG4 A;  2XCB A;  4H7X A;  4GZ5 A;  4I1A A;  2YQ8 A;  2L6J A;  4I2Z A;  5A7D B;  1WM5 A;  3TAX A;  3RU0 A;  4J8D A;  5BNW A;  3KAE A;  3Q4A B;  3QOU A;  4M16 A;  4GA0 A;  4N2S A;  5DBK A;  5G05 J;  3CKB A;  4GZ3 A;  2FEZ A;  4WUY A;  3CK7 A;  4XIF A;  3SF4 A;  2GW1 A;  4HOQ A;  4G25 A;  5EU0 A;  5HQ8 A;  3FFL A;  3Q47 B;  5JFZ A;  3RIB A;  3ASH A;  1ZBP A;  3QWW A;  3KD7 A;  5LCW J;  4JA7 A;  2YHC A;  5KJK A;  5JJ6 A;  4J8F A;  5G04 J;  4I9C A;  2AVP A;  4U04 A;  5M72 A;  2Y4T A;  3CKC A;  2Q7F A;  4J0U A;  1E96 B;  4BTA A;  2UY1 A;  1ELR A;  1ELW A;  2MHK A;  4U0S A;  3O48 A;  2IF4 A;  4G1T A;  3CV0 A;  3SZ7 A;  3ZCB A;  4J8E A;  2Y4U A;  3CVQ A;  1A17 A;  3ZC7 A;  2VSN A;  4U0U A;  5HI7 A;  3LET A;  3GZ1 A;  4X2E A;  4GA2 A;  4ME2 A;  2LSV A;  2HR2 A;  4GYO A;  3N71 A;  4JA9 A;  1HH8 A;  4U0Z A;  4XI0 A;  4Y6C A;  4CGV A;  5D0O D;  2JLB A;  4YVQ C;  3ASF A;  4O6F A;  3CEQ A;  3MV2 B;  5DIZ A;  4AM9 A;  3OXL A;  2IFU A;  2LSU A;  3FWV A;  3IEG A;  3ZPJ A;  3Q5M A;  2XGO A;  1QQE A;  1IHG A;  1KLX A;  2UWJ G;  4GZ6 A;  4NQ0 A;  2KCK A;  4G24 A;  3NF1 A;  2QFC A;  4JL0 A;  3ZN3 A;  2UY1 B;  5KJL A;  2XCC A;  3QKY A;  1P5Q A;  2C0M A;  4G2V A;  4N2Q A;  3JYS A;  5CKL A;  4NRH B;  3HYM B;  1IYG A;  4IN3 B;  2BUG A;  4N67 A;  3R9A B;  3UUX A;  1OUV A;  3ASG A;  4BT8 A;  2VSY A;  3CVN A;  2P58 C;  3WXX A;  4WGJ A;  2PQN A;  4I2W A;  1NA3 A;  3AS8 A;  5C1D A;  3CVL A;  2FI7 A;  2WPV A;  2VZA A;  1NZN A;  3LY9 A;  3LYA A;  3GW4 A;  3UQ3 A;  5FTP A;  3QWP A;  2HYZ A;  3MA5 A;  1W3B A;  4HOR A;  1QZ2 A;  5FZS A;  1HZ4 A;  4UQX A;  3ASD A;  2FO7 A;  2PL2 A;  1WAO 1;  1XNF A;  4GYY A;  2VYI A;  3CVP A;  3LKU A;  4AIF A;  3CK8 A;  1HXI A;  3URZ A;  5D0Q D;  4WND A;  4AY6 A;  4GPK A;  3SHG A;  3SE5 A;  4H7Y A;  3BEE A;  2VY3 A;  3CK9 A;  5FZR A;  3U3W A;  3KS2 A;  4WNF A;  3GZ2 A;  4X2C A;  5G05 C;  1YA0 A;  5EX0 A;  4UQZ A;  1Y8M A;  3Q15 A;  3ZLM A;  1ZU2 A;  4JHR A;  4GYW A;  4A1S A;  5AYW D;  3E4B A;  3TG5 A;  2KCL A;  5LCW C;  5CCM A;  4HOS A;  2KCV A;  2V5F A;  3AS4 A;  5CCL A;  4GCN A;  1TJC A;  4UI9 K;  5KJM A;  1KT1 A;  4EQF A;  3ULQ A;  3LY7 A;  3ZGQ A;  3PE4 A;  4GCO A;  3ZFW A;  2OND A;  2HO1 A;  3RO2 A;  2KAT A;  4AY5 A;  1NA0 A;  5A6C A;  4Y6W A;  2WQH A;  4UI9 C;  3RJV A;  4NPS A;  3SN9 A;  3MKR A;  3FP3 A;  5BW8 C;  4YND A;  5EKQ D;  4HOT A;  4YVO A;  4WNG A;  3RO3 A;  3K9I A;  5ARF A;  2I6H A;  4N3C A;  2VGX A;  2NC9 A;  3VTY A;  2J9Q A;  1KT0 A;  4KXK B;  2XPI A;  3U4T A;  5FJY A;  4BT9 A;  2DBA A;  2XGM A;  3UPV A;  2OOE A;  5JFF A;  4XI8 A;  4KYO B;  1FCH A;  3MEK A;  2FF4 A;  3S7B A;  4HOU A;  3OXG A;  5CGL A;  4N39 A;  4N5C A;  3EDT B;  3ZHE A;  4PY3 A;  5FZQ A;  2PQR A;  4N3B A;  3GYZ A;  3TGO A;  4G26 A;  3CUC A;  3N3U A;  3PE3 A;  2JK8 A;  3S7D A;  2R5S A;  3RKV A;  2FBN A;  4GA1 A;  3S7F A;  3AS5 A;  4UI9 J;  2C0L A;  3VTX A;  2VGY A;  2E2E A;  4G23 A;  5CHE E;  4XI9 A;  4WNE A;  5FT9 A;  3PDN A;  4KBQ A;  2F6S A;  4I9E A;  2VQ2 A;  3QWV A;  2XEV A;  2PZI A;  2VGX B;  4N3A A;  1B89 A;  4RG6 A;  4I17 A;  3OXF A;  5JJT A;  4U07 A;  4ITR A;  3ESK A;  5ARG A;  4LU4 A;  2XGS A;  5EX3 A;  4ABN A;  3Q49 B;  4X2D A;  4RG9 A;  5CMT A;  3LY8 A;  5G04 C;  4APO A;  4F3V A;  3QDN A;  4UQY A;  3LCA A; 
#chains in the Genus database with same CATH topology
 5JJ7 A;  3LJ3 A;  3ZYQ A;  3MGB A;  4LEU A;  5E76 A;  2BED A;  4L9P A;  5ENS D;  2ZU6 B;  4A1G A;  4EBA A;  5HRY A;  4C0E A;  2EIN E;  3FTZ A;  4U8Y D;  4I1A A;  1K1B A;  2YQ8 A;  4WWP A;  3C3O A;  3UKU G;  1WM5 A;  3CHP A;  3FUI A;  3HVE B;  3T9K A;  4M16 A;  5AAR A;  4GZ3 A;  2I2O A;  4G25 A;  1EF1 C;  4IRU A;  3FFL A;  4ATG A;  3FHE A;  1SZA A;  1HG2 A;  1OWO A;  1E8X A;  2YHC A;  3Q73 A;  3U64 A;  5G04 J;  4I9C A;  4EHM A;  2NXP A;  3TWW A;  4U04 A;  1Y6I A;  5B1B E;  4XEI G;  3DPY A;  2XHE A;  3NOG D;  1KZP A;  2X6K A;  3G2T A;  4A3T A;  3SI5 A;  4QFV A;  1H6O A;  5ANL A;  5EYP F;  3SZ7 A;  1Q2Z A;  2P9S G;  3ZC7 A;  1KPS B;  5HI7 A;  4X2E A;  5E75 A;  5EYL A;  2P2C P;  4OVU A;  3HHM A;  4B8C B;  3L13 A;  2HR2 A;  4KT6 B;  3N71 A;  4JA9 A;  3CHO A;  4U0Z A;  1D8D A;  2JLB A;  3NB2 A;  4YVQ C;  2X6F A;  2XZD G;  3MV2 B;  3W9G A;  3X2Q E;  3FWV A;  3UKR G;  3IEG A;  3UT7 A;  3ZPJ A;  4RSY A;  1IHG A;  3AG1 E;  3JUE A;  4XE0 A;  5G55 A;  2KCK A;  1H2V C;  4GTP A;  4ANU A;  2XEE A;  4UWH A;  2WXK A;  3IXE A;  1NL4 A;  3FH5 A;  3CHM A;  2ETA A;  3ZN3 A;  2WXM A;  3EUV A;  5AQ9 A;  3AU5 A;  4I1O B;  3QKY A;  1WY6 A;  5JHB A;  2MRI A;  4GZC A;  3P1U A;  2GRL A;  3KSQ A;  5CKL A;  5LFA A;  4GAA A;  2WXI A;  4NRH B;  4HI9 A;  4DX6 D;  5CBN A;  1IYG A;  1V55 E;  2BUG A;  1BU9 A;  3LJN A;  3UUX A;  4P29 A;  5AN8 A;  2YIN A;  4UWG A;  3FUE A;  4BY6 A;  3OAW A;  3FUF A;  4DK5 A;  3I4G A;  5BXO A;  1QBQ A;  4BEP A;  3PS6 A;  4DRX E;  5C1D A;  2KM4 A;  3Q9N C;  3CVL A;  2FI7 A;  2PM6 A;  3Q9U C;  1ELK A;  2HYZ A;  1UJK A;  4HRM B;  4EBA G;  4HOR A;  1BI7 B;  5CBO A;  1QZ2 A;  5FZS A;  2H6I A;  4Z68 A;  1HZ4 A;  2X6H A;  2HM8 A;  3BG1 B;  2ZIR A;  4JB8 P;  3IKO B;  5CMY A;  3ASD A;  3ZXS A;  1N4P A;  2KXP C;  4GYY A;  2VYI A;  1MZC A;  1NI1 A;  3UT4 A;  3LKU A;  4HI8 A;  4AIF A;  4KVM A;  1HXI A;  3URZ A;  5HS0 A;  4RLY A;  3LEW A;  4GPK A;  3SHG A;  4FAD A;  3IHV A;  1EPU A;  2CG2 A;  3BEE A;  5FZR A;  4WWN A;  3KS2 A;  5CED B;  4X2C A;  2DZN A;  1Y8M A;  3Q15 A;  4K5C A;  4FJY A;  2ETB A;  3ZLM A;  5CMW A;  4URK A;  3D9N A;  3FU5 A;  4L2Y A;  2AJA A;  4TRQ A;  3NAW A;  1YYH A;  3TG5 A;  3ZUV B;  3BU8 A;  2X38 A;  3B7U X;  5LCW C;  1LF8 A;  1OWM A;  3FDH A;  1N0Q A;  4PS8 A;  4GCN A;  1H0A A;  4BX8 A;  2Y3A A;  3DSV A;  4JZY A;  3PZ4 A;  1TNU A;  3AG4 E;  3ULQ A;  4M7C A;  5H7P A;  5AEN A;  3ZFW A;  2OND A;  2HO1 A;  3RO2 A;  4NUR A;  2KAT A;  4AY5 A;  1NA0 A;  1TN7 A;  2X3M A;  3D9M A;  4UWF A;  3ZW3 A;  3SN9 A;  4APF A;  1LD8 A;  4AOF A;  1AP7 A;  2JEK A;  2V5Q C;  3RO3 A;  3FUH A;  3CLJ A;  1DCE A;  2VGX A;  3UIN C;  1N11 A;  4U95 D;  2VSX E;  4DUI A;  3AG3 E;  5ENN A;  3CQG B;  4OAU C;  2OEV A;  1FCH A;  3T5X A;  2FF4 A;  3S7B A;  1SA5 A;  1BPO A;  2BKK B;  3CHQ A;  5BXU A;  5FZQ A;  1OCZ E;  3TGO A;  4G26 A;  1O1T A;  3PE3 A;  3L08 A;  1S64 A;  2R5S A;  2AXU A;  3RKV A;  4MKT A;  4J8S A;  4LNB A;  2C0L A;  3V2X A;  4ZFH A;  3C72 A;  2E2E A;  3QNK A;  4ATZ D;  4JEU A;  1DCQ A;  1K1A A;  3FH7 A;  5CHE E;  2DVW A;  5FQ8 A;  2OCC E;  4WNE A;  5T3R A;  4BER A;  3FUD A;  2VQ2 A;  1E90 A;  3L54 A;  1TNO A;  4RQI A;  2RD0 A;  3QWV A;  3ASN E;  1UN9 A;  2GRM A;  2VGX B;  2AXZ A;  2J4B A;  1B89 A;  3Q78 A;  3B95 A;  2CFZ A;  4OYS A;  1UJJ A;  3FTW A;  5EX3 A;  3Q49 B;  2RFA A;  2CHX A;  2QC9 A;  3ESL A;  4EZJ A;  2DYS E;  4TUM A;  5CMT A;  4GPM A;  3LY8 A;  5AJD A;  3DEP A;  3RRU A;  4AJW A;  1PY1 A;  1ZB1 A;  2WMN A;  3R9M A;  2LNI A;  4LCT A;  2NSZ A;  2WVI A;  1K8K G;  1X5B A;  3NZU A;  4AVX A;  2G03 A;  3FUL A;  3UMV A;  3MV3 B;  2KC7 A;  3RAU A;  5KJN A;  4CZ2 D;  4MRU A;  3EU5 A;  3NOC D;  3SHF A;  2XCB A;  4H7X A;  2ZGD A;  3ONL A;  4I2Z A;  1N4R A;  4JEH A;  5A7D B;  2WXL A;  4CT0 A;  3L22 A;  3D9K A;  3QOU A;  3F6Q A;  1BD8 A;  4N2S A;  3HXF A;  3MX3 A;  4FLH A;  4A63 B;  5G05 J;  3TWV A;  3PUK A;  3R7R A;  4GZD A;  3FU6 A;  2V4H C;  4WUY A;  4XIF A;  5EIL A;  2R17 C;  3MCX A;  5KCM A;  4XZ4 A;  4AP2 A;  3O4Z A;  3RIB A;  4JA7 A;  2J09 A;  3AG2 E;  3RRM B;  2Y4T A;  4F53 A;  4U8V D;  3ZYK A;  3I3N A;  5J08 A;  5ANR A;  5FQ7 A;  1SA4 A;  2MHK A;  3O48 A;  2IF4 A;  1DC2 A;  3ENE A;  4FUL A;  3ULY A;  3ZCB A;  2Y4U A;  3ZVV A;  2H6H A;  2VSN A;  4N5Q A;  2R59 A;  2XS1 A;  4F6R D;  4ME2 A;  2LSV A;  3UT8 A;  3ISM C;  3HRA A;  3L17 A;  3HIZ A;  5D0O D;  3SBS A;  2WB2 A;  3EHQ A;  4KMO A;  4F1S A;  3CEQ A;  5DIZ A;  3APF A;  3CIA A;  2A5U A;  4G8L A;  1JWG A;  5T8I A;  2E0I A;  2LSU A;  4ANX A;  4U96 D;  3UM0 A;  1O1S A;  3Q5M A;  2XGO A;  1QQE A;  3T8M A;  1MX6 A;  4L23 A;  1KLX A;  4GZ6 A;  4F1P A;  3VLE A;  5BV0 A;  4GTQ A;  3MZL B;  4DLO A;  5EID A;  5KJL A;  2XCC A;  4A55 A;  3ONK A;  2BKG A;  3E37 A;  2WXF A;  1P5Q A;  2F37 A;  5AJL A;  2R05 A;  3CST A;  1QNF A;  1E7U A;  2EIL E;  3PRZ A;  2Y0B G;  4FLB A;  4N67 A;  1N95 A;  3R9A B;  4YDO A;  2H6G A;  1DVP A;  2WXJ A;  2WM9 A;  1H19 A;  4CDM A;  3ASG A;  4BT8 A;  2P58 C;  3SFY A;  4FU3 A;  2PQN A;  3DXM G;  4I2W A;  4OAV B;  3E30 A;  2CHZ A;  3ASO E;  4BSZ B;  4B0Z A;  2F8Y A;  2VGE A;  4D10 C;  2XPY A;  4YDY A;  2VZA A;  3LYA A;  2FUL A;  2CHW A;  3GW4 A;  4HNA D;  3L82 A;  3TL5 A;  1TNY A;  2H6F A;  3D9L A;  3QWP A;  1Z5S C;  3MA5 A;  1W3B A;  3ZKJ A;  3NQP A;  1Z3Y A;  1UG3 A;  3MYV A;  3FH8 A;  4UQX A;  2I1K A;  3QJZ A;  2NYJ A;  1G3N B;  1NP7 A;  4GTT A;  4I6G A;  3BQO A;  2GRO B;  1TNZ A;  3UTM A;  3DSX A;  2FO1 E;  4J6I A;  3HDX A;  1MX2 A;  2LXL A;  3ML8 A;  4WND A;  3PZ3 A;  3D9H A;  4L7T A;  2QY7 A;  4AV7 A;  3CK9 A;  3TWU A;  2IU1 A;  3FU0 A;  2X6I A;  4UQZ A;  3LVQ E;  3JQ1 A;  1ZU2 A;  2EIJ E;  4JHR A;  1LTX A;  2AXV A;  4DPR A;  1JWF A;  5AYW D;  2WXR A;  2Y1L E;  2KCL A;  3QB2 A;  2KCV A;  3ZRH A;  3CHR A;  1KZO A;  4FP7 A;  2RG8 A;  3E34 A;  4G8K A;  4EQF A;  4E6H A;  2XS8 A;  3B7T A;  3ZGQ A;  2J08 A;  5HKP A;  3AJI A;  1A5E A;  3PNT B;  4Y6W A;  1N4S A;  5C2Y A;  4KZ0 A;  3PUJ A;  4NPS A;  3MKR A;  1L5J A;  5BW8 C;  3L16 A;  4AXH A;  5EKQ D;  1U3C A;  5EDS A;  5JA4 D;  4WNG A;  4JXT A;  4Q94 A;  3BG0 B;  2I6H A;  3EHM A;  4N3C A;  3TWQ A;  3AU4 A;  4K5A B;  2NC9 A;  1FPP A;  4JHJ A;  4KXK B;  4JW1 A;  3EHN A;  3VLF A;  2XGM A;  3J5P A;  3UPV A;  2B0O E;  3R7Q A;  1GW6 A;  4XI8 A;  1HFA A;  2VJ8 A;  3D9J A;  5IY5 E;  2LO6 A;  2IOL A;  2CFU A;  4N39 A;  3FEX A;  5JHA A;  1Z6T A;  4N5C A;  3EDT B;  4CT4 A;  4YDE A;  3T5V A;  2JK8 A;  1FVH A;  2YHE A;  1MJ0 A;  3I4R B;  2A4Z A;  4JC8 A;  4GA1 A;  3S7F A;  2GRQ B;  3AS5 A;  4WWO A;  2VGY A;  5JMN D;  4G23 A;  2IO3 C;  2F6S A;  4I9E A;  2XEH A;  2IEJ A;  3UM2 A;  2IO2 C;  4V3I A;  4N3A A;  4RG6 A;  2WXP A;  5JJT A;  4OVV A;  3EU9 A;  5ENO D;  4ITR A;  2VTB A;  4TUU A;  2P9L G;  2J07 A;  4X2D A;  2AWI A;  1S63 A;  1HS6 A;  4M3O A;  4APO A;  4F3V A;  1SVX A;  3MKQ A;  4UQY A;  1TN8 A;  5B3S E;  1K3Z D;  3ZYL A;  3LPZ A;  5LOZ A;  2EQX A;  5BT1 A;  4AEZ C;  3S6A A;  4U8H A;  1INZ A;  1D9S A;  3TXM A;  2PNN A;  3TG4 A;  2WXH A;  2L0T B;  1YCS B;  2V0P A;  3APD A;  2L9B A;  3RU0 A;  4BX9 A;  1EDU A;  1H6P A;  5BNW A;  3Q4A B;  4GA0 A;  1BLX B;  4HFG A;  1OWN A;  2WXQ A;  3CK7 A;  3SF4 A;  4HOQ A;  5G2N A;  5EU0 A;  3DST A;  1JCR A;  5HQ8 A;  3HG0 D;  2VTB B;  3PNL B;  3C5R A;  1ZBP A;  5AQ7 A;  3L6A A;  4ACL A;  4TXP A;  5LCW J;  4JVS A;  4J8F A;  2ION A;  3DWL G;  3PZD A;  3ZEF A;  1OCR E;  3MKQ B;  2V8S E;  2AVP A;  2GRP B;  5M72 A;  4MLP A;  4GTM A;  3SFZ A;  3CQC B;  2Q7F A;  3Q7A A;  3LVR E;  4J0U A;  5FIN A;  4BTA A;  2UY1 A;  1ELW A;  3T8K A;  2NUN A;  3QK0 A;  4G1T A;  3V2O A;  3UIO C;  3HXD A;  3KEA A;  4EEC A;  1A17 A;  3KEZ A;  3GZ1 A;  4GTS A;  2LUH A;  4GB9 A;  4GA2 A;  3G2V A;  4LG6 A;  1HH8 A;  3EHR A;  3EIJ A;  1DNP A;  3B7S A;  3Q7F A;  3ASF A;  5ENP D;  4O6F A;  4BSX A;  4XX5 A;  2DCP A;  3OXL A;  1HF8 A;  4PS3 A;  3CVV A;  1RZ4 A;  1TEZ A;  4GTO A;  2X6J A;  5FQ4 A;  3RK6 A;  4NQ0 A;  3NF1 A;  3G2U A;  4UUC A;  2QFC A;  1PAQ A;  4DI3 A;  4JL0 A;  3DBS A;  3ABL E;  1N9A A;  1MHQ A;  2UY1 B;  5EN5 D;  4L1B A;  3IV0 A;  3DPD A;  3BUA A;  3JYS A;  3ABM E;  3HYM B;  4IN3 B;  3MJW A;  4O1P A;  5B1A E;  1OUV A;  3APC A;  3UI2 A;  2QYJ A;  3SGH A;  2LXM A;  3I5P A;  2VSY A;  3WXX A;  4WGJ A;  1JCS A;  4HQD A;  4GTR A;  1MX4 A;  1N52 A;  3RRN B;  2CG3 A;  2WPV A;  1MYO A;  5FWQ A;  4FC8 A;  2MYO A;  3ML9 A;  2IQC A;  5FTP A;  2I1J A;  2WMO A;  3LS8 A;  3U9W A;  4PUC A;  1TNB A;  3G2S A;  2R02 A;  3B7R L;  4IYP A;  4F7A A;  4U7E B;  3WG7 E;  2FO7 A;  5KWD A;  3CVP A;  1HX8 A;  2J49 A;  1HE8 A;  4CRW A;  2J4D A;  1E8W A;  2HE0 A;  5LX8 A;  5T4Y A;  1OWL A;  4AY6 A;  2MOW A;  3SE5 A;  3SFX A;  4CEM A;  2P9N G;  3V79 K;  2VY3 A;  4L2L A;  3JUI A;  3U3W A;  4XKB A;  4ANV A;  1OCC E;  1H2T C;  3FU3 A;  2ZIS A;  1RW2 A;  1JCQ A;  5LP0 A;  3PZ2 A;  1N0R A;  1S70 B;  3E4B A;  2Y69 E;  4HVB A;  1QYM A;  4JD2 G;  2A5E A;  3GZS A;  5CCM A;  3FTU A;  3AS4 A;  5CRU A;  3PVL A;  4GU5 A;  5KJM A;  1E8Z A;  1KT1 A;  2F0Y A;  3PEV B;  5ENT D;  1OY3 D;  2RFM A;  3QC1 A;  3PE4 A;  4C9B B;  5CEA A;  4I43 A;  1V54 E;  2WXO A;  4DX1 A;  1NH1 A;  5A23 A;  1HG5 A;  4UI9 C;  3RJV A;  4CCA A;  1IQR A;  3FP3 A;  2IOS A;  4YVO A;  2WQ6 A;  2XRY A;  3VTY A;  4NAC A;  3CVY A;  1KT0 A;  4R7L A;  4TXR A;  4O60 A;  3U4T A;  1TR4 A;  3V31 A;  4BT9 A;  2DBA A;  5D66 A;  2OOE A;  4FHK A;  5EIB E;  4KYO B;  1EYH A;  3DSS A;  3MEK A;  4HOU A;  1WDY A;  1E8Y A;  4BFR A;  3LXU X;  3ZHE A;  4PY3 A;  4N3B A;  2GRR B;  3DRA A;  3ZU7 B;  3N3U A;  4EZK A;  4MS6 A;  3VLD A;  4KZC A;  1MQS A;  3Q79 A;  2FBN A;  3CVW A;  4UI9 J;  3VTX A;  3RSE G;  2PM7 A;  1OCO E;  4HB5 A;  1IXV A;  2M63 A;  4KVO A;  4KBQ A;  3OTN A;  2QYU A;  3JXJ A;  1SW6 A;  4QQI A;  2XRZ A;  2PZI A;  2JAB A;  2I9C A;  4B8A A;  4HRL A;  3OXF A;  3PRE A;  5KNG A;  3ESK A;  4LU4 A;  2P9K G;  2XGS A;  1UOH A;  5AQA A;  3NZS A;  3C98 A;  4YDW A;  2LAH A;  3QDN A;  2OV8 A;  5FIO A;  4J7W A;  4CDR A;  1S0P A;  2C2L A;  2L6B A;  3ZHE B;  1AWC B;  4B89 A;  4BES A;  4B94 A;  1O5M A;  1PC2 A;  4DJA A;  3Q75 A;  3UX4 A;  3CVU A;  3EIQ C;  4BWR A;  2XEN A;  4BTB A;  3D9O A;  3S7J A;  4DX2 A;  4CGW A;  3V30 A;  3U66 A;  1E7V A;  4W9R A;  3CHS A;  4EZL A;  4GZ5 A;  3FY4 A;  2WXN A;  2L6J A;  3TAX A;  3SQV A;  1HO8 A;  4J8D A;  3KAE A;  5DBK A;  3CKB A;  4CDN A;  2FEZ A;  5ITZ F;  4K03 A;  1SQM A;  1XGW A;  2GW1 A;  1OXJ A;  4ACK A;  1TJF A;  3Q47 B;  5JFZ A;  3C3Q A;  2DZO A;  3ASH A;  3QWW A;  3KD7 A;  3DSW A;  5KJK A;  5JJ6 A;  5AAO A;  1FT2 A;  1Z3X A;  5AQB A;  3PEU B;  1U2V G;  3CKC A;  2GGF A;  1E96 B;  1OWP A;  3HXC A;  1ELR A;  1VDY A;  3ABK E;  1IKN D;  2WXG A;  4U0S A;  3D3M A;  3CV0 A;  4J8E A;  3CVQ A;  3ULE G;  4U0U A;  3LET A;  2KZT A;  3C3R A;  2L0I A;  4HLL A;  4K5B A;  1H2U A;  3LDZ A;  4I6J A;  5AIJ A;  1IQU A;  3B7B A;  4GYO A;  4XI0 A;  3TWS A;  1FT1 A;  4IUL A;  5J90 A;  4Y6C A;  3CR3 A;  4CGV A;  3SO8 A;  4C0M A;  3UXG A;  1H6K A;  4GMJ A;  1TYQ G;  2GRN B;  4AM9 A;  2IFU A;  3QAQ A;  3PH0 C;  4JPS A;  2OVF A;  3FUN A;  4GMR A;  3L9T A;  2R03 A;  3JQ0 A;  2UWJ G;  4J8Y A;  4G24 A;  4HRN A;  2XZT G;  3UM3 A;  3P2B A;  2V4L A;  2F8X K;  3FTS A;  3DXK G;  3FUM A;  4ILI A;  1YMP A;  4A3V A;  2RKK A;  5BPP A;  2C0M A;  4G2V A;  4N2Q A;  2P9P G;  2DIW A;  4ZHB A;  3E32 A;  4LER A;  2KZT B;  1HU3 A;  1U3D A;  3IBE A;  2YNQ A;  1FVF A;  2P9I G;  2BF0 X;  4XKC A;  5CRV A;  4C48 B;  3CVN A;  2ETC A;  4FA6 A;  4PS7 A;  4BET A;  4LNU D;  1NA3 A;  3AS8 A;  3UIP C;  3TWT A;  2KBX A;  1NZN A;  3LY9 A;  4GML A;  2EIK E;  2XPZ A;  1UW4 B;  2P9U G;  3UQ3 A;  4EPZ A;  3UM1 A;  3S2A A;  4JHK A;  3AAA C;  1JUQ A;  2IY0 C;  2NUD A;  2QZA A;  2LAI A;  1X81 A;  4I6E A;  2BTD A;  3HXE A;  3G2W A;  3FTV A;  4LUN U;  2PL2 A;  4UWL A;  1WAO 1;  4LSZ E;  1XNF A;  4DX5 D;  2ILR A;  4I1M A;  4LNG A;  1TN6 A;  3FTY A;  5CER B;  4MBG A;  3FEY A;  3CK8 A;  3SBT B;  5BV1 A;  3ZIM A;  5D0Q D;  3J5Q B;  2AW6 A;  3SNX A;  4H7Y A;  3FUK A;  3W9F A;  2DWZ A;  4ANW A;  4WNF A;  3GZ2 A;  5G05 C;  1YA0 A;  4PH4 B;  5EX0 A;  3CGH A;  4HBD A;  3FTX A;  1NFI E;  4GYW A;  5ENR D;  4A1S A;  4RVB A;  3QAR A;  3TJP A;  3SY2 A;  4FJZ A;  1N94 A;  4Q69 A;  3NBN B;  4HOS A;  2V5F A;  2DYR E;  3TWR A;  5CCL A;  2B6C A;  1TJC A;  4UI9 K;  4G11 A;  3CSF A;  4U63 A;  1LD7 A;  3LY7 A;  3E33 A;  4GCO A;  4FHJ A;  5A6C A;  1OT8 A;  2WQH A;  4GTV A;  4CYM D;  1JPL A;  2EIM E;  4YND A;  4WAF A;  4HOT A;  1N54 A;  2OVB A;  3K9I A;  3FUJ A;  3IHY A;  4DI4 A;  3ZXP A;  5ARF A;  4NIK A;  5KBA A;  2J9Q A;  1SZ9 A;  2XPI A;  5FJY A;  2ZXW E;  4ILG A;  3ZYM A;  5D2M C;  2VSO E;  4X8Q A;  5JFF A;  4TXQ A;  4UWK A;  3OXG A;  5CGL A;  3JXI A;  4TV3 A;  1D8E A;  3KSL A;  5FQ6 A;  3SD5 A;  3JCK C;  2PQR A;  3DSU A;  3GYZ A;  4K0R A;  2J8S D;  3CUC A;  3D9P A;  4O1O A;  3DEO A;  3S7D A;  3ZNG A;  2ZGG A;  3B13 A;  2OEW A;  1IHB A;  2R2L A;  4B93 B;  3CVX A;  4XI9 A;  2XQ0 A;  3TWX A;  3D9I A;  5FT9 A;  3TXN A;  5KNH D;  3PDN A;  3HXB A;  3HVE A;  4HXI A;  2WQ7 A;  4HS2 A;  1BI8 B;  2XEV A;  4Q96 A;  5CEC B;  1WG0 A;  5BUZ A;  1O1R A;  4I17 A;  4DX7 D;  4U07 A;  3PZ1 A;  5ARG A;  4LRZ A;  4PDX A;  4ABN A;  1N4Q A;  2IJG X;  4RG9 A;  3EJN A;  4DLQ A;  4E85 A;  1UN8 A;  5G04 C;  4ILH B;  4HLE A;  3LCA A;  5ENQ D; 
#chains in the Genus database with same CATH homology
 5JJ7 A;  3LJ3 A;  3ZYL A;  4CDR A;  1S0P A;  2C2L A;  2WMN A;  3LPZ A;  3ZHE B;  3ZYQ A;  2LNI A;  5LOZ A;  3MGB A;  4B89 A;  2EQX A;  4LEU A;  1PC2 A;  4B94 A;  4LCT A;  5BT1 A;  4DJA A;  2NSZ A;  2WVI A;  3UX4 A;  4AEZ C;  3S6A A;  4U8H A;  1X5B A;  5E76 A;  3CVU A;  3EIQ C;  3NZU A;  4AVX A;  2G03 A;  1INZ A;  2ZU6 B;  3FUL A;  3UMV A;  3TXM A;  3MV3 B;  2KC7 A;  4BWR A;  5KJN A;  4BTB A;  3D9O A;  3S7J A;  4A1G A;  4EBA A;  4CGW A;  4C0E A;  3FTZ A;  3U66 A;  1E7V A;  4MRU A;  4W9R A;  3CHS A;  3SHF A;  3TG4 A;  4EZL A;  2XCB A;  3FY4 A;  4H7X A;  4GZ5 A;  4I1A A;  3ONL A;  2WXN A;  2WXH A;  2L0T B;  2YQ8 A;  2L6J A;  4I2Z A;  4WWP A;  4JEH A;  5A7D B;  2WXL A;  2V0P A;  3APD A;  1WM5 A;  3TAX A;  4CT0 A;  2L9B A;  3L22 A;  3RU0 A;  3CHP A;  3FUI A;  1EDU A;  1HO8 A;  4J8D A;  4B8C B;  3D9K A;  4BX9 A;  3HVE B;  5BNW A;  3KAE A;  3Q4A B;  3QOU A;  4M16 A;  4GA0 A;  4N2S A;  5DBK A;  3MX3 A;  4FLH A;  5G05 J;  3CKB A;  3PUK A;  4HFG A;  3R7R A;  1OWN A;  2WXQ A;  3FU6 A;  4GZD A;  4GZ3 A;  4CDN A;  2FEZ A;  4WUY A;  3CK7 A;  4XIF A;  4K03 A;  1SQM A;  3SF4 A;  1XGW A;  2GW1 A;  2I2O A;  2R17 C;  4HOQ A;  4G25 A;  3MCX A;  5G2N A;  1EF1 C;  5EU0 A;  1TJF A;  4IRU A;  4XZ4 A;  3FFL A;  3Q47 B;  5KCM A;  3O4Z A;  4AP2 A;  5JFZ A;  2VTB B;  3RIB A;  4ATG A;  3ASH A;  3FHE A;  3PNL B;  1SZA A;  1ZBP A;  3QWW A;  1HG2 A;  1OWO A;  1E8X A;  3KD7 A;  3L6A A;  4ACL A;  5LCW J;  4JA7 A;  2J09 A;  2YHC A;  4JVS A;  5JJ6 A;  5KJK A;  4J8F A;  2ION A;  3RRM B;  3U64 A;  3PZD A;  3ZEF A;  5G04 J;  4I9C A;  1Z3X A;  3MKQ B;  2V8S E;  2NXP A;  5HQ8 A;  2AVP A;  4U04 A;  1Y6I A;  5M72 A;  2Y4T A;  3PEU B;  4MLP A;  4F53 A;  3SFZ A;  3CQC B;  3CKC A;  2GGF A;  3ZYK A;  2XHE A;  3I3N A;  2Q7F A;  3LVR E;  4J0U A;  1E96 B;  1OWP A;  4BTA A;  2UY1 A;  2X6K A;  1ELR A;  1VDY A;  5J08 A;  1ELW A;  5ANR A;  3G2T A;  5FQ7 A;  2WXG A;  3QK0 A;  2MHK A;  4U0S A;  3O48 A;  2IF4 A;  4A3T A;  3D3M A;  3ENE A;  3SI5 A;  4G1T A;  4QFV A;  4FUL A;  3CV0 A;  5ANL A;  3SZ7 A;  3ZCB A;  4J8E A;  2Y4U A;  3CVQ A;  3ZVV A;  4EEC A;  1A17 A;  3ZC7 A;  2VSN A;  3KEZ A;  4U0U A;  5HI7 A;  3LET A;  3GZ1 A;  2KZT A;  2L0I A;  4X2E A;  5E75 A;  4GB9 A;  2R59 A;  1H2U A;  3LDZ A;  4GA2 A;  4I6J A;  3G2V A;  2LSV A;  3HHM A;  4ME2 A;  3L13 A;  1IQU A;  4OVU A;  3UT8 A;  2HR2 A;  4GYO A;  4KT6 B;  5AIJ A;  3N71 A;  4JA9 A;  3CHO A;  1HH8 A;  4U0Z A;  4XI0 A;  3L17 A;  3EIJ A;  4IUL A;  5J90 A;  4Y6C A;  3CR3 A;  4CGV A;  3HIZ A;  1DNP A;  4C0M A;  3B7S A;  5D0O D;  3SBS A;  1H6K A;  2JLB A;  4YVQ C;  2WB2 A;  2X6F A;  4GMJ A;  3ASF A;  4KMO A;  4O6F A;  4F1S A;  3CEQ A;  3MV2 B;  5DIZ A;  3APF A;  3CIA A;  2A5U A;  4AM9 A;  4XX5 A;  4BSX A;  2DCP A;  1JWG A;  3OXL A;  2IFU A;  3QAQ A;  3PH0 C;  5T8I A;  4JPS A;  2E0I A;  2LSU A;  1HF8 A;  2OVF A;  3FWV A;  3FUN A;  4ANX A;  4PS3 A;  3IEG A;  3CVV A;  1TEZ A;  3UT7 A;  3ZPJ A;  3Q5M A;  2XGO A;  4RSY A;  1QQE A;  2X6J A;  5FQ4 A;  4L23 A;  1IHG A;  3JQ0 A;  3RK6 A;  3T8M A;  1KLX A;  2UWJ G;  4GZ6 A;  4XE0 A;  4NQ0 A;  5G55 A;  2KCK A;  4G24 A;  3NF1 A;  3G2U A;  1H2V C;  3VLE A;  5BV0 A;  4ANU A;  2QFC A;  4UWH A;  2WXK A;  3P2B A;  1PAQ A;  3FH5 A;  4DI3 A;  2V4L A;  3MZL B;  4JL0 A;  3CHM A;  3DBS A;  3ZN3 A;  2WXM A;  3FTS A;  4DLO A;  1MHQ A;  2UY1 B;  3FUM A;  5KJL A;  2XCC A;  4ILI A;  3AU5 A;  4I1O B;  3QKY A;  4L1B A;  1WY6 A;  4A3V A;  5JHB A;  4A55 A;  2MRI A;  3IV0 A;  3ONK A;  4GZC A;  3DPD A;  3P1U A;  2WXF A;  1P5Q A;  5BPP A;  2GRL A;  2C0M A;  4G2V A;  4N2Q A;  5AJL A;  2DIW A;  3JYS A;  3CST A;  1QNF A;  5CKL A;  5LFA A;  4GAA A;  4LER A;  2KZT B;  2WXI A;  1E7U A;  4NRH B;  3PRZ A;  1HU3 A;  3HYM B;  1U3D A;  3IBE A;  1IYG A;  2YNQ A;  1FVF A;  4IN3 B;  3MJW A;  2BUG A;  4FLB A;  4N67 A;  3R9A B;  2BF0 X;  4XKC A;  1DVP A;  2WXJ A;  3UUX A;  4P29 A;  1OUV A;  2YIN A;  3APC A;  4UWG A;  3FUE A;  2WM9 A;  4BY6 A;  3OAW A;  1H19 A;  3SGH A;  4CDM A;  3ASG A;  3FUF A;  3I5P A;  4BT8 A;  2VSY A;  3CVN A;  4DK5 A;  2P58 C;  4FU3 A;  3WXX A;  4FA6 A;  4WGJ A;  3I4G A;  4PS7 A;  2PQN A;  4I2W A;  1NA3 A;  3PS6 A;  3AS8 A;  2CHZ A;  1N52 A;  3RRN B;  5C1D A;  4B0Z A;  2CG3 A;  2KM4 A;  3CVL A;  2FI7 A;  2WPV A;  4D10 C;  2XPY A;  5FWQ A;  2VZA A;  1NZN A;  3LY9 A;  3LYA A;  2FUL A;  2PM6 A;  4GML A;  2XPZ A;  4FC8 A;  2CHW A;  1UW4 B;  3GW4 A;  3ML9 A;  3TL5 A;  3UQ3 A;  4EPZ A;  2IQC A;  5FTP A;  3D9L A;  3S2A A;  2I1J A;  3QWP A;  1ELK A;  4JHK A;  2WMO A;  1JUQ A;  2HYZ A;  3LS8 A;  3MA5 A;  1UJK A;  1W3B A;  3U9W A;  4EBA G;  4PUC A;  4HOR A;  3G2S A;  3NQP A;  1QZ2 A;  5FZS A;  2LAI A;  1Z3Y A;  3B7R L;  1UG3 A;  4IYP A;  1HZ4 A;  2X6H A;  4I6E A;  4F7A A;  2BTD A;  2HM8 A;  3BG1 B;  3MYV A;  3FH8 A;  4UQX A;  3IKO B;  5CMY A;  3ASD A;  2I1K A;  3G2W A;  3QJZ A;  2FO7 A;  3FTV A;  4LUN U;  2PL2 A;  4UWL A;  3ZXS A;  1WAO 1;  1XNF A;  4GYY A;  2VYI A;  2ILR A;  3CVP A;  1NP7 A;  4I1M A;  4I6G A;  1HX8 A;  3UT4 A;  2J49 A;  3LKU A;  1HE8 A;  4CRW A;  3FTY A;  2J4D A;  4AIF A;  3FEY A;  1E8W A;  3CK8 A;  3SBT B;  4J6I A;  4KVM A;  3ZIM A;  5BV1 A;  5T4Y A;  5LX8 A;  1HXI A;  1OWL A;  3HDX A;  3URZ A;  5D0Q D;  3ML8 A;  3LEW A;  4WND A;  4AY6 A;  4GPK A;  3SHG A;  4FAD A;  2MOW A;  3SE5 A;  4CEM A;  3IHV A;  2AW6 A;  3SNX A;  4H7Y A;  1EPU A;  3FUK A;  4L7T A;  2QY7 A;  4AV7 A;  2CG2 A;  3BEE A;  2VY3 A;  3CK9 A;  4L2L A;  5FZR A;  3JUI A;  4WWN A;  2IU1 A;  3KS2 A;  3FU0 A;  4ANW A;  3U3W A;  4WNF A;  3GZ2 A;  4XKB A;  4ANV A;  4X2C A;  5G05 C;  1YA0 A;  2X6I A;  4PH4 B;  5EX0 A;  4UQZ A;  3LVQ E;  3CGH A;  1Y8M A;  3JQ1 A;  3Q15 A;  4FJY A;  3ZLM A;  1ZU2 A;  1H2T C;  3FTX A;  3FU3 A;  5CMW A;  4URK A;  3D9N A;  3FU5 A;  4JHR A;  4L2Y A;  4GYW A;  4TRQ A;  4A1S A;  2AXV A;  4DPR A;  4RVB A;  5LP0 A;  1JWF A;  3QAR A;  2WXR A;  3E4B A;  5AYW D;  3TG5 A;  3TJP A;  2KCL A;  3QB2 A;  2X38 A;  3B7U X;  4HVB A;  5LCW C;  4FJZ A;  3GZS A;  4Q69 A;  5CCM A;  1LF8 A;  1OWM A;  4HOS A;  2KCV A;  2V5F A;  3FDH A;  3ZRH A;  3FTU A;  3AS4 A;  5CCL A;  3CHR A;  3PVL A;  4GU5 A;  4PS8 A;  4GCN A;  1H0A A;  1TJC A;  4FP7 A;  2RG8 A;  4UI9 K;  4G11 A;  5KJM A;  4BX8 A;  1E8Z A;  1KT1 A;  3PEV B;  2Y3A A;  4JZY A;  3CSF A;  4U63 A;  4EQF A;  3ULQ A;  4E6H A;  3B7T A;  3LY7 A;  3ZGQ A;  3QC1 A;  3PE4 A;  4GCO A;  4C9B B;  2J08 A;  3ZFW A;  2OND A;  5AEN A;  2HO1 A;  3RO2 A;  4I43 A;  2KAT A;  4NUR A;  4AY5 A;  1NA0 A;  2WXO A;  4FHJ A;  3PNT B;  5A6C A;  4Y6W A;  2X3M A;  5C2Y A;  5A23 A;  2WQH A;  1HG5 A;  3D9M A;  4KZ0 A;  4UI9 C;  4UWF A;  3RJV A;  3ZW3 A;  4CCA A;  3PUJ A;  1IQR A;  4NPS A;  3SN9 A;  3MKR A;  4APF A;  3FP3 A;  1JPL A;  1L5J A;  4AOF A;  5BW8 C;  3L16 A;  4YND A;  4WAF A;  4AXH A;  5EKQ D;  1U3C A;  2JEK A;  4HOT A;  5EDS A;  2IOS A;  4YVO A;  1N54 A;  4WNG A;  3RO3 A;  4JXT A;  2OVB A;  4Q94 A;  3K9I A;  3BG0 B;  3FUJ A;  3CLJ A;  3FUH A;  3IHY A;  4DI4 A;  2WQ6 A;  2XRY A;  5ARF A;  2I6H A;  3EHM A;  4N3C A;  3AU4 A;  2VGX A;  2NC9 A;  3VTY A;  4NAC A;  2J9Q A;  3CVY A;  1KT0 A;  4JHJ A;  4KXK B;  4R7L A;  1SZ9 A;  2XPI A;  4JW1 A;  2VSX E;  5FJY A;  3U4T A;  4BT9 A;  3EHN A;  4ILG A;  2DBA A;  5ENN A;  3VLF A;  3ZYM A;  2XGM A;  3UPV A;  3CQG B;  3R7Q A;  1GW6 A;  2OOE A;  4FHK A;  2VSO E;  5JFF A;  4XI8 A;  1HFA A;  4KYO B;  2VJ8 A;  1FCH A;  3D9J A;  1EYH A;  2LO6 A;  2IOL A;  2CFU A;  4UWK A;  3MEK A;  2FF4 A;  3S7B A;  4HOU A;  3T5X A;  3OXG A;  5CGL A;  4N39 A;  1BPO A;  3FEX A;  1E8Y A;  4TV3 A;  5JHA A;  1Z6T A;  4N5C A;  3CHQ A;  5FQ6 A;  4BFR A;  3EDT B;  3LXU X;  3SD5 A;  3ZHE A;  4PY3 A;  3JCK C;  2PQR A;  4N3B A;  5FZQ A;  3GYZ A;  4K0R A;  3TGO A;  4G26 A;  4CT4 A;  3T5V A;  3CUC A;  3N3U A;  3PE3 A;  3D9P A;  2JK8 A;  4EZK A;  1FVH A;  2YHE A;  3S7D A;  3I4R B;  3L08 A;  4MS6 A;  3VLD A;  4KZC A;  2A4Z A;  1MQS A;  2R5S A;  2AXU A;  3RKV A;  2FBN A;  4MKT A;  4JC8 A;  3B13 A;  4J8S A;  4GA1 A;  3CVW A;  3CVX A;  3S7F A;  3AS5 A;  4WWO A;  4UI9 J;  2C0L A;  3VTX A;  2VGY A;  2E2E A;  3QNK A;  4JEU A;  2PM7 A;  3FH7 A;  4G23 A;  5CHE E;  5FQ8 A;  4XI9 A;  2XQ0 A;  4WNE A;  3D9I A;  5FT9 A;  3TXN A;  5T3R A;  2M63 A;  4KVO A;  3PDN A;  3FUD A;  4KBQ A;  2F6S A;  3OTN A;  2VQ2 A;  1E90 A;  3L54 A;  4I9E A;  3HVE A;  4HXI A;  2WQ7 A;  4HS2 A;  2RD0 A;  3QWV A;  4ACK A;  2XRZ A;  1UN9 A;  2XEV A;  2GRM A;  2PZI A;  2VGX B;  2AXZ A;  2J4B A;  4Q96 A;  2I9C A;  4V3I A;  4N3A A;  4B8A A;  1B89 A;  4RG6 A;  5BUZ A;  2WXP A;  3OXF A;  4I17 A;  5JJT A;  4OVV A;  2CFZ A;  4U07 A;  3PRE A;  4OYS A;  1UJJ A;  4ITR A;  3ESK A;  5ARG A;  2VTB A;  4LU4 A;  4LRZ A;  2XGS A;  3FTW A;  4PDX A;  4TUU A;  5EX3 A;  4ABN A;  2J07 A;  2IJG X;  3Q49 B;  4X2D A;  2AWI A;  2CHX A;  4RG9 A;  3EJN A;  3ESL A;  4EZJ A;  4DLQ A;  4E85 A;  1UN8 A;  1HS6 A;  5CMT A;  3NZS A;  3LY8 A;  3C98 A;  5G04 C;  4M3O A;  2LAH A;  4APO A;  4ILH B;  5AJD A;  3MKQ A;  3RRU A;  4AJW A;  4F3V A;  4HLE A;  3QDN A;  4UQY A;  2OV8 A;  1PY1 A;  3LCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...