4U1IA

Hla class i micropolymorphisms determine peptide-hla landscape and dictate differential hiv-1 escape through identical epitopes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
278
structure length
278
Chain Sequence
MGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQDRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular switch in immunodominant HIV-1-specific CD8 T-cell epitopes shapes differential HLA-restricted escape.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-81 alpha chain
total genus 77
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u1iA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4u1iA01
1CDIA 3QZWA 3BGFC 4U3HA 1VFUA 1V7NL 1CT8A 3C9NA 5JNYB 1UEYA 1T03H 1MIEH 4FRWA 3TT3H 4JM2F 5DVMA 5E95B 5CINH 1I1FA 3RIAK 3KG5A 2E7MA 4GRMB 1LP9E 3QDAA 1IC5H 2H26A 2AS5M 3GFUA 4ZG1A 1JNHA 4PJHA 1Q9KB 1E6OL 3GGWB 3TM6A 1NDMA 4L3EE 4U0RC 1KXVC 1IEBB 4OD2B 4ODHH 1YEGL 3UJJH 3NIGE 2D0FA 1I7RA 3B9DA 4RGOH 4XPFH 2BOCB 3SJVB 4YLQT 4JPIB 4G9FB 5F7WC 1YC7A 1JZ8A 1QKZL 1DDHA 3AFLA 3VRJA 1BD2B 1OP5H 3HI6L 3JWOH 4PJIE 3CFIC 4QNPF 1CGTA 2PTVA 3EJJX 5L0QC 3MYZA 2PXYD 3WFHB 4YDVA 3P9LA 2ZZUT 4HLZH 4QRTA 3FFDB 3BSZL 4YJZL 1HXYA 3RI5K 1PSKH 2CR3A 3QCTL 4JFDB 5F1IB 5T1LB 1XZ0A 3O2DA 3O6MH 5E1AB 3QHFL 3CXDH 4R97B 2EKSA 5IM7A 4YBLC 1I4FB 1IGIL 1QRKA 5GGSB 3TV3H 4F9LC 3BIKA 4K2UL 1KCUL 2FECL 2YRPA 4AEHH 4Z18A 1F58H 3EO1A 3QDMB 2DI8A 3SDXB 4BYHA 1P7HL 4OD3L 1GGIL 3DVNB 4MD0B 4DN4H 4KJQD 1WFTA 2FO4A 3ARVA 3RWIB 4X4XB 3UTZB 2OZ4A 4G9FD 5MI0C 2Y06L 3V6OA 1GZQA 2V5TA 4EUPB 1UQSB 1U8LA 1H3GA 5F6HI 4ZS6C 4HH8A 5IV2B 3WFEL 1K2DB 4Z7WF 3K2MC 4OGXH 3OKKB 3O41A 3RTQA 4F7MA 4D0BA 1RUMH 5EULV 1A3RH 2O5ZH 3OAYK 4NKDB 3JV4A 2FX7H 1I9EA 2YPKA 3ET9F 4OF7A 4P2RD 4WEMB 5FCUH 4APQC 1CLZH 5KSBE 1S8DB 3PWPB 4NWTL 2MMXA 3T0XA 1CXFA 1M05A 3ARED 3QUYA 3RWJA 3C5ZC 5IFHL 5IIEB 2VDLH 1IQWH 1RK0B 4P9HL 4K55A 5IK3A 1NCAL 1DJSA 1QSFA 3LKNB 4U1NB 5I30H 1PGRB 1MCFA 3T65A 3L3GA 3TH2T 4R2GD 2XZQL 1MQ8A 4NN6C 1XF4A 2P5WA 1NFDF 4M61B 3VFGH 2JJSA 1U8OA 3TYGH 3EOBA 4HG4J 1IM9B 5MP6H 3DETC 4M6OL 1ZHLA 4Z0BL 4CDGC 3C60A 3L5WA 3I85A 4HJ0C 1UADC 2OSLA 4U7SA 4Y2DB 5I15L 1R3KA 1U6AL 5T5NG 4OZHA 4QOKA 4BSVA 2Z31C 4EQ2A 1DQJB 1WFOA 4ORGA 4WDIB 3MLYH 2WWKO 3ULSA 2HTKC 4WHDA 4I13B 1EA9C 1ZLWK 1OAZH 3HMXA 4CU8A 4K7PH 4Q6IB 2HLFD 5EC1B 5IVXA 3ARPA 4I0PC 1TZGL 4MJID 5C8JA 1CL7I 3RJQB 1ULVA 1RIVL 4ZD3H 1GGTA 4MGXA 3OQ3B 4B53A 4BFEA 5IB3B 2P48B 1JWMB 4I0PB 3O2WL 4M6MH 5GIRA 4R2GB 4LDEB 1PLGH 1BD2E 3ZKMD 5AUMA 2YOCA 3FQWB 3HE6A 3MNZA 2YXFA 4NQEE 5E9DD 4CU7A 2ZCLL 4OAWB 4Y4HC 1ZVHA 4ZOCA 1RVFL 1YEJL 2WBJA 2BNUA 2Q1EA 3QI9A 1JGVH 3UZVB 2PXYA 1CI5A 1JI2A 2RJMA 2R23A 4LKCB 1QEWA 2EE9A 4CRPA 1TTUA 4EVNB 4TUJB 3C6SB 3ZTJG 5HBBA 3DMMC 1GIGL 3L3JA 1ZT7A 4X7FC 5LJYH 2WBJB 3P3YA 5E94B 5C0BB 5ILTL 5J3HD 3ESVF 4WI8A 4EIGB 3V6OE 4IRSC 4XBEL 3SE8H 1SY6L 1T7XA 1X4YA 1JGLH 3GK8H 1UKSA 2VE6A 4PJAA 2C9AA 3HE6B 2YKLL 3FQWA 1JI1A 4PGEB 1D5ZA 3CMGA 3O2VL 4JLRB 4MLIA 4PB9H 4G6KH 1IAIM 2QQQA 2IH1A 3D5OF 4XP1L 5D1XB 2EDNA 4UINH 3D39B 3THMH 3UYRH 5D71H 3BAEH 4UNUA 3R0NA 3KLHD 2XZAL 3MV8E 3NCBB 4PLKC 2EXYD 1N7MH 4PJCB 1JGEA 1YY9C 2ARJQ 3NIGF 1AE6L 1KNOB 4LCWB 1FNAA 3BH8A 4ORGB 3WDJA 1ED3B 4HK3N 3HMXH 3BYYA 4X7SH 3QQNA 4M1DH 1ADQH 4X6BA 5EU7C 3SCMB 2ED9A 4D0CA 3DX7B 4X8JB 2I24N 4PRHA 1KIRA 2H2SD 4DFIA 3IJSA 4X7TA 4I77H 5D7IF 4YXLH 3A6CL 1EGJH 1A3LH 3QUZC 2CKBL 2G60L 4QY8B 4E5XB 1F4WH 3QJHA 3FHAA 4XNZB 4DKDC 1B0GA 1MY5A 3P0VL 1IFHL 4IRZH 3QQ3A 4DGIL 2DS4A 4LPYA 4JO4L 2XRAH 4CN4A 1REIA 3T0BA 3F12A 1RK0A 4U2ZA 1SJVA 2MSPA 1T2QL 4HCRL 4PP2B 4OLWL 1NBVH 2Q3ZA 3BN9D 3TZVA 4JG0L 4IIQC 5D2LB 2HTKD 4LDOB 4ZPVA 4WTZA 2ZSWB 5IJKC 1T0PB 3V5KA 3MRNB 4LCWD 4FQCL 4X6FA 4JDZA 2X2YA 1WBXB 2PUQT 4NKDA 3RY4A 1T03L 1PX4A 4ONGL 1IVLA 5ACMA 1HOCA 3CNKA 2F53D 5INDB 3F8UB 2EH8H 3X14A 1HZHH 5I6XB 4F7CB 5JA8B 3U30C 4UT6H 3EW3B 5IQ7H 2APXA 2E7LA 1FRGH 3OJ2C 4XCCL 3SBWA 4EUPA 1D6EB 3PL6C 3VDCA 3U4BL 5K9QG 3D3VA 2BZDA 3H6JA 3WIHH 1VSCA 4KV5F 5CUSL 4NQEB 4N90D 1AQDB 2HT4C 3JWOL 3IDGB 2NYYC 4CJ1A 3HS0A 1M7DA 3QWQB 2FSEA 5IM7B 5DC9B 3PABA 4LRNL 1ZLVK 4KQ4H 4NDMA 2DQFB 1T5XA 2D0HA 1T1WB 1W0WA 3S36H 3GSNB 1AXSB 4PP1C 3DUHA 5FCUL 2PO6C 4U0RB 2W65A 1BLNA 4MXQA 1OM3L 2GJ6D 2J8UE 5SWQB 3HN3A 1OD9A 2EYTB 3BWAA 3WO3B 4FP8H 1FFNB 5KSBA 3OKOB 4XVUD 4OV5A 4J2XA 2XTLA 3ZSSA 1ORQA 1UYWH 4OF3A 4HUXA 2CDEB 1EAPA 4GKSA 5HTSA 4OD2A 2AK1L 2WBWB 1JHTA 4JFFA 1PG7L 5GRXG 1KELL 1UXSA 4O4YH 1JNHB 4PJHB 1QQDA 3EJYD 1JK8B 2BRRL 1F2XK 5F7FA 5EORH 2DLFH 1I9JL 2PW1B 5E4IA 2YR3A 2B5IB 4PJCE 3EYUH 4OUOA 4OIBA 3ARYA 2ZKHL 4GG8B 4KROB 4OFDA 2MCG1 5D1ZC 3O9WA 3BZFB 1NMCC 4RGMB 3QZWB 5F1KC 3N06B 4MNQB 4H0HB 1CYGA 3ARBA 4NZJA 2NXZB 3EUUA 4P5TC 4KHXH 2GW5A 3AGVA 2W9EH 1FL3A 1RUAH 3HLAB 2ESVE 3GRWA 1EO5A 5E9DE 3C09C 1RY7B 2R2HB 2WUCH 2AJ3A 5DJ0A 2XXCB 3LY6A 2LAGB 3WUWB 3QUZB 2VKXA 1A4JA 4XNMA 1NDGB 2HKFL 5ALCL 2DWEB 4K7FA 5KVEL 5GGVL 2Y7QA 1ACYH 3C09B 4KKAD 4PJGB 1YEHL 4HF5L 2LTQC 2RCSH 2R0KH 1X5IA 2AJUH 1A6ZB 3ES6B 2LVEA 4Z77B 2DQCH 4J3OC 4UDTA 5ACZB 4O51B 2B1HH 3LN5B 1MCIA 3PWJA 2NX5D 4TUOB 1QBBA 4WY7L 1MAJA 4KRPB 1AR1D 1J0ZA 3FB5B 3GMQB 3AREB 3BJ91 3GRWL 4KUCD 3TNMB 3L95B 1G6RB 4LARL 3LCYA 1HI6A 2WUBL 3PQYE 3QQ4A 4JFOA 4UV4L 3PGCB 1M7IA 2EDOA 4XBEH 1CIUA 5K9OB 3KXFD 3Q1SL 4F9PA 3U30B 2E9WA 1V3JA 2HTLC 3PDOA 1P5VA 3VXME 5ITFA 4ZUTA 4RMRA 3P9MB 4OGAD 3UZEA 3CVHA 3RWCB 3BDYH 3B5GA 4CW1B 4LHUG 4X6EB 2VDQH 4OT1L 4UI2A 1DBJH 3HMWH 2IPTH 4G6JH 3DO7A 5EU7E 3QB7C 4HPYL 2AXGB 1XMWA 1JGDB 3CDYA 2A77L 3UP1A 2JJTC 2XZCH 3CFBA 3AU1A 2FECI 5MERB 1RVFH 4AEEA 3G5ZA 4J23A 4MHHG 2NY0B 1HHGB 4NZDA 2OQJB 3AVEA 4LNRB 3FQNB 2XN9E 4XBPB 5F1NB 1RZJH 4RA3A 4WTWA 3TVMB 2VLRD 1U8NB 3SKMA 4WTZG 3VXOB 1P4BH 1MJUL 2QV2A 3LS5L 2EO1A 5A2FA 4PJ9D 4OZIA 2DF3A 1CE6B 5D7IA 1E4JA 1ES0A 4JFHD 5FB8A 4Q9BA 1V3LA 4L4VE 3D9AL 4NHUB 1FIGL 1F11B 4LVOC 2O5YL 1JFQL 3P73A 4P4RB 5TFSL 4JRWA 1BZ7A 1HSAB 2CLZA 4JKPL 1BX2A 4KI5C 2J8UF 1RZIA 4F3FB 5BRZA 3MV11 3RNQA 4K7PY 3GSVB 1VEOA 4U6XA 1IZKA 3VWKB 1T20A 4IDJL 4Z7WE 2IQ9L 4Q2ZB 5EZIL 1GOHA 4KK9D 1C08B 3BZEB 5E6YA 4F33A 1NGYA 4PLJC 1RJZA 3F7QA 3LKOB 1MWAH 2AKRA 2IANB 3QFDB 4RGMC 1SVZA 3MV9A 1UJ3A 5EB9A 3BVNA 4XVUC 2Z4QA 4IOSD 3T2OA 2ZOKB 4PGJA 4OCYH 1CD1B 1J7VR 5HGBA 4W4NA 3WS6A 2CDFB 5I76A 2EDXA 5L7XL 3EDFA 2NW3B 4G8IB 1GGBL 5DLMH 3NZHH 5DT1H 3RQ3A 5FA3B 2VL5A 1RIUL 3RNQB 1G7LA 5J11B 4E41A 2PTTB 4MA3A 4G59A 5TE6H 3IF1B 4ESKA 2VLJD 1YC8A 5T1LD 5A2KH 1BX2B 3ZKMC 4HGWB 5BOZG 4ZOBA 1G7PA 1IFHH 3P73B 5B8CA 1CZ8L 4U1GC 1FNHA 1CD9B 5KTEH 3REVA 4PDCE 4P5MA 3BX7C 4HGMA 3X17A 4MNGE 1OTTD 1LGVA 5DD3H 7FABL 3S37H 4WCYL 4OCMC 3ZKXC 3RU8H 4Y89A 4Z78B 4NO0D 1XGRB 1YEDA 5CEXB 2NQCA 5JQ6L 5MENB 1DQDH 4G9DA 5IMOB 4PJ5A 1MFBL 3TVMA 3KYMA 2EDKA 1OLZA 1QACA 2OQJA 3D69A 4LNRA 5IP4A 4UBDC 1Y0LB 1NC2D 3G5ZB 3BT2L 5HHOB 4ZFOA 2F8VA 4GW1A 2D4DA 5F6HJ 1M1SA 3FMGH 1I8MA 3CFBB 3QCVH 3DX6B 5T3ZL 4MJ6B 4PGBA 5E7FA 3MJ7B 4AIZB 1T66D 1QA9A 3DURA 3MJ6A 1BFSA 5IVOA 4XI5C 3G08A 2DQUH 3U9UB 3VXPB 4X6EA 2A6JB 2HKHL 2CUIA 1EV2E 4B0MM 1U8HB 3H3PH 2VR5A 4NHUE 4UQ2B 1FYTE 1QO3B 2FL5A 5ITFB 2VITB 1A14H 4PY7B 5D6DC 3BW9A 3MR9B 5FYKE 1Y6MR 2ICWB 1CFNA 3IB4A 4XWGL 3CSYA 4OKVA 4LRNH 4HFWA 4OJFL 5EBWA 3S36L 4JHAL 2FJHB 3CK0H 1WFUA 2QSTA 1Q0YL 4L3AA 1MFCH 5CGYD 4Y5XC 3SDCD 4DAGL 4TUOA 3MUGA 3HHRB 1RZ7L 4R7DA 5ERWB 3GMRA 1V8HA 2RB8A 2APWA 3U6RA 5D72H 1IC5L 4LQ1A 4WFFD 5DI8A 3PWLA 4P59H 4HT1H 2KDGA 3RVWD 3TH3T 1S7TA 2AXJA 4U1HB 3GM8A 5FGSA 5EU3B 3O4LA 4NQSA 4YX2H 1RZ8A 5DJ0B 1JRHI 2A9ML 4LSUH 3WLBB 3E2HA 3QDMD 3WFEH 2YPLA 2Y72A 1FVCA 2B1HL 2FGWL 5DMJB 1MCPH 3HPJA 1F8TL 3QIBA 2RR3A 5FKAA 5T33H 2C1PB 2HH0H 4WW1A 2NCMA 4KVCL 2UUDK 2JK5B 3V52H 4X99B 4NT6B 4AQ1B 3S88L 2V9TA 4BH8B 3CJJA 1ZA3A 2VZ1A 3LDBC 1IKFL 2APVA 1QQDB 2CMRL 3K2UL 4H26A 1G6RH 2VC2L 4ZAKA 2YUZA 4XAWL 4S1DC 1HEZA 4I5BB 2V2XB 2VLLB 3IU3B 4CJ0A 2H9GB 1A7BA 1K4DA 2BVQA 3DETD 3L3KA 3QQ9D 5JOFB 2QSQA 4G6JL 4HWBH 4QHUB 4OV5B 1TJHH 4KHTH 4YWGH 3U4EB 1FZOB 4NC1C 1OF2A 4PPTA 4FXKB 3MLTA 2EYTA 1G7HB 1VFOA 5HHXH 12E8H 1AQKL 3DBXB 3F6IA 5DXWA 4JO1H 1SVCP 2HJKA 3HUJA 1HILA 1F45A 1BLNB 4AK1A 4NSKB 1HH6A 4M6NH 1ZLSL 4R7NA 2R69L 4JREB 3N85H 5IW6A 3ARGC 5F9OL 3ULUF 1KPVA 1T3FA 4RFOL 3PWNB 1JZ3A 2CLRB 4OIIH 1C5BL 4ZUVA 3TBTA 2GTWA 4D9QE 2FSEB 4HKJB 4R6UA 5I8KH 2MTPA 4N1EA 5DQJB 1G9MC 1GGUA 1UM6H 1EK3A 1T0MB 1T7VA 2RFXA 3ARBD 3OKEB 4JANB 1JTOA 2AJXH 1UB5B 4LLAA 4OFYA 4H20H 4LPXA 1UM4H 4TOYH 5GGUB 3V8CA 3AAZA 3IDXH 4HWBA 4NZUH 4OGYH 3U1SL 1DBJL 4NRXA 1YY8A 3X14B 5C2BH 5GISH 3WNOA 1OB1B 3TC9A 2XZCL 1HOCB 3MLWH 3MRBA 3WYRA 4LAQL 1U8JB 3MV7E 3OJVC 4XXCC 2ZUXA 1MRFL 5GJTH 2R15A 3VGHA 1KFAL 4M3KB 4FQLH 5ESVA 5SV4A 1OAZL 4J6RH 4KPHL 4JGMA 5L2KA 4K7PL 1KIPB 3LN4A 1FE8L 2JF1A 3O45B 1IC4L 1SHMA 3NCJL 4Y4FD 3BGAA 2APFA 4Q0XH 4XCNB 5HYSG 1MPAL 4L8SB 4F9LA 4MXQD 4HJGA 4HK0B 1F3RB 5EG6C 2WIMA 1LEGA 4TSBH 2KZWA 5DD5H 4JAMA 3ZE1E 1IGFL 4JKPH 3QJHB 2VZOA 3U9PH 1W2KT 2NR6C 4QY8A 3GIVA 4RRPG 5HHME 3QUXC 4CGTA 5DD1L 2PW2A 3IJSB 4X7TB 3SJVE 5IB5B 5T3ZE 3CIQA 2H6PB 3WXVH 3RDTA 4ZODA 3TVMD 3SCMA 1LDSA 3TT1H 2DTML 1YEKL 1S7RB 4KTYA 1QLFB 4NKIH 4V1DB 4OCXH 5ETUA 1FCCA 1A22B 3BH8B 2VZVA 1KPRA 1TTGA 1DLFL 1DLHB 2MHAA 3B4NA 4Z7UF 4ZFGL 4P5TB 5D5MB 4OCRL 3OWEA 3UXFA 2ORBH 3D2UB 3VH8A 1FP5A 4OCYL 5GSRA 2HJLB 3C5ZA 1CDYA 1YQVL 4HUMB 4LAJH 2HJFB 4LSVL 1YZZA 4QHLB 3EGSA 3B8YA 4ODSH 2DQUL 1H3WM 1B88A 3HNVH 2X9XA 5MEPB 2HKHH 3RVVD 2ICWJ 4PTUA 4NO3A 3SCMD 5GZOD 4KUZH 3V5HB 3U0PB 4PGEA 1RULH 4EDXA 4ODVL 5MEOB 4MA8H 3V6ZB 3I75B 1IRAY 3AUVA 5IMMA 1XIWB 3BAEL 5D7SH 2QQLL 3L3JB 4L4JA 4WFGD 4CNIA 3GSUB 4RZCA 1QFUL 3EOAA 2DLGA 1G7QA 3C6SA 3VFWB 5EZOH 4QO1A 1X5XA 4AZ8A 3M07A 1MFBH 1QEWB 4JZOA 1NCCH 3FO2A 3K8KA 4DAGH 5BQ7A 1T6WA 5CJQL 5DF0A 3MFGB 1JGUL 4FZ8L 4LHQB 1G7IA 2BNUB 2YWZA 3MMEA 5E8NA 3FOLA 3WMSA 1KJ2A 3TNNA 4Y19A 4NO0B 5F96L 1YNLL 3MNZB 2X4OA 3MREB 5C0ND 5FYKH 4PB0H 5GIRB 4XMKL 3U4AA 3Q3GB 3O4OC 2W1NA 5H94A 3TO2B 2OJZL 4Z7VA 1CLOL 5GPRA 1OSPH 2E7CA 3QHZH 2DIJA 1N5YH 2B8OT 3BHBB 5J0BA 2NY2D 4PRPD 3TA3B 1LEIB 4F2MA 2XV6B 4MLSA 2NY4B 4M1CC 3INUH 4BH7A 2XYCA 1U8PB 5E99H 5IBTH 4CVXA 1Z5LB 4JFZL 3MRPB 4LQFH 1IGYA 3WHXA 4L4VD 1RK1A 3P0YL 5DUPH 5ICZB 1R3KB 1T7WA 2GI7A 5HHPA 2OSLB 1MJJA 5TF1L 2OTUA 4APQB 5DMKA 3DMMA 4DFHA 4P23A 2R2EB 5F8QC 1NJ9B 4PRHD 2B4CC 3W2DH 4K8RH 1KCGC 2HLFC 2CK0L 2BNQD 3N1GC 4MAYB 4OCSH 4XAWH 3VGFA 1M6OA 5H35B 3JTTB 5JUEL 2X4SB 4QTHB 1XF4B 3WNPA 5D7LA 4MNHA 4I1NB 4P2OA 3L3GB 1VHPA 5I73B 1MFEL 1U3HA 5FOJA 3WJLA 1XR8A 2IPKB 4MAYC 5I1EL 1CGYA 4BJLA 3QUXA 1Y18A 4WV1B 4FABH 1DQLH 1IT9L 1QUNA 2HFTA 3JVGC 2X9YA 1BBDH 5JPNB 3JWDL 4NUJB 4JZJB 3CAFA 4UOW1 3QUYB 3TIDB 1N4XL 3GI8L 4JHWH 4LSQH 4XBGA 3Q5YA 3SPVB 2BVOA 1JYWA 3QXVA 2QHRL 2D7OA 2R0WH 1A9BB 5EZLA 1AGFA 4KDTA 5ISZA 3DTXA 3TBVA 5IB2B 1PQZB 2JJTA 3R1GL 5T5FH 1EMTH 5H8DA 1L0QA 4HC1L 2XQBH 3MGOB 5DD6A 5GGRA 4TSCH 3O41B 1RU9L 3HFML 3IFLL 3PHOA 4XC3H 3SO3C 2AJZB 3KR3H 4DUWA 4BUGA 3ARRA 1MIMH 4PJFF 1D5BA 3FOMA 1OAXH 1FFOB 5JIPA 4HLZG 1EBPA 3QFJB 3LD8C 3OF6D 1BVZA 4L3EB 3ZYJA 1EIBA 2ARJA 3IDXL 2PETA 3NCYS 2CLVB 3NN8A 5E5UB 4YXKH 2ILLA 3I9GH 5GGSA 3UC0H 1I3GH 1ZSDB 4N0CA 3QDGE 5IMLA 1QBMH 2EKSB 2XKSA 5GS2H 2VH5L 1C1EL 2V7NA 3OKMA 4NC1E 2VQ1A 3LKPA 1VGEH 5FYJH 1G0XA 1CGSH 4QRQB 1ZMYA 4ONFH 5B3NA 5C92A 5F1IA 3BZ4B 1MHCB 4OV6F 1AFVH 4M48L 2JTDA 25C8L 1NFDB 3AS0A 3F7VB 5M7QA 4Y5XB 3P9LB 4NNPH 5I18H 2X05A 4WGWB 3T77A 2C7UB 3BPLB 4YO0B 3HZYB 5CGYC 4XP9H 4LLYB 1DN0B 1I3UA 5J56B 5L0QB 2YD4A 4OQTH 4U1LB 3VFNB 4AT6A 1PY4A 4WU5A 3X3FL 1DDHB 3VRJB 1J8HE 1I1AB 4PS4H 1NGXA 2BOCA 3ELAT 3EO0A 1BAFL 5ALCH 2D0GA 4PJ7A 4PUBH 4Z8FH 5GGVH 4YR6A 4TVPD 1IEBA 2YD2A 3NIDE 3O3BB 4LF3B 1RJCA 2NY2C 4H20L 5DD1H 1F4HA 5B38A 1VPOL 1FPTH 2WLYA 4OGYL 2NW2B 4Y5YA 1P9MA 3ZTJH 4NM4H 5CEYA 3RA7H 3BP7B 1CLYL 3LV3A 1YDPB 1OSZB 3QULB 5DK2A 2JIXA 1WJ3A 4JFQA 5D8JL 1RFDH 3OGCB 1HINH 1J18A 1CT8B 3C9NB 5HDBF 1AGBB 1KTKE 4TULH 2W9DL 4ZFGH 5AD0A 4X6CF 4ELMF 6FABH 3MNVA 5D1QA 5L8LB 1FNEB 4R96A 3QULA 5DEZA 3EZJB 3KDMB 4LSPH 5IHZB 1AP2B 1WCBB 3NH7L 1ZHNB 4ZFZB 2NW2A 1ZWIA 3ISWA 4G8GA 2BOBA 4WW2F 2EO9A 1JFQH 1EFQA 3ESUF 1GC1H 4MXWL 3UBXB 2FX9L 2Y36H 2R1XA 3W9DA 2VLKA 5E2VL 4ETYA 5DD5L 4BK5A 3EO0B 1MHPL 1RSFA 1QZ1A 4Y8DC 4LSRH 1X44A 3MROA 3LEVL 3AXLB 1J1OH 4M1CD 4N8CH 4UV7H 5DQDL 4XT1C 3VFNA 3DVIA 3CFJA 4G5ZL 5CZXD 2CR6A 1UM5H 4PBWD 1JYXA 1R3IL 4LCCC 4Z95L 5TH2A 1CDUA 1DBAL 3HZYA 2C7UA 3T77B 5C6PB 3SE3C 3LKRB 3OPZL 4K7PX 4P57B 4ZDHA 4HAGA 5IEKA 5C0EB 1E4XL 4KKBD 5L8KB 4GQ9L 4HS8L 4DEPB 3V4VH 1MHCA 3MRIB 4Z7UB 5F7YC 5DURD 1DLFH 2I9TA 4QRQA 3ALPA 5HPMA 3MRLA 1BQHG 1LK2A 1BFTA 1WFNA 2VQ1B 4HHAB 5C6WH 3CU1A 4FFYL 1BIHA 1INDL 4PBVC 3V9FA 3L3IA 3G5XB 3C87A 4AIXA 4PY8I 3W81A 5DT1L 1MCLA 5B4MD 1I9RH 2V2WB 2RBLA 1W0VB 1L7TH 4HS3A 2VLRE 5DZLA 1A2YA 3D9AH 3EOTH 2ARJB 4QT5A 5DK0A 2HFGH 2YBRB 2E9JA 4DCQA 1OCWH 4PJEA 4UAOB 3GMNA 2ZSVA 3MRRA 1IEAB 3FOMB 4TNWF 4U2YA 3ZT5A 4QXWA 4Y4HB 3D2UD 3OTTA 1J5OL 1E27A 4QRRB 5A3IC 3IAGC 1I8LC 3PHOB 3CH1A 2YSSA 2X41A 3QXDA 4S1SL 3SKJH 3PGDA 4GW5A 4OLXH 4QWWC 1FL5B 3VI4E 2IALA 3WIHA 5AWNH 3O0RL 5F1SA 2PKDA 3IAPA 5IB2A 1TPXC 1VFMA 2BSTB 4LQFL 2BNQE 1X7QA 2A74A 3P0YH 4N0UA 1AGFB 1C5CH 1H15A 1AGDB 4UIKH 5GZOC 2X4QB 4HDIA 1P5UA 2HT2C 1BVLA 4HJ0D 4L3CA 4MSWA 2HP4A 4QF1A 4YUEL 5KS9F 1S7VA 4JKWA 3F5WA 4N1CA 3FQTB 2JCCB 2ICES 1DEEA 4KJQC 5AG8A 2DM4A 4FG6C 3RWHA 3O4LD 1AC6A 5L8JB 1N64H 1RMFL 3HB3D 3W11D 1GC1C 3TN0C 3L7FA 2BHYA 4R0LA 4BQ9A 5DZOA 3DV6A 3EYOA 3IDYB 1T0NB 3CDCA 3MCLL 1PW3A 3KJ6H 1XGPA 1A14L 4JPKL 1M6OB 1GGCH 5KTEL 3GEWB 2I27N 2OK0L 1YPZB 4K8RD 4QRRD 5BS0A 1E4XI 1QG3A 4S1QL 5D6CB 5I1IL 5HGHB 1N4XH 5IFAH 4LVEA 1TVBA 4POZC 2VLJE 5DMKB 5E6IC 3MRDB 4KRPD 8CGTA 4PJBE 3AMLA 1FH5H 4NQCE 1X4ZA 4TQEL 2NY3D 4P2OC 3E6FA 4OZIF 1QHOA 3WE6B 4CADB 3KPRB 4FQ2L 4PRAB 2ITCB 3B6SA 5A3ID 4R4ND 4KRMB 4JO2L 3S37X 1IGIH 2V6HA 4NRZA 2CK0H 4DW2H 2NY4D 4K3EL 4J3UA 2R56H 3QDGD 4J4PD 3BXNA 5BJTA 3Q3GA 1QRNE 5IROA 3DOSA 3VG9B 1T6VN 4LOUD 1ZANL 4P99A 2MOVA 4TNVF 4YXKL 5C0JB 4NO0A 4WU7A 2CIKA 1F90L 1MSPA 2EZ0D 4PTTB 2ADIA 4JGUA 3TYFB 4ENEC 4POUB 4P46B 2NXZC 4XP6H 1E4KA 4KKBC 3BJLA 4JY4B 5K9JL 1RUQH 3BPNC 3BE1L 4OZFB 4JZOB 2P44B 3QDHA 4KVCH 2Q8AH 4XCYB 5D2LE 1S7WB 2GT9A 3U7AA 5HYJD 3CK0L 3WN5A 1PDKA 3LH2H 3QEHA 2ZOLA 3S5LG 1LK3H 3VFSA 4LCYA 4XWOC 3RWEA 4HZLB 1LO3H 4KH2A 1VGKB 2BVTA 3F7YA 5I16B 5KG9A 1MCWM 3MACH 5HI4D 1I3VA 4IDLA 2HFFB 2X4NB 3ZZ1A 3BQUC 1FNGA 4LLDA 3NA9H 5BMFL 1DFBH 1F2QA 5I30L 1SYSB 5F3BB 4RMQA 5FA4B 3TBSB 1KTLA 4KJPC 4N68A 1CXIA 1CN4A 1CR9H 4ZQKB 2N7BA 2NTFA 2BHZA 5FGCB 3L3DA 4N8VG 3EGSB 4PGCB 5DJ2B 5GGTA 1KBGH 4IJ3C 5GGQL 1MLCA 3U0WH 3LZFH 1I3GL 1H3TA 3T0EB 3MBEB 3O81A 5E03A 2VDRH 1A7OH 5MENE 4WI6A 1ZLSH 4P5TA 3IFPA 5D5MA 5I75C 1DLHA 4QHKI 1TNNA 1QFWM 1D5MA 3QDJA 4JY5L 5DRXA 1T1ZA 5JW4Q 1FVEB 2BVPA 1XIWC 4U4BA 1YMHA 2Z35B 3RJDA 4M7LL 3SE9H 2FH6A 3TBSA 3N9GL 5H2BA 3BN3B 3ARFC 4UILH 3T2NH 4NJAH 2J8UB 3DGGB 2P5WD 2L0DA 1QLEL 5KG9B 5F1OB 2AJXL 4R90L 5ICYB 4JAMB 4HZLA 5T1DL 4R9HA 4K8RC 4Y16A 4DKFH 4OCWH 2ZOLB 2IMMA 3K74B 3RL2A 5DQDH 1J1PH 1RJYA 1NCWH 2BFVH 4O58L 2GT9B 5FV2A 3G04A 4O2CB 4XCYA 5TPWH 5EPMB 1ZTXH 1ZK9A 4L5FH 3O6FD 5E6ZA 2AJSH 1FLTX 1IGCH 2V9QA 4UB0L 3AM8A 3T0ED 1WISA 2EC9T 1VFBA 1GPOH 1T04A 4PRNB 4AEIL 2R8SH 1WITA 2AJYL 4FQIH 5MI0B 1QYGL 2WP3T 4YDLB 1PVHA 1KEGL 3QNXA 4PG2C 2R69H 2NNAA 3VGGA 1NC2B 2EDDA 4YHMH 4LVOB 6FABL 1N2RB 1P2CA 3IDJA 4H0IA 3H7LA 1A7QH 3ZE2E 4BM7A 5EOTA 5C0CE 1OARH 4WNQA 4XCEA 5DMYA 3MCKB 3QO1A 4NRXB 3I50L 2CKBH 2G60H 4PP1D 3NA4A 4JN2A 5D2NA 3ZDXF 4AM0B 5IROC 2AJVL 4AG4H 4YHNA 1UB5A 1X5JA 3B6SB 2MWCA 3O6KH 1CE1H 5ANMA 3IDIA 3WE6A 4Q6YA 4PP8C 1FFQA 1UKQA 1GSMA 4I4WA 2VAJA 2P1YA 3LEVH 4I8DA 5T5NF 3EJZC 4RFEB 3WL9B 5LVEA 3ZMRA 5M94B 1XR9B 3IJYB 3CMOL 1GCFA 3TJHC 3UTTD 4ZUVB 3TBTB 4WEBL 1BWMA 3OPZH 3P30L 5IW6B 5JMRA 5I8CA 4ZPTB 3V0WH 5I17B 3FT4A 4HBQA 1Z9LA 3GJFA 5HI5D 2JE8A 5DHYB 5C08B 2HJKB 3HUJB 5IVZA 3LEYH 2J12B 2COQA 3QIWD 1J88A 4IOFD 5FYLH 3SO3B 4KXZI 4R0LB 3GBML 4V2CB 2A83A 1OF2B 3E6HA 2OCFD 4DOHB 4Q0XL 2P5ED 1XGQA 2CKBA 4YHIA 4L4VB 1RUKL 4LCCB 3WSQH 1QBLH 1TZIB 2A38A 5GS1C 2H9GA 5C0AD 2HN7B 4K3DL 3D0LB 1ACZA 3KJ6L 3PDGA 4JGJA 4XPBH 5DURB 2X4UA 3MJ8A 4S11A 4XNQA 5I2IA 4H26B 4HDIB 2ICEB 3QWOB 1H15B 1B0RA 4HZAA 3LQAH 4DK3A 1X6NA 2X4RB 3QPXL 4HCRH 2XN9B 3EDDA 4UZGA 3PGDB 2X1QA 4GW5B 1U92B 2FD6L 4NQXB 3RL1A 2IAMB 2Z8SA 4X99A 1EZVY 1BPVA 5EU6E 4NOBA 4U7MA 1UKTA 4CMMA 3ARBC 2CDGB 1LO0H 1UH2A 1MAKA 5DMIH 1J8HD 4PJ8A 4M93B 2YN5A 4U1GB 1Q0XL 1KJVB 2LFGA 5SV3A 4DCQB 3SOBL 4TTDD 3HPJB 2QQKL 1SJEA 1OW0A 4HS3B 1MREL 3E2HB 3MV9D 4MX7B 4QXGH 3SDYL 5L2KD 1FFRA 2BMKA 4XTRD 5HGAA 3P4NA 1FLRL 4BSWB 4R2GC 4N0RA 1YYLH 4FXLA 4OUUB 3UBXG 2KQNA 1JTTA 1K5NB 2VTFA 3HG1A 5DJ6B 3QUYC 1F3DH 1LK2B 5JA9A 5HPMB 4O4YL 3IXTB 4RNRA 1JNJA 2VJXA 1HH9B 5CP7B 1K6QL 1T22B 4ETQA 5IOPA 3C6LC 2DTSA 5HHNA 2ZUWA 3AM8C 3FT2A 5T1KD 5DJDA 3KPSE 1BFVH 4P5KA 3LKRA 5D7SL 1R6VA 4IS6B 4OGAC 5IUSA 4MDIA 2GK0A 4JRXE 2CRYA 3RY6C 3UTPE 5C08E 1QHPA 3VGAC 1BQHA 1BHGA 1V7NH 1RHFA 1TITA 3KPOA 5D7JC 4GO6B 4WFGE 3EO9L 1YQ2A 3VW3L 4JY6A 5KN5B 3MACL 2OL3L 3HC4H 3BW9B 3PWPD 5KZCD 4JO2H 4C59B 5E6ID 3EDEA 1ZWIB 4JFYA 5FYJU 1EFXD 5I9QB 2CRZA 1F42A 3O9WC 5KVEH 1N5AB 3EDKA 1K9TA 4KZEL 4WI9A 2O93L 5D1QB 4E41D 4QRUA 3B2UD 4ZSOB 4PIRF 4F7EB 3LB6D 1AGCB 4LRIA 4MNGB 5DUBA 5I8EB 5HDQH 3CLFL 4CVUA 4KVNL 1QSFD 3LV3B 5JHLL 4EN3A 3D69B 3RVWC 5IBTL 1I8KA 3KYMB 3UTOA 1D9KC 1O5DT 1I9IL 2VUOA 1NEZA 2R0LL 4M7ZC 1CS6A 4NBZB 3FQXA 4OF5A 2RIKA 1BOGB 3F6LA 4G9DB 5MENA 3LEXA 4XPHL 1ZS8A 2HTLD 1XGRA 1NFIA 1YEDB 4YC2B 1L9MA 5CEXA 2DQHH 4NQVA 1FGVL 4C58B 1FBIH 2VXQH 5J6HB 4O2EB 4Y1AE 2R1WB 1SMAA 3REVB 3ARFD 5JUEH 1XF5A 2FJFA 1KN4H 1FAIH 1HIML 3L3HB 6CGTA 1FZJA 3HI5H 4WEUD 3RWGA 3BPNB 1CR9L 4AH2B 5HVHB 4E41B 2JELH 5E5MB 4JG1L 5DYOA 4WUUB 3VJ6B 5IESL 2PNDA 5MP6L 3W9EB 2D9CA 4HC1A 1CTOA 1MJ7L 3QDJD 4Z0BH 3GDBA 5E5RB 3KPQA 1JRHH 3VD5A 2EEAA 3OXSB 5F88B 3OKMB 2O5XH 3IDNA 1S9YA 1KGCE 1NEUA 5C0CD 3DNKA 4U1MB 5IMLB 5LXGL 1UJ3B 9CGTA 3T0EC 3FONB 4PJXB 3KXFB 3FO1A 3WFBL 4I3SH 1H5BA 3DIFA 1RJZB 1EH9A 4JQIH 4M7KL 3WHE0 3JUYA 4IOIA 5ITBL 1RZGB 4GH7B 4FQ1H 3E1F1 4OFVA 5HI5C 4UBDD 2VDLL 1BM3L 3VXSA 5EU4B 3VWJD 1N6UA 2GITB 1EHLL 4OTXL 1HSAA 1QD0A 5J13B 1NQBA 1WT5C 5DD6B 5T1DH 1QRNA 2F8OA 5IQ9B 1P7KB 4XVJL 1PQZA 1QSEE 1WZMA 4YXHL 1NGWA 3WCYA 5FKPA 3KWWB 4XP5L 4BK4A 4HQQL 5FB8B 1A9BA 1HNFA 4WUUD 1N59B 4FQQA 2GAZB 1DUZA 3SPVA 2V17H 4MS8A 4YZFF 2VH5H 4W6WB 5ICXB 1IE5A 3VXOA 1AKJB 3RIFK 2HG5A 3W11C 5FYJL 1MRDH 1S7XB 5GHWH 1CGSL 3GSXB 3QI9D 5C0RH 4QKXB 3HTLX 4OQ1A 1RZJL 4XBPA 2E9IA 2OBGA 5C0AE 2IPKA 4YHML 1GIGH 4JRYB 4PD4K 3W0WD 3OF6A 5D7LB 2VLJA 3CUPA 3L3OB 1JGDA 4PJAF 5EO9A 3RWDB 1NL0H 3T3PF 5BV7L 5DFVD 2Z8WC 4EEEA 2CD0A 5CAYB 3PJSA 4WHTA 1IBGL 2OTUB 3RWCA 5D6DA 5T1KA 4L4TB 1GZPA 3GBLA 4JB9H 5HHPB 5HYFA 2EE2A 1RHHA 5KSAD 2EIEA 2JLLA 3SY0B 3I6GA 3NFNB 2R2BB 1QTYT 3C5JA 4CVXB 3M45A 4YHYB 4BH7B 3D85D 4IRJB 5IW1A 4HD9A 4WWKA 5C70A 2F54E 1LEIA 5F7DA 2F58L 4Y4FA 5C09D 5KS9B 3ULVC 4PJ5D 1J10A 5F71A 3QAZB 4N0UE 5DJYA 2CXKA 4Z7VB 2AV7A 2VDOH 4PJXE 5LCVL 1ZVSA 2SEBA 3WIIH 3KLSA 4N5EA 2FX8L 3LN5A 4MJIE 4O51A 3MLXL 3H0TB 3MREA 4EXKA 1PJ9A 1S3KL 5LGJA 4MJ5A 1MY7A 2FHFA 1GXEA 1YNKH 2QADD 3ZE2F 4XZUA 1MI5B 3KPSD 3SDDD 5LQBH 1BVKB 5IVXE 1B2WL 4LU5H 4KY1H 4DGIH 2A6KB 3QWRD 1L0XA 4JO4H 2Q3AA 3WUWA 5C08D 3N50A 3QUMH 1KJ2H 3LRHA 3KYOA 4ACPA 4YGVB 3VXRB 5DD3L 3K3QA 1P4LB 1FZMB 4S1RL 4S0TD 2BJML 3I3EA 3S37L 4I2XB 1HHHA 1MF2L 3QPXH 2F9BT 4NKMB 3GSUA 5C1MB 4H88L 5I0ZA 3DV4A 2G2RB 5KVGL 3KXFE 3K0WA 3V6BR 2I5YL 3IDMB 1OOAA 3T4AB 4R8WL 3BZFA 4CKVX 1YN7B 4G3YH 5F9JA 1R24A 4EDXB 1CFSB 4X7SL 2WV3A 5CILL 4MQXD 2FBOJ 4FFYH 1NAMH 1UCBL 1JV5A 4PTUB 1INDH 3WO4B 4YHZL 5FM5O 4LBEA 1YEFL 5IJKA 5T3ZH 2PCPB 1BP3B 1MREH 3VXUB 5I75B 4JFFB 1JNLL 5ESAA 1A3LL 2HFEA 1R5IA 1EAPB 3WIHL 1ZE3C 3ZLQC 1ZLUK 1ORQB 2MPAH 5FOBA 3O2DL 2XN9D 1WZ1H 5DGRA 3CX5J 5IBLC 3FQRB 3BP4B 3H7BA 4HEPG 3G6DL 3GBNH 4DGVL 4KUCF 5SWQA 1S7RA 3K8MA 5CEZD 2DBJA 4I3RL 4X9GA 1A9EB 4IM8A 3VH8G 2WQRA 5AZEL 1R3LA 5B3JE 4HAFA 1AXSA 4UIKL 4EI5D 3NAAL 1EHXA 1W0WB 1OAQH 4RMTA 1T89A 3HCVB 3R06B 3DARA 4Q9RL 5FUOH 1LEGB 2QEJA 1RZKL 2UZXB 4PJDF 3HS0B 5JZ7C 3LMJL 3NFPB 4KK8D 3MJ9A 1AQDA 1Z0NA 1F00I 4M5ZH 3SDAB 2XIDA 5HYEA 3CFDA 4RQQA 4NQEA 5DZNA 5EFIB 3MGTA 1SBSH 2PYFA 4JFED 4PRPA 5DJ8B 4MQ7B 3AB0C 3UROR 1AJ7L 4C83B 2ADJA 1NUFA 3OZ9H 3SGJA 2AV1A 3CLEH 5C6TL 1WBZB 5A43C 5DDHB 3NFSH 4MZ3A 1UGNA 3MRQB 2WWMC 5INDA 4GAYB 4ODWA 3KPNB 4BKLA 4U1SA 3RKPA 4OLVH 3MV8B 4U1SB 1JMZA 2IAMC 3KPNA 3MYJB 5EBMB 3V6FA 3V7AG 3S36X 1HKFA 4ALAH 3PHQA 2NLJA 4WI4A 1NLDL 2FIKA 4GAYA 1H8SA 4X6FB 2Y6SD 3C60C 2WINB 2O61A 3S3PA 4RFOH 4LGSB 3JV5A 2QLVB 3CCHA 1HN1A 4M93C 4ZPVB 5DFWH 4U6TA 3I6LE 3NACH 4JHBA 3CD4A 1EGJA 1JVKA 2N1KA 2ZJSH 2F53E 4GRLA 2XA8H 5BXFA 1AD0A 4WI7A 32C2B 3F12B 5IF0A 3C5SA 4MD4B 4DW2L 3HPLB 1DFBL 1NCDH 4HKJA 3RZWA 1TCRA 5CBEB 1B0GB 4AENA 1E6JL 1YECL 1EZVX 4KKLC 5I1JL 1OWWA 1KELH 1MCNA 1KCRH 3M1BA 3BPCA 5GRYA 4E0RB 3DX7A 4X8JA 2BSED 4D0CB 3G5YB 3SDCA 4LP5A 4IRSB 2EZ0C 2QQNL 5C0RL 1UH4A 3BE1H 3TN0D 1QR1A 1KNOA 4X4YB 3KAAA 1FSKB 3QEGH 4JQIL 4JVUA 3TJHA 5LBSH 4IHOA 3GZKA 4KHXL 4NNYB 4U6YA 3GO1L 5EUOE 4BZ2H 1R5IB 3NZ8B 3MOQA 5HVWA 4QCIA 2EYRB 4EUPG 1MRCL 5I66A 4QRSB 1KOAA 4GRWF 4XXCA 4TTGA 2IH1B 4RIRB 2OXHA 3HE7B 3VGDA 3WXWL 1NANH 3V0VA 1Q9LB 2WP3O 2VLRB 3WNLA 1A02N 4JPVL 2F54D 4MQSB 1J86A 5C0GB 3A6BL 4NT6A 1GAFL 4KTDH 2D7TL 4F7PB 1PD6A 5F9JB 1Z3GL 2CRIA 4YHKL 1YN7A 3UTPD 3W5MA 1F4YL 2E27L 1N6QH 5KOMC 2IPUG 2NY3C 2GSGB 1ZT7B 2R0ZL 3HRPA 1Z0MA 4U1KA 3MTRA 4NZRH 3S7GA 4MA7L 1KEGH 2XFXB 4PY8J 3T0WA 1CU4L 4ZXBA 2ATPB 4QHMA 4DZ8B 2X4TA 2R23B 3T0VA 1MJUH 4LSTH 3FB8B 4YBQD 1AY1H 4JR9H 5EU3A 1OPGL 1OQXA 2GUOA 1S7TB 5GS1B 2DMBA 1WZKA 2A1WL 2IBGA 4HMCA 1MVUA 4LSVH 5I1GH 4XZUB 4U49A 2OP4L 2OR7A 1J05B 2JCCE 5LGJB 3G6JF 3U6RB 2GSIA 5AUMB 4X5WB 2A2QT 1MHHB 3QNYA 2SEBB 3GKWL 2GY7B 2DQJH 4HJJL 2YD9A 2D2OA 4OT1H 5TQ2H 1MHEB 3KLHC 2PXYC 2ADFL 1IM3A 4Z7NE 4KTEL 4HFWB 3O6LL 3ZL4H 1LP9A 2JJUA 3DYMA 4NPYB 5IW1B 2WMPA 2DRUA 2ICWA 4Q97A 2MNUA 1NMAL 4JFPA 2HA1A 1D6VH 4NQCB 3TBWA 5JXAH 2IJ0C 3V95A 2C5DC 4PRBB 4UQ2A 4FZ8H 3C6LD 1VADA 1P4BL 4NIKB 1JF6A 3X3GH 5DJAA 3L5WB 4RGNB 3LS5H 4FFWD 3U79A 1I8IB 3ZT6A 3DURB 1T80A 4XCFL 4M6AA 5ADOL 4PR5B 4ODTH 4M61A 1U3HC 3WJLC 3CUPB 5LQBL 2B7DT 1EXUA 3KPPA 4TRPH 2JJVA 4CVZB 5KVDH 5HHOA 1BF8A 3B8SA 1DQML 1SMOA 1VENA 4EIZC 2F74A 2EIZB 5H37H 3HNTH 1AKJA 3PGFH 1F3DJ 5C07A 2YPLE 4NM8H 5B39A 1AO7B 1DL7L 1DUZB 5E8DH 4FQQB 2B0SL 1UXWA 4G6FB 3RWFA 1XGYH 3AY4C 5HVHC 1TLKA 2AXFB 5IGXH 1FSKC 3MNWB 4P4KA 4UAOC 1Q0XH 3VFUA 1J1XL 3RX8A 1G7PB 4D0BB 4KQ3H 3B9KA 4LHJB 3Q6GH 3W2DL 2G5RA 3LMJH 3TGXA 5LAXB 2PTTA 4MA3B 1UQSA 3VXSB 4X4MA 2VL5B 1GZQB 3FB7B 4Y0GA 1B9ZA 1YEGH 3UJJL 5HGBB 3DVNA 4MD0A 1CD1A 5EIQA 5I1EH 2H2SC 1WEJH 3GHBL 4IOIB 5HD8C 1YEIL 5TJWK 3LB6C 3SDXA 3BVNB 3NCYP 4XPBL 3MV9B 2IANA 3CFCL 3VG9C 1G0DA 4TSAH 5BV7B 4ZAKC 1FDLH 3G6DH 3FO9A 4U1MA 1LO5A 2JB6B 3JWDC 3I6LD 5SX4H 2DN7A 1T20B 1DZBA 4HIXL 3LRSB 1G84A 4WUUA 3VJ6A 1T5WA 2Z8VC 3MA7B 3QCTH 5E5MA 3DUSB 3S35X 1YN6A 4WTXA 1DR9A 3C2AH 3HC0A 1FZJB 1ZOXA 1HCFX 4AQOA 2OMBA 2VXUL 1EEZB 4E42A 4YIQB 5I1CL 1IAMA 1ZA6B 3WLWD 4WI2A 4P9HH 1F11A 5HYIA 5JORA 4O2EA 1SEQL 1KJ3H 3SGDH 1J0JA 2VDKH 4AMKH 4JPIA 4K3JH 3U7WL 3DI2B 5D7IB 1CE6A 5C7XL 5F7MC 4NQVB 1ZS8B 2AERT 1JWUA 3STLA 1MCCA 5C09E 5JHDA 1J0YA 3BKJH 3CLEL 2NY6C 5C6TH 1M7XA 5F1NA 3NFSL 3AB0B 1ZT1B 4R26L 2MCPL 2FEEL 2C3HA 3QUKA 3JBG7 5BZDB 4MNGA 5DUBB 2ZNWA 4Y5VB 5I8EA 2C3GA 3X12B 3BWUC 1KPUB 5E2WL 2AXGA 1BIIB 4TNVK 2VSCA 4H1LG 2R0LH 4RCAA 3VGEA 5L88L 5ADPH 3RP1A 1I7ZA 1BFOB 3BEWA 4RGNE 3IFNL 3GJEA 1CG9A 2F8XC 3WIFB 2G5BB 2R4SL 4YDJA 5I19L 4GBXD 3O3DA 4JKKA 5D72L 1FO0B 3ORJA 3QBTB 3PG2A 4RMUA 1T7ZA 4P46C 5K9OA 1CF8H 4HIJA 1BAFH 4XNXL 4JY6B 5IVXF 5CJOL 1G6RA 3L95A 4YFLF 2DL2A 4HUVB 3VMOA 2HRPH 4N0FB 4YX2L 3TJEL 1JPGA 3SKOB 2DQTL 4PV8B 3UTTB 3SE8L 2P49B 3OXRA 1F02I 1CDBA 4NYLB 4LP4A 4NP4L 3HZVA 2JCCF 4PJ7F 3DXAB 3CLFH 4IS6A 5I1AB 3TIEB 1TMCA 4NYLA 5J12C 3PWJB 4X6CA 1AXTL 5BRZE 3FT2B 4X0KB 3SKOA 5CP7A 2DIBA 4YPGB 4RNRB 4PJGA 5EOCL 5D2NE 5DVLA 5KVMC 1IL1A 3RGVA 4GAFB 3QUZA 4KZDL 1UB6A 2MQCA 4BSWA 2XI9A 1RIVH 2ESVB 2AJ3B 2UYLB 5IJVA 4U6HA 4WFFE 1IILE 2FX9H 1NAKL 4PJFB 3WIFA 2ARWA 3HR6A 4EBQL 1CG9B 4ZOEA 1T1XA 4XP1H 1NMBL 5JO5A 4UTBH 1GAFH 4KTDL 5FK9A 4HWBL 1UM5L 2PTUA 3QEUB 4YWGL 1A6AA 4IIQA 2V17L 1P6AB 4Y5VA 3GIZH 1H8NA 1UZ8A 1RD6A 3GHEL 1ZHBA 2IAMD 1JBJA 1CLYH 3RL1B 2FHBA 4FQHA 4LVHB 3L5XL 5JOEA 4QNPE 1ZT1A 1CFVL 2AEPH 2X4RA 2W9LA 2PW1A 4Y7MA 1HKLH 1T66C 2UWEA 2DOCA 4X4ME 1DQQA 1A4KA 2PYEA 2ICEA 1FV1B 3CGTA 5FHAH 3N85L 4J6RL 2VERN 3LQMA 3QRGL 4F8QA 3JV0A 1VCAA 2NY1C 5D7JA 3TZVD 1CK0L 3D0LA 1YEEH 3CDFA 4NC0B 5E2TH 4JG0H 4LCCA 4JKLA 4L4VA 1TVHA 5JORB 3MLVL 5I73C 3OKOA 3SE3A 3DSFH 1LE5B 3O6FA 4MHHI 3BWAB 5FGCE 4GSDL 4BZYA 5FYJD 4UT9L 3UJTH 4LEXL 4P4KD 2IFFH 2DBLL 4Y8AA 1QSZA 3UAJD 2VSDA 4O2FA 1DBKL 1T5WB 5I17A 3VU2A 2EH8L 1DBMH 5IEHB 5I8CB 4G5ZH 2H32A 3VG0H 4JM4H 4D9RE 1UA6H 5DUML 2LU7A 3JV6B 2FEDD 1EX0A 2BC4A 4LLQB 4WJ5A 1CD8A 1G0YR 4L4TD 3ZE0E 3GSRB 1JCKA 1BQSA 1I1CA 2VXTH 3DWTA 4GXVL 1M7DB 3GNMH 4X6CE 4OCXL 1F6FB 4RFEA 1MEXH 1EVTC 3QXWA 5C0FB 4I4WB 1NMAH 3TFKC 4KK6D 4N1HB 1CGXA 2HLAB 4OZGF 1MNUL 4WO4C 5ANMB 1KG0B 4KPHH 2R29L 3MJ9L 3QXAA 4YHNB 4MA1B 5D2NC 1P7QB 2I60H 4OM0H 5CBAB 5IB4A 4JFDD 3BYTA 3WS3B 4KUZL 5F70A 5EOTB 5B4MC 5F9WB 1S9VA 4TPRL 5KVFL 1FN4B 2KKQA 3BPLC 5CUSH 4JPKH 4P4KB 2EDQA 4KV5E 3NTCL 3RWFB 3MA9L 1MI5D 3B9KC 3QNXB 4S1RH 1II4E 2AGJH 4JN1H 1XF2A 2P7TA 4PRNA 3TCLA 5B39B 1VFBB 3IXAA 3PGFL 3X13B 4OFYD 4N0YH 3GSNH 4HPOH 2F74B 5F3HA 4PP2A 2VYRE 3QIUA 1YNTA 4NKIL 1LDPH 5EPMA 3IFOA 5GZNC 1CXLA 4G3YL 5I1KL 4ZTPH 5CD5C 4JQVC 1RJYB 4K9EH 2FATL 3WJJA 3RL2B 2BNRD 1PKQE 5EORL 2C3XA 2H1PL 4O5LL 2N7AA 5ICYA 5DJZA 1KJMB 4W68A 4YBLB 4X9FA 2A6IA 3QA3A 1QFWL 2EE6A 4LKXA 4EDWH 5EIVA 4P2RB 3SGEI 5CIPH 4HIIB 3VFMA 1R0AH 2XWJB 4PRHB 2YHGA 5H2BB 1W72H 5DJAB 4X6BB 3U83A 1NBYB 2MPAL 4MMZC 2Z35A 1KXTB 4GLRI 3HI6H 4NQCA 1FVEA 2DJSA 5BVPH 3QIUD 1ED3A 1GGCL 3QDJB 3S96A 3ZKND 1D5MB 3LHPH 4QTIL 2OK0H 1A6VL 4LCWA 4M8QA 2V5MA 3IFPB 1T4KB 1MFAH 3QYCA 1FDLL 4PJCA 3FN0H 3INUL 3FRPA 1XF3A 4NPYA 1OAUL 2ADGB 1BD2D 5FF6B 4ODXA 1IM3B 2QKIB 4NWUL 1WGOA 3WEXA 1V5JA 5ADPL 4UIMB 5D1XA 1FZKA 4FXGA 2J5LC 3L3DB 4NN6B 2NTFB 1IM9D 4WRLA 2NZIA 4P2CG 5CZXC 1F13A 5I1HH 5FA4A 4LLMA 3SDCC 1WWBX 4NHCH 5D7KE 2VXUH 3ROLB 2AQ3A 2GSIB 4Y2DD 1FNGB 4FP8L 5JHDD 4EXPX 4XC1H 1GGIH 1JNLH 1SY6A 4PB0L 4Y16C 4I18A 2GUOB 1X3DA 4ZS6D 1D9KD 2WBKA 3ARGD 2BNQA 2X4TB 5AYUH 3V5DB 1CLCA 1KIUA 1ZHKB 1QKZH 3QFJD 3LS4L 1BOYA 1H3PL 5D70H 4TUJA 2DQTH 4PJHF 3VXMA 3BESR 4JO3H 4OSUL 4OZFA 1I9JH 3RY6A 3T4YA 3BKYL 2HVJB 5IHUH 3HE7D 2FYYB 4KKNA 4XP6L 1A6UL 4YC2C 1VKXA 3ETBF 2E8ZA 2GSGA 2VUYA 5K9JH 4P46A 2VZUA 5SWSE 3MRMA 1JUFB 4GKNA 1KTDA 1BQLL 5HHVL 3S34H 1CLZL 1EHAA 3SBWC 5E8PB 5H37G 1JNNH 5C2UB 2I26N 4KDWA 4NQDE 5B38G 1BJ1H 5EC2A 1HQ4B 2H8PA 2DKMA 2VLRA 3WFCH 3BGFB 3I02A 3UPCA 4O00A 3BXNB 3V0VB 3FQUB 4CN6A 5HHOE 4S1DD 2P5EA 3KHOA 4LPUA 5I66B 1OGAA 4P2QB 5JZ7D 4URTB 4U6YB 4NNYA 2YA0A 1EO7A 5FCSH 4LSSH 4M00A 4HXAH 5DTFB 3ARGB 1ACYL 2NY5H 1YEHH 4UT7H 1QR1B 4QRPA 2RCSL 3ULVL 4ZSOE 2WWKT 2WK2A 1FGNL 4GBXC 4FQJH 1FHGA 5EWIL 2I07B 5E0QA 2QQNH 2E6PA 3EYVA 4NZTL 7CGTA 4E0RA 2ENYA 43CAA 2FX7L 1U3YA 1YPZA 1NANI 3DPBA 3WJJC 3VXQB 3MO1A 1JE6A 1FFPB 4GBXB 2XG5A 2VLKE 3D39D 4U1IA 3FB6A 5T5FL 1K8DA 4DTGL 5D4QA 4PRDA 3EYOB 3N9GH 1OARL 3VFTB 3OHXB 4UV4H 2L4OA 4FMFA 2Q86A 3ARDA 3MLVH 4PYGA 4M4RA 5IK3B 5MEQA 3CDGB 32C2A 4OZGB 2J4WH 3S8WA 4D9RD 3VXUE 5IIEA 4XAKD 3OAUL 3RWJB 2YPVH 4Z7NF 1OP3H 3CCHB 4J3SA 2YRLA 3BKCL 1FPTL 5CJXA 4KJPD 2D7PA 5C3LD 2AK4A 3JV4B 1MCEA 5L9DL 3MYJA 4MJ2A 2Q6WA 1FL5A 4UB0H 4WWID 2DMKA 2D03L 5BOPA 2VXTL 4BKLB 3GNML 3P4LA 4ODWB 2LABA 2CRMA 5FUCC 4YHYC 4LVNB 2X5PA 5IV2A 4M43H 4QRRA 4OZGA 5BS0D 1U8LB 3CDGA 4PJ7E 4JFDE 1Y6KR 4Y4HA 1P9MC 3MRJB 2D4FA 5DJ8A 1ZT4B 4X4XA 4QYOB 2ICCA 5DK0B 5FUZL 4NO2B 4RQQB 4FQXA 1A2YB 2OP4H 3CFDB 4HH9A 4ODBD 1FFPA 3MO1B 3SDAA 1N8ZA 1W0VA 4JJ5B 3MBXL 4DN3L 3DVFA 5EOCJ 1ZLUH 43CAB 1TIUA 3CC5A 3V8OA 4PS4L 3EYVB 4X6DF 3DROB 4P3DA 2DQJL 4HJJH 3MLSL 1KB9K 4KU1A 4LEOA 2CPCA 4RWYL 4NCC2 3QCVL 4FHBD 5L6YH 1HHKA 3B9VA 1ND0A 1A9EA 2EKJA 2XZAH 4YHOL 1KCLA 4P57A 4ZDHB 1MCRA 2NMSA 4R0LC 1S5IH 1U3ZA 1CBVH 1LO4L 2VLME 3E3QE 4ODUA 4ZUSA 2B20A 1S9XB 3CPLA 3H7BB 4PJ9B 3KPMA 3BP4A 4TULL 1S78C 1FNSL 2Y5TA 1BD2A 4PJIF 4IEFB 3W82A 4BQ6A 5FOBB 4G9FA 4CU6A 5C0AB 3LEYL 4CMHB 4RMVA 1CGWA 4Z7QE 4ZTOH 4X5XB 5DFVC 5ELIA 3S5LB 2PCPA 1I7UB 2HFGL 2FLBT 2EDTA 4LBEB 1WCBA 3MRMB 3MSPA 1Z9OA 3KDMA 2AK4E 1OTUC 3MLZH 2DQIL 3WFDL 1R24B 5JNYA 2G9HB 2BSRB 3T1WA 4OZHE 4QOKE 1NKRA 3BI9X 3QPQC 3L7EB 2BY1A 3DYOA 1IC7H 3GSOA 3V5DA 3DV4B 3MLRL 4KC3B 1QLRA 4WCYH 1UC6A 1KEMH 3K4DA 5AWNL 5D93C 4I2XA 5D7KD 5E8DL 2Q8BL 3OJDB 3BP7A 1FZMA 5JW4M 1C5CL 4OLEA 4HKBA 43C9A 3HZKA 4S0UC 3UTSB 2QR0A 3MQIA 5EUOF 2P5WE 3NMEA 3TESA 3IETB 5B38B 5DMIL 1VEMA 2A9MH 3C8KA 2XQYK 1T1YA 1NFDE 3O3BA 4LF3A 5I1HL 4LHUA 4APQD 2XWTA 4M1DL 4NHCL 4YAQB 3GKZA 1JTPA 5I74B 5J12B 1R3HA 4P59L 4KK5D 3QXTA 3KPRD 4AT6B 4MJ5B 1ROWA 4HT1L 2HH0L 1DANT 4ERSL 3H0TA 1IAIH 2C3VA 3AC0A 1DN0A 5FF6A 4Y2OA 3V7AE 4DGYH 1WEJL 3GHBH 1XF3B 4ZAKD 4W70A 5SWSD 4QHKJ 3C08L 4D9LL 2BNRB 4D8PB 3F7VA 2XRAL 4G80A 1TNMA 2W0FA 5KS9A 3VFOB 3BH9A 2OTWB 2C1OB 1WF5A 3BKYH 3LIZH 5HHMB 1KLUA 5L2JB 4O02L 4WWKB 1NBYA 3PXHA 4XWGH 4JDVA 5IMKA 2OI9C 5T33L 2VABA 3VFMB 1ZSDA 3SY0A 1KIQA 5HVFB 3RZCA 2P8PA 3KS0H 1F6AA 4ZXBC 1ZVYA 5JPMB 3O8XA 4MJIB 4L3EA 4NQDA 5FYJE 3DX9A 3T1FA 1JZ5A 2M26A 3GMLA 1NC4A 4OB5L 3KPLA 4P46D 1KJ3L 4G6ML 3OX8B 3D18A 4XB7A 1KC5L 1T21A 1WVZA 4K3JL 2I9LB 3U7WH 2NXYB 4NJ9L 2ED8A 5MHSE 1QVOB 1QFOA 5JXEC 3ULUC 4YDIL 2P7TB 4G9FE 3V4PL 4QEGA 5EU5A 4OD1H 4XGZA 5TE7L 2YD5A 3L9RA 1S7XA 12E8L 3CX2A 4HS6A 3RPIA 4Q58C 1AR1C 5F21B 3J8F7 3T2QA 1S9VB 2W07A 3E3QA 3TIDA 3V4UH 5E2WH 1OGAE 4JZJA 3WS3A 1EO8H 3L9RB 3DO3A 2P5EE 4P23C 4FFWC 3S34L 1NGWB 3A67L 4RDQG 1Y18B 1W8NA 5IQ9A 3ZDYF 5FXCH 1NCBL 4FQ2H 2NY4C 3OR7A 4CMHC 1KG0A 4A2LA 2GITA 1A8JH 3VGBA 5FHBH 2X4SA 1T21B 2DKSA 1ONQB 4LGRB 1XGUB 4MAYA 5ESQB 5KSAA 1S9WA 2ZCHH 1J11A 1L8JA 4OM1H 4B7LA 3DX9B 1C12A 3D0VA 3T1FB 4CUCA 1N0XL 4TOYL 3JV6A 4LSSL 3O8XB 4EKXA 1HDMB 1IGMH 1EJ6A 1L6ZA 5ICZA 2P8PB 1ITCA 1NBZB 3FO1B 1KIQB 3CFEB 1OTSC 1OP3K 3U0WL 3REWB 3CZJA 2Y07L 5HSFA 2HVKA 1EGJL 4YZFE 3KPQB 4HSQA 3S35L 4BZ1L 5HHMA 1AO7E 2OTWA 3S4SG 3P77A 5DYOB 2W0FB 4HFUL 2ZUQB 4HK3J 1D5IH 1KULA 2DB8A 4OBSA 4YH6A 4F57H 3IVKA 4GRLC 5F9OH 5HYQB 2MJWA 3FL7A 1DEDA 1JPSL 1FJ1A 1CL7H 4WUKH 4Z7UE 5CGMA 4K71B 1R3JA 3TT1L 1JYNA 5I19H 3VWKC 3KYNB 4OLUH 2H2PC 1FV1A 1PEWA 3HKFA 4JRXA 4PJ8D 2VWEC 5J6HA 3Q5OA 2UWEB 2IAND 1GYAA 4NUGH 3TT3L 3OAUH 1NFIB 3MLSH 3U9PL 4OCWL 4F80A 3DUUA 3KPSA 1J1PL 2H32H 1UZ8B 3F58L 3FO2B 3IETA 3O3UN 2EDEA 3RUGB 1YQVH 2XKNB 5DRWA 4Z5RB 2X09A 3VFWA 2DQCL 2XG4A 1S5IL 3KVQA 3OJDA 2GHWB 4NP4H 4AEIH 2R8SL 1N0LA 4AJ0A 4GT7A 3GSOB 1XCQB 3L7EA 3TBYA 4F7EA 1NGPL 4ZSOA 5GRVL 4U6HB 1EEYA 2UYLA 5IJVB 2BSRA 3V6ZA 1CDGA 1Q9OB 1U8KA 3GMMB 5EOCH 1YEEL 3RGVB 1N5AA 3U0PA 3MRGB 2DIAA 5DEGA 5K9QI 5BRZD 4PLOB 3Q1SH 4ELKB 1U95A 4X0KA 4PJIA 4X5XA 5EU6A 4EOWH 4OI8A 3C5ZB 2XTJE 5J6GB 2P8LA 1U42A 5GJSL 3VH8B 2IFFL 3Q5TA 3Q2CA 1JF5A 3HZVB 3T3ME 1JGUH 2YUWA 4Y4HD 4O9HH 3UTTA 2Y5TB 1OY3B 2OS7A 1A47A 2C4FT 4IDJH 5DMGC 4N0FA 1QLFA 3GIZL 4D3CH 4OD3H 4ODHL 4P5KB 2DTMH 2APBA 4BA8A 3EYSL 1QYGH 1L0YA 5HHNB 2AK1H 1A1NB 5FEBA 1PG7H 5FHAL 1KLGB 1MNUH 1RJLA 5DRZA 5HI3D 2VISA 5CILH 4QRPE 5LCVH 4YHZH 3DROA 3RGVD 2C4FU 5B21A 1K5NA 5DJXB 3FN9A 2VRAA 4HK0A 1ZLWH 1OP9A 5AAMA 3T08A 2GKIA 1SJEB 4XCNA 5D1XC 4KXZH 4NO2A 4XMKH 5EO1A 3X12A 1B3JA 1FIEA 3KPTA 2KPNA 5BZDA 4AG4L 1F4XH 3LN4B 3MRFA 3QI9C 5L2KB 4LIQL 3UEZA 3DSNA 4GMSH 5EUKB 4DJMA 3MA9H 3QG6A 1RUAL 2CDGA 1D7FA 2IWGA 3ZDZE 3LIZL 3AMKA 1KB5H 3D39E 1KCUH 5JHDB 2IQAA 2IAMA 4H5SA 1CVRA 2K7PA 4KAQL 1RZFL 4NQXA 3UO1H 4N0YL 3MRBB 4Y16D 4DVBA 1TETH 3UMTA 3BMVA 5GS0H 2V5SA 5GGUA 2X4UB 1KENL 3MJ8B 3NCEB 2FR4B 4KJYA 3GSWB 4R4FH 1MIEL 5MHSD 5LG1A 3SOBH 4ZFOL 4K8RL 3OKEA 1FVDA 2XNAA 4NBYB 5CINL 4EN3C 5E2UL 2G75A 3QUZD 4W4OC 2NXZD 2CKBB 1XGQB 1JN6A 1D9KA 4DEPC 1E28A 5MEQB 4JZNA 2Q86B 4YEEA 5BVJA 1WAAA 1RUKH 1W72L 3GRWH 1J87A 2Y5EA 4PRIA 4YFDB 1K8DB 3QH3A 2CLRA 3C60D 1CZ8H 3O2DH 1JMXA 3VXTA 1K6QH 3VXQA 4OLYL 5GRWA 4WVRA 5JR1H 5F7EL 5A2JH 2NX5B 4KGJA 5TDPB 1BGXL 4LSQL 4OLVL 3B83A 1ZAGA 3DBXA 5HJ3A 4ALAL 1L9NA 2FZ3B 1NLDH 5DWUH 1U58B 4FXKA 3GSNL 2Z8RA 4N5ED 3U4EA 1PSKL 4QRPB 3BRGC 5C0IB 1DVFA 1Y6NR 3S98A 5EBLB 1XH3B 3L3KB 4HC1H 4CBPA 4XHQA 1GHFL 5K9KA 2Y23A 3GMOA 4I0CC 3ZHDA 4W81A 3SDDA 3IU3A 4I5BA 2FH8A 4I9WE 3O3AA 3VFUB 4GG6E 3JUZA 4ZAKB 5JW4R 4M1GL 1NCAH 4FTVD 4XC1L 1NCDL 5D5ME 1H5BC 3UAJC 4DZBB 1K4CA 5I1LA 2ID5A 5J3HC 1SQ2N 1YJDC 3I02B 4XPTH 5DR5L 3H3PL 1WLHA 1P2CB 4EUPH 3ZT7A 1SJHA 1HQ4A 1P1ZB 3G6JB 4XNYL 5DSCB 3DECA 1FG9C 5E6IA 4PJ5E 5BCAA 2NNAB 3PP4L 2BK8A 3UC0L 4YE4L 4H1LH 1DQLL 1BBDL 4GKNB 2PO6B 1JUFA 1UZ6E 2BVEA 3FFCE 4HBCL 1T04B 3BKML 2JB5H 2FYYA 3FN0L 5T3XE 3KPPB 2R39A 1BQLH 2O5ZL 4PUBL 3NABL 3QHTC 4HFUH 2YPLB 4L1HA 5DO2C 3THML 3UYRL 1Q0YH 1RZ8B 3H9HB 2BNQB 3HAEH 4MAYD 4XPHH 1U8MA 1MCWW 4ZYKA 4GUPA 5IHBA 3DHJA 2XQBL 1YEJH 4I18B 3IFLH 1B90A 1IQDB 2J7LA 3B3IA 3BO8A 3L5JA 5FM4A 1RFDL 1G7MA 3DGGA 1C8PA 5KANI 1UVQB 2ED7A 5CEZH 3ROLA 1FAIL 1HIMH 1YUHB 4LLMB 5ERWA 1EEUA 2HT4D 2J3SA 5D96C 3H3KA 2A73A 5FECB 3MUGB 4HKZA 1I3RB 5T1MB 2OR9H 5F7UA 1N0XH 4FXGB 1FZKB 5FO7A 4JG1H 3ULVH 1Q72H 4U3XA 3VI3E 4UTAL 4BFIA 1H3PH 2F19H 5D70L 5JHDE 2PYEE 5EBWB 3HUJF 4PRIE 1FGNH 1RIUH 3TF7C 4NGHH 1WAAE 1I3RA 1CD0A 3VWJB 4NZRL 2W92A 3SEPA 3CVHL 4M6NL 1YUHA 1MLCB 4L9LB 4X5WA 4D0DB 1A7PL 1HQRA 5J57B 5IT2H 4HLJA 3S96B 4X7EC 3M8OH 3O3EA 4UINL 3B2VH 25C8H 2VITA 1D5IL 1MVUB 4CAGA 5ISZD 3A6OA 2A1WH 1U8HA 2QADC 1AI1L 1PYWA 3FB8A 4GUPB 1I7TB 3U9UA 4P2RA 3N0PB 1JGLL 2DMCA 4JRYD 4OZIE 3RY5A 2YKLH 5E9DB 1FAKT 3DRTB 4MJ6A 3VXMD 3DX6A 2XFXA 1S78D 1UWGL 5DJZB 4BQ8A 3ULVE 1I8MB 3RWEB 1LILA 4GW1B 2LU4A 4LCYB 3VFSB 3TO4A 4YXHH 1Y0LA 4X98B 3A6BH 4PJGE 1CDHA 2ADFH 4LLVB 2EDFA 2B2XL 4KTEH 5I74C 1I9RL 2EDRA 2YD1A 3ZL4L 5F3HB 4F7PA 4GS7B 3MX0A 5HHXL 1PBYA 4FFZL 3IXAB 1JGVL 5JW3H 1M4KA 1Q9LA 4TYUA 1E4XH 4IRZL 4RIRA 4GW4B 3CZFA 4BFBD 3MOBH 2DDQL 1D6VL 1J8KA 5C0JA 4NFCA 2AEWA 2AQ1A 1MJ8H 3B43A 5TE4H 5J8OA 4FQPA 3FTGB 5K9KB 4LLUA 1MPAH 5DS8A 5BV7H 1RAMA 3ILQC 4N8VB 4JFHE 2WIIB 1G7LB 4WFED 4N0CC 2H45A 1P7QA 3ALXA 15C8H 4GRWB 4LVHC 4XMLH 4RA0C 2Y36L 1ZLVH 3QXAB 3O11A 1BJ8A 3LAFA 2ZOKA 1OGAD 3KJ4B 2YC1B 3IT8D 3HZMA 4MDJB 5TGBB 3TPUA 4XMPH 3WXVL 1T83C 4HWUA 1GOGA 1G9NH 2DLHA 3EJZD 4PG2A 3H9ZA 3MRDA 2BC4B 1LO2L 4LLQA 5CWSA 4Q2ZA 2YA2A 2H32B 2VDNH 5SWSB 5F6IC 1FNSH 4JZNB 4GQ9H 1OD7A 3C5SB 4IBLT 1X9QA 1AIFB 4FTVA 4F9PC 3V4VL 2MFNA 5EN2B 5INCB 4H8WH 1H3UA 5BRZB 1OAKH 1J1XH 1XGPB 2X7LB 4GRLB 5C09A 5D1ZD 1FVDB 2XNAB 4S1QH 1T0NA 1WICA 4UNTA 2VB5A 1FE8H 2DLEA 3HRZB 4G7YL 1V7ML 3GSWA 3L7FB 5E4EC 4RAUA 5C0NC 4UUJB 4HIHA 4YHLL 4YFLI 2CGRL 2WINA 3PP3K 5EO0B 2WBJC 2NLJB 3PHQB 4KMQA 1ETZB 4J8RB 2F5BL 2DQIH 1RULL 1BJMA 3K81A 1UACL 4F8TA 3WDIA 1OAYL 1S7VB 2X9WA 1F97A 3M17B 1G1YA 3MRQA 2PYEB 1MWAB 5F7EH 2VN7A 2WUCL 5DDHA 1E4KC 1JWSB 1WBZA 2AV1B 3QG6B 4WUUE 3V6OC 3EYQC 4MQ7A 5BO1L 3WO4C 4FQHB 3QXDB 4HXBL 3MRFB 5B39G 2R2CA 5EFIA 2OMNA 3H42L 3MV7D 4HIXH 5MERA 4ELME 3AU1B 5EO1B 3QEUA 1E27B 1MCOH 1T2JA 4B5EA 5FK9B 4GMTH 2IANE 5SWZA 1PEZA 1CQKA 1DN2A 2X6MA 2WQ8A 3GMNB 4KK5C 2B4CL 5KSUB 2CO7B 1PFCA 2WLZA 3VMPA 2YBRA 2J5LB 4JZJC 4ZUTB 5B22A 5DRZB 1E6OH 2VQUA 1YNKL 4DOHE 1RIHL 3E0GA 1DSFL 4Y1AB 3EJYC 5DR5H 4A6YB 5J89A 4XNYH 4AYFA 1WZ1L 3FZUC 3MRLB 1OSPL 4ODVH 5C0DA 1HSBA 2HT3D 1M71B 4ZO8A 4U6VH 3GMQA 3IU4L 4HG4K 3KYKH 5SWZD 3VI4F 4X6CB 3LRGA 3I6KB 2EE3A 3HI1A 1QP1A 2NY5C 2UUDH 3DXAA 2ITDB 3BSZH 2AK4D 3OB8A 4TVPE 5TH2B 3MV7B 4R3SB 3BRDA 3JTCA 2HFEB 2F53A 2KL6A 4JCMA 5DHVB 2IPTL 5J1TC 1HWGB 5TDOB 4UNVA 3D3VE 1NCCL 3RGVC 5DEGB 5EUOA 1F6LL 2YA1A 4NFDA 2DWEA 5CKGA 1KACB 1U8KB 5CMAA 4G8FA 1IGTB 3BPOC 1ZGLP 5B8CC 2YK1H 4EI5A 2Q7NA 4CVWA 2V2TA 2O26U 4KMTL 1ZHNA 1MUJA 4XNXH 3CSBA 1TQCC 4C56A 4KI5E 5DJCA 4YDJB 2G5BA 1A1OB 4RMWA 3D25A 1IC1A 2A9NH 5EIIB 1IJ9A 1ZANH 4PJDE 2D31B 5AD0B 4YGVA 3VXRA 4JDTH 3NIFF 1BIIA 3QDME 1KPUA 5TQ0L 1QSEB 3RVXC 5D9SB 2E8YA 5GGSY 3EBAA 2JIXB 4JFQB 1OSZA 4WY7H 3G9VA 1RUPH 3QUMB 5HPOA 1A7PH 1EVUA 3S4SA 2JJWA 1A1MA 2XA3A 4JFZH 3NABH 2E7LC 1JK8A 2J1KA 4X6DA 2J6EH 5C71A 4L9DA 3ULVD 4MVBC 3KYNA 3LH2L 3SE9L 3QCUL 1XT5A 4PJ7B 5F9DC 1EJOH 2CDEA 3IFNH 4JFXB 4P3CH 4LLWA 3VD9A 4Q74A 3OG6B 4OB5H 3OBAA 4U1LA 1IGJA 3QG7H 4MMXC 5CEZL 2F15A 2YPLD 1OQOA 1JL8A 1YN6B 4YGAB 3U7YL 1QOKA 2F5AH 3V4PH 2R2BA 3C5JB 2FWOB 3MA7A 4I0PD 5FO8B 2A77H 3WFZA 3ECBB 1QNZH 5JOPD 1RHHB 4PRPE 1HDMA 1T5XB 1GZPB 3A0OA 5SX5H 4NGHL 5JW3L 1VGEL 4JHWL 4P2YA 4ONHB 1DE4A 3PJSB 3FO9B 3LSOB 3MC0A 3ARWA 2VDRL 3MXWL 2CH8A 4MS8C 2PR4H 5GGTH 2BSSB 5J13C 2X70A 3QRGH 3RHWK 3MRCB 3ZYZA 2VLJB 2VO5A 3EHBC 1IZJA 2UY6A 3D3VB 2QQLH 2X4PA 4OLUL 1D5BB 1MQKH 2R9HD 3KR3L 2AJZA 4F7CA 1EBAA 3EFFB 2Y4SA 3GSXA 4XNZC 5J1SC 3CXDL 4R90H 5ICXA 5IHLB 3D85A 4YNYA 4MB5A 5FYLL 2AXFA 4NRYA 8FABA 1D5XA 4HS6B 3HE6D 3TBVB 2GAZA 4F15C 5ISZB 5KW9H 1DBML 1UXWB 4C54A 5EU5B 1KCVH 3V5KB 1JPFB 1B4JH 1P7KA 2Y07H 1AO7A 3D85B 4YNYB 4HGKC 5EH1A 4ZXBD 3P30H 4N90E 4NUJA 4M7ZB 4XPFL 5JTWA 2VKWA 5JPNA 3EFFA 2EDYA 4F37K 2D9QB 5EU4A 1CLOH 4Y5YC 4RWHA 3QUXB 4MB4A 3QHZL 1FO0L 2R29H 3MJ9H 4G7YH 1RZGA 1SYVB 1V7MH 3NH7H 2ZUVA 4XP9L 3MRCA 3PP3H 3JTTA 1YA5A 4F58L 2XTJC 1H5BB 1F6AB 2BSSA 1WT5A 1HYRC 2DQEH 3RZCB 3KXFA 2E7BA 2XKUA 1TQCB 3PQYB 5E2JA 4TNWK 1QFWI 5F88A 3BGMA 3OXSA 3TFKA 3EIFA 5C0BE 2GCYA 1KLUB 5L2JA 3BUTA 3NVQA 3VFOA 7FABH 3ECBA 5HHMD 4JFPB 1IGYB 3WHXB 4DKEH 1AH1A 3MRPA 5FO8A 1BZ9A 5I6XC 1A6WL 3RU8L 5BO1H 1G9NL 5DVKA 1F58L 2R0ZH 4KK8C 4F2MB 1I85A 3L3HA 3STZB 3EYSH 4QHNA 2FJFB 4L9LC 1K8IB 3BHBA 1MHEA 4LASH 2B4CH 4WGVB 3TO2A 1VFAA 4MWFA 4WI5A 1BOGA 3FQXB 5C07D 3SDYH 4MXQC 1QFWH 4GFTB 4Y19B 1KJ2B 5HYJE 2QR0B 3H9YA 1I8KB 1INEL 4EOWL 3MMEB 3QUMA 2R4RH 4JVPA 4JM2C 3SDDC 3S3SA 4R97C 5CJ5A 2BY3A 4LPWA 1I1AC 4LSRL 1QSEA 1ZV5A 3DLQR 4ZD3L 1YYML 5IFHH 1WC7A 3FRUB 2D31A 3ZE0F 4JHZA 3SN6N 3LQAL 3LQZA 3KS0J 5EIIA 5KBNC 4RZCB 4U1KB 2MQ0A 5FUCE 4LMQE 3E8UL 1WTLA 3O4OB 4M02A 4YUEH 4EI5B 4IMKC 4KJWD 3I75A 3S5LA 4FZEL 1IGTA 4KI5D 1I8LA 4GMTL 5C0GA 5E08H 3VW3H 1MCPL 3V5HA 3X3GL 3LPWA 5C0AA 4I0PA 3KPOB 3HE7A 4M62H 1U8IB 4XVSL 4QCIB 5D7LE 2VXSH 1CFTA 3KPMB 4DKAA 2HMIC 3EOTL 5C8JB 4L3ED 3MV7A 4R3SA 1C5BH 4ZUSB 5KAQG 5GSRB 3MCLH 1R0AL 1I9IH 4ODUB 2A9NL 4KRNA 1F4XL 2LTQB 2FEEI 4Q9CA 5DJDB 2OL3B 1BEYH 1ND0B 5I8KL 1CXHA 1HHKB 1T22A 4ETQB 5ETUB 2J6EA 1IKFH 1J9CT 3W39B 1U8QB 1HH9A 1HSBB 4OZHB 4GXUN 4QOKB 5C0DB 1KB5L 4X7DC 3B9KD 4LEOB 3SDCB 3NCCB 4I2XE 3G5YA 4ZS7H 1VEPA 3BDBA 4Y1AA 4J3VA 1UM4L 3RDTB 3KLAB 3CC5B 3HAEA 3BPCB 1MCDA 4I18C 3M1BB 3BISA 3NOIA 2J6EL 1MCSA 4NWUH 4JJ5A 3NPSB 3EYFA 4V1DE 4HH9B 3IKKA 4GQPH 2N4IA 4AENB 5FM5M 4TVPH 1WTGT 5KSUA 5DA4A 4G6AD 2O5XL 5SWZB 1CICA 4MD4A 1CIDA 5IF0B 2Q76A 3RPKA 2BDNH 2R56L 4NFBA 4S10A 4HV8B 1MFDH 1I1RA 2W0KA 4PG9B 4PFEA 4G7VH 2XPGB 3P2TA 3MV01 1A7RH 4HWZB 5CJXC 1IMHC 1U92A 3LPFA 4RRPA 1IC4H 3VWJC 3RAJH 2O61B 5IBUB 2VDML 4OLYH 5J7CC 3GJFK 2KUTA 2WY3A 4AEFA 2Q20A 4XNQB 5JW5B 1AQKH 5EBMA 3V6FB 5EWIH 1JYVA 3VXRE 3GMPA 1HK6A 5KJRH 4J8RA 4IRSD 1ETZA 1FORL 3MOAH 1FG2B 2Q8AL 5EO0A 1K2DA 4G6KL 1Q8MA 1ADQA 1A7NL 3DXAD 3AAZB 1T7YA 5KZCB 4DTGH 3C2SA 4Q7DA 5GISL 3ZE1F 2W9EL 1MCJA 5C9JA 1E4WL 1EFXA 3MFFA 3MGTB 2K7QA 4Z95H 2CJUL 5C08A 2FB4L 3MZTA 4U1IB 5DQJA 4GBXA 1XAUA 4GAJH 5TDNB 3ZKXB 2QHLA 1CDJA 4LPCA 3QG7L 4Z0XB 2ZUSA 3HMXL 4N9OB 2W0LA 4WW2C 5E1AA 3TJEH 1XR9A 3IJYA 1KCSH 1E0OB 1IKNC 3MRHA 4JFDA 1KCVL 1F90H 3HG1E 3TPUB 2BNRE 4QRRE 4WI3A 4YK4B 4HBCH 2XACC 3WFHA 4Y4FC 2VWEE 1MRFH 1FYTB 1KT2A 5GJTL 5GHWL 3MLTB 1SEBA 5LXGH 4JN2B 4MA8L 1CGVA 1UCTA 3HNSH 1IGFH 4U0QB 1OGAB 2WIIA 4PYHA 2CUHA 5DS8B 2OLDA 2BVQB 1K4DB 1NGZB 1QPXA 3UDWC 1PKQA 4NC2B 2LQRA 3SJVA 5K59E 2VLLA 1X5HA 1HEZB 5E56A 5C0BD 1QFUH 3IDJB 5ESAB 2HWZL 3QNZB 5EZOL 3VXUA 1S7UA 4M7LT 1Q9KA 3CZFB 4A6YH 1NAKH 1KTDB 5SWZE 3MLUH 3PL6A 4GRMA 1OWRM 1IBGH 1EHLH 1BBJA 2ZCKL 1VKXB 3PIQB 1WQVT 3T4YB 4O58H 2EH7H 2OR9L 1OTSD 4NQED 3CSPA 3D3VD 1YPZE 5C2BL 1HHIA 3PWUA 1BMGA 4X98A 3CSGA 3QEQE 4QWWD 4Y16B 3SQOH 4NKMA 5DA0B 2AEPL 1FYTD 3MPCA 1FVCB 4E9LA 3KYOB 3WLBA 4M43L 5E8EA 2IBBA 2PYED 2Y1VA 1I7TA 4NQSB 1L7IH 1Q1JH 4RGND 4Z9KB 4HIEB 5DEFB 2YD7A 3SGEH 2GJ6B 4JJHA 2ZKHH 3JTSA 3QPQD 4P0DA 5DI8B 4Z7QF 3TCXA 2DQEL 1HQRB 2J2ZA 3WEXB 2NTSP 5TFSH 1B2WH 4LU5L 4L9LA 4ODXB 1AC0A 1P7QD 4R7DB 3VXSE 1UWGH 35C8H 5CJBA 2B39A 3IGAA 1ZVSB 3VWJA 5ABDE 5KAQF 2EXWC 4RX4A 1FNFA 3N1FC 2AV7B 4L8DB 3T0EA 5DJYB 4ZO9A 2YZ8A 4M8QB 1NCWL 2BFVL