4U1MA

Hla class i micropolymorphisms determine peptide-hla landscape and dictate differential hiv-1 escape through identical epitopes
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-42 alpha chain
publication title A molecular switch in immunodominant HIV-1-specific CD8 T-cell epitopes shapes differential HLA-restricted escape.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u1mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4u1mA01
1E4KC 4WDIA 3SDYL 3O2WH 3W2DL 1UKTA 4TSAH 3C2SA 3BQUB 3IAQA 4FHBD 2R23B 1NCDL 2NTFA 5E70A 4JM2A 4K8RL 4CN4A 4NZTH 1JHKL 1WBXB 3QWQB 5E8PB 4K71B 5T3XH 3CDGB 1LEIB 2X2YA 4RAUB 1MCJA 4IRZL 4G6JH 4N0YH 2PCPA 1MCKA 5CEZH 3LIZL 1KACB 2CKNA 4A2MA 1MLCA 4DUWA 3D2UB 1T1ZA 3LSOB 4U2ZA 5CD3B 2OR7A 4P2OA 1T5XB 4FG6C 5CJ8A 2NY0C 3JTSB 5FECA 1QSEA 1JTPA 1W72L 4ERSL 2VNCA 1DUYB 3OXSB 3T8XA 4E9LA 2P24A 5D1QC 1PKOA 4XP1H 5KG9B 1IBGL 4JRYD 3OF6A 4CDGC 4XBEH 4YXLL 5KTEH 1MRFL 3IU4L 1MI5B 2Y7QB 5HHPB 4MNHB 5T33H 4LHJB 4DZ8A 4CRPA 1GZQA 2OBGA 1W0WA 1NJ9B 1QLFB 4YHIB 1H5BA 3P11L 3MA7A 4RA0C 4HWUA 1G7QB 3EYQC 1U58A 4S0UC 4MYWB 5JA8B 4NO3A 2HJFA 4JRWA 3ESUF 2W65A 5JDSB 2BHZA 3DETD 2CIIA 5FIEA 1WLHA 2FEDD 4PV9A 3MJ9H 4LCIH 1JGDA 2VZUA 1IKFL 4ELMF 3ZHLA 1I7UB 3G6JE 1YN6B 1E4XH 2X4QA 4XWGH 1AY1L 4KRMB 4AEHL 4NQXB 3MODL 4GJTB 4DKDC 2C1OB 2HKFH 1F4XL 3KWWB 5IMLA 3VXRE 3DMMD 5FAAA 5IMKB 4LQ1A 3VD5A 1AO7A 3HZYB 1OP3H 4MA7H 4GT7A 4XXDB 5C0CA 5C86A 3RWIA 5KVEH 4JB9H 2VE6A 3PJSB 4TULL 3LQMA 1GGTA 2ICCA 4ZS6D 1GOFA 1RUKH 1S7RA 3FB7A 4NNYA 4R90L 1JZ7A 4P9HL 3ZKSD 4U1KB 1K3ZA 4F37F 5HHQA 3MLVH 1QVOA 1PY9A 3OWEA 2XA8H 3QI9A 5BZDA 4JFDA 5BQ7B 5GGQH 1NGYA 4PJGB 1NQBA 4DUVA 5EZLA 1Q0XH 4FQQA 2BNQD 2QSVA 4MDJA 2JKXA 2MKLC 3FQWA 4UAOC 1XF2A 1WF5A 4ODUB 3N85L 3O6LH 3IF1B 3VGHA 5EORL 3VGAB 1ITBB 4OCYL 1E27B 4FG6D 5E2JA 4MNGA 2NY0D 2WWMC 3IFPA 3T2QA 3NCFB 1A7OH 3BW9A 4J8RA 4RAVB 4RRPG 5D1QD 1KJVA 2Y36L 2WAHA 1WIPA 2OL3A 3BP5B 4MD0B 4BZ2H 4NBZB 3QHZL 1U0QA 1A3LH 2R8SH 2L7JA 4FQPA 2AEQH 1GVIA 3DUSB 4OZGF 1KIQA 3RL2A 5KVFL 4LPYA 2NY4C 3FB6B 1MHCB 3TNNB 4HFUL 5IV2A 1AIFB 1CXIA 4X8XA 5CILL 1JGVL 3EYQD 3TYFA 3E1F1 4NC0B 3E8UL 3ZE2F 3U6RA 3SDAA 2GTWB 2ZCLL 3RTQC 3CVHL 2OP4H 2ARWA 3RGVB 3RVUC 2FATH 4PJIA 3UBXB 4IOIB 4YO0A 1N26A 3CFDB 2H2SC 3EAKA 4M03A 2P46B 1C5CL 5A3IC 3NFSL 4G8EB 4NSKA 4QYOA 4Z0XA 3C6LB 2YUXA 2YD8A 4ZPTA 1HHIA 2JJSA 1KXVC 4L9DA 4XWOC 1J1XL 4E42B 2H9GA 1CQYA 3I3EA 4I0PB 1AQDB 4OIBA 3KXFE 5FHAH 2R1YA 3CLFH 2D7OA 2DQFA 2UZIH 4QRPB 3MLWL 4HF5H 5TQ2H 1RZ7H 3O3UN 5IVOA 2DYPA 4JFFA 3QO1B 2DQHL 5DWUH 3ARBA 3KPPB 1IFHH 4WNQA 4JPIB 4Z7VA 3BN3B 4RQQB 2KH2B 2WANA 1NDGA 3WBDA 2XKSA 4QCIB 1MCHA 4S1RL 3PHQA 1SYSB 4UIKL 4R26L 2DS4A 2ED8A 4JFOB 3WN5A 1ZXQA 2CMRL 4LOUC 5DSCA 3REVA 3MRPA 3HE7C 2B5IC 1YPZB 3D25B 1Q0YL 1T6VN 2VKXA 4HCRH 3A67L 1H3PH 3KPOA 4UUJB 4GRWH 1S7SA 3QBTB 2YA2A 5D6CB 1KG0A 2GQHA 3CH8A 2R0WH 1JNNL 3CFJA 5K93A 4JAMA 3MYJB 4HUNB 2Z91A 3PP4L 1GXEA 2IGFH 3KDMB 3U30B 2FZ3B 3CX5J 3NZ8A 5DA4A 4KWUA 1R5WA 1QBAA 1PZ5B 4OZFB 5JMOC 4L8SA 4S1SL 4OFVA 1FORL 1J5OL 5GISH 1C16A 2WWMD 5EU3A 3RWDB 1ACYL 1AE6L 3GJEA 2FJHB 1NAMB 2DDQH 3DGCR 4IBLT 1W2KT 4XPFL 2VXTH 4E41B 2WIMA 1IEHA 1EGJA 3I50H 2X42A 1J8HB 5EBMB 5MERA 1LE9A 2RHEA 3KLAA 2D4DA 2NY4D 1RMFH 2CXKA 3WFCL 2I07A 3C5JA 4PREB 4WHYG 4JRYA 3BSZH 4LQFH 4F9LC 1NPUA 3WL9B 5T1DL 3LEXA 4G42A 4PJHB 3X12A 1NLBH 3GJFA 3RTQD 1CFTB 3WSQH 1YJDH 2DLFL 3RVUD 3V7AE 5IB3A 1KLUB 4X6CE 1KPRB 1S7QB 1LO4L 3RY4A 2H2SD 3HMXH 1MEXH 1MCLA 4R0LA 3HC4L 5A3ID 2XZAL 1EO8L 3QEHA 5KJRL 2YMXL 1DFBH 2Q86A 5ERWA 3TJHC 5IFHH 2ILLA 4X9FA 5F6HJ 4PRIB 1QPPA 1ZVHA 2EIEA 2XI9A 4XWOD 2ZPKL 1C08B 5HHXH 2GW5A 3W81A 2J1KA 4FQCL 1QSZA 4HFWA 1P53A 3RZCA 4OKVB 2CLZB 3EYOA 4MB3A 1HYRC 4KTEL 4NCC1 5E5MB 2Q20A 5IQ7L 4ZSOE 3PGCB 5B38B 1OWRM 1L8JA 5DEFA 2OJZH 4OLUH 2H32B 5DGRA 1DQQA 4LLDB 5F7EH 3WS6C 1J05B 5DRZA 3DX6B 3QO0A 4OD2A 1MAJA 4OZHF 4P4KA 4LGSB 4PJCA 1FFNA 3KVQA 3OKLA 4LOUD 2H32H 3DMMA 3HE7D 2WUBH 4YGVB 5JW3L 2FX9L 5BMFL 2BFVH 5F96H 3QUMA 4I1NB 4QXUL 5C3TA 1QACA 3VFSA 4Z7QF 3V4VH 3CFEB 1UM6L 1YZZA 3AS2A 3LQZB 3TNMB 4GAJL 5ILTL 1HHHB 2VOTA 3QG7H 4KGLA 2A83A 3DROB 3P4LA 3LQAC 1BBJA 1WVZA 5E8NB 1RU9H 2X4UA 2VLKB 1I3GH 2I9LB 3ZHDA 2DD8L 3QUXB 3VGEA 1E4KA 4XVSH 1CE1L 3OHXA 4KJYB 4OF8A 1LK3L 1UZ8B 2I9TB 4LSQH 4LLYB 5KW9H 1CGXA 3JUYA 2BNQA 5SWSB 3VI4E 1G1CA 4AZ8A 2NZ9C 5A2LH 4M7LT 3N1FC 5C70A 3BT2H 5TQ0H 4AH2A 3VMPA 4IMLB 1CVSC 3K4AA 4JDTH 4Y4FB 1NCBH 4YDKL 3O9WB 3MR9A 3JTTA 4AIOA 4G3YH 4HC1H 4YQXH 4XX1E 1ZHKA 2X40A 1NMAL 3BESR 4OM0H 4JHWH 4UT7L 4NUGH 4XMLL 4LLMA 4M6NL 4BUGA 4M9PA 3KNBA 1L0XA 4K9EC 2JIXB 5D1QA 2PYFA 4EBQH 5DZOA 5BXFB 5J11B 5EUOF 3OKNB 3RWGA 2ZG1A 1RZJH 4LCCB 2EIZA 4Y2DB 1OGTB 1K5NB 4HK0B 1R0AL 2VTFA 4U1HA 3S88H 4WI4A 2YPVL 5BOZG 3HLAB 2I60L 2D7PA 4FTVA 4BSWA 3DX7B 3UYRL 4XNQB 5IEHA 5DO2C 1FP5A 2QSCL 4NRYA 2Y5TA 4ZDHB 3TJHD 4JFQA 4NKMB 2FD6H 4MQTB 2VH5H 1DN0A 4JPWL 3GIZL 2DICA 3SE3A 3ZTJH 4K8RC 2N56A 5KSUA 1FG2B 3D85D 3UX9B 1IQWL 1D5BA 2AJ3B 4JY5H 4PJBA 5IVNA 3AS1A 3V4PH 1RUMH 3EDKA 1K4DB 5E2UH 1MVFA 1HOCA 4YDLC 5ICYB 4QXTA 1D5MA 4JG1L 4ODXB 4U1NA 3ZYIA 5JW4Q 4M1CC 4JQIL 5K9KA 4NHUE 2YRLA 3AS3A 4ZO7A 1B9ZA 5FF6A 2B1HL 3QQ4A 2V2WB 1S7TB 2ADFL 2FGWH 1QA9A 1PJ9A 4M1GH 1FVEB 5B39A 2ZCHH 2MCG1 1G7LB 2VDML 4H25B 1RJLB 4ODHH 3VXMB 4OJFH 5I8EA 4QWWC 4P9ML 2HWZL 4R4NC 3SE8L 1U8IB 1FZKB 1Q9LA 3I6KB 4LCUA 4MZ3A 5GQBA 1DANT 3GMMB 1D5XA 4N5UA 4Y7MA 1I8KA 1ZLWH 2NTSP 2AI0H 2F74B 4XMKL 5J13C 2XXCB 1I9JH 2X4SB 2CKBA 2D03L 2XPGB 3PUCA 4GG8B 2VDLL 4PRHE 5DRXA 1X6NA 2W60A 1G7IB 1OF2A 1UJTA 1WAAA 5CJOH 1YYML 1P1ZB 2IAND 2NZ9D 3T0BA 4MAUH 5GRXG 2GUOA 3WNPA 1RURL 2EDKA 5CLTA 4HH9B 4PJEE 1ZWIB 3MLUH 1MPAL 3QNZA 1RUQL 1BAFL 3H9SD 5SV3A 5H94A 1AXIB 2KL6A 1QFWI 4K3DH 2WMPA 4CW1A 2APFA 1JCKA 1W0VB 5KSBB 5I75B 4JO3L 1ZT1A 5JQHC 4G6FB 1H8SA 2ED7A 1M4KA 3U46B 1OAZL 3GSOB 3T0AA 1XF4B 3VFGH 3VU2A 1FLRL 5HD8C 1INEH 1RVFH 1Q9KB 4JFEB 4JO2L 1TVHA 3NMEA 2N7AA 1HXYA 3QP3A 2CDGB 4P9HC 2Q7NA 2R1WB 4JRXA 5KVGH 5DO2D 4HWZA 2H8PA 3HS0B 2NXYC 3S35L 1TQCC 2O5XL 3MUJA 4C83B 3L6FA 4K8RD 3RTQA 3TN0A 1ADQL 4YHLH 1J0IA 5IP4A 4QHMA 3BZFB 1AKJD 3T2NL 4RGNE 1G9EA 4PP8C 1T0MA 1NBYA 2AXHA 4M1CD 2XNAB 3FO0H 3O2DH 1A6PA 4GFTB 4OUUA 1T20B 1BVLA 4XRCA 4ZNEA 5IMMA 1QG3A 4FFYH 1BWWA 4NO0B 1KJ3H 2D0FA 5JLZB 3OXRB 3O3BB 5IW1A 4QWWD 3MRIA 5EOCJ 4R4ND 4AT6B 5E6YA 3G6JF 5I1DB 1KGCD 3BIKB 3KYOA 3UJIH 1A22B 3EDEA 2X7LB 3ISWA 4POZC 4FQIL 3NPZB 5C0EA 1J1OL 5GRUL 4GUPA 5IM7A 3KYKL 3MLSL 3HE7A 2ADJA 5IT2H 3RX8A 1XF3B 3S8WA 1X6LA 4BQBA 4P2CG 4KDTC 4MX7A 4PD4J 3ARGC 5D7KD 5T3ZL 4JDVB 4MMZC 3VXTB 3LOWA 1HH9A 1A7QL 1NGQL 4JFZL 3JWNC 4JGUA 5E6ZA 4XBGA 1L6XA 2VXVH 5IBTH 2IADA 4Y5XB 4YGAB 2ORBH 3QNXA 1ZHLA 4G8IB 4KUCD 1NANI 1CFQB 1L4IA 4AG4H 2BXZA 2H41A 3VRJA 3WHXB 3A6CL 3OZ9H 5B39G 1JI1A 2PF6A 1CG9A 3VJ6A 4JANA 5AAMA 1GJIA 4RNRA 5HHNA 4TSBL 5KSVB 3MRQA 4RGMC 4YPGA 2C26A 1QSVA 3N50A 3H8NA 5CZXC 3T09A 1FYTD 4WTWA 3EGSA 1X9QA 4PJEA 4K7PY 5LG1A 1U3ZA 3MOBH 5HD8D 1A3RL 5GGRB 1QFUL 3TWCH 5HSFA 1J0YA 2C4FU 4N5EC 2ICEB 4LU5L 3G04B 5D7IA 3LKRA 3QIUB 1BF8A 1FO0H 3SQBA 2W38A 3MFFA 4KXZI 2NXYD 4HEME 3ZHKA 3O41B 1PG7H 2XWJA 5F44A 3VDAA 4J3UA 1PG7X 4WDIB 1YDPA 3VWJA 5E1AA 2VDRH 3RVXC 1BZ9A 4YEFA 2NTFB 1QPXA 3NFPA 4JM2B 4KK6C 1R3IL 4M7KH 4JLRA 1OAUH 3EFDL 1AGBA 3HI6H 3TJHA 2PCPB 5FYLE 3K2UH 4Y16A 1MLCB 1MFBL 1T1ZB 4WV1C 3D85A 3VMNA 4JQVC 3ARFA 3PP3H 5IBUG 5GS2H 5FECB 5LGKA 5GGUA 1QSEB 1KGCE 3BPLC 5AWNL 3T2OA 1HXMA 4NQED 3T8XB 5D1ZB 3UZVB 5LKNA 4O9HL 5EULV 2P24B 3WS6A 4NZRH 1V8HA 1SVCP 4POZD 4HWEL 4UTAL 5C0IA 3QEGL 12E8L 3HB3C 4UINH 1K3IA 4WCYL 4BYHA 5E4EC 3MBXH 5I30H 3P0YH 5BRZA 4DZ8B 4HPOH 3SDCC 1DQLL 1GZQB 2V5TA 1W0WB 1KCUL 2CRZA 5F6IB 3U0WL 5D7KE 5F7LB 1OP9A 4ZG1A 1H5BB 4TNWF 3ARGD 3MA7B 5BO1H 1UCBH 4DW2L 3WFZA 5IK3A 1U58B 5D96B 3TA3C 1MCPH 1JRHI 4NO3B 2HJFB 4NQDD 4S1DC 3REWA 4EVNA 2OR8A 3BRDA 5DUML 5LCVH 3D69A 3WNKA 4GG6E 5JORA 2W65B 5EIQA 2VDOL 2X4TA 1LO0H 1CD8A 4QOKD 2CIIB 1A4JA 2VERN 4PV9B 4XCCL 2YPLD 5L8JB 4UNVA 1JFMA 1JGDB 2Y07H 4JY4A 5L8KB 4FOMA 3S7GA 1HE7A 2IANA 1CLOH 4YHKH 1CBVH 1JZ5A 3D18A 2X4QB 2G5RA 1KIRA 1FYTE 2EDQA 3GMNA 1FE8H 5CZXD 5IMLB 1AO7B 1JYVA 1IGIL 2N7BA 3H9SA 4GMSH 2V6HA 5C0CB 1AXSA 5ALBL 3RWIB 2VE6B 5HHMD 4N5ED 1AFVL 3ROOA 4UOW0 3PWPD 1S7RB 3FB7B 4NNYB 4NNXA 1S9KC 1ZLSL 5I73C 4OD3L 1IT9L 4YFDB 5A2FA 3KR3L 1QVOB 1VDGA 1FV1A 2MQ0A 3RVXD 3QI9B 4F9PA 5HI5C 5BZDB 4JFDB 4DGYH 1NGYB 1X5JA 1LO2L 4HQQL 2FGZA 3H42L 4KK6D 5EZLB 4FQQB 5DD5H 4MDJB 1JGEA 2W9LA 3FQWB 4KZDH 3BKYH 1MRDH 1ZLVK 4K2UH 4GLRH 3IKKA 2NXZB 4X6CF 4FABL 1OAXL 5A16A 2VITA 3DX9A 1CL7L 4X83A 4NQEE 3TF7C 4MNGB 4M7JH 4ZUSA 3UJTL 5LQBL 4LP5A 4OKDA 4KVCH 3IFPB 2YXMA 4U1GC 3BW9B 4J8RB 1LEKA 2B20A 1KJVB 3GO1H 3WDJA 2OL3B 4J6RL 1EEZA 1YEJL 4JG0L 4WRLA 5K9QI 1W72A 3F7VA 3HB3D 3AB0C 4FQ1H 1RULL 2QADB 3UMTA 2VDNH 3DWTA 3SDCD 1KIQB 2OL3H 3RL2B 3VW3L 2VAAB 4HG4K 3B9KC 5IV2B 1V3LA 5MEPA 1G0XA 2XQBH 3TA3D 3ZKNC 1ZLUK 3TYFB 3KPSD 3U6RB 4S1DD 4L3AA 3BFOA 2BRRH 2V2XB 5FOBA 4DUXA 1AXTL 2QJDA 3CXDL 2PKDA 4WFGD 4PJIB 3FL7A 3KJ4B 4YO0B 2BOCA 4GH7B 2I25N 3CFCH 4LCWA 2X9WA 4NSKB 1CK0H 1KEML 3Q1SL 4Z0XB 4YXHH 4ZPTB 1HHIB 3BIAX 2H9GB 4WIQA 1GPOL 3GJFK 2QBWA 4UILH 1B6UA 2R1YB 4PJDA 1S9VA 3SOBH 2DQFB 1QQDA 1FSKC 2GITA 3B2UC 4KU1A 1T1WB 3P2TA 4F33A 1FGNH 3B9VA 2DYPB 3GUTA 4JFFB 4K7FA 3ARBB 2DI9A 3VI4F 4S0SD 4WNQB 4Y4KC 3PWPE 1AHWA 4Z7VB 4BQ6A 1NEUA 3IRZA 1CLYL 1NDGB 4HAFA 1QLRA 4M6OH 3PHQB 5I18H 3WN5B 5DSCB 3REVB 3MRPB 1S7WA 3INUH 5JA9A 1LILA 1KCKA 5EBLA 5IKCA 2X70A 2G60L 2WNGA 3IFNH 1YQ2A 5HI5D 3U4AA 1IGJA 3KPOB 1S7SB 3TM6A 5E5UB 1YEHH 3WIIL 1KG0B 4OF3A 4EUPH 3CFJB 2G9HA 4JAMB 4FQ2H 2Z91B 5KAQF 3DLQR 3L9RB 1G7HA 3NZ8B 1VSCA 3GSXA 4NNPH 4N0RA 4L8SB 1C16B 4I2XA 1FNSH 5CINH 5EU3B 1JGUL 3GJEB 4F58H 1N3NA 3BI9X 4PLKC 3QDJD 5EOQL 1NBVH 4YHZL 3HNSL 2GT9A 4Z8FH 1NFDE 4P0DA 4F15C 3MUHL 3ZTJG 5DK0A 3MJ7A 3NAAH 2A0LC 3DHJA 4YDJA 2FECL 3W0WD 1RPQA 1TJHH 1LWRA 2DLEA 3S34H 5E2WH 5F7MC 5EUKB 5MERB 1LE9B 2EDJA 1R3KA 3KLAB 2APTA 1JWMA 2I07B 5EBWA 3C5JB 3KPSE 4JRYB 1RZFL 1SYVA 1MJ8L 4X80H 3ZKND 1U8OA 1WIUA 3LEXB 3QR2A 2VXQH 3GJFB 4G42B 4K23L 4WFGE 2AK4D 5FV2A 4QHLA 1LVEA 2X4OA 4WFFD 4ZFZA 5IB3B 4RMSA 1WJ3A 4U0RB 3Q6GH 1DLFH 3OKKA 4XPAH 3JUZA 5AZ2H 3QEHB 3S37L 5ERWB 2Q86B 4JO1H 4ONGH 1G7JA 4R3SA 3NZHH 2X09A 4NQDA 4ODTL 3QEQD 3ARDB 3NCCB 1WBZA 1Z9OA 1BEYH 4HFWB 4DKEH 3RZCB 3EYOB 3V0AC 2YEZA 5C07D 5JHDD 4TTGA 2J6EL 2V7HA 5GZOC 3B2UD 4QOKA 1TZIA 5FUOH 2UV3A 2BNUA 3PGFH 5DEFB 2YPLA 5GS3A 5KS9E 1QLEH 1BFVH 3KJ6H 1T0PB 2R15A 4Y4KD 1DQQB 3K8KA 3NVQA 5F9WC 3QFJD 5DRZB 3QO0B 2JF1A 1MNUH 2C1PA 4OD2B 4P4KB 5E4IA 2APVA 3GMQA 3BDBA 4PJCB 4HLZH 1FFNB 4XMPH 3OKLB 4XPGH 3DMMB 4G6AC 1C8PA 1IZJA 4APQC 3QPXL 3BPOC 2ZWLT 1JPSH 3QUMB 4P2RD 3O4OB 2IEPA 2Q8BH 3VFSB 1G0YR 3CCHA 4KTDL 5HHMA 5I74C 3NGBB 2GFBA 3PDOA 5FYJL 2A83B 4AMKL 1BBJB 4QHNA 3QUMH 2X4UB 4PJXE 4P23B 3DSFH 4ETQB 4HUVA 3B3IA 2FIKA 3OHXB 3U2SA 2A2QT 2J8UA 4QT5A 1LD9A 1HSAA 3DO3A 1UWGL 1G9NL 1G6RH 5K9QG 3QDJE 1YNLH 2BNQB 4ALAH 2F5AL 2EDEA 2XRAL 3ARVA 5I71B 1UM5H 4PLKD 4H20H 3IAPA 3WKMH 4AH2B 4Z95L 4YNYA 4WV1A 3CPLA 1XCTA 2AP2A 2A0LD 3MR9B 3MA9L 5DS8A 3JTTB 5I76A 1WUNT 3EFFA 3H0TA 3O8XC 2P5ED 1ZHKB 3L3KA 5F72S 3BE1L 4QTIL 3MLPA 2NNAA 4W6YB 4LLMB 3CSYA 3SPVA 4O58H 3KNBB 5D1QB 2PYFB 3DHMA 5DFVC 3VMOA 1GSMA 1D3CA 4L3CB 4M48L 3UDWC 4M8QA 3MCLH 3D9AH 3QUKA 3I9GL 5ETUA 3RWGB 4EZMA 4HJGA 2P8PA 2AK4E 4HBCL 4LAQH 4HS8L 2AEPH 2EIZB 3SBWC 4TSCL 5J1AA 5CZVL 5I1GH 3GSQA 1F11A 3IDNA 4ONHA 1LP9A 4K94H 3WLWC 4Z76A 4Z5RA 4P2YA 3SDCA 4U1HB 5DMGC 1WZLA 2BY1A 4FTVB 4BSWB 2J4WL 5IEHB 5J57B 2J8HA 4NRYB 4JFYB 1DQTA 1OB1A 2Y5TB 1FRGL 4P2QD 4JFQB 2HRLA 3QEQE 1OSPL 3TA3A 3KPSA 3WYRA 1DN0B 5C9JA 3WLBA 5C07E 5KSUB 4P59L 3U4EA 1D5BB 5CAYB 1T6WA 4PJBB 1MCOH 5DMIL 4YHYB 5GZOD 3ZZ1A 2AXJA 1HOCB 1NBQA 1BZQK 4QXTB 1D5MB 2W9EL 5DR5H 3QHFH 2ESVE 1C7SA 2PETA 5K9KB 1UACH 4FXLA 3P0VH 3TV3H 3PXHA 5ITFA 5FF6B 3QQ4B 3VFRA 2DM3A 1Y0LA 1QA9B 3RI5F 3RY5A 4MLSA 5B39B 1JGLL 1WSST 3LS4H 3WJLA 2R69H 4G6AD 4P2RE 4APQD 2VLJD 3DVNA 4YIQB 5GJTL 4PY7A 3NABH 4KZEH 3EHBC 1Q9LB 4LCUB 5L2KA 3ARXA 2IQ9L 5D72H 3L3OA 3S36H 4MDIA 1D5XB 3FKUS 3S36X 1I8KB 3QXDA 4R4FL 3U7YH 1AH1A 4BK5A 3SJVD 2X9YA 3PWNA 2XTJC 2CKBB 1FAIH 3AC0A 2ZJSH 4N0FA 3ZKXC 5T3ZD 4GXUN 2HP4A 5DRXB 3Q5TA 2W60B 1OF2B 4HPYL 1ND0A 3U9PL 2ITDA 3TCLA 3U1SH 2IG2L 1CTOA 2G2RA 3B2VL 5GIRA 1P69B 4OCNC 4WUUA 2C3WA 5L7XH 3OAZH 5C6TH 3QNZB 2EDYA 1A6UL 5H94B 3X13A 4HV8A 3FQXA 4YBLB 4GKOA 3O8XD 4CW1B 2VR4A 4RMUA 5C2BH 1CZ8H 1ZT1B 3QDJA 5DFVD 3RVWC 2B4CL 5DURB 3NBNA 1DR9A 5I0DA 1QEWA 1S5IL 4O02H 5GGVY 3W0WA 4DGIL 4GRLA 3WLWD 2EC9T 1TVHB 2PXYA 5IGXL 5DMGD 1HXYB 1MCWW 4ZQKA 4F2MA 2NY4B 2M2DA 4OM1L 4JRXB 3B9KA 4HWZB 5ADPL 2VDKL 1YYLL 3E3QA 2H8PB 3R1GL 4LPTA 4LMQI 4Y5YC 5D7LD 4KGJA 3L6FB 4XPTL 1C5DA 3RTQB 1GGUA 2WBJA 3TN0B 4YC2C 5D7JC 4QHMB 1EJ6A 4MNQA 3GSNA 4NM4L 1U93A 2EO1A 1OAKL 2HG5A 3NIDE 5C0FA 1T0MB 1NBYB 5TH2A 1KB9K 1F6LL 4OGAC 4YE4H 4OUUB 5KZCD 3DUHA 5IB1A 3LDBB 1RSFA 2C3HA 2ICES 1BVLB 2GSGB 3L95A 3ARTA 4XRCB 5IMMB 4GG6F 1L7IL 5HHVH 4KV5E 3QWOA 2R1XA 2VLJE 5JHDA 2DQTL 4CJ1A 3OTTA 4G9FE 4I3RH 3AROA 5IW1B 4CN6A 4M8VA 3MRIB 2K7PA 2ZOLA 5FGCE 2AJSH 2V7NA 3EHBD 1K85A 4EJ1C 4QEGA 3KYOB 4KRNA 2OJEA 3RIFK 4HIXL 5I8OL 1EHAA 3QFJA 3SJVE 1Z0NA 1GCFA 2P1YA 4BQ8A 5C0EB 5IM7B 1SM3L 3L5XL 4K07A 5T3ZE 1KJMA 1KPVA 1O5DT 3HE7B 2XTJD 2ADJB 3MRRA 5A2JH 3QDGA 4HUKB 5IJVA 2CO7B 3GRWH 5I1LA 1V3JA 5DD3L 4MX7B 4TQEH 3LKOA 4IOFC 2OI9C 1A7RH 1HH9B 5D93C 3UPAA 1T83C 1G9ML 2CUHA 3EOYG 5ELIA 1MHPH 4N0CA 1U6AL 3BGAA 4GKZA 4J4PC 4XBGB 2IADB 4ZOCA 4R8WH 2QKIA 1H3VA 3QNXB 1AP2A 1ZHLB 2E8YA 1NCCL 1UB6A 1LE5A 5CMAA 3VRJB 1MF2H 1B88A 4E0RA 5FDWA 1ITCA 4RIRA 1CG9B 4QRRD 3VJ6B 4M61A 3V8CA 4JANB 4M62L 2AXGA 4RNRB 5HHNB 3ZT6A 4K55A 3MRQB 2EC8A 4OUOA 4ONFL 4YPGB 3RVWD 2DQDL 3WNLA 3RUGA 3EGSB 5F9OH 5L2JA 4QRQA 1KCVL 1HNFA 1TPXB 1RZIA 1YMMD 2P5EA 5C0AE 1PGRB 1EMTH 4IDJH 4NP4L 2WM0A 5I19H 3Q3GA 5D7IB 3LKRB 2D0HA 2EH8H 5D7LE 1NCUA 2JCCA 5IOPA 4U7MA 5E8EA 1S78C 2XWJB 1FNEA 1YDPB 3VWJB 4YAQA 5TDPA 5DEZA 5E1AB 4CU7A 1D5IL 3IDUA 5D7JD 2AV7A 6FABL 1BZ9B 1NMBL 3NFPB 3QRGH 5AD0A 4YBHA 5E08L 1WFUA 5I15L 4JLRB 3T2PA 3AAZA 4B53A 3FN0H 3T4YA 4P2QA 1AGBB 1BLNA 4OGAD 1ADQA 1UM4H 1JF6A 1NANH 1DJSA 4Y16B 5TPWH 2YUZA 3GI8L 1UA6H 2AQ1A 3MRNA 4HIHA 3D85B 3UTSE 2MQ3A 4XVJL 5EWIH 1MCEA 4DAGH 1U9KA 4Y88A 3ARQA 3ARFB 1YECH 4FQLH 3FT3A 2VC2L 1QSFE 4HKXB 5JQ6H 2GKIA 1DQJA 1HXMB 3VRLE 2ARJA 4L5FH 3B6SA 1DVFC 5HVGB 5CBAA 2HFEA 5D71H 1ERNA 1YQVH 5JOFA 3GHBL 1ZEAH 1SBSH 4KHXL 4HT1H 5C0IB 3WFDH 5I1KH 2XTJE 1WICA 5CSGA 1GHFL 1V7ML 4JN1L 4J3OC 4JKLA 4PLJC 5BRZB 3L3HA 4APQA 1E4WL 4NZUH 3BKCL 5AZEL 1TDQA 5I17A 2QR0A 2P42B 4G80A 3BP4A 4BFGA 1NSNL 1NAML 2H2PC 1I9RL 3T08A 4IOFD 2QQKH 4HZAA 5EZJA 5IK3B 3NCMA 1PZUB 5H8DA 4EVNB 3SCMC 3BYTA 4J4PD 3D0VB 1I9IL 1C1EL 1F4YH 2ZZUT 3D69B 5JORB 1XR9A 2P43B 2X4TB 4QRRE 1MFEH 1QYGH 3DXAA 3V52H 5L6YL 1A4JB 3LQAH 1FHGA 5I1CL 1H0DA 4NWUL 3F58L 4JY4B 1HSBA 2IANB 1Z9LA 4I9WE 4LVOB 2FBOJ 3D18B 1HQRA 1KIRB 3P3YA 5DMYA 3GMNB 4PRAA 2EDDA 3P30L 3DI3B 2LTQB 1IC5H 3H3BC 1YMME 5EO9B 3EYUH 3H9SB 4X99A 1A64A 1AXSB 5DD6B 4H26B 1NBZA 1RAMA 4O2FA 1KYOJ 2WINA 3ROOB 3C5ZA 1HZHH 1UEYA 1NFDF 4OZ4A 4I4WA 4NNXB 3QUYC 3UDWA 3LVEA 3T04D 9CGTA 1KELH 4PGEA 4FS0A 2AW2A 4JR9H 1S78D 2PTUA 3SBWA 2BC4A 3RIAF 1HINL 4K9EH 1B4JH 1FV1B 2CR3A 4JFHE 3QXUA 4YDIL 3BO8A 2VDPL 5DQDL 3K8MA 1M1SA 2ATKA 4A2LA 1RJYA 3MOAH 1JGEB 2CD0A 2X1QA 2FIRT 3DYPA 2YRZA 3QNYA 4V1DD 1A6VH 1IM9D 5KANG 4O5LH 5JPNA 3FHQA 4PJ8A 3D3VB 1G9NC 2LAAA 5DVMA 4EOWH 5A16B 3B8YA 2VITB 3OR6A 3TO2A 2EYTA 1QOKA 4ZOEA 2NY1C 3DX9B 3SDYH 4GBXC 3W2DH 3P4OA 4PTUA 4OCRL 4ZUSB 4YDLB 4MXVE 4LDEB 2UY6A 3DIFA 4K8RH 1ZANH 4JPKL 2RQ8A 2IPTL 1JHKH 1DVFD 1T2JA 1LEKB 1IGYA 3ILQC 5ANME 4TNVK 4YHPB 4IRZH 1AQKL 2VZTA 1EEZB 3EYFA 3LIZH 1W72B 3F7VB 1FC1A 2IQAA 4KMQA 5FCUL 4KFZC 1JI2A 3O4LD 4L1HA 4PLJD 5KS9F 4LLQA 5TE4L 4QXWA 4ZUVA 1T21B 5IHBA 2ZUVA 1W72H 5FHBL 4ERSH 3MC0A 2H2PD 4X6EA 1B6DA 4QRTA 4OFIA 4AK1A 1FIEA 1IBGH 5AG9A 3QCUL 4YXLH 3MOQA 3SCMD 1MRFH 5J13B 3IU4H 5FOBB 1A3QA 4HLZG 1JFQL 3SO5A 3KGRA 4J23A 1IAIL 2BOCB 4PG9A 1I4FA 4LCWB 2O93L 1F6FB 5ID1A 5MENE 2OXGA 4M5YL 5JIIA 3P11H 2AV1B 4PJXF 2QHRH 3CX5K 4PJDB 1S9VB 1QQDB 2GITB 5E0QA 1KTDA 4F33B 3GUTB 4WGWB 4K7FB 1JWSA 2V5MA 1BQHA 1AHWB 1UENA 3G5ZA 3QDMD 4U3XA 5JDJA 1CL7I 4RFOL 5CFHA 2OK0L 1QLRB 3RY6C 3QUYD 1UKSA 5HJ3A 1AY1H 4K71C 4CU6A 2BSTA 4AEHH 1CD9B 1S7WB 4X6DE 1F4XH 1BQLL 5EBLB 5IKCB 2X70B 5FYJD 4D2NA 1IGJB 5DLML 4ISVA 4V1DE 4KMLB 4TULH 5I9QC 4HWBH 3OKOA 3HPJA 2G9HB 5AG8A 4R90H 2G75A 4Q9QL 2CPCA 4Y5YA 5GJSL 2X44D 3Q0HA 1QBML 1G7HB 3BDXA 1PEZA 2E7MA 1HQ4A 2NY1D 5B22A 4GBXD 3C9NA 2KQMA 5DJ6A 4I2XB 5F88A 5EU5A 5DA0B 2CO6B 1HHJA 4RFNB 4DFIA 3QQ3A 4BK4A 4NJ9L 5C6WH 2AJXL 3ILQD 2BVPA 43CAA 5GZNC 3G6DL 4DQOL 2ADGA 2GT9B 1A7NH 4WW2C 3N85H 2Y72A 3QIBA 3O4LE 3DVGA 1P7HL 5DK0B 4LHUG 3MJ7B 5EORH 1UEMA 4YDJB 4LDLB 2F15A 1AGDA 2DM7A 1R3KB 2B4CC 1JWMB 4L4VA 2DBJA 3I84A 1PSKL 5EBWB 2X1OA 1VFMA 3MV7E 4D9QE 1SYVB 2Y36H 1U8OB 2BVQA 2DKUA 2WQ8A 3VFWA 2CSPA 4I48A 1BHGA 4URTB 3QHZH 4QHLB 2X4OB 4ZFZB 3BXNA 2DLGA 3KG5A 4XH2A 2F8VA 2XQYG 3OKKB 3OB8A 1VFUA 3CNKA 5KVFH 4ZD3L 1FAKT 2XZQL 4KDVA 1G7JB 4HFUH 2JELL 4R3SB 2F53D 1I3RA 5LBSL 4NQDB 5CILH 1OARL 1WBZB 3E8UH 4S2SA 4OAWA 4RDQF 4OCWL 2YEZB 1EVUA 2ZCLH 3CVHH 3GMPA 2V7HB 4NC1C 5FO9A 5HYEA 4QOKB 1TZIB 2XN9D 3OL2A 2DQIL 1DL7L 2BNUB 2YPLB 1GGCL 4H1LA 1BWMA 4XBPB 4PRBA 3FO9A 4G9DA 1C5CH 3NFSH 2YRPA 2K7QA 3OG6B 1T1YA 4Q2ZA 2IBZX 2EE2A 4RGMB 5GGTL 2C1PB 1U8NB 4QHKJ 1EX0A 3GMQB 5A2IH 1J1XH 4YK4C 2P49B 2R29L 4GXUM 3VFOB 1KJ2L 2H3NA 5EA0L 3MLWH 2E7LE 3D2UD 4Z7UE 2DQHH 1P6FA 2FECI 5HHMB 2GFBB 4N9GA 3PDOB 3V95A 5JXEA 3AM8A 4WWKA 4HMCA 4QHNB 1NAKH 1Z9MA 5IR1A 4QF1A 4S1RH 1YEFL 4TRPL 4HUVB 1UVQA 6CGTA 2FIKB 4R26H 5EZIL 3GBML 2CMRH 3P0GB 3U2SB 1UWEL 2AVGA 1KLGA 2J8UB 1DN2A 3OAYK 4QT5B 1LD9B 5C09E 1G9MC 1Q0YH 5F3BB 1GOHA 1HSAB 3WFBL 3A67H 4Y4HA 5I1IL 3NCJL 1B3JA 3GMLA 2DMBA 1EDQA 3MGTA 3WEXA 2E27H 1N64L 5IHZA 1IM9A 1BQHG 4MCYA 1R5IA 5GZND 2NY7L 5DJDA 1JNNH 4YNYB 1BJMA 4WV1B 1YNKL 5J8OA 3ZYOA 3PP4H 1V7NL 4A6YA 3IDYB 5HI4C 1XCTB 4XX1G 1B0GA 5JR1H 3NIDF 2MNUA 5D1XC 5I76B 5BVJA 3EFFB 4F3FA 3H0TB 3FOLA 3L3KB 2LVCA 4PBWD 4S1SH 2NMSA 1U36A 1FORH 3CSYB 5SWZD 3SPVB 4Q6IA 1DVFA 1ACYH 1UH2A 1UZ6E 1AE6H 5ACLA 4KV5F 4M8QB 2EH7H 5DD1L 3QUKB 3FOMA 3BPCA 5ETUB 4HJGB 2P8PB 3C6LC 4XPFH 5J1AB 5E4EB 3GSQB 1F11B 3IDNB 4ONHB 1LP9B 3BP6A 4Z76B 4Z5RB 3SDCB 4QXGL 2QQLL 2A9NL 5H35A 1A14L 2F53E 1OB1B 4GSDH 5EC2A 1DEDA 2VLRA 3WFCH 3TA3B 5EBGA 5GRVK 5MI0B 5IF0A 5C9JB 3WLBB 2J2ZA 1QR4A 4OV6F 3SCMA 5IIEA 3U4EB 1TLKA 4XB8A 2XN9E 3HE6C 5BCAA 1ZGLM 4FNLL 3DURA 1PDKA 2DLFH 4CKVX 4NKDB 5GRWA 1HYSC 4ZOBA 1LO4H 4XZUA 1P5UA 4QHUB 5DC9B 5F3HA 1CXFA 4LGRB 3HC4H 4KQ3L 5ITFB 2XZAH 1EO8H 4F7EA 5DTFA 5KJRH 2YMXH 3VFRB 1Y0LB 3FJTA 4NHCL 4LAJH 4FQCH 3UZEA 4Z7WA 5D70L 2XY2A 1X5YA 2D4FA 1GAFL 3DVNB 4OT1L 2JJVA 1NFKA 4PY7B 4KTEH 5IQ7H 3VE0A 4OZIF 3U30C 5L2KB 1B0RA 1N4XH 3UYPA 2L4OA 3QDMA 4MDIB 1IM3A 1SEQL 3QXDB 5CLWA 1P4LA 5J4MA 1FNLA 4HSQA 4XPBL 3JWDH 4MVBA 3TJEL 3JV6A 5GRYA 3VDCA 5I73B 3PWNB 3SN6N 3F65A 4N0FB 3EW3B 2Y5EA 3O45A 1MI5E 3GM0A 5JW3H 3O2VL 2FX9H 2D3VA 3AFLA 1ND0B 4QXUH 2JK5A 3TCLB 1UM6H 2G2RB 4GAJH 5ILTH 4H1LG 5GIRB 4WUUB 1EEYA 2FHCA 2QL1A 4LLUB 4M3JA 3CMOL 1JTTA 3KS0H 4Y8AA 5EIIA 2DM4A 2MQCA 1T5WA 5HI4D 5C0GA 1CE1H 4X7CC 5D1XD 3X13B 4HV8B 3FQXB 1LK3H 3MPCA 1NGPH 5INDA 1FH5L 3TBVB 1SHMA 2FLBT 3GSRA 1ZVSA 4I8DA 1JZ2A 1NKOA 2FDBP 2X89D 3NN8A 1BQSA 1P9MC 3ZL4L 3LY6A 3GHEL 4UDUA 1BREA 1CCZA 3C6LD 4GKNA 3MX0A 1QEWB 2EDXA 3W0WB 5GGVL 2XZCH 1MWAL 4GRLB 5D8JL 3BAEL 4YDKH 1GC1L 2GI7A 3HZMA 3BZ4A 2PXYB 4ZQKB 1YY8A 5D5MA 1AJ7L 2E6JA 3QQNA 1T04A 1TITA 4F2MB 3QZWA 2ZUSA 1NMAH 3B9KB 4UT7H 4QRPD 3U36A 4XMLH 4M6NH 5FM8A 3NIGE 2R9HC 5IVXA 1C5DB 2EDLA 2WBJB 5HPOA 2X9XA 4N8PA 3HE6D 4JQXA 4MNQB 3GSNB 1AI1L 1R0AH 3C2AL 2HG5B 1HYSD 4PD4K 5C0FB 2YPVH 5TH2B 2I60H 3UYRH 5IB1B 4PJGE 5CZKA 3L95B 5ICZA 4HXBL 3QWOB 2R1XB 4JPWH 3GIZH 5JHDB 1KB5L 2QHLA 1IQWH 1FSKB 2NPLX 3MV9A 1CWVA 2ZOLB 3VDBA 2V7NB 3QUXC 4Z0BL 3RX5A 2CJUL 4N0UA 2OJEB 4JQIH 3QFJB 4HXAL 3ABZA 2B1HH 1I7ZA 2ADFH 2YWZA 5C0DA 1KJMB 3MACL 1KPVB 5J6HA 3TT3L 4WW1A 1P4IL 2VDMH 3QDGB 3U0PB 5IJVB 3RA7L 2XKUA 4P9MH 4Y4FC 4E41D 1BMGA 5I1LB 2PR4L 3SE8H 5ADOH 3LKOB 1J8HD 4G8GA 2QEJA 2UY7A 4LHQB 3I6LE 1YEDA 1NL0L 4GKZB 3JXAA 2LU3A 2BJML 2QKIB 5DI8A 4XMKH 2CIKA 5SX4I 1UB6B 1LE5B 5CMAB 4WI6A 3QT2A 4NZJA 3WO4B 4E0RB 3IVKA 2D03H 4RIRB 3M1BA 2VDLH 4LCCC 4M61B 4N1HB 3WCYA 4Y2DC 2C9AA 4ZO8A 4PP2A 3OSKA 4XAKD 2AXGB 4JN2A 1YYMH 4WW2A 3RUGB 4NQVA 4UIMA 4F15B 5GS0L 4QRQB 1RURH 5L2JB 1G7QA 4MXVF 4S0TD 4PRID 1RZ8B 4PJ5A 1RZIB 2P5EB 4U6YA 1MPAH 2OTWA 1BAFH 1CF8L 4QRPE 5CJQL 5SWZA 4U1JA 3Q3GB 4CUCA 1NCNA 4I18A 2YD2A 2YPKA 2JCCB 5IOPB 2R9HD 4GKSA 5E8EB 4PJFA 4DGVL 1OAZH 4YAQB 5TDPB 2AJVH 1I7UA 2AV7B 4JE4B 5AD0B 4JO2H 3H7BB 1YPZE 3AAZB 3TPUA 5IMKA 3T4YB 2VR5A 4LIQL 4P2QB 1BLNB 3FHAA 4X6FA 4XB7A 5KOMC 2M1KA 3S35H 2O5XH 3MRNB 4HIHB 1PEWA 3S35X 3B9AA 1ADQH 1VEMA 3FT3B 4OQTA 1IGML 3QDAA 1DQJB 1CS6A 5F1IA 1OLZA 1UH4A 4MZ2A 4U1KA 3MTRA 2ARJB 3CFIC 2NY5L 3QUXD 5K59E 5IW6A 3T2NH 3B6SB 5LGJA 5CBAB 2HFEB 2NX5D 2QSTA 5F9WB 5EU7E 5JOFB 2XQYK 1WTLA 2BK8A 5TF1L 3MNZA 3BPNC 4LARL 2RIKA 5SWSD 3BEWA 3L3HB 4APQB 3BPOB 4E41E 1Y6NR 2D7MA 4YR6A 5I17B 2QR0B 4G80B 4MJIB 3BP4B 4LGPB 4JM4L 4Y4FD 1J8HE 4XNYL 5I74B 3BH8A 1DZBA 4AQOA 5EZJB 3EZJB 4HLJA 4X6DF 4P57A 1J1OH 5GRUH 1ZE3C 5D6DC 3KYKH 1XR9B 4XTRC 3MLSH 3DXAB 7FABH 1IILE 4PJHE 3E6FA 2YUVA 4IEFB 4L3ED 4NT6A 4F57L 1L9NA 1TMCA 1H0DB 2HFFA 1HSBB 4Y2DD 3FTGB 3L3IA 3WNNA 1AGCA 5T3ZH 3FONA 5DDHA 1HQRB 1A7QH 4PRAB 4P5TA 4JFZH 3MLYL 2PO6C 2C5DC 3WS3A 1JPGA 2AQ2A 2QTEA 4PRIE 2P4AB 4WUKH 2PW2A 4X99B 5D1XA 2GJJA 3A6CH 3ROLA 1RHHA 4YJZL 1NBZB 2GHWB 4O2FB 4P99A 3HAEH 3WD5L 2OYPA 3IAGC 4NWTL 4ZMAT 3C5ZB 3DTXA 4OZ4B 4I4WB 1WCQA 1I7RA 1LDPH 3F7QA 4TSBH 1WFTA 4PGEB 4NRXA 2BC4B 5GRJL 1V3KA 4WEMB 4C56D 3BO8B 1QFUH 4R6UA 1EFQA 4WY7L 5BZWA 2ATKB 4N68A 1RJYB 4UI2A 5FOJA 3VXMD 5HYFA 4IIQC 3HRZA 1UB5A 4LU5H 2M26A 3QNYB 4FA8A 1A6ZA 3A6BH 1KLFA 1K9TA 2XV6B 3MJ8A 4IMKA 5JPNB 4PJ8B 1BD2D 4DFHA 3P9WB 4AQ1B 4N8VA 3HE6A 3OR6B 3TO2B 2EYTB 2VLKE 1JV5A 4X4YA 1B2WL 3P4OB 4PTUB 4N0YL 3C8KB 3SE4A 3K4DA 4MLIA 1AGFA 1KCLA 4H0IA 2IPKA 1HKLL 4CNIA 2P48B 2HVJA 1KEGL 1R3IH 1YPZA 4CVZA 3EFDH 5KZCB 2XY1A 1IGYB 5FFLA 5T1KD 2D31A 5D2LA 5SWSE 1BJ1H 3EYFB 1MFBH 2IQAB 5T1MA 4BZ1L 3B9EA 4JZNA 4LLQB 2J5LC 1OQOA 4XBEL 4Y5XC 4ELKA 4XGZA 4ZUVB 5AWNH 5IFJA 4LEXH 3VD9A 2ZKHL 2Q3ZA 4NDMA 4RMTA 4X6EB 3ULUL 3FMGL 4O9HH 4QRTB 5HDOA 3X11A 3F7RA 3PF2A 3C08L 4CJ0A 5A43C 2Z31A 4HWEH 4UTAH 1X4ZA 3QEGH 12E8H 4WCYH 4G6FD 4XTRD 4Z7UF 4JCLA 4LRNH 3V5KA 1DQLH 4PG9B 1KCUH 3U0WH 2XXMB 4AL8L 5ID1B 4J12A 1JL8A 4LSSH 1NDMA 2F5BL 4JFED 5HHOD 5IHLB 4HIJA 5F9JA 4DW2H 3TBTA 5CBEA 2B39A 2BMKA 2PO6D 5J1SC 1ONQA 5CP3H 3OKYA 4NFBA 5DUMH 3C5SA 1KTDB 1QRND 2VDOH 1JWSB 5C0BA 4F7TB 4HDIA 5JW4N 1T66C 1BQHB 4XCCH 4DZBA 3G5ZB 1TVBA 1MSPA 3U83A 4IDLA 2CQVA 4DJMA 1P9MA 2ICWJ 5DF0A 5HJ3B 2BSTB 5KVEL 1RIUL 4KHTL 1CGVA 1WFNA 2BZDA 3LRHA 4PGBA 1MCQA 1IGIH 1I1CA 1UZ6F 3VXME 1KUMA 5ALBH 4NO0D 4GXVL 4MHHI 4BH8A 1J7VR 1OCWL 2UWEA 3OKOB 5DT1L 1AFVH 2BY3A 3HPJB 5D1ZC 1RV6X 4X7FC 4Y5YB 2P8LA 3BISA 1CICC 4X7SL 4OD3H 1MQ8A 1IT9H 2FB4L 1HQ4B 4RZCA 3C9NB 5DJ6B 5F88B 5EU5B 5IWLA 1LO2H 1WT5A 3H42H 1BPVA 3QQ3B 1Q9WA 5F6IC 3MCG1 43CAB 2BVPB 4OQ1A 4DK6A 4YH6A 1CU4L 3CFEA 3QIBB 2XFXA 3B5HA 3DVGB 2E6PA 4MWFA 3LQZA 2BVEA 1EHLL 5F89A 4LVEA 5D96C 4FABH 1OAXH 5E8NA 4I77L 1AGDB 1CL7H 3VXUA 1RQ5A 1U92A 4OFYA 3UJTH 3UTZA 5LQBH 4L4VB 5FUCE 2FHFA 5IEKA 2NX5A 2IF7A 1UT9A 2LFGA 1X5XA 1GC1C 5KSBE 2Z9TA 4WO4A 3VFWB 1U91A 4EQ3A 4J6RH 3K80A 4I48B 5SWSA 1YEJH 4JG0H 3BXNB 1KENL 1RULH 4XH2B 2Q76A 5JTWA 1WISA 4JFEE 4N8VG 3STLA 5DYOA 5JMRA 3FB8A 3VW3H 3GMRA 3RZWA 4NJAL 4QLRA 4XXCC 1F4WL 2VSDA 4V2CB 5D93B 4X9IA 5FB8A 1I3RB 1MFDH 4JCMA 4YPJA 2VR9A 4S2SB 4OAWB 3GM8A 2Z93A 3GMPB 3VXQA 5FO9B 4LSVL 1AXTH 3CXDH 4L3EA 4H1LB 4QGTA 1T66D 3HUJA 4PRBB 2WWKO 3FO9B 4G9DB 4MAYA 4LF3A 1KEMH 3Q1SH 1T1YB 4Q2ZB 1S9XA 2BXYA 4MJ2A 3BN9C 1GPOH 4PY8J 3S3PA 1A5FL 2H3NB 2Z35A 5F7YC 3V6BR 1I3VA 1KOAA 4C4KO 1EFXB 3NOIA 2Q8AL 1CLZL 5IB4A 2C4XA 3HG1A 4N9GB 1TJGL 5DUBA 2LU7A 4WWKB 1QSED 1DSFL 4NKIH 4QF1B 5IR1B 3K8LA 5D1ZD 1UVQB 1CICD 3D48R 2EDRA 2Z4QA 1KLGB 4C56A 1I1RA 3BP7A 2G60H 4Y4HB 1RJLA 1UWXK 3NIGF 1EV2E 2FYYA 2QADC 3GMLB 3RNQB 3ZT7A 3MGTB 4PTTA 3WEXB 5IHZB 1KSRA 1J18A 1R5IB 4MCYB 1BP3B 5DJDB 1BD2A 5B3JE 4A6YB 3N9GL 1B0GB 4KROC 5JNYA 5BVJB 4F3FB 3RWFA 2A6KA 4M7LL 3FOLB 4OGZA 5DUPL 3VH8A 3I2CL 1FL6A 3MRCA 4PJGF 4Q6IB 5GS0C 1DVFB 2IWGA 1JGUH 5T1KA 3FOMB 3UXFA 3BPCB 5EOQH 3MGOA 4YHZH 3HNSH 2PYEA 1P1ZA 5HDLA 1J0HA 3OBAA 3BP6B 4DKAA 3TT1L 2BY2A 3BSZL 4HK3J 2ITCA 2P8MA 5H35B 4JY6A 2C3GA 4XNMA 5EC2B 3VWKA 2VLRB 2W59A 4X9HA 3C09B 3ZDXE 3ARBC 3IDGA 5IF0B 3RKDC 3LHPL 3SCMB 1MJ8H 5IIEB 2JLLA 2DRUA 2DQGL 4K23H 3MROA 5IFHL 1DFBL 1CR9L 2HJLA 3GSOA 3WN5C 5DVNA 3R0MA 4XZUB 2V5YA 3SKUD 1YC8A 5F3HB 2VKWA 5HHOA 5HDBE 1WIOA 4F7EB 5DTFB 4JFDD 4MA1B 1DDHA 2DN7A 2PO6A 3GFUA 4ODTH 2R1WA 2NY5C 3BN9D 4Z7WB 3EOAA 1QRNA 3A6OA 4G6KL 4ZAKC 1EZVX 2J6EH 4HH8A 3VFVA 3VE0B 4C83A 1B0RB 4HUXA 1JVKA 3FB5A 3F7YA 2HRPH 3V6ZA 3LRSA 1I75A 3QDMB 3HR6A 1IM3B 1QSEE 4BUHA 3SDXA 3VFPB 2BSRA 4CAGA 3T0EA 4L8SC 1P4LB 1KJ2A 4W81A 5E56A 1OAYL 4NO5A 3JV6B 1XF5A 2ADIB 3G08A 4L8BA 3PL6C 4OCXL 4U6HA 3O45B 3QG7L 4QGYA 3ET9F 4NCDA 2JK5B 1JYNA 4ORZC 2QADD 3NH7L 4KTDH 4IIQA 2YOCA 5DJYA 5HGDA 4AT6A 4R7NA 1EEYB 4AMKH 3EDJA 1LK2A 4H5SB 5EIIB 1T5WB 4Q58C 5F9DC 1ZT7A 3MRHA 3DSNA 4KROD 5C0GB 4LVNC 4WEUD 5INDB 1FLTX 35C8H 5HYSA 3BWAA 1G9NH 1ZVSB 1MIML 3H3PH 5GS0D 4Y0GA 1F90L 3FFCD 4U0RC 3NN8B 4O51A 2F5AH 4BKLA 4KPHL 4UDUB 4LPCA 4GKNB 3VXTA 4Z95H 4JZJA 1XF1A 1F5WA 5K59F 3LKPA 3HZMB 3VGDA 3BZ4B 1TNMA 3ARDC 3MA9H 3UTPE 3RZCC 1YY8B 3ZSSA 1S9YA 5D5MB 1AO7E 1T04B 3QZWB 1RZJL 3D0LA 1MCDA 5C0CE 5DHYA 3RWHA 1C12A 4AIXA 3U36B 2DYPD 4JFFD 1U3HA 3ARBD 3TIDB 4M48H 5IVXB 3I9GH 1NEZA 3RKDD 3VFTA 4HBCH 1FFRA 5T5NF 4OLWH 1Y18A 5JIKA 2MHAA 3FQNA 4TSCH 5CZVH 3SGEH 2EDOA 2CK0L 4OGXL 4P4KC 4X7EC 1FNAA 4KI5E 2FD6L 3V4UL 1WWBX 4JFDE 2J4WH 4JY5L 4RRPA 3O4OC 5IESL 5ICZB 1OSPH 4FFVC 4LPVA 4PJHF 4P59H 5TF0A 3MV9B 3PWJA 4D9RD 4ZAKD 1OQXA 4P23C 5DMIH 4IM8A 1N6UA 4K3JL 4N0UB 1BJ8A 4MNGE 1PX4A 2FCBA 4D9LL 3LEYL 4OJFL 4FMKA 3O3AA 1I7ZB 3SEPA 5C0DB 3MNVA 2F54D 5J6HB 3VFMA 5I71C 1JGLH 1HH6A 3PL6D 5SX5K 4WW1B 1F00I 1I1AC 3ULUC 3BVNA 3WFEL 5GJTH 2DBLL 1RUPH 5CHNA 2ZUXA 2YD6A 1N8ZA 5ESQA 3LAFA 4YFLF 4G8GB 2IQ9H 5I9QB 4PG2A 2VWEC 3PGDA 5DZLA 4MJ5A 4MQSB 1YEDB 4R4FH 5D1ZA 3MBEC 3U4BL 5EU6A 1MELA 5DI8B 4X4XA 4FP8L 2CIKB 1CICA 1TTFA 4ZODA 1G6VK 1WCBA 3SQOL 3IVKB 1XT5A 1K2DA 5CEYA 1TNNA 3M1BB 2VZ3A 2XWBA 4FZEL 4MAUL 3V2AR 1WC7A 3D1MC 4OF5A 4PP2B 1IEBB 4PJIE 4HPYH 4JN2B 3U9PH 3SKJL 2IG2H 4MB5A 3ESVF 1BFTA 1W0YT 1OAQL 3HMWL 4WW2B 4ACPA 3B2VH 4MQXC 4NQVB 4UIMB 4PJAF 3BDYH 3HI5L 2Q1EA 3MV8D 2R2EA 4PJ5B 2GY7B 4BM7A 1FVDA 3RJQB 3SE3C 3DBXA 4U6YB 4D94A 5LWYL 3ARDD 2OTWB 1A6UH 3RZCD 2Z8WC 5EB9A 5SWZB 4P46A 2OZ4L 3H6JA 4U1JB 2A38A 3CZFA 4JFFE 4YHYC 3VFGL 3GKWL 4I18B 1INEL 4KJWC 32C2A 1MWAA 2YPKB 2KKQA 1S7VA 4NPYA 4GKSB 4Z7VE 5J1TC 3TZVA 4PJFB 1FCCA 4GAYA 3VXNA 5JUEL 5KVGL 1S5IH 1JUFA 1GRWA 4DGIH 4P4KD 2BY0A 4EI5A 5IGXH 3TPUB 1IEAA 1LNUA 4CMMA 3WDIA 1MLBA 2WUCL 4OM1H 4XXCA 1H3WM 4X6FB 5ADPH 2VDKH 3QUZC 1YYLH 3GSUA 1F42A 4PB9H 5HYSG 4PJ9A 1PAMA 2WY3A 4BFIA 4FFVD 1J0ZA 4XPTH 4D9RE 2HVKA 3HPLA 3QCTL 1ZHBA 5F1IB 4P23D 3X3GH 2ATPA 5IW6B 4X5WA 4NM4H 5E03A 4C55A 4I0KA 4L4TD 3S97C 5LGJB 1OAKH 1KCGC 4NM8L 3DV4A 3RFZC 3PWUB 2A77L 1KB5A 2IH3B 1ORQA 1EH9A 4UQ2A 1FFQA 2J3SA 3MNZB 4YK4B 1L7IH 2EDNA 2RR3A 3BEWB 2X1PA 3UO1L 3UCRA 4YR6B 2DQTH 5DRNA 1I1AD 3ULUD 1NEZG 3SKNA 4U1IA 2C7UB 1KYOK 2DIBA 1ZA6A 3I85A 3BH8B 2HAZA 4YBLC 4HIXH 2MKWA 4L9LC 4P57B 1AC0A 3MBED 4JRYE 3L5XH 5K9JL 5HGBA 4LSUL 2B1AL 2LE9A 1TMCB 3E6FB 4NT6B 2HTLC 2HFFB 2CLRA 4KI1A 3UTTA 4OI7A 5DD3H 5E7FA 3L3IB 5H37H 1AGCB 3FONB 2X05A 1P2CA 5DDHB 4NN6C 4OLEA 3WKNA 4NZDA 3OZ9L 4P5TB 2VAAA 4FTVD 1G9MH 3WS3B 1BM3L 4MQXD 1JPGB 1Y6KR 1U6AH 4UQ3A 2D9CA 3CAFA 4OI8A 1NCCH 2PW2B 5D1XB 1S7UB 3ROLB 1RHHB 3TN0C 1OD7A 3O0RL 2V2XA 5GHWL 1V5JA 2VUOA 4M62H 3DTXB 3FFCA 3IYLW 4OSUL 2AEWA 1I7RB 4KJWD 3Q48A 4NRXB 3S5LG 4MS8C 4ONFH 2DQDH 3BUTA 1L7TL 1OM3L 4B7IA 4Y19B 1M7DA 3LDBC 4NN5C 1PQZA 4PJCE 1KCVH 2X6MA 4PJ7F 1TTGA 5BZWB 2E3VA 2L7UA 4WU5A 5KSBF 1T1WA 3HRZB 2DM2A 1UB5B 4NP4H 5INCA 1A6ZB 2GTZA 3QUZD 4HD9A 3MJ8B 5LGHH 1GGYA 4N8VB 1FC2D 3DECA 3HE6B 4U6XA 1EAJA 1JV5B 4X4YB 1D5IH 6FABH 1VFAA 2BERA 3ZLQC 1NMBH 1AGFB 2DWEA 5DJ8A 2IPKB 1MHHA 3HR5A 2ERJC 4CNIB 2HVJB 5I15H 4CVZB 3V5HA 5F71A 2PTTA 2D31B 2NY3C 2JJTC 5D2LB 4KMTL 5AYUL 2BNQE 3LKNA 4WHDA 3CC5A 3QIWC 5T1MB 3ULUE 4XVJH 1Q38A 4JZNB 4ZAKA 3WXWL 4NZRL 1MOEA 3CGTA 4ELKB 2VC2H 4XGZB 4OFKA 5IFJB 3L9RA 5E95B 1QR1A 2VWEE 4NDMB 5I30L 4V3EB 5M95B 3X11B 5HDQL 3GHBH 2Z31B 4KHXH 2F54A 3PNWA 1NCWL 3PL6A 1IRAY 2DF3A 2P47B 3IKCA 3FRUA 1GHFH 1V7MH 2YK1H 3NIFF 4JN1H 3ZE1E 4OZFH 1E4WH 3QXTA 3BKCH 3V5KB 5DURD 3WDHA 1MFAH 2HTLD 1NSNH 4RCAA 1A7PL 1SEBA 5BJTA 1NDMB 4N90D 4BQ9A 1NAMH 1TPXC 1I9RH 4FTVE 3MRKA 3VD7A 4HIJB 5EUKA 5F9JB 1JYWA 3TBTB 5CBEB 2BMKB 4JVUA 4JRXD 1ONQB 1I9IH 1HILA 3C5SB 4TUKL 3LKQA 5CSZA 3KPMA 2W0LA 5ALCL 2YA0A 5C0BB 1CDIA 4HDIB 2A9ML 4PJBE 5FCSH 3VWJC 4GRMA 1ZHNA 3TN0D 5L6YH 4DZBB 5I1CH 4NWUH 1KN2L 1TVBB 2HH0L 1OGAD 3O6ML 5AYQA 4AJ0A 2HN7A 5B3JF 3BGMA 5IG7A 3C60A 2EYRA 1EPFA 1BF2A 4MS8D 1JHLH 3P30H 2W92A 3MV8A 5FM5O 5DHVB 1LMKA 4Y16C 4PGBB 1NC2A 3D39A 1CXKA 3ARDA 2YSSA 4OLYL 2A1WL 5JIHA 4BH7B 1VKXB 3ARFC 4BH8B 2WZPD 4MD5A 2UWEB 2DJ4A 1PD6A 5HVWA 5IFAL 3U7WL 2GJ6D 2P8LB 1JZ8A 2GSIA 4F80A 3IT8D 3L3GA 3KHQA 1YMHA 5DD5L 4ZTOL 2YBRA 4RZCB 3ALXA 1HINH 3Q5OA 4UT9L 3FFDA 1F97A 4YDIH 4GAGH 3MSPA 2BOBA 2VDPH 2HFTA 5DQDH 3ZDXF 4DN3L 1G7PA 1Q9WB 1WAAE 2FJGA 1ZTXL 2NY3D 4XNXL 4FN0A 2XFXB 2YD9A 3BJ91 2H26A 4MWFB 3UROR 2GIYA 4KVCL 1DLHA 4PGJA 3QIWD 5F89B 1FQ9C 2EIDA 2X41A 4QRUA 3SGKA 3GO1L 1RIVH 4JM2F 4P23A 4ETQA 5HDBF 4OCRH 3VXUB 1U92B 3UTZB 4L4TA 4ZUTA 5IEKB 2NX5B 4JPKH 3HHRB 1E4XI 2IPTH 3GZKA 1P7QA 5DQJA 3M17B 4WO4B 1AC6A 1U91B 1AQKH 3RPIB 1KNOA 5BW7A 3AY4C 1VERA 4LVOC 4Q9RL 1RZJC 1B90A 5FCUH 1I1AA 4X5XA 2Q76B 1IAMA 3IDIA 5D4QA 2XQBL 4Q0XL 1VGEL 3STLB 1KFAL 3NTCL 3FB8B 3ALWA 2LTQC 3GMRB 1TXKA 5DYOB 5TE4H 2UUDK 3KYMA 3OQ3B 5A2KH 5FHBH 1EJOH 2YKLL 3EDDA 5GRVL 5DFTA 5FB8B 3TBSA 4JRXE 1UCTA 3MBEA 3QCUH 1H3GA 2Z93B 1T7WA 1CK0L 5DC4B 3QYCA 3CLEL 3VXQB 4L3CA 5IB5A 1JFQH 2PUQT 4L3EB 4HAGA 1IAIH 3VXSA 1IE5A 3HUJB 3VWJD 4MAYB 4LF3B 4M5YH 4F9PC 4JVPA 1T80A 1S9XB 5A1AA 1ZSDA 1JNLL 4JFYA 4IOSD 1ZK9A 4D0DA 3GSNL 4XAWL 5CJBA 2Z35B 4ZNEE 4JREC 4Y16D 5C08D 2BX5A 5JW4R 2DWDA 5MEOA 4XT1C 5IB4B 3HG1B 3RQ3A 5F97E 3ARFD 5DUBB 3OV6A 1CIDA 43C9A 4RFOH 2HLFC 2OK0H 2ZSVA 1II4E 1SJXA 5FGBA 1YEHL 2Z4QB 3J8F7 5HGHA 4C56B 1BQLH 3BP7B 2OM5A 3TFKA 5F1NA 4M7ZB 2FYYB 5BRZD 5DLMH 3HCVA 1DQDL 4PTTB 4YIQA 1GGBL 3BKJL 1NGZA 4NNPL 3QUZA 2EDTA 1CVRA 4LLVA 1LQSR 1BD2B 4Q9QH 4CU8A 5GJSH 1QFPA 4KI5F 5FYKL 1QBMH 4F58L 5JNYB 2P5WA 1JZ6A 2O5ZL 3RWFB 2A6KB 4PRPA 1NBVL 2NR6C 3VH8B 1FL6B 3MRCB 4F7PA 4B0MM 3P4MB 2J12B 2CGRL 5L0QB 1BOGA 5T1KB 2GCYA 1TJHL 4NJ9H 4BQCA 3MGOB 3G6DH 4DQOH 2PYEB 3BPNB 4P5MA 4CVUA 4WVRA 1INQA 5EOCL 3LV3B 4JDZA 1G7MA 4ZUUA 5A40E 2ITCB 1E4JA 2P8MB 4U31A 3F5WA 4JY6B 2FO4B 4XNMB 1DBKL 4L1DA 3VWKB 3GEWB 3M8OL 1PSKH 3IDGB 3U79A 4L9LA 1AHWC 4GS7B 5D7IE 3MROB 1SJVA 2B7DT 2EDWA 4YWGL 3CIQA 2HJLB 2VN4A 5KVDL 1KXQE 1U3JA 4L8CB 4TPRL 1H3TA 3ETBF 5HHOB 2LABA 4ZD3H 2XZQH 1VEPA 4UB0L 4XVTH 2JELH 1DDHB 2PO6B 5LBSH 1U8HA 2QSQA 1U8QA 4OZIB 5F1OB 2OX5A 3EOAB 1QRNB 4OCWH 2IBZY 4PJIF 2W07A 3OX8A 1QHPA 1T2XA 1YC7A 2N4IA 1MNUL 3VFVB 1XZ0A 4NQSA 1KCSL 2DQIH 1DL7H 1AD9B 3FB5B 4HUXB 3F7YB 3D3VD 3V6ZB 3LRSB 4HIEB 1GGCH 1TENA 1OGAA 3SDXB 4XHJC 2BSRB 3W39A 3T0EB 1MFCL 3MUZ1 1KJ2B 2HLFD 5C0AB 4NO5B 4NOBA 5B8CB 1XF5B 2Q8BL 4MS8A 5GGTH 4RFNC 5HBBA 3G08B 4L8BB 2D7QA 2W0KA 3O81A 2R29H 4U6HB 3H7LA 3N1PC 1U8MA 1KJ2H 2GSGA 1KT2A 5BRZE 4GW1A 4HCRA 3MZTA 3GI9H 3DSFL 2BNRA 4HUWA 4Z7VF 3JTCA 4KK5C 4IIQB 5DJYB 4M93B 3ZYZA 5HGDB 2Y06L 3DARA 5DMKA 4R7NB 5AAWA 2GJ6A 4KUZL 1YEFH 1LK2B 2EDBA 2V2TA 1RJZA 3GNML 5HXMA 4ALAL 1ZT7B 2FL5B 3MRHB 5EZIH 3GBMH 1J11A 3NCYP 3T4AA 2IMMA 3ZE0E 1M05A 1UWEH 2XT1B 4HMDA 3V0VA 1CE6A 3CUPB 2NR6D 3RPKA 3WFBH 5HYSB 3BWAB 4LSPH 5I1IH 3NCJH 4O51B 4G7YL 3ZTNL 2JJTA 1N64H 2IANE 4BKLB 4LCWD 4KK9C 4OB5L 4JZJB 1GIGL 2IALA 1SMAA 3QIWA 1YNKH 4ENEC 1V7NH 4EKXA 3LKPB 5TJWK 4WI9A 1BECA 1T7XA 2I26N 3G6AB 2J5LB 2RGSA 1S9YB 2N1KA 4LAQL 1VPOH 3D0LB 3H9SE 2AEPL 5DHYB 3RWHB 1C12B 4CL7A 5E9DA 3B5GA 2AGJL 4K94L 1U3HB 3GBNH 1HKFA 5DD1H 1DP0A 1NEZB 3QEUA 3VFTB 1DUZA 1Y18B 5BV7L 2MHAB 3FQNB 3OGOE 4DKFL 1J9CT 3JWOL 2DLHA 3EBAA 3DRQA 4QXGH 3VD3A 4NRZA 1KBGL 2QQLH 2A9NH 3HMXA 1A14H 4LKXA 4XPHL 3P77B 3MLXL 1OHQA 1BVKA 2B2XH 2Y6SC 1MH5A 5ITBL 3RX7A 5TE7L 4XP4L 2RB8A 5CKAA 3CD4A 4NQCD 1G84A 3OB0K 3PWJB 3D3VE 1ETZA 3PQYD 4FNLH 3W5MA 3TGXA 5F8QC 1QNZL 4LCYA 4ODVL 4XHJD 1IJ9A 1BIIA 2OR9L 3THMH 3GIVA 3O3AB 3NABL 5C6PB 5DVKA 3MNVB 1Z6JT 3VFMB 1HH6B 4NHCH 5D70H 5I1AA 3ARSA 3BVNB 5C08A 1GAFH 3MUGA 4OT1H 5CHNB 3IDYC 1N8ZB 5ESQB 3VA6A 5KSAA 4L29A 1A8JH 1A1MA 4KK5D 4M6MH 3PGDB 1SEQH 2DIJA 4HKXA 4MJ5B 3UPRA 5EU6B 4X4XB 4PJCF 1CICB 3TJEH 3M07A 1WCBB 3UBXG 1K2DB 5CEYB 1N5YH 3LMJH 4MB4A 4YUEL 2XWBB 1R6VA 1WC7B 3CZJA 3O2VH 3OKMA 5MP6L 1BVZA 5L7XL 4PJAA 3MCKA 4LCWE 1JNHA 1ODAA 1MREL 2R2CA 5F9AC 2NY6B 3ULSA 4KK9D 1PLGL 1K6QL 3AMKA 1YEKL 5GGSY 3CMOH 2R2EB 3RHWK 4ENED 1WEJL 5MI0C 1FVDB 4NO2A 4PJDE 5DXWA 3DBXB 3IS1X 1MQKL 1QBBA 3D0VA 4P46B 4O2CA 1FH5H 3CZFB 4GQ9L 4ELMA 1L9MA 32C2B 1MWAB 2WW8A 1S7VB 4NPYB 3RAJH 15C8L 3TZVB 4W4OA 3ULUF 3ZL4H 3G9VA 4GAYB 3GHEH 3PHSA 3AY4A 3VXNB 1ORSA 1PBYA 5E1HB 3U9UB 1JUFB 5GGVH 2O5YL 1MWAH 5D8JH 1YEIL 3BAEH 1GC1H 1XGYH 4EI5B 3WJLC 4R97B 3JZ7A 3PABA 3K46A 1IEAB 1LNUB 4CMMB 1MLBB 1AJ7H 3BRFA 4B41A 5EO9A 2GYSA 5T1LD 5DD6A 3GSUB 4H26A 2Y6SD 4PJ9B 3SKOA 3ZE1F 5TFSL 4FXKA 5E8DH 4BFIB 1P6AB 2HVKB 3FCTA 3HPLB 5CGYC 3NA9L 1ZHBB 4ZTPL 4OZFG 3LZFL 3AXLA 1AI1H 2ATPB 3C2AH 4X5WB 1JK8A 3V6OC 5DJXA 4AIZA 3DV4B 4QRSA 3UEZA 1KB5B 4I2XE 4HIIA 1ORQB 4X98A 4N8CL 4UQ2B 3T65A 1R24B 5IB2A 1UG9A 1MFNA 1IC4L 1XGTA 3P40A 1XH3A 5T5NG 3I6GA 3K2MC 2MSPA 4PJBF 4MXWL 1YNTA 1KB5H 3CFKA 5DRNB 1FFOA 4WHYH 3SKNB 2ZCKL 4U1IB 5IBLC 2WWKT 3T1WA 3D3VA 1ZA6B 4PS4L 5D7SH 1J1PH 2E7CA 4Z0BH 2VB5A 2CJUH 1T4KA 1FBIL 4HXAH 3TH3T 4PPTA 4M1DL 1UYWL 5HGBB 1NGXA 3MACH 4R7DB 3ARPA 4C4KT 3ARZA 4YHPA 3TT3H 4G5ZH 2VISA 3EOBA 1P4IH 4OZGA 3HZKA 1MHPL 3RA7H 2CLRB 3UTTB 4R8WL 2PR4H 2VLLA 4GRLC 2OTPA 1P2CB 2PXYC 1T21A 2DQCL 1NMCB 1NL0H 3PV7A 4UQ3B 4U7KA 1IAKA 3E3QC 2BJMH 3LH2H 5ISZA 4NQDE 4EI6A 4JPVL 3L1OL 4KROB 4LFHG 1I3UA 4JJ5A 3L3DA 4IHOA 5B38G 2WBJC 1N6VA 1WAAF 2WLYA 3UC0L 4KH2A 4QOKE 4H8WH 2YPLE 3FFCB 5ESVA 2JB6A 3ARWA 3CSPA 3OJDA 1JWUA 1I9EA 3PHOA 2X4RA 1XFPA 1IZKA 2AV1A 3AUVA 3HRPA 5GS0H 2OZ4A 1M7DB 2FJFA 3RVVC 1PQZB 3HI1A 3AMLA 1Y6MR 2FX7L 2X1XR 4WU5B 4FQHA 1CF8H 5CJQH 4GO6B 3QQ9C 4KQ4L 5INCB 1HIML 5HHME 2GTZB 5L2KD 5CGTA 1HHGA 4OLXL 4LASL 4DGVH 4U6XB 3RWEA 2DOCA 2DLTA 3K81A 1RI8A 5CGYD 4WI2A 1VFAB 5HYJD 2DWEB 5DJ8B 1MHHB 3HR5B 2WQRA 2J8UE 2BDNL 3V5HB 1OW0C 2HA1A 1K4CA 2PTTB 3RGHA 1OTTC 1ZLVH 3LKNB 4ORGA 4L5FL 2W9DL 3TCXA 3CC5B 1KN4L 4NQCA 3EDFA 4N0CC 4ZAKB 3PQYA 4J3XA 2EKSA 4WUUD 2MMXA 4JHBA 1IGMH 5IBLD 3WFDL 1P4BL 1QR1B 2NY5H 3WO4C 2B0SL 4LSRL 5KOVC 2VJXA 2LVEA 1CGUA 2DKMA 4M00A 4A6YL 4TOYL 2F54B 3MLRL 3PNWB 3C8HA 3PL6B 5TF1H 2VL5A 4LARH 3IKCB 3FRUB 3QJFA 2YUWA 1LO3H 1XGQA 1ROWA 4CN1A 4PP1C 3K7UA 3ZKQD 1LP9E 4JM4H 3IU3A 4L4JA 1SEBB 4KRLB 5BJTB 2KZ1B 3KPRA 5JOEA 4GRLD 3NACL 4XNYH 3MRKB 2PXYD 3Q2CA 2QQNL 3VFUA 1ZLUH 5HPMA 1GL4B 1EGJH 3B9KD 2KPNA 1HILB 3LKQB 5CSZB 3KPMB 4LVNB 3NFNA 1OWWA 3SGJC 4MA8L 4GRMB 1ZHNB 4F57H 2WBJD 4UV4L 1J86A 4O4YH 4WFHD 3Q6FA 4MNQD 1Q9OB 4FXGA 2HN7B 1TJIL 5FKPA 4LBEA 3BGMB 5IG7B 3C60B 2EYRB 3GJFH 5F6HI 3MLYH 4YXKH 4RMVA 1D6EA 4WHCA 5E6IC 3MV8B 2V5SA 5FGRA 3RVVD 2R56L 1NC2B 1FIGL 1DQML 3D39B 4WTZA 5BS0B 5EO0A 3QAZB 4XC3L 2YSSB 4Y1AA 1KELL 1T2QL 2XZZA 3I02A 1HNGA 4MD5B 3AU1A 1W8OA 2OLDA 3QQ9D 4NWTH 5L2KE 3X14A 5T5FL 1IVLA 2R4SL 1FO0A 4XBPA 3VXRD 1O7SA 1ZS8A 3O6KL 4OZHA 2GSIB 4OD1L 3L3GB 1YMHB 2YBRB 4PJEF 4XCFL 2I5YL 1CDGA 1U8NA 1A6WL 3FFDB 4Y5VA 3VFOA 4OTXL 2BOBB 1QFWM 4WY7H 2NLJA 3QDGD 1G7PB 4IRSA 5T1LA 2FJGB 5D7IF 1WBYA 4U0QB 4YHNA 5JIPA 5FYKD 1OTTD 1PKQA 2ICWB 2H26B 2VYRE 1DLHB 4OCLC 5FM5M 1ZANL 4WUUE 4QRUB 4TVPL 4G7VL 4N0CD 1Q72H 3MRGA 1B2WH 4NFDA 1RUAL 4L4TB 4ZUTB 1HKLH 1EAPA 2APXA 3HZVA 1KEGH 5F7DA 1P7QB 3RIFF 5DQJB 1GGIL 5F3BA 4HS3A 5FYLL 1KNOB 1WZ1L 2FR4A 5EOTA 4BZ1H 1HHKA 1I1AB 4X5XB 3IDIB 4K94C 4PP1D 4UT6L 3W0WE 1JHTA 1IGCH 4RBPK 3KYMB 1T3FA 2YHGA 2ZKHH 5BV7C 3TBSB 3ULUH 3FMGH 5EUOA 3JWOC 1MCIA 3RDTC 1CDYA 3MBEB 5FYJU 3E3QE 3C08H 3C5ZC 3BH9A 3MGAA 3KPQA 4XNZC 1QFOA 3VXPA 5IB5B 2VXSL 2ZNXA 1S8DB 4LL9A 1F45A 4J1UA 4WFFE 2VIRA 3VXSB 3DRTA 4WFHE 4MNQE 1A1OA 2QHRL 3RP1A 4AL8H 1FNHA 1J12A 2F5BH 2RJMA 3MLZH 1MCNA 2VO5A 1ZSDB 1N7ML 4GLRI 4KY1L 1T89A 1TETL 3FQUA 3RNKA 3ZE0F 4D0DB 1RZKL 5F70A 5E6ID 5JHDE 4FQXA 4PJ8C 5JOPD 5IJKA 4D0CB 2DWDB 5MEOB 3TO4C 4KJPC 5D2NA 3S4SA 1JMZA 1Z3GL 43C9B 2R2HA 4NKDA 3KXFD 2ZSVB 1MIEL 1X5IA 3EO0A 4QHUA 3QFJE 3E6HA 1URLA 4ZFFA 1RIUH 4KHTH 5HGHB 4HWBL 1EEUA 4LMQE 4X0KA 1JTOA 1NLDH 2XACC 3QDGE 5F1NB 2E8ZA 3HCVB 5FYKE 4GXVH 1JPST 2AJUL 1NGZB 1OCWH 1S7XA 4MJID 5DT1H 3QUZB 3RL1A 5GS1A 4LLVB 5JPMA 1CFSA 1AR2A 1Z0MA 4XI5C 4X7SH 2P5WB 1HCFX 25C8H 2FB4H 4PRPB 5HYJA 3MYZA 4Y8DC 3VRIA 1A7NL 4JFXA 4F7PB 4WEBL 3FT4A 4PGDA 5L9DL 4NBXB 3QWRD 3V6OA 1JPTH 4WTZG 3DXAD 1BOGB 2GCYB 1PFCA 4J2XA 4C58B 3BZEA 4Z78A 4H0HB 1CU4H 2FEEI 2CKBH 3BKML 4P5MB 4RBPH 1INQB 3GSVA 4JDZB 3RUGE 3TYGL 4UMGA 4DVRH 5IHUL 1EHLH 1G7MB 4ZUUB 1PVHA 2EZ0C 3DNKA 4LLUA 3F5WB 4I77H 2LU4A 2P5EE 5BVPL 1J87A 5C2UB 1OL0A 8FABA 4ZFGL 3L3JA 3TBVA 4L9LB 3RDTD 1E28A 4U6VL 5FO8A 3C5ZD 1MY7A 2JCCE 3OG4B 3MO1A 4LHUD 1EXUB 1OP5K 4P4RA 2BVOA 1CDJA 1MHEA 5IBUB 1MRCL 1KENH 1FZJA 3PDDA 5DK3A 2WV3A 2R0KL 3IDXL 4PLNC 4OIIL 1WWAX 4JKPL 5HGGS 4NJAH 2ZUWA 2AAVA 4NN6B 1F4WH 2DL9A 1OTUC 2OCFD 4P2QE 1U8HB 1U8QB 1DBAL 5TE6L 4G43A 1TVDA 5JOPE 4EXPX 3OX8B 5DMJB 4LSVH 1XZ0B 2DTML 4NQSB 2UVEA 4PJ8D 4LKCA 3TO4D 4KJPD 1I8LA 1OGAB 1DBBL 5ENWA 2AK1H 3W39B 4PRNA 4ZO6A 3T3PE 2RCSL 4D3CL 2NZIA 3GBLA 3IDMA 4KUCF 1FDLL 4PJDF 4OQTL 1MAML 5I66A 3MMEA 1MJ7L 4KTYA 4NN5B 3MXVL 1U8MB 1A5FH 3QIBC 1NAKL 1KT2B 3IJYA 4GW1B 1FZMA 1SVZA 3G6JA 1QFWH 2BNRB 4HUWB 4OF7A 4FFWC 5E5RB 2Q8AH 3RVTC 4KAQH 4GRWB 4MJIE 1CLZH 5CJXC 3PWLA 3E2HC 5KANI 1TJGH 3B9DA 4PRDA 3QULA 5DMKB 3GSWA 2F19L 1JPFA 3BMVA 4I0CC 3VXRA 2GJ6B 1DSFH 4EUPA 3PG2A 4F8QA 2WBKA 3C6SA 1U8KA 2V2TB 1RJZB 2B8OT 4HKZA 4XI5D 3T4AB 1M05B 1JIBA 2E27L 4QO1A 3V0VB 5B3NA 1CE6B 2VDQL 4XP9H 2ERJB 3DXAE 3MRFA 3ORJA 3BWUC 4ODWA 3U0PA 2R39A 5C0RL 1OW0A 4RA3A 5ICXA 4ZFOA 4WU7A 1R3HA 5JR1L 2NY3B 1HN1A 5L8LB 4HEPG 3S4SG 4KC3B 1Z9SA 2DQUL 3B4NA 4TNVF 2Q87A 1CIUA 4DOHB 2IALB 3PE9A 3QIWB 2CDFA 1ZT4A 4YEEA 2HKHL 3N9GH 2EH7L 2EZ0D 1KTKE 3T77A 4M7LH 5DUPH 3EYSL 3I2CH 4NN7C 4GOSA 5E9DB 3S98A 1OP5H 4K3HA 1IQDA 4RGOL 3TBWB 1KXTB 3CJJA 4EDWL 2XG5A 3QEUB 1MUJA 1NCAL 1DUZB 1RIHL 1PYWA 1X5FA 2E5EA 4GSDL 4Q6YA 3QXAA 1VACA 3DRQB 3HNTL 5E2VL 3TT1H 2F58L 4CMHB 4HGWA 4NRZB 1EA9C 5F7HA 3FO2A 4K7PL 1RZ8A 2DLIA 4LKXB 5J12B 1ACZA 3CXHJ 1BVKB 4XP6L 1MH5B 1DEEA 1IKNC 1OTUD 4PUBL 2OSLA 1F8TL 3LHPH 3V6FA 5JXEC 3AM8C 4WWKC 2VN7A 3QH3A 1F3DH 2DQGH 1ETZB 3R4DA 1EK3A 1CR9H 2EO9A 3SGJA 4O2EA 1GYAA 4ZYKA 2KBGA 4LCYB 1EZVY 4KKCC 4JFPA 1BIIB 4BJLA 2CXGA 4C59B 1I85C 2CDEA 4Y4HC 3GIVB 1FYHB 3IJSA 3H7BA 5EC1A 3HNVL 4F37K 1N4XL 3E0GA 5E94A 5E6IA 5I1HL 4RGNC 5I1AB 5C1MB 4G6KH 3MUGB 5C08B 3QIBD 3JWDL 4P3CH 1N0LA 1UJ3C 3V0WL 2VAJA 1T0NA 4M43L 3FT2B 2R0ZL 4L29B 5KSAB 4FFWD 1A1MB 4H88L 3RVTD 5FXCH 1KTLA 3UPRB 2ZUQC 3KXFA 3O6FC 4PV8A 1OAYH 4L4VD 4Q6IC 1SJHA 3T0WA 4ODSL 5JXAL 3H9HA 4OCXH 1ZVYA 2IPUG 4ZS7H 5L88L 2Y1VA 3OKMB 2APBA 5CWSA 4JKWA 2X4NA 1G6RA 4PJAB 1Q1JL 3MCKB 1JNHB 3NH7H 1TQBB 4MJIA 4HS6B 1ZLWK 3K1KC 1NFIA 4Z7NE 3ULSB 4KXZH 1NGPL 3DV6A 4PRHD 3C09C 4NO2B 2J8UF 2R0LL 4J3SA 1BFOA 3B5TA 2Q6WA 4O2CB 1RK0B 3QWRA 4YX2L 2BHUA 4ELMB 2C3VA 2XZCL 1MIMH 1EHNA 2DMKA 1F90H 4W6XB 1BX2A 3W9EA 3FTGA 4KPHH 1ORSB 4DVBA 2ID5A 4MA1C 4E5XA 4EUPG 1O7VA 1CFVL 2A6IA 3OKDA 3PABB 2D7TL 3HC3L 3LS5L 3HC0A 5F1SA 1RK1A 1IMHC 4DTGL 4PBXA 1EFXD 2BSSA 3SKOB 3RDTA 5GPRA 5EPMA 4RWYL 4FXKB 2V17L 3KAAA