4U1MA

Hla class i micropolymorphisms determine peptide-hla landscape and dictate differential hiv-1 escape through identical epitopes
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-42 alpha chain
publication title A molecular switch in immunodominant HIV-1-specific CD8 T-cell epitopes shapes differential HLA-restricted escape.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 80
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u1mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4u1mA01
4KRLB 5KW9H 2OR9L 3BPNC 4GXVL 1XGPB 2BXZA 4OI7A 1G9NL 2BSSA 1QQDB 4OGAC 3IF1B 5CGTA 1DUYB 1PSKL 4PB9H 2ZSVA 4FQIL 4M3JA 1LD9A 2BHUA 4WV1A 3GJFH 1MJJB 1UXSA 3BKML 3OJDB 3S96A 3CX5J 4KU1A 5F9WC 2NZIA 2IBZY 4LLDA 1EH9A 4ODWA 5C7XH 4AL8L 1U6AL 2AI0H 2YD5A 2D7TL 1FZKB 2NY4C 1U3HC 5IFJB 4LIQH 4TOYH 4PRDB 3PWPB 1I8KB 2VWEC 4WUKL 3RVVD 4YHMH 4JPIB 4JFPA 4XMLH 2FO1A 1PYWB 3MLZH 5I16B 1F11A 3VXSA 4Q7DA 4WFFE 1AKJB 1ZANH 5HY9A 2UZIH 4RAUA 4AEIL 1G7JA 4LVOB 4XCYA 1RURH 3QIBC 3RZCA 1QSFD 4OFYA 4MCZB 5J9PB 5EO1A 1LO4L 5KOMC 5ICXA 1JGUL 4LP5A 4XZUB 3P4MB 2C3XA 3X12B 4H20L 4PRHD 4L4VD 4LASH 3WEXB 2DIAA 3KYKH 1TMCB 1FVDB 2Y5EA 1I8IA 4G9FB 3ABZA 1W2KT 1CDUA 2ZOKB 4IRZH 3VA2C 3IJSA 3FMGH 3ORJA 4DGYH 4KQ4L 3FN9A 5I1LB 2P48B 3QNZA 1JPGA 1LO2H 1XGQA 1NSNL 3X14A 2EDYA 2Y06L 2CIKA 2ICWA 4KAQL 3UTTE 2FRGP 2F53E 3W11C 1MVFA 2O5XH 3QDGE 5DD5H 1K8DB 2A0LD 4O4YL 4ODSL 3CC5A 3VU2A 4DJMA 3H0TA 4NNXB 3WIHL 4AMKL 1CIUA 1SJHA 2HT2D 3PHOB 4MQ7B 3UJJL 1VFMA 5GGTL 5HD8C 3PIQA 3B6SA 1WAAF 2PTTB 5GRVK 5CJXA 4EOWL 4PJBE 5GGVH 1T2JA 4R7NA 1MI5D 3QIUD 5TE4L 1RY7B 3F7QA 5CD3A 2WBJA 4X0KB 3FFDB 4IRJD 4S1DC 4R4FL 2Q76B 4XX1E 3EYFB 3GMLA 3HPJB 2IC2A 3E2HB 4OLEA 4UB0H 1ONQA 2OSLA 3EO1B 3SGKA 1P9MA 3HI5H 1IJ9A 2GJ6E 3T65B 3N1MC 4JFFE 4KTEH 4WO4A 4NGHH 3G5XB 1YEKH 4KHXH 1ZOXA 3DPBA 1L7TH 4FQJH 3FTGB 3FB8B 3QPXH 2PTVA 2AJXL 2G5BA 1MAMH 1B6UA 3C08H 3ZDZE 4KJPD 5GGQL 4KI5C 2D31B 4WI7A 4XNMA 2OJZL 4KTYA 3SE4C 5CD5C 1ADQA 1BQHA 5FEBA 2FX8L 4XHJC 1XF2A 5GRWA 2XKSA 2YPVH 1L7IL 5FA3B 4QOKD 3VXOB 2VDPL 3W39A 1QR1B 2C3HA 4Y16C 2RHEA 4RIRB 5L9DH 4LLUA 3U2SA 2DLGA 4MD0A 4YXKL 2VWEE 4J6RL 1RUPH 1NAMA 3S5LG 2DL2A 3BP5B 1D5BB 4YE4H 2FGWL 4Y5YA 2EZ0C 4OZGE 2Z0BA 2EYRB 4P3CH 4LCUA 3WFDH 5DQDL 5F9OL 3QNXB 4LVHC 4X6FA 4NQVB 4Z95L 4KQ3H 1J1OL 3KYNB 3EYUL 4TUKH 2XPGA 4G8EB 3TV3L 1X3DA 3LY6A 5L8KB 4FFVD 1OAUH 3CFIC 5DRXA 1IGTA 5CJBA 3NN8B 3QG7H 5DK2B 2H41A 4NYLA 1C7TA 4JDTH 1OGAE 1T5XB 5GGSY 1TQBC 1UJ3C 1WSST 4WU7A 1Z3GH 3CMOL 2EDFA 1NQBA 3VFRB 3CFJB 4PJ7E 5D7LB 4B41A 1OM3H 3QWRA 5T1MA 2PTUA 1GOFA 4NWTL 2P5EE 2ICCA 5TQ0L 4D0CA 5ANMB 1PDKA 4X4YB 4ZXBB 3VA6A 2CKBL 4QRSA 5HJ3A 3VXMB 3PJSB 5DUMH 3WFHA 4M6OL 4PLJC 2VH5H 3T0WA 4K9EL 3U48A 5C8JA 2PCPA 4QLRA 1RD6A 3VJ6A 4NNYB 4GRLD 4XVTH 4NRYA 4OSUL 3DETC 1TTGA 4GSDL 3MNZB 4JKPL 4N1CA 2NY5H 2HT3C 4XWGH 3ECBA 2QR0B 4XXCC 3U0TB 2XG5A 5CJQH 3DX9A 3MCKB 4NQUA 4F2MB 1QLRB 4WEBH 1EFXA 3EW3B 4UDTA 1C8PA 1U8HA 2IH1A 5DK0A 1L9MA 2DQUH 5GJSL 2EDKA 4M7LT 5EA0L 1UEMA 4AY0A 3RIFF 3DGGA 5A2JH 2DD8H 4MX7A 1T5WB 1RJLA 3NCBB 4R8WH 1Q72H 8FABB 1GAFL 1A2YB 4UOW0 4X6BB 2B20A 3UPRB 3MLSL 3EIFA 4U1JA 4F33B 1IZJA 1AP2A 5ERWA 4PJIE 4HS6B 3AREB 2CMRL 4PGBB 2EECA 4HC1H 3T0EE 3GUTA 3MJ9L 4XPBH 4HGWB 3KDMB 4Y1AD 4LAQH 2Z4QA 3WFBH 1YEIL 5IF0A 1JGEB 2WUBL 1QOKA 2H1PH 3TWCL 4LIQE 4WW1A 4CU6A 3C5ZB 1WGOA 5MEQB 2B4CC 3DRTB 1H3PL 4G9DA 3TA3D 2FR4A 3N50A 1E4XH 4P5KA 1QFWL 4KPHH 5TF1H 3MV7D 4JG0H 3OQ3B 3WIIH 4NPYB 5KSVB 3HNSL 3M1BB 1LDPL 5C0BB 3RGVB 3K46A 4NOBA 4M7JH 3G6AB 4JHBA 2YWYA 2H3NA 4WCYL 1LVEA 4KK5C 4P2OA 2R8SL 2VZUA 1R3LB 1I3RA 2BFVL 1HH6B 4MQTB 4D9RD 5J89A 4FQCH 3ME0A 2FSEB 5EB9A 2VNCA 4C56D 1IM9B 2ZNWA 5FOBB 4MAYC 4LLYA 3RWGA 3CFKA 4TVPD 3SKJH 4M5ZL 1ZMYA 4FNLL 4KKAC 3QUYA 4UNUA 5I71C 2IQ9L 2FYYB 3E1F1 2D7NA 3DXAD 4OLYL 3ROOB 1L0QA 1U8IA 3NH7H 3ERYA 4XNZC 3VFUB 4YHLH 1UJTA 2NY5C 4N0FA 4YEFA 2BZDA 5EU6D 5J6HB 5D2NB 3TO4C 4NM4H 4JZNA 1JV5B 4PJAA 1KBGH 5DUBA 2E9JA 4UILH 3WL9B 5E8OB 3FO9B 3EOAA 1J9CT 4X4ZA 2E5EA 4Q0XH 3QJHB 1I7RA 1P7QD 5IMOA 2KBGA 5T5NG 4YAQA 1HHGB 1YNLL 2R0LH 1QLEH 1FFNB 3KYOB 4R96A 5IQ9A 4E41B 5I1DB 3V5KA 4PJFF 5C9JA 2CRIA 5IB5A 2NX5D 1MHEB 4GKSB 3HTLX 4F9PC 4H1LA 4RNRB 1G6RL 1NH6A 1UB6A 2E7CA 4K8RD 4Y4KB 4HIXH 3VWJB 1G0YR 1T7XA 1CDBA 4UTBL 2FNBA 3VWKD 1AY1L 1PD6A 4JREB 2IALB 5EUOF 1INDL 1G7IB 2Z91A 4QY8A 1T22B 5DTFB 5IESL 4DVBA 3OBAA 4OCNC 4XPAH 3CZFA 4XPTH 3LQZA 4WWID 5LGJA 1E6JH 3SDDB 3QEQA 5DHYA 4L29A 2Y9RT 3X13B 4JB9H 4HJJH 4MYWB 4R90H 1KGCD 3RDTD 4B0MM 5JO5A 2DBLL 2WZPD 2XRAH 1JNHB 5TH2B 4ZDHB 5DEFB 1F5WA 4QTHB 4G80A 2DQHH 4XC3H 4L8SA 4Y2DA 4FTVA 3NMEA 5CINL 5L8LB 4XP5L 5GS1B 2NY1C 1D5XA 5ACLA 3HZMB 5JPNB 1C5DB 4U6YB 5IW6B 1F6FB 1CGVA 3T0XA 4LPCA 1EV2E 1RIUL 3UZEA 4AEHL 5HHOE 2DQEL 5FAAA 1WAAE 1EUTA 5JNYB 3CSBA 4UV4H 4M02A 5JUEH 3KPLB 2CQVA 3QO0A 1AR2A 1T7YA 2WQRA 3RL2B 4NCC1 1T1WA 4U1IA 3SE9H 4ERSL 3NABH 1MH5B 3D85B 4C57C 5ESQA 1FO0A 4GMTL 4G6KL 5E5RB 1OAXH 5I8OL 5INDB 1KCVH 1HQRB 1N59B 1DCLA 1C5CH 1F3RB 2R0KH 1LWRA 4Q9RH 3KPRE 1F3JA 3BT2L 3EDJA 5MEPB 4YDJB 3C6LA 2R4RL 3MUY1 4Y5VA 2R2HB 5KOVC 4LLAA 4FN0A 1IEHA 4U1HA 3MRDB 4NN5B 4Z77B 1KJ3L 3A0OA 1KCUL 3UTSE 5DEGA 5HYJA 1ZA6A 3LS4L 2EH8L 4M7KH 5TF0A 1FZMB 4ZAKD 1R5IB 4ZOAA 5KSUB 3PGFH 2J6EH 3FT4B 1I3GL 5BS0E 4R4BB 5KJRH 4NZUH 2C7UA 3G5YB 1SYSA 1KJ2A 2DYPD 1Q0XH 1IILE 3SE8H 2BVOA 5AUMB 3DHJA 4Y4FB 1P2CB 1ZK9A 2WUCL 5HHMD 1PFCA 1ZGLA 2CDEB 2HTKC 3UDWA 2V7NA 4WHTB 3TNNA 2NXZB 1XIWA 2KL6A 2FWOA 4U1NA 3LVEA 5B8CA 4MJIE 4QXGH 5JLZA 3IJHA 1S7SB 3JV5A 2VLKD 4Z9KB 3JBG7 4LARH 4W6WB 4LVNC 4PJDB 2GK2A 4JY5H 3TCLA 1GIGL 5BZWA 4MA8L 3UTTD 4XP9H 2IBBA 3CLFH 3W9EB 5FGBA 1ZLWK 1ZANL 3EAKA 3WSQL 2G5RA 3CNKA 4I0PD 4M6MH 2P8MA 1KTDA 2ZSWB 5D70L 3RGHA 1NGQH 4NIKB 1RURL 3Q6FB 4XPHH 5LAXB 2Z93A 4AG4H 1T3FB 3WJLA 4U0QB 2YS4A 3KYKL 1KPVA 3GSOA 1ZHLA 5BZDB 1S78C 1YNTA 5EC2A 2H32B 3CXHK 3VGAC 2A74B 3MX0A 5FB8B 2CLZB 4BFBD 4OLWL 4QHLA 5DVOA 1ZTXL 5HGHA 5C09A 3TJEH 1E4XI 4XH2B 4BZYA 5EC1B 3QH3A 4KI1A 2M2DA 5FGCE 1XCQB 3P0GB 2YD9A 2Z31C 3HFML 2R1XA 3DYMA 3MV8E 5IT2H 5I1EH 5J11B 1Q9OB 2GJ6D 1J12A 5D1XA 5FO9A 1QSFB 4PRIA 5CEZH 4PP1C 3CIQA 1NFIB 3AUVA 1FSKC 3OTTA 2GJJA 2JJSA 3WKML 4PRHB 4L4VB 1LQVA 1KPUA 2KQNA 2YPLE 4PUBH 1M7IB 1OLZA 1KYOJ 3BIKB 5E95B 1FFOB 1TNMA 4KUZL 1QBAA 4EN3B 4F15B 3MLPA 2QADC 1I75A 4OCSL 2HLAA 3TJHD 4FG6C 1Y0LB 2PN5A 3BESR 3U0WH 3BGMB 1AGDB 3GMOB 5E0QA 1BOYA 1JYNA 4LLQB 1DE4A 3FT2B 4ZOBA 2XYCA 2XQYG 1E4JA 4X99B 1T03H 1TQCC 1P4LA 3VRJB 4S0SD 4A6YH 2I07B 2RB8A 3IETA 2X1XR 1RMFL 4G6FD 4WI3A 1Y6NR 1Z6JT 4KTEL 2B8OT 4NGHL 4N0UB 1BEYH 5ALCL 5DJ2B 1L7TL 1U95A 4UNVA 2NY6D 4MS8A 3ZSSA 3MOAH 4NN7C 5C3TA 3NFNA 4PRPA 5F93C 3M17A 1MAML 3Q1SH 4RISH 4LEOA 2HN7B 1MFCH 1MI5B 1QYGH 3BEVA 4K3JL 1IL1A 5D5MB 4Q6YA 3UAJC 5E8PB 4FQXD 1WFTA 4IRJB 3ESVF 2F74A 3WNKA 4JM4L 1HOCB 2X89A 1YYML 3N9GL 4JG1L 2W0PA 2EDQA 2EH7L 4UOW1 1UACH 3JUZA 3BFOA 2VUOA 3MJ7A 2AXGA 4GBXD 4DN4L 5IKCA 1U8NB 3GBML 1H5BA 2MQCA 3LH2H 4OIAA 2B4CL 2WWKO 2VXTL 1U91B 4OJFH 2Q8AH 3D2UA 1V7MH 5E8NA 1YYLH 3BX7C 3TN0B 1GPOH 3VG9C 1JZ7A 3WS6A 1Y18A 3O9WA 5JMRA 5I2IA 4UU9B 1BJMA 3QI9C 1OSPL 4KQ3L 4R26L 1WWBX 1NBZA 3DNKA 3L3IA 5JHLH 2IFFH 3QCTL 5ESAA 5K9OA 2BNRE 5AG9A 2FB4H 2B0SH 1ZXQA 2GAZB 1CICC 5JDSA 4JDTL 3PL6A 3MRBA 5D1QD 1W0VA 4PJ9C 5DXWA 5I66B 5DO2C 2Q3ZA 4OIBA 1K9TA 2CUIA 1LK3H 4PJFE 1C08A 5KTEL 2EDRA 5CIPB 4DEPB 5GZND 4KRPD 1BVLA 1WIUA 2LAGB 3SBWC 4Q9QH 4S1SH 1LO0H 2Q20A 5DUML 5GRUL 1YQVH 1OAYH 3L3DB 3C9NA 8CGTA 3IDGA 3O2WH 5EUOE 1DVFC 1O7VA 4XVTL 1CD8A 4KZEH 1BIIB 2NY5L 2DLFH 4XWGL 3T0ED 5F7KC 1ZHNB 1ND0B 2NY3D 3WJJC 5FM5O 1Z5LB 1HWHB 2BK8A 1WV7T 1KG0B 2CUHA 2AXFB 43CAB 2VXQH 2IMNA 1RULH 3GI9L 1KJVA 3EYSL 5EOTA 4G43B 4ZNCD 2I60L 1PKOA 1XGPA 4M1GH 3LKNB 3OAYK 2VKXA 4R8WL 1MFEH 1Q72L 1QQDA 2FEDD 4NQSB 3P2TA 2XACC 1DQLL 3IF1A 4F7EB 4NQED 5SV3A 1DUYA 3SJVB 5I0DA 5D7IB 4GRLB 1MJJA 4MMZC 3OJDA 1CD1B 3IDXL 1OL0A 5KSAD 3INUH 1S7WB 4O5LH 4QKXB 2CXKA 4X7EC 3L3JB 4LAQL 3WFBL 5DR5H 3MPCA 4WFEE 4JZJC 1FZKA 1FCGA 1VESA 4OCXH 5IFJA 3RWEB 4PRDA 1JN6B 3PWPA 1I8KA 2A77H 1K8IB 3RJQB 4J2XA 4JPIA 2OXGA 3WIIL 1PYWA 5I16A 1UM6L 3M8OL 1AE6H 1AKJA 1HQ4B 5IMLB 2YZ1A 1KTRL 3MFFB 3OV6A 3MRLB 4MLSA 2A6JB 2BDNH 4MCZA 2VR5A 5J9PA 3VMOA 2YRLA 4Y1AB 1A14L 2WBKA 3BKCH 4XZUA 3P4MA 2PUQT 3X12A 3ZTNL 5IJKA 3WEXA 4K55A 2IH3B 4G9FA 1TMCA 1FVDA 3ZHLA 2ZOKA 4YHPB 3TA3B 3MV9D 4PJXB 1N0LA 1RQ5A 2VXSH 1HZHH 3SKJL 1IKNC 5I1LA 2XTLA 1T83A 3IXAB 3MV7B 1B0GB 1EHAA 5ALBL 1MLBB 1WIOA 4O58L 3FL7A 3VFGH 4NQDD 4I18B 3ARFC 2AQ3A 4M1DL 2VDKH 2DJ4A 3WHXB 1K8DA 4LHQB 1KEML 4NUGH 1I7UB 5I9QB 1QFUL 4JQIH 4M7ZB 5CEZE 3EOTL 3BPLC 4ZO7A 4NNXA 2AJYH 3HZYB 3GB7B 4P4KD 4UILL 4LSTH 1A7BA 4LFHG 1ZHBB 3PHOA 3L5HA 4MQ7A 4JFEE 4GAJL 4D9QE 4C56B 3L3GB 4ALAL 2OR8A 3P9WB 2LTQC 1WUNT 2PTTA 3WIFB 3ZLQC 2X09A 3ILQD 3NCMA 3RX5A 3ZHKA 1ZLSH 3O6LH 4YDLB 1QLEL 5CFHA 4ZO6A 2N7AA 4QGYA 3DXAB 1P6FA 2O5ZL 5FM5M 4X0KA 3FFDA 3I6KB 3FO1B 2BSED 2DWDB 2NY7H 3G6DL 4LNRB 2Q76A 2QSTA 3BH9B 3RVUC 3EYFA 3HPJA 4DW2H 3E2HA 2UUDK 4ODBD 3B5TA 2EXWC 3EO1A 1UFUA 4WV1C 4QHUB 3T65A 3F58H 5E08H 3VG0L 3CGTA 3G5XA 2OI9B 3UX9B 4XPAL 2R56L 5FM8A 1GVIA 3FTGA 1P7QB 2H26B 2NTFB 3FB8A 3G04B 5CCKH 1WWWX 5DEZA 5BXFB 3BGFB 2WBWB 3WFCL 2HWZH 5E7BA 2OK0H 1D6VL 2YZ8A 4O51B 3R8BB 3SY0B 3L5IA 2CGRH 2D31A 1F58H 2XRAL 4YHOH 1ZEAH 4PPTA 1T66D 2NX5B 1MELA 5I17B 2V9RA 1U8KB 5E2TL 43C9B 5FA3A 3VXOA 1QR1A 1ADQH 4YR6B 5F1OB 3SDYL 3VWKB 3PHSA 2GFBB 4RIRA 1BPVA 3GSNL 3ZE2F 2AERT 4XP1L 4QTIL 5ENWB 3BP5A 1D5BA 4Q9BA 4X6DF 3VGBA 1TVDA 2EYRA 1NAMH 5JHDB 3QNXA 4CUCA 4H1LG 2XY1A 4NQVA 3RDTB 3X3GL 2HRPH 2HFGL 3KYNA 4G8EA 4TTDD 2A73B 3NN8A 5DK2A 3R8QA 2J88H 1MRDH 5EN2B 1W8NA 4HBCH 4ZNEA 3KG5A 3B9KD 1T5XA 3ARWA 1WBXB 3L6FB 1T2QL 3VFRA 1KCVL 3CFJA 5D7LA 1GGBH 1QZ1A 4B50A 4K94C 1CZ8H 4CMMB 5ANMA 1JGVL 25C8H 4X4YA 4QRTB 4ZXBA 1DBBH 4FABL 4Q9RL 3EYQD 3VXMA 3PJSA 3K74B 2VXVH 5CJXC 2YEZB 5B3JF 4NNYA 5C0CE 4YQXH 3MNZA 3U0TA 1W8OA 3MSPA 2QR0A 3T09A 2NQCA 3MCKA 2C4XA 4F2MA 1QLRA 3PGFL 2KH2B 1W0WB 2FBJH 1L0XA 2X41A 2YA0A 1VEOA 4NZUL 3KLSA 3RRQA 3SGKC 1Q0XL 1P9MC 2BMKB 3RZWA 1UZ8B 2NY0D 1NCWH 3WUZA 4WO4C 1NLDH 5T1LB 1T5WA 1FFQA 1T04B 1I9IH 8FABA 4HUWB 1A2YA 4X6BA 4NKMB 1IZKA 4Y5XB 3UPRA 4F33A 3MCLL 3NBNA 3HB3D 4HS6A 3CSGA 3AREA 4PGBA 4XNUL 4ODUB 4LPWA 3JWDC 3N85H 4ZAKB 4HKJB 5IW1B 4HGWA 1FNSL 2OBGA 3KDMA 4PJAF 5D7KE 3QAZB 1JGEA 2CRZA 3CLFL 4KJWD 3T0BA 1WTLA 1K4DB 3C5ZA 3IB4A 2DYPB 5MEQA 3DRTA 2FX7H 3F7YB 2UY6A 3D25B 3Q5OA 5IBUB 2HKHH 1KULA 1OP5K 4JHWL 1A6PA 4F58H 4NPYA 2AJZB 3VI3F 4PJ8B 4Y5YC 4M61B 5HHMB 5KSVA 5EIIB 4DTGH 3VXSE 3M1BA 4U1GB 4P3DB 5C0BA 3MACH 4RA3A 3RGVA 1TZHB 3I6LD 3G6AA 4RMTA 5D7JD 1TPXB 5E2UL 1HXYB 3ZYJA 3U30B 1R3LA 2ED7A 2VLKB 1N6QL 4J3WA 4YDVB 1HH6A 2JELH 5TDNB 2EE6A 3FB7B 3PWJB 3QWQB 2FSEA 4G6AC 2UZXB 4I0PB 3I02B 1IM9A 5FOBA 5GJTH 3ARDC 4XI5C 3DVNB 3DSFL 3P3YA 5DD0H 5BJTB 5JPMB 4QRPD 1LO3H 5D2LF 2FYYA 3MR9B 2EXYC 3QEUB 4HAFA 2IBZX 3ROOA 4HT1L 4G59A 3VFUA 5L8JB 2E27L 4PUBL 4NJAH 1DFBL 1TZGH 2JJWA 2BSTB 2BNUB 5J6HA 5D2NA 3GSWB 2C1OB 4UOJA 2Y72A 2JB6B 2ED8A 3QUML 3WL9A 5TPWL 5E8OA 1UB5B 3FO9A 3KVQA 1A6VL 4P2CG 5GS0D 2QJDA 4IJ3C 3QJHA 5C0EB 3G5ZB 1AGBB 1HHGA 2FH8A 2GJ6B 4NFBA 4A6YL 1FFNA 3KYOA 4E41A 5I1DA 5BRZB 3DUSB 2ICWI 4U1KB 4LCCB 1PQZB 1OTTC 1BEYL 2Y36L 1MHEA 3AROA 4GKSA 4RNRA 4P3WA 2VN4A 4ODTH 4Y4KA 3UTZB 3VWJA 5E6IC 2B7DT 3Q1SL 1JZ4A 5FF6B 4H1LH 2IALA 2W0FB 1G7IA 5L2JB 1T22A 5DTFA 5KVFH 5T3ZH 2PYFB 4HUNB 5HHNB 3EJYC 1AI1H 4Z7VB 4R4NC 4JFYB 2Y7QB 1GC1H 1J11A 3SDDA 3ZKXC 4JE4B 3X13A 4G6FB 3IFLL 2EYSB 2GTZB 1RUMH 1JNHA 5TH2A 4ZDHA 3SEPA 5DEFA 4QTHA 3U82B 3AU1B 3BVNB 3VH8B 3L3HB 1BECA 2NY6B 3CU1A 4OJFL 1V7ML 1X4XA 5GS1A 1HINH 5F97E 5DRNB 3HZMA 5JPNA 1NMBH 4P2OC 1C5DA 5CLWA 5T3XD 1N0XL 2XZAL 4U6YA 2GUOB 4JCMA 5IW6A 5JHLL 1HKFA 2E6QA 4FQXB 3WNLA 2B0SL 4LU5H 3MUGB 3GJFK 2YKLL 2EKSB 3V5DB 1EO7A 4YK4B 5JNYA 4N5ED 5K93A 1ED3B 4GRWH 3TF7C 3RKDD 3TZVD 2CK0L 1J5OL 3KPLA 4GBXB 5EIQA 1CGYA 3QUYC 1WTGT 3RL2A 1JPSH 4XCNB 1ACZA 5HGBB 3QZWB 3X3FL 3ZT7A 1MH5A 3D85A 1GOHA 4Q9QL 5CZXD 1QBMH 5INDA 3CSPA 3HR5B 1FO0H 4KZEL 4YLQT 2FECI 1HQRA 1N59A 4P59L 3VFMB 2WINB 3I75B 1UM5L 5MEPA 4YDJA 5D1QB 4KDTA 4WFED 2R2HA 5CJOH 3MRDA 1FNGB 4Z77A 1G7LB 4RGNC 3LN4B 4MJ6B 3VFNB 5IWLA 4JO2L 4KMTH 5EPMB 4M1GL 4KRPB 4XGZB 1FZMA 1R5IA 5KSUA 1R3KB 3FT4A 4MWFB 1H0DB 4R4BA 5KVGL 4CNIB 1NL0H 4NKIL 3G5YA 4OD3H 5BOZG 3ZE2E 5D6DA 4YUEL 2YD6A 3KPSE 5AUMA 4JGUA 4Y4FA 1KJ2H 1H8NA 4OQTA 1P2CA 1CGUA 5DR5L 2CDEA 4JRXB 1X5GA 1JGLL 4I0KA 4WHTA 2EDXA 5EU7C 5EBWB 1CGSL 3Q5TA 3GIZL 4MHHG 3M45A 1I3UA 1S7SA 3QJFB 1NEUA 4HWZB 4UUJB 5I1IL 4LCIH 1NCCL 5J8OA 4PJDA 3DVGB 3QQ9D 4L8SC 3GBLA 4Y2DC 4JKWA 4NQEB 1AE6L 4K3DL 3W9EA 3EGSB 1MJ7L 2ZSWA 5DJ0B 5KAQG 3IAGC 2JIXD 5FUOH 5CEZD 5DMKB 2DQTL 2DIJA 3MYZA 4JR9L 3Q6FA 5KSAB 2XZZA 5BQ7B 4O9HL 1CXIA 5K33A 5LJYH 5LAXA 4JFED 3BKCL 4P23B 1T3FA 4D9QD 2B2XH 5B21A 2EDBA 2NMSA 4X4MA 4KK9C 5B3JE 1JPFB 1CFVH 5EBLB 3ARRA 5BZDA 4HLJA 4WTXA 2H32A 2VXSL 1HZHL 4FHBD 2A74A 5C6TH 1MJ8H 4WU5B 2CLZA 5FB8A 1A7OH 5HDLA 2KUTA 3V79C 1S7VB 5DJ6B 1FGVH 5HHPB 1S9WB 4XH2A 5EC1A 1FZOB 1QUNA 3OAZH 1A64A 1XCQA 4NZRL 4MSWB 1A9EB 4NUGL 4TSBH 1YC7A 1B90A 5FO8B 4GKZB 1Q9OA 4HPOH 1QSFA 1C5BL 1JK8B 2DM4A 3DMMC 3WCYA 1NFIA 1CU4L 1HILB 2GEEA 4HCRA 4HXAH 4L4VA 4PRHA 4HK3N 3TC9A 3RFZC 3C6LC 1M7IA 4K94L 2E6PA 3BIKA 3MV9B 4MQXC 4ZUTB 5JQ6H 4KJYB 1FFOA 2C3VB 4MA1C 1NGPL 5KANG 4HS8H 4EN3A 4PJAE 3SKUD 1Y0LA 4NQDB 2VN7A 3BGMA 1RVFH 4LK4A 1AGDA 3GMOA 4GS7C 4WTWA 4LLQA 2XFXB 4D3CL 3FT2A 2R4SL 2VLLB 5HPOA 4LOUC 5F21B 4X99A 4AT6B 4NHCH 3VRJA 3HI1B 1NMCC 2I07A 1F2XK 1RV6X 2AEPH 1X5LA 3D0LB 4RFEB 4RDQF 3VI3E 2H45A 2ZNXA 4RWHA 2Q86B 4N0UA 2HJFB 1T2XA 5DJ2A 1YNKH 3BZFB 4ZS6C 1CLCA 1FBIL 1IMHC 4OLUH 1KB5B 3ARYA 1A5FL 1E4KC 3RNQB 2X4QB 5CCKL 1DQQB 5MERB 1CFTB 1K2DB 1TTFA 4NT6B 5LCVL 3MLWH 5B8CC 2HN7A 1MI5A 3O2VL 5T3ZE 4ZFFB 1F58L 1UENA 4YHOL 4M62H 5D5MA 1XGTB 5E8PA 3KPMB 1CQKA 4IRJA 3HPLB 1HOCA 3ILPB 1FYTD 5FGBC 2B1AH 3JWDL 5CAYB 1PG7W 1T80A 1J1PL 5KAQF 5EU7E 3EFDL 2F19H 1U8NA 4RGMB 4FZ8L 4H0GA 1U91A 1OTUD 3SDAB 2I27N 4OM1H 4PIRF 3WJLC 3OSKA 3TN0A 5LXGL 5C6WH 3MRKB 4FTVE 4UU9A 1G1CA 2BCKB 1OWRM 4J4PD 4QRRE 1QTYT 2NTSP 5DMGC 2GAZA 3GFUA 4EXPX 1S8DB 5I66A 1EJ6A 2X4PB 3TEUA 4KK6D 1U8PB 1VENA 4WNQB 2IEPA 1QACA 3CDFA 1A3QA 3QB7C 5CIPA 4K7PH 2R9HC 1GGBL 2PKDA 1TJIH 1CZ8L 1JIBA 1I9EA 3WDJA 4BZ2L 2JJSC 1ZGLP 5C0ND 3WBDA 3LS5L 4DVRH 3RNKB 4LRNH 1ETZB 3QFJD 1BJ8A 3L3DA 2V7HB 4JM2F 4X6CB 2EIDA 4HMEA 1BIIA 2DICA 1ZHNA 4JPWL 1ND0A 1Z5LA 3C8DA 1AHWB 4EDWH 3T2NL 4NSKB 3L1OH 4P2RD 2AXFA 2XN9D 43CAA 1FG2B 4ZUWB 4G43A 4BZ1H 3LKNA 3MXWL 5HYJE 4KROB 1NC4B 4NQSA 1LEKB 2YXFA 4GAGH 2GK0B 4F7EA 1X6NA 2CRMA 4UQ2B 1QP1A 2DM2A 5DC4B 3GKWH 3SJVA 5D7IA 4GRLA 5L7XL 4DGIL 4XCFL 1CD1A 4M9OA 1V8HA 4QXTB 3RZCD 4LVEA 1S7WA 4K3EL 3L5WB 3FN0L 3L3JA 2JJVA 5HVHB 4A2MA 2ZKHL 3H3PL 3L5XH 1KIUA 4PRAB 2O61B 5ID1B 3K81A 1YEDB 2ADFL 2NY0B 3O2DL 3RWEA 1JN6A 4C4KT 1K8IA 3Q5YA 2D03H 1H5BC 3CXDH 3QXUA 1PZ5B 3UYRH 2ARJB 1CFBA 1HQ4A 5JW3L 3MACL 3L95B 5FECB 3HC0B 5IMLA 3I9GH 1FNLA 4LQFH 2CUMA 5DRWB 3MFFA 3MODH 3N0PB 4I77L 3MRLA 2A6JA 3Q6GH 3VI4E 2YUWA 5EOQH 2JELL 1N6VA 4Y1AA 3OL2A 5IR1B 3BEWB 5AZ2L 2IH3A 3PL6C 3WXWH 2GCYB 2JB5H 1H3XA 4GQ9L 2FIRT 5AG8A 4YHPA 4ONHB 4PY8I 3TA3A 3QRGL 2VL4A 4PJXA 5DD0L 3HI6H 4LRIC 1TITA 2P7TB 1MY5A 3VXPB 3IXAA 3BAEH 3MV7A 1IT9H 3KS0H 1B0GA 2QQKH 3NACL 4YXLL 1MLBA 5TDOB 4FFWD 1AD0B 5C09E 4I18A 2WBJD 1MHHB 4I3SL 3UBXG 3WHXA 2FCBA 5D7JB 5D72L 1I7UA 5IW3A 4FQ1H 5C0JB 5D7SL 3HZYA 3GB7A 4NQXB 4XTRD 4PRIE 1ZHBA 3CK0L 3TLRA 3U46B 3C2AH 3O8XD 5C1MB 4C56A 2R2EB 3L3GA 4RGOH 2F5AH 3WIFA 5DJ8B 5FKPB 1Q38A 4QRPB 4IMKC 3RVTC 3S5LB 2H8PB 4NKDB 1MCOH 2AABH 3DXAA 3WLWD 1JHKL 4HD9A 4YDIL 3I6KA 3FO1A 2VKWA 2DWDA 1DEDA 1HE7A 3ARGD 4RX4D 5IK3B 5JXED 4LNRA 5F8RC 2E9WA 3BH9A 5DC9B 1T7ZA 3QRFM 1KXVC 3QHFL 4XNXH 4QHUA 4BQ9A 3IFNL 5AD0B 1FH5H 3AS3A 2K9UA 2OI9A 1U58B 4TNWF 5T3ZL 2VZTA 4JY6B 3H6JA 1N4XL 1P7QA 2H26A 2NTFA 3G04A 3EFFB 5BXFA 2H2PC 3QXDB 4MNQD 1Y6MR 4PRPE 1NKOA 5K9KB 4O51A 3SY0A 5DDHB 1NCAH 1CE1H 4L5FH 4OCWL 1CFQB 1ROWA 2XOTA 4NJ9L 4R7DB 5C08B 4RWYH 4S1QH 3TVMD 3WFEL 2PXYD 2IWGA 2NX5A 4JM2C 5I17A 3BKJH 1U8KA 4M4PA 4LVOC 1OAZH 43C9A 4WI5A 1HINL 3DTXB 2FZ3B 2ZCHL 1UXWB 4YR6A 3VWKA 2GFBA 6FABL 2C5DC 3EUUA 3QWRD 5ENWA 1B2WL 4WI6A 5IJKC 1WITA 4OB5L 1M7DB 4G8GD 3DYOA 4QRQB 3RU8H 5BMFH 1IGYB 1OB1B 5JHDA 4CADB 2WWMD 4FP8H 4MCYB 4PJCB 3RDTA 3QXAB 1T7VA 2EC9U 1JE6A 3PV6B 2K7PA 3MMEB 2A73A 3GK8H 5EZJB 5EN2A 5TQ2H 2HMID 1DBMH 1NCDH 2AK1H 1EFXD 3JTSB 5GGVY 1MCPL 1CCZA 1IARB 1BWMA 1JUFB 1QBML 3CU7A 3E6HB 1WBXA 1FO0L 4EVNB 3L6FA 2G9HB 3KPSD 5F96L 4URTB 4CMMA 1SM3H 4L1DA 4QRTA 2APVA 3EJZC 2FX9L 3D6GA 1CXHA 1JRHH 1CXFA 3GO1L 3TZVB 5EZOL 1MIEH 2YEZA 3L5JA 1U3JA 3D5OF 4BM7A 1MPAH 3FOMB 2X4SB 4RAVB 3RPIB 1G0DA 4UV7H 5FA4B 2QQQA 1CF8L 4PY8J 1CLYL 4HIHB 5DZLA 1W0WA 4XNYH 5CILL 3E2HC 4GXUM 2YK1L 4KRMB 2RAMA 4APQC 2BMKA 5F7DB 4F7MB 1UZ8A 3LPGA 4NZTH 5C70A 5T1LA 4FFEX 1T04A 2C4FT 1KJ2L 4LSQH 4HUWA 1MWAB 3BE1H 4MHHI 3MZTA 5D6CB 4NKMA 4YBLB 4Y5XA 5IEHB 1FYHB 1AR1C 35C8H 5DD3H 3ZTJG 1MCEA 4ODUA 2CH8A 3B5GA 4ZAKA 3QUXD 4HKJA 3UC0L 5IW1A 4ZSOB 2NYYD 1ACYL 4R97B 4UT7L 1SY6L 1K4DA 3C8KB 2DYPA 4K3GA 5E2VL 3SDCD 1IEAB 3F7YA 3D25A 2OYPA 2MKLC 3E6FB 4J12A 5A16B 3PWPE 4CN6A 2VQTA 5DLMH 1ZAGA 2AJZA 4ELKB 4PJ8A 4UQ3B 4M61A 5HHMA 2R0WL 5EIIA 3CFBB 9CGTA 4P3DA 1TZHA 3DUUB 1JNNH 1T89A 3BUTA 1WBZB 1HXYA 2NZ9C 4U2YA 3LD8B 5C6TL 1EO8L 2VLKA 4LDOB 3MZGB 1CT8B 2VRAA 3H7LA 4YDVA 5TDNA 1FC1A 1IC7L 3FB7A 3PWJA 3S34L 1A4KB 4JDZB 3PHQB 4I0PA 3UYPA 4BH8B 3I02A 4ONGH 4YEEA 2ZCKL 5C0DB 4G9FE 2JIXB 3AXLB 3DVNA 1NLBH 4TSBL 3LEYL 5BJTA 3BO8B 3EZJB 5JPMA 1A1OB 4KI5D 2UWEB 3TBWB 3L3OB 3MR9A 3QEUA 5JW5B 5KANI 3AM8A 1A3LH 3OWEA 1CDJA 1HIMH 1W72L 3A6CL 4P5MB 2BSTA 2BNUA 2W91A 3GSWA 2VDOL 5JOFB 2VXUH 3LKPB 2C1OA 2JB6A 1KC5L 1XGYH 1PZUB 1KCSL 2B5IB 1UB5A 3I3EA 2W9DH 5C0EA 2JE8A 3G5ZA 1AGBA 1MIML 4L4TD 2GJ6A 2R23B 3TH4T 2LAAA 3JWOC 2RFXB 3DUSA 5BRZA 4U1KA 4LCCA 1J7VR 1IGFL 1N6UA 1PQZA 1P53A 1XR8B 2MFNA 4Z7WB 2ZWLT 5JQHC 1HI6B 3K8MA 3BN9D 3UTZA 3MXVL 1ZSDB 1KN2H 2AGJH 3AREC 4YGVB 5FF6A 3MLWL 4QRRD 2W0FA 2X7LB 5L2JA 3TJHA 3PP4L 5K9QG 5DQJB 2PYFA 5HHNA 4Z7VA 1P6AB 4JFYA 4HBQA 2Y7QA 1U3ZA 5CBEB 4RMWA 3EZ8A 3C5ZC 1BM3H 1NCBH 2DAVA 5FM4A 3O45B 2EYSA 2GTZA 2F19L 1T4KB 2GQHA 3AU1A 3BVNA 3VXUD 3VH8A 1JYXA 3L3HA 3VFSB 4OM1L 3RGVC 3EO9H 4MAUL 4F3FB 5KZCB 5DRNA 5FHAL 5LQBH 1YEGL 4KFZC 1HYRC 5H94B 2GUOA 5C86A 4P9ML 3P30H 5FYJH 4ONOA 1BLNB 4XCEB 4FQXA 3BPOC 4S0TD 4L9LC 1Z2KA 2BSRB 3MUGA 2VMFA 1FYTB 1O0VA 4DKAA 2EKSA 2VZ3A 3V5DA 5SX4H 5C71A 1TNNA 4AH2B 5J1TC 2WNGA 2I9TB 1ED3A 4PTTB 4XVUD 1AGFB 3IDMB 3ZE1F 5GRYA 4OD2B 4GBXA 3BD5A 4XCNA 5C0IB 5HGBA 4YBQD 3QZWA 4Z76B 2OZ4L 2D9QB 4YHYB 1F8TH 3TO2B 5TE7L 4V3EB 1KEGH 3QYCA 4DFHA 3VFTB 5FUZH 1MCRA 3VFPB 4HKBB 4PJDF 4ZNEE 1A7RL 3QA3B 3HR5A 2OL3L 4HEME 1CXLA 2LQRA 5ADPH 4FQ2L 5HVWA 5D7LE 1NCUA 3VFMA 1TCRB 2WINA 3I75A 5ANME 1DBKH 1M7XA 5D1QA 1MFDH 3HAEB 3V0WH 1ZT1B 5EUKB 5F7NC 2IAND 5EORL 1DBAL 1FNGA 3O6ML 1G7LA 1RHFA 4WW2C 3R0MA 3LN4A 4WI8A 4ZO8A 4MJ6A 1X6LA 1Q0YH 3VFNA 4BZ1L 3V4VH 4F7TB 5EPMA 2J5LC 1KN4H 5A2FA 4XGZA 5DT1L 2EO9A 1AC6A 1R3KA 2F58L 3SGJA 4GAGL 4MWFA 5I30H 3QFJB 1H0DA 3MOBL 1Q8MA 4B5EA 1R3IH 4CNIA 3LRGA 3VWJC 1KELH 1XZ0B 1JRHI 5IGXH 4Z7NE 1EIBA 4JREC 1YY8B 1JZ5A 3MBXL 2L0DA 1FRGL 5BO1H 3GMQB 5D71L 3PXJA 4BQ6A 4P2RB 1YEHH 1DDHB 4AQ1B 2XN9B 5D1ZD 1QD0A 4JRXA 1PLGL 2QHRL 3LHPL 4OQTH 4U7KA 3SDDC 2BJMH 4U6VL 5EBWA 2ERJC 2IGFH 5HI4D 2V9TA 5BW7A 1NDGB 3IAQA 1I1YB 3KS0J 3WFZA 4HWZA 3QJFA 4UUJA 2D03L 3S35L 1VDGA 1WIPA 2WIMA 3DVGA 2V17H 4P5TD 1FFPB 3P0VL 5C09D 3CSYB 3UYRL 4NQEA 1IKFH 1LE9B 3ZKMC 5GS1C 3HNTL 3EGSA 3NTCH 4IOFD 5DJ0A 2CKBB 3FCTB 4DZ8B 3RAJH 5DMKA 4L1HA 4QCIB 5KSAA 5D1XD 5IB3B 5BQ7A 1Q9WB 4MVBD 5GIRB 1I9RH 2BY1A 2AV7B 2UYLB 2VDLL 3IJYB 1X4ZA 5CJ8A 4P23A 4QF1B 2NY2D 3QULB 1JPFA 4N0RA 5C0BE 5EBLA 1I8LA 3IU4H 1T0PB 4WU5A 1S7VA 5DJ6A 3LEVH 5HHPA 1E28B 1S9WA 3MRPB 1FZOA 1YJDH 3PWUB 3RBSA 1OAKL 3S97C 5IB4B 5D5MF 1JHLL 4MSWA 2BC4B 3DIFB 1A9EA 2QEJA 5FO8A 4GKZA 4FQ1L 3QUZB 5IHUH 3VD4A 2MHAB 2W59A 1JK8A 1HN1A 4PGDB 2HH0L 4M48H 3WNPA 1HILA 1YECL 1FPTH 1NCTA 4OLXH 4RMRA 2R2CA 4JO4H 2F5AL 1VB9A 4MS8D 5E03A 3MV9A 3S3PA 4HCRH 2LU7A 3QDMB 4KJYA 4NN5C 4ZUTA 5T1DH 1VPOH 2C3VA 4AEFA 1UCBH 5D2NE 5IWLC 2VLJD 4LHUG 4PLKC 5L88L 1MCOL 2AABL 3H3BC 3TT3H 4KUCD 4NZJA 4NQDA 2Q7YB 3ZE0F 4M6NH 5EIVA 3I50H 3B43A 5HI5C 3NGBC 2XFXA 2VLLA 3CPLB 4AT6A 3HI1A 1DN0B 4WI4A 4IM8A 3RWJB 4RFEA 3D0LA 1L6ZA 1IAIM 5LGHL 1YY9C 4E41E 2Q86A 4JCLA 4NBYB 2HJFA 4KVCH 1BD2D 3O8XB 4NCDA 3BZFA 1NUNB 1KB5A 3D3VB 4Z0BH 3RNQA 2X4QA 3D2UD 1F4XL 2ZG2A 1YDPB 5JTWA 1DQQA 1AJ7L 2NXZC 5MERA 1CFTA 1K2DA 1YN7B 3O9WD 4NT6A 1IC4H 2CSPA 4Q2ZB 1T0NB 4ZFFA 1NCAL 4L5FL 4ZFOL 5CJ5A 4RWYL 3U7WL 1XGTA 2ZOLB 3KPMA 4M7LH 3ARGB 5I18H 3MUJA 3HPLA 1MCWM 3ILPA 4O02L 1PW3A 1GGIL 1OAZL 1SEQH 2DQCH 4LMQE 1K4CB 1VGEH 2BVTA 3LKSB 3KJ4B 4XPFL 4PV9B 4JFQB 1FORL 5ADOH 3R1GH 3SDAA 1BZQK 1QVOB 1REIA 1QFHA 4JVWA 3MRKA 4LLVB 2Y07L 1YEFH 4GOSA 4MNQB 4OLZL 1YJDC 3RA7L 2BCKA 5HYIA 1T20B 3RVVC 4OTXH 4XB7A 3TVMB 2PXYB 5D7IF 5LG1A 1QBLL 3TGXA 3FKUS 3K2UH 1KJMB 5EH1A 5D8JH 5FGRA 5TQ2L 2HTKD 1S8DA 3MUHL 2IAMD 2X4PA 2XWJB 1U8PA 4WNQA 1AD9B 4FFZH 4UIMB 1G6RB 5KSBB 3DGCR 1SM3L 3PUCA 3DVIA 4PV8B 3TP4A 1BAFL 1JNJA 4U33A 1TCMA 2MCPH 4G8GB 5CIPH 3RNKA 1PJ9A 1BFVH 1ETZA 4G7YH 1JRHL 2V7HA 1TJHL 4X6CA 2XA3A 3FB6B 1MPAL 2AJSH 2OP4H 4OI8A 1CR9H 1I85C 3OB0H 4UV7L 1AHWA 4NSKA 4CU7A 4XNYL 2A0LC 1FG2A 4ZUWA 2PW1B 2XWTB 1S78D 4W68A 3KPSB 1OWWA 3F62A 4CN4A 1VHPA 4NZTL 2HT2C 3ZSTA 3PWPD 5D93C 4PJXF 2XA8L 2WLZA 1WCBB 2W1NA 1NC4A 5DFVD 1LEKA 3SO3B 2YA2A 3JWOL 2AEQH 2GK0A 5FCUH 4UQ2A 4GUPB 4MA7H 4ZTOL 1AKJD 4S11A 4BK4A 4HC1A 4HUVB 2VC2H 5CZKA 5DD3L 3QIBB 1ZT7B 2B1HL 5GXBB 2XXCB 3QIUC 1S5IH 1RUKH 4QXTA 1A7QL 4YJZL 1J0ZA 1M71B 1ZV5A 1PX3A 4IRJC 3L5WA 3DLQR 1EX0A 4DKEH 3ZE1E 2UY7A 1ULVA 4G7VL 4PRAA 2JLLA 3MRIB 5ID1A 1ORSB 1YEDA 1JMXA 2HFTA 1JVKA 3FRPA 3V4UL 5TDPB 4FG6D 3BH8B 4Z78B 3A6BH 1UWGH 2XWBB 4GW5B 1PZ5A 4BYHA 4PJDE 2ARJA 4U31A 4ZFGH 3MCG1 4I4WB 4GG6B 4TSCH 1JNLL 3L95A 4P2QD 5DVMA 5FECA 3HC0A 1GZQB 3JV6B 1SBSH 5DRWA 1GHFH 4KJPC 5IEKB 4HK3J 1MQKH 1NBVL 1EERB 3QUXB 2XNAB 2FH6A 2CIIB 5IR1A 3BEWA 5I74C 4HQQL 1F6AB 1IGJB 4Z7UB 2GCYA 1A6TB 5DMJB 1UGNA 3NOIA 4X4ME 4ONHA 3SDCB 2X05A 3U1SH 4DAGL 4AIZB 1K6QH 2P7TA 2AXHA 3OG4B 3VXPA 1G7QB 3AMKA 4DEPC 4PRNB 5JZ7D 3MO1A 1PAMA 3ARSA 1E4WL 5TDOA 5HTSA 1AD0A 3V95A 3CFCL 3UZQA 3FB5B 1MHHA 3LZFH 1HIML 5D7JA 3BDYH 3U4BL 4FFVC 5C0JA 1GSMA 4NQXA 4LSRH 5FGSA 3OHXB 5IBUG 5EU5B 3U46A 3H42H 1G9EA 4PRHE 4L4VE 2R2EA 1JZ2A 5E8EB 2AJUL 1JJUA 5DJ8A 5FKPA 2EDJA 2R0ZL 3VD9A 2W9LA 4QRPA 2OMNA 2YD2A 3LB6D 3ZZ1A 3S5LA 2GY7B 2ZUVA 2H8PA 4NKDA 3PDGA 3HC4H 5J6GB 1DP0A 3KPNB 2G60L 4TVPH 2XZQH 4K23L 4Y4HD 3NCFB 1VFBB 1BF2A 3MA9L 5E8DL 1G9MH 5IK3A 3QIWD 3OPZL 5K9QI 1BREA 4LQ1A 4JPVH 5DO2D 4YZFF 3WDHA 2BRRH 3VMNA 5AD0A 3KLHD 2FO4B 5DI8B 2NR6D 3NAAH 1U58A 1IFHH 1BQLL 3RY4A 4N0UE 3MJ8B 4JY6A 1DR9A 3EFFA 4L4TB 2CJUH 2QSCL 1NCBL 3H8NA 4HW6A 5K9KA 1QO3B 3P9MB 4YHKH 5DDHA 1D9KD 1CFQA 2A2QT 4R7DA 5C08A 1MI5E 1KTKE 4M93C 3ULUD 5D5ME 3WMSA 3M07A 3NFSH 3JTCA 1UJ3B 3EO9L 3O4LD 1QPPA 2XIDA 3DTXA 2FZ3A 3D39D 1UXWA 5I1HH 1HK6A 1F90H 4K8RH 2DDQL 1OY3B 2N4IA 4KV5F 4QRRB 1QG3A 3O6FD 4KZDH 3TT1H 2R29L 4OM0L 4JRYD 5D7LD 2ARJQ 3TCXA 3GHEL 5DUPH 1PBYA 4GRWB 4OCRH 2WIIB 1M7DA 4ZXBD 3LN9A 4AIXA 1KIQB 4QRQA 2VZVA 1IGYA 1OB1A 4DZBB 3TA3C 4CADA 4MCYA 4PJCA 2LABA 1II4E 3QXAA 1UA6H 5CHNB 1SVZA 3R0NA 2E9BA 3PV6A 4YPGB 5ILTL 1MCQA 4AYFA 1S7QB 3VXUB 3MMEA 2CLRB 1DL7H 1F8TL 5EZJA 2VDRH 3KXFD 4X9HA 3CVIH 3JTSA 2WP3O 3IDJB 1UG9A 4CGTA 5I9QC 4M7ZC 1JUFA 2E7LC 3E6HA 1ERNA 4EVNA 3ARUA 2GHWB 2G9HA 1P7KB 5ADPL 5BV7B 5F6HI 4CAGA 1CBVL 3KYMB 2AAVA 1JMZA 3D9AH 3FO0L 5HDQL 1N5YH 3U36B 1MFDL 3VH8G 3QPQD 3TZVA 4PLNC 1GGCL 1FL6B 1FGNH 5T33H 1G9MC 2HT4D 3FOMA 2X4SA 5KVMC 2J6EA 3BUYB 5FYKL 3CLEL 4RAVA 4G5ZH 1MHPH 4Z7QF 3RPIA 5FA4A 2DWEB 1FDLH 4Y8DC 3TIDA 4HIHA 3D18B 5ICZB 1T7WA 5DVKA 2A6KB 3GRWA 1MFNA 1P4BL 4I0CC 1KELL 4XMPH 5F7DA 4F7MA 3OAZK 4JVPA 1VKXB 2OI9C 3GHBL 1MWAA 1QEWB 4P57B 1WBYB 4QXUL 5D6CA 1YEHL 5IEHA 3QZWG 5IVOA 2IANB 5C0BD 3BGFC 1D7FA 4U0RB 1U8MB 5I1JH 4PJEB 2IGFL 4POZD 3SJVE 5D7IE 2W60B 4FRWA 5KS9B 5JA8B 2AJVL 1D5ZB 4KMLB 3C2SA 2DRUA 1FLRL 2EO1A 4ZSOA 1FP5A 2YD3A 1FN4B 1U93B 1DZBA 1PG7H 2X4NB 4GLRH 4K8RC 5L6YL 4XXDB 1OLLA 3C8KA 3S3SA 2DTMH 1IM9D 1IEAA 3VWKC 3KYAA 1BIHA 4QRUB 3E6FA 3PE9A 4UT6H 5A16A 3KPPB 4BH7B 5SWZD 2FHCA 4ELKA 4UQ3A 1KLFA 1RU9H 3CFBA 5D1ZB 1CK0H 4EUPB 2PNDA 3DUUA 4XBPB 3MJ6A 2X1PA 5E6YA 3TO4B 1UWEH 3RDTC 1EAPB 3MRRB 5DWUH 1WBZA 4RFNC 2DMKA 3IU4L 3TYGL 3U6RB 4NO3B 3FQTB 2VOTA 1CT8A 3D0VB 1IVLA 4UIKL 4OT1L 4P5TB 3ZDXF 2YPKB 1A4KA 2YD4A 4JDZA 3PHQA 4BH8A 4HF5L 5C0DA 1N7MH 2JIXA 3AXLA 4XPGL 4Z7VF 2BNQD 1QNZH 3BO8A 3HZVB 5JXAH 4KJQD 4PJXE 1A1OA 2UWEA 3TBWA 3L3OA 5ITBH 3VW3H 3MV7E 4G8FB 5JW5A 1AFVL 2NY2B 3I6GB 1B9ZA 1FPTL 2YSSB 3PNWB 1FV1B 5DJCB 1MRFH 4JO4L 4P5MA 4MB3A 4Y4KD 1C1EL 1MREH 3NZ8B 2YMXL 5JOFA 1UCBL 3LKPA 2MPAL 5L2KD 1KCGC 3I50L 2YBRB 2YRZA 4HJ0D 4NQCD 4EBQH 4C56E 5LWYH 1DLFH 5IHZB 1FC2D 2R23A 4TVPE 1RZ7H 1MHCB 4EJ1C 2RFXA 4RRPA 4JFZH 4TSAL 1UT9A 3LN5B 1DBJL 1U3YA 3DXAE 1NMAL 1XR8A 4D9LH 3T3MF 4Z7WA 1HI6A 2GW5A 2VDML 4LPXA 3THMH 1CLZH 4OGXL 1ZSDA 3U9UB 5F6HJ 5FYJD 5I6XB 1R0AH 4YGVA 4OBRA 2VLJB 5CUSH 2X7LA 4ZAKC 5DQJA 2JJTC 3EYVB 1X5FA 4OZHB 3QAZC 1MRCH 1SJEB 4F57H 3O6KH 3WXVH 1OCWH 2GT9B 5CBEA 5CKGA 3RKPA 3O45A 3PDOB 1KENL 3ZL4L 3CMGA 2EYTB 2XQBL 4JPKL 5FIEA 4HZAA 1T4KA 3D48R 3PV7A 1BD2B 1A6UH 4YX2L 1MVUB 5HGAB 2NX5E 4U1GC 3VFSA 3S8WA 1DSFH 3B8YA 2Q7NA 5EZIL 3WIHA 4WGVB 3MLYH 4F3FA 1YEFL 3PG2A 1TPXC 1T89C 5ESVB 3SGDH 5ACMA 1J10A 3U30C 2ZCLH 5GGTA 1T6WA 5H94A 4PJIF 4HKXB 1BLNA 2F15A 4XCEA 4RQQB 4UAOB 5TE6H 2BSRA 4L8BB 1FYTA 1EHLH 4G8IB 2GY5A 4I0PC 2VZOA 4AH2A 4YDKH 2J7LA 2VE6B 2I9TA 1X7QB 1LP9B 4PTTA 1AGFA 3IDMA 4ODXB 5SWSD 5JHDE 1OD9A 4JO3H 4OD2A 3H9HB 1KGCE 1ES0B 3A67H 3DBXB 5C0IA 4XNQB 4Z76A 3PF2A 3AM8C 3TO2A 4O00A 2VO5A 4YZFE 1UH2A 3VFTA 3VFPA 2ESVB 4HKBA 3O3DB 2JCCB 3QA3A 1RFDL 4P46D 2APTA 5T5FL 2RJMA 2GYSA 2AJSL 2OP4L 4Y19D 2DQIH 4U1SB 1JBJA 1BBDH 4N8CL 3K80A 4PBVC 1TCRA 2YD1A 4XMKL 4Y4FD 3ZKND 4XT1C 4P2YA 4CVZB 3J8F7 3HAEA 2IAMB 4H8WL 4D94A 4HG4K 1ZT1A 4Y8AA 5EUKA 2APFA 4QYOB 1RUQH 2FD6H 4F7TA 1S7RB 4LCCC 1X5KA 2D3VA 2ENSA 1OOAA 3C09B 1INEH 4TULH 3GSNB 2YUVA 1TJGH 3QFJA 2NCMA 1Q1JL 4J1UB 4OGZA 2IPUK 4HWNA 3UJTH 3MLRH 4U6HB 4KV5E 1HEZB 3U7YL 1XZ0A 2AJ3B 2FL5B 4RBPK 1YY8A 1GL4B 3MA7B 1RZFL 1RUKL 3TJHC 4OD1H 2VDQH 3GMQA 3ARXA 1IAII 1F4WH 1H3GA 3ZYIA 4P2RA 1DDHA 1TETL 2BOBB 1EBPA 2XN9A 4DKEL 4NWUH 3FQXB 4ZPVB 4N5UA 1NDGA 3ARBD 1I1YA 3VE0B 4WY7H 1VEMA 4MB5A 4DKDC 1RUAH 3N1QC 1UWGL 2NY6C 1FFPA 5H2BB 3CSYA 5C2BH 3DX8B 4ZFGL 4S1RH 4ELMB 3KJ6H 4RCAA 2VUYA 1LE9A 1R5VB 1BGXH 1U42A 4NN6B 2CKBA 3FCTA 5MP6L 1KIRB 4DZ8A 1FE8H 1SBSL 3KR3H 3MRMB 4QCIA 5IB3A 4FQXC 1Q9WA 3NCCB 5GIRA 4IS6B 3HS0B 2UYLA 4DUWA 1Z9LA 2AV7A 3IJYA 4XBEH 2MWCA 4QF1A 4XP6L 4JFDE 5HHME 3CUPB 3QULA 3NA9H 4OFPA 1NCNA 4L3AA 4GLRI 4YNYB 4GBXC 4DKFL 4YHIB 4O2CB 5EO0B 4Z7QE 1JF5A 5F7YC 4EN3D 2VLKE 1E28A 1F2QA 3MRPA 5IROC 3C87A 3MFGB 3TPKA 3PWUA 5E99L 4P2QB 3LZFL 5IB4A 5DD1H 2BC4A 3DIFA 4N0YL 1KNOB 1YPZB 3UPCA 3QUZA 4I3GA 2MHAA 4PGDA 4LSRL 3F8UB 1OGTB 3FRPG 3BZEB 3ETBF 5D1QC 3U4EB 3QCVH 3MJ9A 1MCBA 2EDOA 3QDMA 2Q1EA 5I1KH 1CWVA 5GZNC 4KRPC 3CH8A 3WYRA 1MOEA 4IIQB 5J4MA 2DKSA 2Q7YA 2XZQL 3SGJC 1J1XL 1G9ML 5INCB 3VGHA 4U49A 4YO0B 5E94B 3CPLA 3EDEA 3ARQA 5HYQB 4GO6B 1DN0A 2X9XA 2ATKB 4GH7B 5TFSH 4E5XB 4E42B 3RWJA 3T0EC 1H15B 1A9BB 2NY3C 4X98B 3BRDA 3QEHB 4ZQKB 1MUJA 4X9FA 5BRZE 1IFHL 3O8XA 3T0VA 3T0DA 3PQYD 1X5XA 2I25N 4AJ0A 3V7AG 3D3VA 1T21B 1U92B 2C1PB 1YDPA 15C8H 3TN0D 2EDTA 1MFAH 2CJUL 1YN7A 1KB5H 2X4UB 4Q2ZA 1T0NA 3ZHDA 5GZOD 2OS7A 3BP7B 4X6CF 3ZDXE 2FEDC 3G9VA 4Y4HB 4LSSL 2ZOLA 5JXEA 3ARGA 3K7UA 4RX4A 2V2TB 1QHOA 3QIWB 3F12B 2Z8SA 5K9JL 2V5MA 4PJ9B 4Z7VE 5F7EH 3EOBB 3V6ZB 4KXZH 3TFKD 1K4CA 1F90L 5F7FA 3LKSA 5KSAC 4PV9A 2DB8A 4OGYH 3TT1L 4JFQA 1WCQA 5DUPL 3SQOL 1QVOA 4KC3B 1SJVA 2AKRB 4LLVA 3QUMB 1MSPA 3HE7D 4MNQA 1I8LC 2PR4H 1RIHL 1T20A 1D9KB 5DMYA 3TVMA 4KK8D 1MF2L 2PXYA 1KJMA 1KLGB 5JW4Q 1DL7L 3O4LB 1U8QB 3ULVL 3D39B 2XWJA 2DQDH 1AD9A 3RVXD 1LK2B 2XZCL 1G6RA 4UIMA 3O6FB 1PEWA 1X5YA 4JRYB 3SGDI 2D7PA 3T3ME 3BMWA 4PV8A 4Z8FH 3UXFA 4G8GA 1QRKA 4QWWD 1LGVA 2FEEI 4BSJA 1N5YL 3HMXL 1B4JL 1EUUA 1WZLA 4LSPL 5C6PB 1KXTB 3SJVD 5EOCH 3FB6A 5T33L 5C0RH 1IAIL 3A6OA 1AH1A 3FT3B 1MHPL 3P73B 3KXFB 1NANI 1NPUA 2F54D 1JZ8A 1M1SA 2Z9TA 5IV2B 2PW1A 2XWTA 5M7QA 4Y0GA 1UCTA 3DRQB 3KPSA 1AIFB 4RAHA 3DO3A 5ICYB 3LPFA 4FXKB 4HX1B 4P4KC 3S7GA 4HFUL 1NGWB 5MI0C 3SGEH 1WCBA 1J0JA 4TPRL 2WM0A 1A1MB 4ESKA 2VSCA 5J3HD 4GUPA 4HUVA 1EJOL 3QIBA 1DANU 3WUWB 4LSUH 1ZT7A 4LHUD 3GJEB 2JJUA 3MOQA 1M71A 1BOGB 3UBXB 5I1GH 4UINL 3VCLB 1EEYB 2DOCA 1PG7L 3BQUD 4M6AA 2EIBA 3QEGL 4JRXE 3MRIA 5CP7B 1ORSA 3P11H 1ZLVK 4JKMA 3NCJH 4R9HA 4KKLD 1WFUA 4FS0A 4IDJH 2VDNH 5TDPA 4K2UL 1Q94B 4NBXB 4RGMC 1HKLH 3BH8A 5TGBB 4Z78A 2XWBA 4GW5A 4F7CB 1IGCL 4I4WA 1CXEA 4GG6A 4NQEE 1WEJH 2F5BL 4K7PY 4N1EA 1UWEL 1GZQA 3JV6A 3ZYOA 5IEKA 4NRZB 1U9KA 2Q8BH 4L3ED 3QUXA 1T66C 2XNAA 5MENE 2CIIA 3MNVB 4PD4J 5IQ7L 1F6AA 1IGJA 3DO7B 4Z7UA 5HHVL 5JW4N 1EEQA 5KVDL 1A6TA 1X5JA 1EMTH 4HGKC 3SDCA 2A9NH 5CKAA 4AIZA 3GNML 1RPQA 4G6MH 1G7QA 5JXAL 2D7MA 3KHOA 4PRNA 5SWZB 3S37H 5J0BA 4P49A 4MGXA 5F7WC 3VW3L 1JL8A 1JFQH 3B8SA 1DUZB 5BVPH 3FB5A 4JN1H 3OKYA 4MLIA 5B39B 2XICA 4BQCA 3BSZH 4CVUA 1AXTH 4TQEH 5DMIH 2QQLH 1MREL 1IGMH 4N8PA 1MJUH 4TTDC 3NIFF 4PJGB 4ZS7L 2IPKB 1DQDL 3BP6B 4F8QA 3OHXA 4ZUVB 5EU5A 3S36H 1MNUH 1NAKH 3QCUH 3B9KC 2WQ8A 5IBTH 4YHZL 2J8UB 3W5NA 4OKDA 1GYAA 5E8EA 2C26A 1FVCB 2BNQB 3OR6B 4FQQB 3MV9E 5LVEA 2X10A 3BIBX 5AYUL 4X6EB 5J6GA 3SE4A 4JFZL 4PJCF 3KPNA 2VJXA 3EYQC 5I8KH 4XAWH 1VFBA 5K59E 1JPST 4D9LL 5IBLD 4NQDE 12E8L 2ICEB 1E6OH 4DN3H 3VD7A 1OQXA 1OARH 2BHZA 3TBSB 4OLVH 3DV6B 1Z9SA 5HI3D 4Q6IC 5FYJU 4UI2A 1MEXH 4HWBA 2FO4A 4HXBL 5DI8A 2I5YH 4GAFB 5L2KB 1R3HB 3RJDA 1GXEA 3MJ8A 5HVHC 1MRCL 5GHWH 3G6JB 3EYOB 4NQCB 3O6KL 3OZ9L 3WXVL 1HH9B 1F13A 4H26B 1A6ZB 4F7PB 5B4MD 4L4TA 4JAMB 2DM7A 5GS0H 5JHDD 2NY0C 4UBDD 5FDYA 1QO3A 3P9MA 4RFOL 4BJLA 1J0YA 3NCEB 3FZUD 4A2LA 4D2NA 4MXQD 4JLRB 4UT9H 3I2CH 2CK2A 4NM8H 3EJJX 2DMCA 5DS8B 1DSFL 4WFHD 1UJ3A 3E8UH 1YEEH 4RZCB 4FFYH 4M5YH 3HB3C 4XCCH 3K8LA 3PWNB 4QRRA 2O61A 2LE9A 1JWUB 2PO6D 3HE6D 1A0QH 1RK1B 2FEEL 3KPQB 4RRPG 4W4NA 2WIIA 4KJWC 4X80L 2I9LB 1F45A 1KIQA 1U8JB 4DZBA 3BWUC 5L0QC 1UYWL 4OIIH 1IC5H 5IFHH 5E70A 5A2IH 3SOBH 4JO3L 4E0RB 3B2VH 4XXCA 3UROR 3FQUB 1GJIA 5CHNA 4KXZI 5GS3A 4YPGA 5F89B 4F80A 1S7QA 2GIYA 4LKCB 2R1WB 5DJAB 5LBSH 3P0YL 3VXUA 2CLRA 5IJVB 3HC3L 4HPYL 2VABB 2AXJA 4KY1L 4NNPH 1QSEB 5D7JC 3IDJA 4M43L 4NDMB 2OLDA 2Y6SD 4WUUD 2DQFB 3FJTA 4G6JH 3V6OA 2IJ0C 5F7LB 1P7KA 4TN9A 3T4AB 2DQIL 1FQ9C 2EDHA 5T3XH 5T1LD 3KYMA 3MLXL 4GMSL 7FABL 1KV3A 3U36A 3GSXB 4LLMB 1U41A 5SWSB 2Q6WB 3BRGC 2D4FA 1IBGH 1MCLA 2GSGB 1FL6A 4X6CE 5T5NF 4OFIA 1XGUB 2IMMA 3BUYA 1ZLUK 1EVTC 5KW9L 1PY9A 5HHXH 5JIPA 2DWEA 4RA0C 2X4OB 3GBNH 3D18A 5ICZA 1TJGL 5A43C 2A6KA 1BQSA 4PB9L 4P46B 3ALXA 3F7RA 3MROB 1HCVA 2ARWA 1H9VA 4Y19B 3U7AA 1VKXA 5J06A 3GRWH 3ESUF 4R2GD 1QEWA 4P57A 1WBYA 5E1HB 5GGRB 3RWFB 5GS0C 1OAQH 4PJ5D 2UWEF 4JFDD 4PJ8D 2D0GA 1UADC 2IANA 5C7XL 1MWAH 1U8MA 4PJEA 2AI0L 4X7SH 4DUVA 5KBNC 2W60A 5KS9A 4JKLA 4QNPF 1D5ZA 4LIQL 1YMMD 4TOYL 4XVJH 3T2PA 4YHML 2A9MH 4XMLL 1FN4A 3MLZL 1U93A 2X4NA 2VLMD 3SGEI 1QRNB 2FHBA 4PY7B 3ARDB 4XXDA 2UZIL 3HKFA 1F4YH 3HAEG 4QRUA 3WO4C 2WK2A 3KPPA 4BH7A 1JPTH 5DJDB 1QSVA 5CZVH 5D1ZA 4EUPA 3QDJD 4LASL 4XBPA 3TO4A 5I75B 1EAPA 3MRRA 4Z7WF 4R3SB 3ARBB 4IRZL 2QLVB 3U6RA 3FMGL 4NO3A 5GSVB 4DGYL 3FQTA 3D0VA 3OKDB 5C0AE 4P5TA 1LO2L 1A6AB 1YUHB 2YPKA 5IMMB 4Y7MA 5HDOA 1EK3A 4J8RB 2ZJSH 2K3TA 2PETA 2O5XL 5DD5L 2OR9H 4GXVH 3HZVA 4X6DB 2P44B 1G9NH 3MRQB 3HRPA 1BBJB 3BD4A 4MVBA 1JI1A 5BRZD 4G8FA 1NFKA 3U83A 1PSKH 3I6GA 4FQIH 4N5EC 2YSSA 4TUJB 3PNWA 1FV1A 5DJCA 5E6IB 3RKDC 3I6LE 3BKMH 3EKCA 1J05B 3ARTA 3F7VB 1OW0C 4PS4H 4O2EB 2EDDA 3NZ8A 4KKBD 3VDCA 4RSVA 2YUXA 4ZTPH 5GGVL 3BZ4B 4NUJB 1RZGB 5ISZD 5CZXC 4OKVB 2YBRA 4WWKC 4AL8H 1U6AH 3ZKXB 1EEUA 2D7TH 1CLOH 1S9VB 4CKVX 3V8CA 4UB0L 4OZFB 5IHZA 4WUKH 5TFSL 2W0LA 4KGLA 1MHCA 3HI5L 4QRPE 4MB4A 2BRQA 3LN5A 5BOPA 4NFCA 1YEKL 4KHXL 4YBLC 4AEIH 4FQJL 4U1MB 5J56B 5ECJE 3QPXL 1IRAY 1RZIB 1FIEA 3U9UA 2VLJA 3C08L 1LO4H 3CDGB 1JGUH 2GKIA 3EYVA 1X5ZA 4PRBB 4OZHA 1HNGA 2OXHA 2A1WH 4N9OB 2RBLA 3OAYH 1EEZB 1SJEA 4R97C 2GT9A 1X5HA 2YPVL 3RY5A 4KQ4H 2UZYB 3PDOA 3VRLF 3WN5C 2EYTA 1D5MB 3GMPB 4L3CB 4U1LB 5L9DL 4OGYL 2Y06H 4KAQH 1BD2A 4PGZA 3WD5H 5C08E 2IFGA 1MVUA 3PQYB 4FQHB 1RUPL 5HGAA 5J12B 4YE4L 1QBBA 2PYED 4O4YH 3GM8A 3TBYB 4ODSH 3IDIB 4NO0B 2EE9A 4P3CL 3NIFE 3WFDL 5ESVA 5EOCJ 3QXVA 4M1CD 2PR4L 3LD8C 2EIEA 3WIHH 4AMKH 3TPUB 3GIVB 5CP3A 4HKXA 4TUKL 1DQJB 1U2HA 1OAUL 4RQQA 3UTOA 4L8BA 1S9YB 5GGTH 3QG7L 4G8IA 3RQ3A 1UZ6E 1G9NC 2VE6A 5EBGA 1X7QA 4LEXH 1LP9A 4PTUB 4EOWH 1Z0NA 4ODXA 1WZMA 4NO5B 4RGNB 2AEIT 2C3WA 3H9HA 1Z3GL 4PJCE 1ES0A 5TE4H 3W9DB 3DBXA 4W4OA 4XNQA 1OM3L 3SCMD 3BD3A 4R4FH 2V5YA 4HEPG 1GCFA 4V3DB 5HYSG 5A1AA 2ESVA 3HE7B 1A22B 2VH5L 3O3DA 2JCCA 3RUGB 1N26A 4OZIB 4DQOH 3R06B 5T3XE 5B3NA 3W2DH 4OV6F 4U1SA 2M8XA 3UP1A 2B5IC 5CJQL 4JN2B 4X5LA 4H5SB 3B9AA 4WEBL 4CVZA 2AJXH 5D2LB 4DOHB 2IAMA 4JRXD 4MA3B 2DQUL 3CX5K 5GGQH 4WI2A 4QYOA 3HAEH 1S7RA 1RZKH 2FX8H 2DD8L 3HG1B 4POUB 1GH7A 1L7IH 3GSNA 4XX1G 2VDPH 4POYA 4ZG1A 4J1UA 4PR5B 4U6HA 1HEZA 4XWOC 1QPXA 2AJ3A 2FL5A 2OTUB 2F8XC 2W0KA 4J6RH 3MA7A 4HC1L 2FGWH 5MEND 2P45B 4XPBL 3IGAB 2ED9A 2H2SD 2EEBA 2BOBA 2ZG3A 5DQDH 2F54B 3RTQD 5F9JB 4P23D 5KVEH 4Z95H 2H1PL 2QBWA 1J1OH 3EYUH 1MQ8A 3FQXA 3TV3H 4FMFA 3P11L 4ZPVA 1O5DT 1E4XL 3C60D 3VE0A 4KPHL 5IB1B 1G7MB 5C07D 4RMSA 5TF1L 2WY3A 4JG0L 1OP3H 1WFOA 4ZSOE 3P77B 5H2BA 3DX8A 4X5XB 2W65B 4ELMA 5BCAA 1R5VA 1EBAA 5FYLD 2VITB 2P47B 2ICES 1LHZA 3CMOH 4OFDA 4M7JL 4AQOA 2HVKB 5I8CB 1KIRA 3VD3A 4LHUB 3MRMA 3LKOB 3O3BB 4NWTH 4U6XB 2XXMB 5TQ0H 2HFEB 3DMMB 2CKBH 4IS6A 3MBED 3HS0A 1UH4A 4IRSD 4OF3A 3BQUB 4EI5D 4K07A 4FQCL 1A02N 3CUPA 1HHKB 2GJZB 1QA9B 1LNUB 4OSUH 4GSDH 2NLJB 3V6BR 4YNYA 4G6ML 4YHIA 4O2CA 5EO0A 3BW9B 4I1NB 4YHYC 1OTUC 4GS7B 5FUCC 3NH7L 3MTRA 1HYSD 4YHLL 4P2QA 5EA0H 4OF6A 3HLAB 1E27B 4WGWB 1KNOA 4OFVA 4TQEL 1YPZA 4J4PC 5DMIL 5M94B 4XVSH 5F8QC 1IGML 1HSAB 4L3EB 4NM4L 1GAFH 1KBGL 2CD0A 1SBBA 2G75B 2CDFB 2UWEE 3EDKA 1OGTA 3MLSH 3OGOE 2XTJD 3O3AB 3BZEA 3U4EA 4C54A 4Q0XL 4KK6C 1RZKC 4QNPE 1B0WA 3H2WA 1TTUA 2R0LL 4BSVB 3MJ9H 1SMAA 4XRCB 3HR6A 1SEBB 5E7FA 1TIUA 4IIQA 3T08A 1YEIH 5C0NC 2WUBH 4JRWA 2BY2A 3CVHB 3QG6B 5INCA 4YO0A 1H3PH 5E94A 5HYQA 4M3KB 1C7SA 4HIXL 1QFWH 2ATKA 4EEEA 4E5XA 1ZA3B 1M05B 3NPSB 1H15A 1A9BA 4X98A 3QEHA 1X44A 4ZQKA 4BFEA 3HNSH 1LDPH 3J7HA 5GHWL 1KPRB 3DURB 4XPTL 2MCG1 3VXTB 1T21A 1U92A 2C1PA 3LRHA 4WCYH 4Z7WE 3SDAD 3CH1B 1SJXA 1E6JL 2R8SH 2QQNH 4UMGA 5GS0L 2X4UA 3T1FB 4JB9L 2BFVH 3NVQA 3MLTB 4HJJL 4R90L 2GSIB 2XI9A 1RHHB 3BP7A 4Y4HA 2V2TA 3B2UD 1I1FB 3QIWA 3JZ7A 4UT9L 3F12A 2DQHL 4XC3L 3N06B 4PJ9A 4MZ3A 1IAOB 3E8UL 2BVYA 2R2BB 1SQ2N 3EOBA 4M5ZH 3V6ZA 3DV4B 4XCCL 4W81A 4FNLH 5F1NB 1BZ7B 2IQ9H 1W72B 3CXHJ 4OLYH 3RZCC 1ZGLM 1RZJH 1QSZA 4AEEA 2ZUQB 5F70A 2AKRA 1N8ZB 5GGSB 1FL3B 3FO2B 3QUMA 3VGDA 3MGTB 1V3JA 3ARZA 4H0HB 3B9DA 3RHWF 4UV4L 2VZ1A 2XT1B 5JUEL 4NHUB 1D9KA 3MGOB 4OAWB 1KLGA 1OP5H 1HSBB 3SE9L 3NABL 3HRZB 3O4LA 1FYTE 1U8QA 1YNLH 3D39A 1OAXL 3WE6B 2WSKA 3FOLB 4HUMB 1LK2A 4G6JL 3O6FA 4YC2C 2PO6B 3HE6B 3IRZA 5E9DB 4JRYA 3WLBB 1P5UA 4HZLB 2YRPA 2WMPA 5T3XL 1C5CL 2R0KL 2R69H 4ZPTB 1G6RH 3FQWB 4KROD 1NC4D 2P5WD 3RBGA 3QQ4B 5IHBA 4RMUA 5FUCE 2CKNA 5CEXB 4OV5B 5E2WH 3PGDB 4UTBH 1AY1H 3SO5A 3ISWA 4GG6F 5IESH 3P4NB 3FT3A 5DRZB 4D8PB 4FFWC 1CQYA 3IDYC 1G7PB 1BHGA 5HHXL 1ZT4B 3P73A 4M7KL 2WBJC 3KXFA 3WHE0 1D3CA 4HUUB 3CFEB 3K3QA 2J6EL 2AK4B 3VRLE 5KJRL 4WUUB 5IV2A 1BJ1H 2DBLH 3DRQA 1AIFA 4Z7UF 3SE8L 4XTRC 5F3BB 5ICYA 4HX1A 4FXKA 4KTDH 1UH3A 1MCNA 2UV3A 3GRWL 4HAGA 4P4RB 1NGWA 3I84A 1CG9B 1H3WM 3O8XC 4XP5H 3NPZB 1A1MA 1TVBB 2AQ2A 3DX7B 3Q2CA 3QFJE 4MJ4A 1ZKAA 1CYGA 3U9PH 3OF6D 4D0DB 3WUWA 2W9EH 4N8VB 5ABDE 3GJEA 4AEHH 3AAZB 4QXGL 3WLWC 5C0AD 4XVJL 5JXEC 3ARGC 5EWIH 1BOGA 4LARL 3UBXA 4PREB 3PABB 3VCLA 4JY5L 1EEYA 3I85A 4P2RE 1KCRH 4XP9L 1LO5B 2XN9E 5FYKD 1FZJB 1ZHKB 4HIEB 1KIPB 1RZJC 4M6ML 5CP7A 5DHVH 3W0WD 1NGQL 4ZUSB 5F7UA 2NPLX 3V9FA 4R2GB 1Q94A 5TGBA 2AVGA 4GMTH 4KI5F 4XPHL 3JTTB 4F7CA 4PJ5B 4G6KH 2OL3B 4JFDB 3KAAA 4AG4L 5CZVL 4D0BB 3QISA 2HLFD 5I8OH 4PB0H 4U05A 3WKNA 1P84J 5GGUB 1X5AA 4NRZA 1YMMB 1P1ZB 4KDWA 3TVMC 3BT2H 3MNVA 4OF8A 3TJEL 3NIGE 2R4RH 3DO7A 1UQSB 1WFNA 1KCUH 5IT2L 5I1EL 3FFCD 1CL7H 3DECA 3LS4H 1AQDB 2EH8H 4BFIB 5SWZA 5J13C 4CMHB 5CEZL 1I3GH 3V6FB 3D87B 3DOSA 3QR2A 1DUZA 4HFWB 1INQB 3QDJB 5CMAB 5B39A 5F3HB 2WWMC 5M95B 4PS4L 4M4RA 2YN5A 3KLAB 4PJGA 1JV5A 3NCYP 2IPKA 4ZTPL 1CVSC 3BP6A 4L8CB 4HV8B 2WUCH 4ZUVA 3EHBD 2HMIC 3VXRD 3U0WL 2J8UA 3ES6B 1FVCA 2P24B 1CLOL 3HNVH 4GRWF 2BNQA 1T03L 3OR6A 4EUPG 2P46B 4FQQA 3WS3B 2HP4A 3QDME 1GIGH 4X6EA 3LDBC 4JM2B 4MA8H 5C08D 5F88B 3SO3C 4HGMA 2H6PB 3ZDYF 3WSQH 3H9SE 3AS1A 1KTLB 2ICEA 3OKEB 3LAFA 5D70H 1JFMA 3TBSA 3MOAL 3DV6A 1ZWIB 4RISL 3W82A 5E4EC 1MFCL 1QYGL 5L2KA 1XF5B 2YA1A 1R3HA 5HYEA 1JGDB 5C0GB 5ISZB 5F1KC 2A1WL 4HWBH 3G6JA 5IMKB 2MQ0A 3EYOA 3O3EB 4NQCA 1HH9A 4H26A 3D3VE 4JKKA 1A6ZA 4F7PA 4JAMA 1VGKB 4OLWH 1UACL 1S7UB 1ZTXH 3L9RB 4XAKE 1QFWI 3B9VA 3TYFB 3WD5L 4F9LA 3FONB 3LH2L 4JLRA 3HFMH 4I2XB 2MMXA 4X7FC 1S7TB 5DS8A 2Q8AL 4RZCA 1YYLL 1GPOL 3QUKB 3AMLA 4MJ5B 4NRXB 3PWNA 3QUXC 1JWUA 4WTZA 3WKMH 2IFFL 2NYYC 1RK1A 3KPQA 1F4AA 1KB9J 2FB4L 3PWLB 1VCAA 2I9LA 1U8JA 4KUZH 3MV01 4LEXL 3SDCC 5HGDB 4E0RA 4MNQE 4OCSH 3FQUA 1LK3L 5EO9B 1H8OA 1EHXA 3BJLA 3IVKB 5F89A 2QSQA 1R6VA 4PJEF 4LKCA 5DJAA 2R1WA 5IJVA 4MXVF 4L9DA 5KS9F 1P7HL 1CGXA 2PYEB 2VABA 4ZMAT 4S1SL 1LO0L 1QSEA 4J3VA 3FAWA 4APQB 4NDMA 3GGWB 1YQVL 1OAYL 1RMFH 3Q3GB 3VFOB 1RK0B 1JHTB 1I7TB 2DQFA 4DQOL 3O2WL 3RVWD 3VFWB 5ALCH 3T4AA 3W2DL 2DLFL 5KSBE 3REVB 4ZFOB 3SHSA 4G8GE 3VI4F 1MCDA 5BV7H 3GSXA 4LLMA 5SWSA 2Q6WA 2VXQL 4NKOB 1RULL 2GSGA 4JHAH 4I3RH 4B7IA 4K3JH 1OTSD 1XGUA 4Z5RB 4ODHH 3SCMB 3T4YB 1RZKL 4JM4H 1YYMH 2X4OA 3N9GH 1MFEL 4JG1H 3EOYG 2EH7H 2YC1B 4Y89A 32C2B 1FAKT 4FXGB 4P46A 4ZO9A 5IVZB 4DN4H 3MROA 3GBMH 1L4IA 5F6IB 2R1YB 4Y19A 2B4CH 2VXTH 4LKXB 1GC1C 2CLVB 3QWOB 4PYGA 1QKZH 3INUL 4N68A 4O5LL 5GGRA 3RWFA 1S3KH 1S9KC 4HIIB 5KVEL 1JF1B 1OSPH 4X7DC 4R26H 3OXRB 5BVJB 3QCTH 4X9GA 3E3QA 4OCXL 1XT5A 5T1KD 1CTOA 2GITB 4JQXA 2A77L 1BX2B 2N7BA 1MCJA 3UCRA 4LGSB 4N9GB 3BN9C 4QGTA 5EULV 1QRNA 4PJHB 4PY7A 2DL9A 3ARDA 4BK5A 1K3IA 5DD6B 5KTEH 3ZO0A 3K4DA 5CLTA 2V5TA 2X44D 5MENB 2BDNL 5DJDA 5E56A 5GRUH 3RTQB 5CEYB 2A6IB 1L0YA 4GG6E 4R3SA 2BERA 3ARBA 4N1HB 4EUPH 3C60B 5GSVA 4DFIA 2QSVA 3OKDA 5C07B 1J88A 2R39A 1E0OB 4BSWB 2MQ3A 3OXSB 2HTLD 1A6AA 5FO7B 1YUHA 1KYOK 3VFGL 5IMMA 3GI9H 1I9JH 2VDKL 4GT7A 2X6MA 4J8RA 4KUCF 3EYSH 3SN6N 4OZHF 1DQMH 4Z7UE 2EIZB 2I60H 4OQ1A 2ZPKH 3CAFA 4JQIL 4X6DA 4XVSL 1DLHB 4R0LB 3MRQA 3V6OC 3HMWH 1BBJA 4ZOEA 4JGMA 5BV7C 3MBEB 2AJYL 3G9AB 4FQPA 4IRSB 1DQLH 2VR4A 2D2OA 2DI9A 4LSTL 3RIAF 4EI5B 4TUJA 4XVUC 5D96C 5E6IA 1J8HE 4Y5VC 1AO7B 3NFPB 3F7VA 1J05A 2V5RA 3L7FB 4O2EA 3IDXH 1HDMB 1G84A 1ZLSL 1V7NH 3O6LL 3V52H 4YBQC 3BZ4A 4NUJA 1CL7I 1NKRA 3KPTA 3DVFA 1RZGA 3O2DA 4PBWD 1T0MB 4OKVA 4K7PX 2VQUA 2CXGA 5JORB 2NY7L 5DJYB 5GRXG 1S9VA 1GGTA 4DW2L 4OZFA 2XKNB 1LP9F 4KI5E 1UM6H 3F58L 3AB0C 5E08L 3M8OH 1U8LB 4I48B 2XTJB 5E5MB 4KKCD 2LV4A 2HYMA 2VIRB 4U1MA 4PDCE 3L7EB 1Q9LB 1RZIA 1UVQB 4U0RC 1YN6B 3UDWC 2MTPA 3OGCB 2QQNL 3WHE1 5KZCD 1XIWC 3BPCB 4FQLH 2HWZL 2OK0L 3CDGA 1WWCA 1C16B 3BPOB 2ZZUT 4PBXA 1A14H 4L9LB 2JCCF 5A2KH 2CGRL 4V1DD 3ZTNH 4LLWB 4PRBA 1ZEAL 1JCKA 1EEZA 4BKLB 3TF7A 3PP3H 5A3ID 4V2BA 3BKYH 1ADQL 4L4TE 1D5MA 3GMPA 5ALBH 4L3CA 4U1LA 4O58H 5C92A 3F6LA 4M1DH 1RZJL 3PQYA 5H35B 4FQHA 2VLRB 2WWKT 1WT5A 5D1ZC 1WLHA 1KEMH 5GS2D 3TBYA 1QFUH 2ADGB 3IDIA 3EOTH 4NO0A 4X83A 5HI4C 1RJYB 1AGEB 4EI6B 1NAML 2WAHA 2FECL 5E2JA 2HRPL 4YPJA 3TPUA 3GIVA 5E6ZA 4GAJH 1CGWA 3RWIB 1DQJA 4P5TC 1A1NB 4QHKI 5C9KA 2BX5A 1N3NB 1S9YA 5J1AB 4ALAH 4GRWE 5CP3H 3S35X 4IOFC 2J88L 1MRDL 4HBCL 4ETQB 2GI7A 4PTUA 1BJ1J 3TFKA 4X5WB 4NO5A 4WW2B 3W9DA 2VTFA 5D1XC 4K3HA 2J5LB 4CDHA 2O5ZH 4MVBC 3ZDYE 1DJSA 1TDQA 3G6DH 5CGYD 2NY2C 5CBAB 2R69L 3VXUE 25C8L 1MFBH 1DBBL 1MCCA 4LCYB 4YIQB 3UTPD 4OCYH 3HE7A 1EDQA 4J3TA 5E2WL 3T04D 5FDWB 3O4OC 3RUGA 2VXVL 4OZIA 3R06A 2X42A <