4U1SA

Hla class i micropolymorphisms determine peptide-hla landscape and dictate differential hiv-1 escape through identical epitopes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
278
structure length
278
Chain Sequence
MGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-81 alpha chain
publication title A molecular switch in immunodominant HIV-1-specific CD8 T-cell epitopes shapes differential HLA-restricted escape.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 83
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u1sA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4u1sA01
2EIDA 2APVA 2BDNL 3VWJB 1KIRB 4WUUE 1F4WH 4BSVB 2UV3A 4YHLH 1NCAL 4PREB 4PJHF 1KULA 4RZCA 4LNVA 3ZSTA 5D8JH 2CKBL 2V17L 3HLAB 4KMQA 3O3UN 3H2WA 4HIJA 3O3EA 3O4LB 1PZ5B 2EIBA 3QQ3B 4ODUB 5AUMA 3KLAA 3FMGL 4JY4B 4F3FB 2AEWA 4G5ZH 3VXRD 1MCDA 2UWEE 5CILL 3OJVC 3S88H 4HW6A 5GS2H 1CLOL 4JRYD 4KDWA 2VERN 3BYTA 4JGUA 5BJTB 2ZOLB 3O6FB 4GOSA 1GC1H 5EC1B 4J4PC 4M02A 5ANME 2IAMA 4PRHB 2E7CA 5D1QA 3X3FL 4GMTH 3PP3K 4K8RC 3AROA 3ALXA 1ZV5A 4DN4H 2VZVA 1N5AA 4QHNB 4XMPL 5B21A 3OJMB 1F4AA 3S36H 3DRTB 1NCDH 2HTLC 2R0LL 1JNHB 3ZDYF 4WTZA 4JQIH 4XX1G 1WTGT 1OM3L 4MNQB 5CEZL 3RGVB 2XICA 1ES0A 2A77H 5INCA 5HI5D 1YPZA 1YEIL 3VFPA 5ID0B 2F53A 2CUHA 3HC3H 2R1WB 2NX5A 5C2UB 5IG7A 4PGZA 4M1CD 1W0YT 4IMKA 4KK9D 5DR5H 4QGTA 4ONFL 3MRCB 3BMWA 4MB3A 4YDVB 5KTEH 4QRRE 1NUFA 4LNRB 5D72H 4HEME 4UIKH 2HJKB 3AAZB 1DL7L 4NRZB 2WNGA 1PEWA 5EOTB 3KYNB 4X6FB 1DQML 5HDBE 4BUHA 4QYOB 4P46B 4ZUUA 4PJAA 2H6PB 1NC4A 1QFWM 1MLBB 1D9KC 5IROC 1JZ6A 3TO4A 3OAZH 4EXKA 3RDTA 2NLJB 4RWYL 2VZOA 1JUFA 2AV7B 2JCCB 4RDQF 4BKLB 1I9JL 5J56B 3BEWA 1ZT1B 5FGBC 4L9DA 3MODH 3KDMB 4XP9L 4JRXB 3QP3A 2IH3B 1D5BA 3T2QA 3SOBL 3HE6B 4N0CC 4CN4A 2YK1L 3MRIA 5E1HB 5DJZA 4R8WL 5E08H 5DUML 4NZRL 3DTXB 3OXRB 3L1OH 3OPZL 3OTTA 1OLLA 4KZEH 4GQPH 4HQQH 3WS6C 5K9JH 2E9IA 4J3OC 2BRRH 3CSPA 2LVEA 4F8QA 3BEVA 3QFJE 3BPOB 1T5WB 3EOYG 5D1ZB 2ORBH 5JLZB 1OF2B 2DBLL 4UV7L 3VFMA 1FJ1B 1EFXD 3T0EE 2E27L 3R0MA 2D4FA 1LEIB 1CE6A 4I3GA 1CQKA 2FWOA 4Z7OF 4L3EA 2DN7A 2B1AH 3QPXL 3O0RL 4UTBL 4H25A 1A3RL 4QKXB 1TLKA 1FFPA 2A6IB 2ZPKH 5E9DD 1CFTA 4P5TA 2BJML 2DQDH 3OKOA 3CU1A 1P4LB 3KYMA 4BELD 5BZDA 4KKLD 3NIFF 3AXLA 3PWUA 2DTSA 3F12B 4ZS7H 3UCRA 1D6VL 3T1WA 1HZHL 3OZ9L 3EYSH 3CFDA 3UYOD 2YPVH 2GSIA 3LEYL 5GGVH 1N4XL 1EERB 1JZ2A 4OCYH 2Y7QA 1BFSA 1S7TA 2NXYC 1LO5B 2W07A 4Z0BH 5FYJD 5ICYA 2MPAL 1I9EA 1AKJA 3S97C 1GAFH 3TPKA 2VDKH 4OD3H 3LZFH 2P45B 2IPUG 1T21A 3BP4B 1FNHA 3RZCD 3WL9B 5GGRY 3MRHB 4C55A 5L2KD 3ARFD 1IQDB 3F5WA 1VCAA 4X9BA 2DIBA 5MERB 2CQVA 3L3IA 5DGQA 1Z5LA 4R3SB 1T66D 5KVGL 1HQRA 3ZHLA 3FT3B 1HOCA 3WEXA 3QB7C 4XZUB 3VFRA 3FOMB 5J4MA 1VHPA 2HKFH 4HUUA 4PJAF 1XCTA 5GGTH 1S7WB 2N56A 4FXLA 4Q7DA 3DIFB 1K6QH 3M45A 2AJXH 3VFWB 3UPRA 5GISL 3WYRA 1N5YL 1OD7A 3SO3C 1I3VA 3QQ4A 1T7ZA 3QDGE 1UWGL 4DVBB 3QYCA 5I74B 1YEFH 2H8PA 1SBSL 4WU5A 3SDCB 1OTTD 3WS3B 1YQ2A 3TF7C 3RWIA 4PJIA 2JKXA 3TNMA 4L8SA 1XIWD 4XPGH 3MGAA 3WIFA 4Q9QL 5IW1B 3EOBA 1TIUA 3TO2B 4IIQA 5GZND 3RWCA 4OBSA 4K9EC 2VXUH 5I18L 4OBRA 5FDWA 3V5KA 4H0IA 1LEGA 1P1ZB 3OR6B 4OLEA 4D9QD 2J8UF 1CICC 1A9EB 5I8OL 2BSED 4ZXBC 3DO3A 2Y5TA 4JN2A 1EMTL 3DX7A 1K2DB 3LEVL 2VQUA 1CD1A 1MCFA 2P43B 2YPLB 3QCUL 3NTCH 3JWOC 3VG0H 2HJFB 4NN5B 4IMLB 5FF6B 3WNMA 1AR1D 1GXEA 2VXQL 2E3VA 1JNLH 4LKXB 4I0KA 4P2QE 3N1PC 1RIUH 3VXOA 3GMRA 4HMCA 1JZ5A 2DDQH 3EOTL 3MV8A 4U1IA 2IBZY 4TSAL 5EU6D 1CVRA 3DXAE 4BM7A 2VISB 5I1IL 4YEFA 1ORSA 3MZTA 1VENA 2HFFA 4U3HA 1WSST 1VFBA 1DQLH 4J3TA 3WFCH 2AVGA 2FLRT 4WUKL 3SJVE 2IBGA 1MOEA 5CJ5A 2N7AA 1UCTA 3QNXB 2VR5A 4E42B 2CGRH 4NQDB 1QEWA 4OZFH 1LO0L 3MROB 4OLYL 1PY4A 1IGML 4PRPB 4NQED 3VXRA 4QRSB 1CXEA 5FO7A 1PSKH 1QRKA 3BXNA 4HXBH 1HHGB 1Q1JH 3O6KH 1GHFL 4FFWD 3HC0B 4CAGA 1FVDA 3KPMA 4Q6IC 4JPWL 1LD9A 3MFFB 4JRYA 5F7MC 3MLVH 3TVMC 2OI9C 4LSTL 3IDGA 5C0DA 1FSKB 4U1GB 2GJZA 3QPQC 3ULUF 1VEOA 3Q1SL 2A9MH 3UJTH 3ZTNH 1UZ6F 3KXFB 4HK0B 5EO9B 4S2SB 3NCCB 4LPUA 4MJID 1FL6A 1WZMA 1NBZB 4PRBB 5FYLH 3BFOA 4OZIA 1DQDH 1MFAH 2Z35B 3BH9A 5HHNA 5JDSA 3T3PE 2AI0H 4LHUB 3TBSB 5IVXB 3VGHA 8CGTA 4TUJB 3B5TA 2R4SL 3T0VA 3RPIB 2FX8H 4PJIF 3AB0B 1OW0A 1GPOH 2MQ0A 1NEUA 1F2XK 2Q3ZA 4J2XA 1MQKL 4NNXA 4EN3C 3GI9H 3OQ3B 4L29A 1LK3L 2I9TB 1ZVSA 5HVWA 3PWJA 3NCFB 3V0WH 1Q72H 1BQLH 4K7FB 5IBLD 3ULUC 4HIIB 5F3HA 4JPVL 1LP9E 2HA1A 5F44A 4ONOA 4WV1C 5IHUH 2P44B 2VXSL 3PV6B 1S5IL 4KGLA 2I07B 3PDOA 3EDFA 3E6FA 1RZKC 5DJXB 5HDQH 5T1KD 2H2PD 2KUTA 5FHAH 3MRFA 4FQPA 2WM0A 4IIQC 3HG1B 1AJ7L 3IXAA 1BVKA 4NWTH 4D2NA 5HSFA 2VDLH 2A2QT 1JPGB 1MCBA 1WFTA 5BO1L 2R2HA 1HXMA 3AS2A 4JZJC 3G04B 5DJ0A 5DMJB 2VE6A 1GIGH 4IS6B 1YNLH 1EHNA 5EWIH 4O02L 2CR3A 4PJGA 2UY6A 5JQHC 4FP8L 1C12A 4MB5A 4P48A 3RL2A 3B9KB 4LAQL 1NAKH 1P4IH 2MQCA 3Q3GB 2JIXD 4XNQA 4NC1E 1PKOA 5CSBA 2R0WL 3SGEH 5IBTH 2H2SD 3VMPA 4G8GB 3WHXB 3F7YA 2BNQD 4R6UA 5DD1H 5BV7L 1EFXA 3B4NA 4A6YH 1H0DB 3OBAA 5I1AA 3CX5K 3ZT5A 2WQRA 3DWTA 3G6AB 5FM8A 4P57A 3LN5B 1MCKA 4FZEH 1J8HD 4HV8A 1P9MA 4H20H 4LRIC 5E9DA 2JJTA 3QUMB 3LN4B 3U46A 5IMLA 3QXTA 1YN6A 1DQJA 4OZIF 5EU3B 1HH9A 3HR5B 4JRWA 3S3JA 1DUYB 3CGTA 4E5XB 4I0CC 5KG9B 3DUSB 2IFFL 5E2VL 1X5JA 3QULB 1JWUA 1KG0B 1YEJL 3K0WA 3CH1A 4X6DA 4JY5H 1YUHA 3JTSB 1D5IH 5BXFB 3ULVL 3L5JA 1NQBA 3H3PL 5D6CA 4UDUB 5E94A 1UZ8A 5HHPA 1EHLH 4MXQD 3T0AA 1BM3H 2ATKA 5CGMA 1FNAA 3V52L 3ARZA 3RZCA 3OB0K 5L2KA 3CSGA 3FHAA 2CRYA 3ARFA 4HD9A 3CVIH 5I1LA 4JO2L 1TJIL 3P0YH 2O5ZL 4OLXH 1T0PB 3BX7C 4UINH 4XPFH 2WAHA 5GZOC 4HUXB 1KB5L 4M7LH 5L2JA 1BF2A 4NN7C 3RWEA 1RJYB 4L8DB 1QSVA 1NCTA 2L0DA 2MNUA 4KKNA 2ADFL 1QLFB 3OKKA 2R0KL 4JDVA 1R5IB 2Z91A 1FPTH 4LEOA 4MS8D 5GS1C 4GBXB 3VGGA 1MLCB 5D7JC 4LBEA 4FG6C 5DZOA 4GRLD 5EIIA 4M7ZC 4TOYL 1RULL 3R1GH 4Y0GA 4PJHE 5D5MF 1ZEAL 3O9WC 3S96A 1FO0A 3ARXA 4OLZL 1PG7L 1CLCA 1E27B 5ALCL 1ZVYA 3UPCA 5K9QG 1CTOA 3MBXH 5FKAA 1G9MC 2DL2A 3AU1B 3ARWA 4GKZB 1N8ZA 2EDTA 5EBWA 4D0DA 1N3NA 3MJ8B 4A6YA 3HMXA 3OKLA 4KI1A 2VH5L 3GK8L 1DN0B 1H8NA 2NPLX 43C9A 1FVEA 5GRUL 4PJCF 4MXWL 4C56E 2AXGB 1T2JA 1VPOL 5CKAA 1I8LA 4POUB 2MFNA 4L3AA 3K8MA 2AJZB 4MDIA 5IMKA 3TBVA 2GJ6E 3L3KB 4YBQD 2PNDA 3DMMC 5I1HL 3TT3L 2A74B 3C2AH 3VJ6B 5GS3A 5HPOA 3GHBL 1IMHC 4U1NA 4YGVA 2EDXA 3X14A 4BSJA 2V9QA 1JPST 3S35L 1IGJB 5F1IB 2AJVL 3ZDYE 4WW2A 5FUCC 4HBQA 2WWMD 4LASH 1U8MA 2BSTB 1ZS8A 3UAJC 3U0WL 4G6JH 4X6DF 5EU6A 3Q0HA 1BD2A 4L4VE 5CKGA 3K46A 4BK4A 4ELKA 4EZMA 5KVEH 3VXUD 1DBKL 3HI5L 2FD6L 3SGKA 4XVJL 3MLSL 1LDPH 1FZJA 1T83C 3P40A 2KQMA 4MA3A 3UYRL 4P2RB 1EEYA 5GGUA 2VC2L 4Y19D 2MSPA 4WO4B 2HWZL 4LCCB 3JTCA 5A2LH 1CXIA 5HGHB 5EUOB 1PBYA 4NQEA 3BVNA 3JUZA 1FQ9C 2PW1A 2N7BA 4X8JB 1LO3H 3KYKL 1ZHLB 1L6ZA 1QSFA 4ERSL 3D69A 4GW1A 1M71B 5F7KC 3WHE1 4JFDD 1D3CA 2JJSA 5L88H 4PJ5D 5CMAB 4KHTL 5F88A 2XZZA 2FJFB 1LNUA 4MJIA 4S1SL 2IEPA 4KK5C 1YJDL 3DRQB 4Y1AD 5HGAA 4MAUL 5JPMB 3MLUL 1F42A 4R4NC 2J5LB 4QRTB 4DEPB 5K9KA 5HTSA 4P4RB 4WY7L 5IEKB 1WZLA 4CMHC 2VLRD 3BWAA 4G6FB 1T04B 2C1PA 4YHNB 1M7IA 3BPNB 5D2LA 1S7SA 3KPTA 5JW4Q 4NN6C 1VGKA 4OF7A 4WI6A 1NGXB 2ZCKH 1U91B 4HFWA 2WBJD 3RP1A 4DOHE 1A3LL 1UM6L 1RZJL 2QQLL 3VA2C 5IEHA 5JZ7C 1YDPB 4NQCB 4Z7OE 1GGTA 4PLNC 1NDMB 4EQ2A 2EEAA 4JG0H 3K81A 4GAJH 2XXMB 4UDTA 2CLVA 3MOAL 2I26N 4DUXA 3NIFE 4B50A 4NM4L 4WI7A 4XMLH 5T1KA 3U9UA 3VU2A 4FHBD 2ADJA 1KJMA 1NGPL 5I0ZA 2HTLD 5E6YA 2BFVL 4NKIH 3RNQA 3D2UB 3SE3C 2DQUH 1LE9B 2VZ3A 1SBBA 2DM4A 2BCKB 5I1KH 5L9DL 4PG2C 3ZL4L 2NX5E 3MOQA 3CFEA 4YDLB 3ISWA 3ARPA 2W38A 4HPYL 1QOKA 1IEBB 1Q0YL 4OF3A 3UTTB 2HLAA 5CJOL 4U31A 1KENH 4FQQB 1J0YA 3RAJL 2EXYD 5D7IB 2VLMD 5CSZB 2JIXA 2A6DA 5GSRA 3IAPA 4BH7B 1RHHB 2V2TA 4P59H 1PFCA 4PJAE 5DWUL 2BNQA 4ZSOE 1UB5A 1CVSC 4QOKB 3IJYB 2NY7L 1FP5A 1GJIA 4OFYD 1WFOA 4AH2A 4HJJL 4PV9A 3C5ZC 3QEGH 5BRZB 4PTUA 1SYVA 2EDKA 3G5ZB 5ALBH 2X1QA 3KLDA 4LDLB 5C0AD 2BY1A 3IDYB 4JREC 2W92A 2G5BA 4OLWL 1T1ZA 2ZJSH 4OCWH 3RWFA 2NY3C 2Q86B 3WN5B 3PL6D 1S9YA 2AP2A 3GSXA 4G9FD 1G9EA 1FIGL 2HVJB 1T20B 2QHRL 3U0TA 4LPWA 4PJEB 3IU4H 5D2LF 4K3GA 1SM3L 2J8UE 3RVTC 5HGDB 3OX8B 5HY9A 4N8VG 3ET9F 4U7MA 1MCLA 3STBA 1C16B 2PO6C 3GIZH 4XCFL 4EDXB 5E8NA 4MXQA 3BKJL 3I6LD 4OV5A 3THML 3P4OA 1JK8B 3LKNA 4WU7B 4L3EE 3VA6A 2I5YL 3JBG7 5IK3A 4XTRD 1V7NH 3E6HA 1BBDH 5EDXA 4GRWF 1S7QB 4LLUA 3VFNB 3U4BL 4ODVH 1MCJA 2A38A 4OQTH 4NZTL 1INDL 3CXDL 5E6IB 4XP4L 3D3VD 2ZP0T 1AC6A 3O3BA 5DJAA 2R69H 5JOPD 3EO9H 3V6ZA 4ZOCA 4K3DL 4MS8A 2IPTL 4G80B 4NKMA 3QDMD 4KKAC 2V2XA 2VQ1B 4OM1L 2BVEA 2RIKA 4GRLA 2Y6SC 2VKWA 3FOLB 4PJ7F 1ZANH 4MHHG 3CMOH 1E4WL 1Z9MA 2CRZA 4BZ2L 5LQBL 4QHUB 3WFHA 3PGFH 3JWDC 2V7NA 2CUIA 3WKMH 4ZPTB 3ULSA 3RA7H 3TA3C 1R3HA 1X5HA 1S5HA 4NZDA 3FQRA 3T0BA 4X6CE 1TCMA 2F54B 1MJUH 3NVQA 5DFTA 2COQA 5GRYA 3MOBL 3QUML 1TZIA 1JGDB 5J06A 2D7TH 4PJFA 4XRCA 4DGVL 3B9DA 2YRPA 5E00B 4LPXA 5T3XE 3F7VA 3VD4A 3REVB 3MO1B 3B2VL 4A2LA 4N0YL 4AL8L 3GUTB 5LAXB 5C07E 3ULUE 3V4UH 1QRND 4F9PC 1NGZA 5IFAH 1FNEA 1KGCE 2Q76A 1ZHKB 2YA2A 3MGOA 4YHYB 3IXTB 2VXTL 3TEUA 4PJIE 3RRQA 3T3ME 4JFQB 1XR9A 3ARTA 5DRZA 5JORB 1I9RH 3QIBC 1SJHA 2ESVE 1UM5H 4NT6A 3T77A 1I1AC 1OTSC 4KDTC 5BOPA 4WHYH 2F8VA 4XVTL 3VXUA 5E8DH 1RZGA 5DD5L 1JHKH 1R5VB 2ZCLH 3X12A 5FM5O 3BGMB 4XNMA 5E2WL 3TN0B 3D85B 4P2OD 5E7BA 4Y19A 3ZTJG 2FL5A 2EH8L 4CVXA 1HHKB 1A2YA 1NCWL 2Z93B 3QUKA 3ARRA 3H7LA 1X3DA 4R96A 4WGVB 4KK6C 1HI6B 5FFLA 1FCCA 4PTTB 1U8IA 4Y4HD 2OJEA 1AI1H 4OCRL 3IDXH 2ZOKB 1MHPH 1XCQB 1IC4L 3DX8A 3QI9B 4B7IA 4DKEH 3JV5A 2RBLA 3P3YA 4JFDA 4I8DA 2FYYB 4GKOA 4G3YL 3GSNB 5ENWB 3G5VA 5CBAB 4KKCC 1AQDA 3P0VL 1OP9A 1BFTA 2X41A 5DD6B 2A6JB 4HS8H 1P7KB 1KTDB 2KPNA 4Y1AA 1BQUA 5DQJB 3SDAD 2LQRA 4JO4L 1QSZA 5GIRA 1JGUH 1FCGA 2NY4D 4H0HB 4JHAL 4PUBH 5F6IB 4HCRL 4KK8C 1GZPA 2VLRA 3MLRL 1R3LB 4LHJB 1YQVL 5MI0C 4PD4J 5EBGA 3VXRE 3VWJC 4ZFZB 5KVDH 1IC7L 3VXNB 3CAFA 4I9WD 4ORGB 2C4XA 1KCRH 5B3JF 3HI1A 4MA7H 2WBJA 4M9OA 4JRYE 3FO1B 1NAML 2Q6WB 4PIRF 3SCMD 3ZKXB 5JMOC 4RMVA 5TE6L 2QSTA 5D1XD 1MRDH 1SYSA 4I1NB 3QPQD 4NKOA 3UBXA 2P47B 1I3RB 3MXVH 3FN3A 3VFOB 2CLZB 5JA8B 4MCYB 1BLNA 4OZIE 5MP6H 4Z7VB 1RU9L 2BNUB 2YC1A 4QCIA 1QA9B 4JDTL 4JR9L 3MRLB 5J1AA 3O6FC 1YNTB 1YY9D 3LS4L 3RU8H 3IDIA 1WC7B 1RJLB 2YEZB 3MTRA 4YPJA 3GNML 2X9YA 3GBML 1TVDA 1ZA6B 1YEEH 1W2KT 4KQ4L 1OGTB 1RUPH 2GI7A 2XZAL 1RMFL 1YYMH 2EXWC 3NIDF 3Q5YA 4KKBD 4L5FL 3V7MA 1P84J 1S7RA 3FQUA 3EDDA 3KPRB 4UT9H 1S9VB 1A5FL 4XMKH 1E6OL 1KPRA 4S11A 2XWBB 3ARBB 3RGVC 5C0EA 4PJ9B 4EIGB 3FQNA 4ENED 3BW9A 2YHGA 3FQWA 2WLYA 4ZFGH 1JZ7A 4YNYB 2VDPH 3FN9A 4Y4FD 3MQIA 4LCWE 5HI3C 4JAMA 2JCCF 4OFYA 4U0QB 2DYPB 2X7LA 1A0QL 1N0LA 1NCBH 3FB5A 5I1DB 5D5ME 4IDLA 4MD0A 4YR6A 3EYVA 5GSVA 5C0AA 3DVNB 3LPGA 4M7JH 5JW3L 1J5OH 2AABL 4LLDA 1H3GA 1GOGA 3D39B 5JHDA 1AD9B 3PL6A 3R8QA 4YLQT 2YMXH 1I1YA 1EJOL 4YEEA 4ZS6D 4LL9A 2QJDA 4GH7B 5FUCE 4LFHG 1YYLH 4Z76B 4HX1A 4PJCE 43CAB 1UADC 1HH6A 4RA3A 4Z7NF 2PYFA 4R0LA 4NKDB 4ELME 5C6WH 2H1PL 3QH3B 3TJEH 4K9EH 3DBXA 1J8KA 4OIIL 4ODXA 1L9MA 4G7YH 5AZ2L 2UYLA 4FFZH 2QSQA 4E41B 1TVHB 1NLBL 3QHZL 5C9JB 3CDGB 4YGAB 3U9PL 1IGYA 1MVUA 3BPOC 4D8PB 5D1ZC 5HBBA 5IMOB 3N9GH 1NEZA 3BJLA 4HF5H 3D3VA 2PKDA 3C8HA 1QBLL 4OGZA 3JWOH 5TPWH 2P5WB 3OHXB 3QDMA 3MGTA 4X6DE 3LH2L 1W0VB 1G7QA 3L3GB 3MR9B 3IDMB 3MYJB 4MCZB 5JOEA 1A4JB 3D0LB 4PG9B 4L8CA 5CSGA 1HDMB 4NJ9H 3SPVB 2ATPA 1QYGH 2EIEA 3I9GH 2MCPH 3TCLA 3LIZH 5B4MC 4WNQB 5GJTL 1HNFA 5GZOD 3G5XA 4MSWB 2V5MA 4WWKD 1N64L 3SDXF 3CK0H 4TNVK 3GMPA 2Y1VA 1H15B 3T2NL 3HI6L 3IRPX 1L6XA 5KJRH 2DQIL 4G8EB 1TTUA 4KRPD 5DHVB 2E7MA 4LEXH 4YDIL 1D5MA 1AY1L 1C7TA 3EO1B 1JJUA 2VR4A 1AXTL 4LVOB 2XTJB 2LE9A 3KPPA 5D7JD 2H32H 1E4XH 1QRNA 4G7VH 4HKBB 3JTTA 1UXWB 3FT2B 3UO1L 1CD0A 3KPOB 4NKQB 3PWPD 1S9XB 3S4SB 3TBYA 5DK2B 2F58H 4K7PL 5H35B 4LLQA 1MHEA 1NCNA 3T0WA 4GW4A 3DHMA 2DM7A 4D9LH 3LKOA 3UMTA 1DBJH 3S34H 1YMME 2DWDA 5JXEC 2AEPL 1VEMA 1J9CT 1A6AB 4DWHA 1CK0H 5EG6C 4OD2B 4Z5RB 3RUGB 1YNKH 5HHMB 4X4XA 1X7QB 5I74C 1W72H 1J1OH 3SDCC 2NY1B 3MA9H 1U8JA 3S5LA 4BFEA 1T0NB 3BH8A 4HUKB 1VGEH 1KT2A 2OL3H 4P2OA 5MEOA 3CC5A 2P5EB 4YBLB 1ACZA 3MZGB 4XCCH 3PDGA 4EUPB 4JCLA 4Z77A 5IW6A 35C8H 3INUH 2Y36H 3O2WH 4JDZA 4AEFA 4BFBD 2E7LC 1QP1A 1I8IA 4JKPL 2IPKA 1YJDC 4Y4HA 2CXKA 5DLMH 1MY5A 5D7LB 3MX0A 4XAWL 1JMXA 1MCNA 4S1RH 1DQQA 1T5XB 3B5HA 5GGSY 5SWZB 4L4TB 1LQVA 5EU6E 4O2CB 1U3HD 1BD2E 1RZKH 3REWB 1B4JL 2IBZX 3CFBB 4NGHH 3CLEL 1RIVH 1CE1L 1U8QA 3VGAB 5CEXB 4HBCL 5DVLA 1MCHA 4NN5C 3QEQB 4TVPD 3SDAA 4HS6B 4YFLF 4JQXA 3SDDA 4K94C 5ID1A 3U4EB 1G7IA 4CADA 3GSOB 3MRDA 5MENE 3PQYB 4KVNH 1RQ5A 4CKVX 1CFVH 3ZHDA 3VXQB 4Y5XA 4I4WB 3LV3A 1QSFE 4MWFB 1IKFL 4NCC1 4OUUA 3QUXB 2FR4B 4TULL 4I5BA 5T5NF 3SCMA 5D70L 1MAJA 3VXSB 4DGYH 2AEQH 5D1XA 3AM8C 3PABA 5IVXF 4RCAA 2IWGA 1FORL 4POZC 5CHNB 4YWGL 3V4PL 4MJIE 4DAGL 2W60B 4NRYA 1NGQL 2Q1EA 4BH8A 4KRMB 5HYSA 3U2SB 1BX2B 2XRAL 4P9HC 1EGJA 5IGXL 4JFZH 4KRLB 1W72A 4LKCB 1MRCL 2YKLH 1FSKC 1SHMA 5EORH 4MAYD 4LLWB 4U1GC 3CVHB 4UU9B 1F4XH 2JJWA 5D2LE 5E8EB 5E2TH 1DBMH 2OL3A 1R3JA 4KZDL 3U0PB 1XMWA 3K4DA 2YSSA 2WANA 4JM2B 4ZAKB 5HI4C 4HKXB 4JPKH 2NXZD 4N9GA 5T1MB 4ZD3H 1U58B 2QHLA 2YA0A 2YBRB 2DMCA 2X4TA 4DZBA 5EUKA 3AB0C 4GRWE 4IOFC 1LE5A 3IDNA 2BVUA 5CWSA 5F6HI 4ZYKA 1Y6MR 4FTVD 1DBBH 4AT6A 4WUUB 4IOIA 3QIWD 3R06A 1JTTA 2NY0B 3BZ4A 5J6HA 4UOW0 2GUOB 1RZ7L 4XPBH 1MPAL 3SDYL 1QR1B 2E9JA 2C3VB 4LDEB 4Y4FA 3PJSA 1G6RB 1JYXA 4M8VA 2ED8A 4U6VL 1XGPA 1F3RB 4O2EA 4LSSH 4Y8DC 2VZSA 4PJ7E 2HT2C 2UWEB 4FFVC 4PLKD 5C6TL 2B39A 1LGVA 3S37L 3HRPA 1M7DB 3AMKA 3WUWG 5B38A 1QQDB 2EE2A 3QJFA 3BZFA 4CNIB 3ZE1F 1FYTB 1AO7E 1KJ3H 5FYKD 4L1DA 1OOAA 4JJ5A 1ZHNA 1HYSD 2XWJB 1F6AB 5ANMB 1P7QB 3CCHA 2CD0A 1DEDA 3VFTB 1P5VA 4FQ2L 2ZKHL 3EZ8A 1IAOA 2FO4B 1U6AL 1QLRA 1UJ3C 4HFUL 3ILPB 1EJ6A 2F74B 1S7VA 4MA8H 2ITCA 1RUQH 3RY6A 3BQUD 4YAQB 1V3MA 1KEMH 1KJVA 2XPGA 3DVGB 4HZLB 4H1LB 1MUJB 3BP6B 1CFQB 1RZ8A 3B9KC 3BIKB 3CUPA 4YC2B 5CBEA 5IP4A 5D7KD 4U6HB 3NFNB 2DQHL 4QRUA 4JO3L 2WIIB 5TF1H 4YDJA 1N26A 5FDYA 1T0MA 2C5DC 3SDDC 4Y16D 1INEH 1KEGH 1IT9L 2BDNH 4QRRB 3TZVA 2ICES 1KN4L 3CH8A 1DE4A 1IC1A 1ZTXL 1GGBL 5KZCB 2EC9T 1NCAH 2DWEA 3VFUB 3H9SA 1NCDL 2CKBH 2V17H 4UQ2B 5E1AA 2WBKA 1G7MA 3CNKA 3MRMB 1X5AA 4X7TB 4U7SA 1H8SA 3MNWA 1FV1A 3FMGH 5DDHB 1NFKA 5CILH 5D6DA 3MBED 4KGJA 2A73A 1EXUB 3DGGA 4WWKA 3ZKMC 3D87B 1EH9A 1CLOH 1FL5B 3QT2A 2GYSA 5BVJB 3JZ7A 3SE4A 4L9LB 1DLFL 1WT5A 1DBAL 4IRSB 2AEIT 3FZUD 4KJYA 2QR0A 5KSAD 5DVNA 3X3FH 4N0RA 5I76A 3FB6A 2Y6SD 3TIEB 3PWPA 3QFJB 2FHCA 1MAML 4XMPH 1OWRM 1EHXA 5F1NA 1A22B 3VWKB 2R0LH 3T0EB 1QLEL 3BD4A 2GAZA 5EU4B 2CLRB 3MRGA 1OM3H 4GBXC 5CEZH 1TENA 2X4UB 1A6PA 2AXJA 1Z6JT 4ZQKB 4KJWC 3O3DA 1YEIH 4CMMA 1PW3A 1X44A 5B3JE 4AZ8A 1K9TA 5E08L 4ONFH 5AYQA 5C09D 3RHWK 1KLGB 5HPMB 3DETC 1ZGLB 2NY6B 4RISL 4OM0L 2DMKA 3FT4B 1I7ZB 4MDJB 4NO3B 2R29L 1DL7H 4YFEA 3L3JA 4ETQA 2C1OB 3HAEG 3WJLA 5EOCL 4ZUSA 5BW7A 1DQMH 3RWHB 4NFBA 3I6GB 4MNQE 4PY7B 3PWVB 1Z9OA 2ICCA 5E5MB 1DLHB 2BNRD 2FSEB 1PD6A 1CG9B 4EDWL 4X5WA 2Z0BA 1WCBB 4TTDD 2CKBA 4LIQL 4Q9BA 5AAMA 1N6VA 4RWYH 2OLDA 2IQAA 3BKCL 1I8MA 2E9BA 4UUJA 1U3HA 4HS3B 3LKRA 5J1SC 2P8PB 5HXMA 1I9JH 5IVNA 4RDQG 1BQHG 4XP9H 2EKJA 3NFPB 4XWOD 5CD3A 5FECB 4X9HA 5T33L 3SOBH 5EUOF 5IBUG 2YK1H 4R8WH 5DQ9B 1NFIB 4Y19E 4NZRH 5DUMH 32C2A 3OPZH 4Y2DD 4EI5D 4MD4A 3HNVL 3ZE2E 5M94B 2V9TA 4U1LA 3N1FC 5SV3A 3QDGB 4G43B 5I30L 2DBLH 1CFSB 3ILQC 1A7PL 4UV7H 5IB3B 4PGEA 4LARL 2J6EA 2E27H 5C0BD 4BUGA 3BHBA 4RGND 4D0CA 3TZVC 3VGFA 1AGDB 3QPXH 2JCCE 3O0RH 1UA6L 4UTBH 3L7FB 3G6DL 4PGDB 1HK6A 1OP5H 4WRLA 1L7IL 2BJMH 2R0ZL 5I75B 1T03L 2VITA 4M62L 2G9HB 4HKZB 3KWWA 2AK1L 4BJLA 4G6ML 4IRJB 3ARED 1D6VH 1GGIH 3KPSD 3HZMB 1HZHH 1LK2A 3OZ9H 4GG6A 4OLUL 3EJZC 3GJFK 4ODWB 3WIHL 3LEYH 5A16A 4HWZA 1U8HA 4MAYA 1N4XH 2VDML 4DK3A 3LVEA 5LGJB 2RFXA 5GRZA 3UP1A 3B9AA 2DOCA 2MPAH 3QNZB 4JZNB 2B7DT 1EAPB 1ORQA 4Z7NE 5H2BA 3DX9A 4U1SA 4M8QA 2BHZA 4I3SL 2CR6A 3PGDA 2VUOA 4I48B 3MJ9L 3TWCL 2J5LC 2EC9U 4DEPC 4P2QB 1IQWL 4FQLL 1FYHB 3BN9C 3BPNC 5SV4A 4FTVA 1I1FB 1P4BL 5KVGH 2B0SL 3DXAB 2VYRE 2X10A 3BD3A 3V5DA 3QIWA 1KYOK 3CXHK 1MJ8L 1UVQB 2HFGH 3KR3L 1U8KA 5ERWB 1QHOA 3MLYH 1KTLB 1IGTB 1GRWA 5GISH 3UTQA 5JW4M 1N5YH 4J1UA 2AJ3A 4RMQA 1UWGH 3HUJA 4KAQL 1LILA 1FBIL 5CEYA 2NNAB 3RVVD 3TYFB 1SBSH 4PRHD 1V8HA 4XXDB 1A4KA 1EUTA 4KV5F 1IFHL 4GKNB 2XNAB 1CFNB 1VSCA 5GRWA 1RJCA 2EC8A 3T09A 4Q9QH 3EYFA 3HE7B 3E8UL 2CIIA 5I18H 3SDXE 2VLME 4K07A 2WINA 3NCJL 4ZTOL 5DRWA 5IFJB 4RSVA 1QO3A 3QWQB 2XQYG 3AY4A 5I8OH 1Q9LA 2BC4B 1AXSB 3BD5A 1EMTH 2CGRL 1QD0A 4PP2B 5DTFA 3I50L 2WLZA 3LEVH 4YDLC 2FECI 4LOUD 1OB1B 2BVPA 1DVFD 3BQUA 4F8TA 1JHLL 3QCUH 4UV4L 1BZ9A 2WIMA 1N2RA 1KCGC 5JIIA 2ENYA 1CS6A 1I7RB 3MLVL 4U4BA 5DA0B 1WBYA 3BP5B 4RNRA 2VXQH 4POYA 5C0AE 1MJJB 3ULVD 3RJDA 4Y5VB 1PX3A 2DD8L 3RTQC 3VFVB 1XF5A 3IFOA 1IL1B 4P46D 3QG6B 5JHDE 3QCTL 4L8BA 4Y16A 1LP9B 2PW2B 3EOTH 3BESR 4GG6F 1XF2B 5F72S 3LOWA 5FYLL 4TSAH 3L7EB 1TZHB 4YHMH 4AIZB 4WHTB 5I1IH 3GJFH 2VLJE 1IGFL 2Q20A 2F5AL 5D2NC 3IGAB 2YPLE 5DMKB 4NQSA 5EO0A 1BAFL 4OFIA 2JELL 4WUKH 3IDYC 1KLUA 4WFFD 1G0XA 3I6LE 5E56A 4RFNB 1EO8L 4XNZB 3T1FA 1UEMA 2D3VA 1MF2H 3HE6D 1VFAA 1G6RL 3TBTA 3QCVL 1LO0H 2DQFB 5I71B 2OP4L 1PYWA 4OLYH 1IGMH 4JFFD 5DFVD 25C8L 3MBEA 1GHFH 1L0YA 5CZXC 5I8EA 4NC0B 1I8KA 1R3KB 2Z92A 1UYWL 4JPWH 1R3IL 5D1ZD 1IAIL 3PXHA 3LKSB 2D03L 4LSTH 3D3VE 5JO5B 3O45A 3SE9H 3FB7A 1AIFB 2YD2A 1NSNL 3Q1SH 2FIKA 1KV3A 5HGBA 1BGXH 2HN7A 3QDME 5KSAA 1EVUA 2EYRB 4N9OB 4XGZB 1MFDL 3HUJF 4KDVA 1WEJL 4HHAA 2H26A 1WVZA 5KSBA 4PRPE 3OXSA 4QF1B 5JA9A 5E6IC 4ZG1A 1FZOA 2CDFA 1MQKH 3EYUL 3BKMH 3IU3B 2E6QA 1Y0LA 3VRIB 1LK3H 1JGEA 1RZIB 3RWGB 4NUJA 4XC1L 3LRSB 4MQXD 1I7TB 1TVBB 2EECA 4WJ5A 3KXFE 3FCTB 3QUYD 4JPVH 3DPBA 1HE7A 3WUWB 4I77L 2FGWL 2VZUA 4X83A 3VRLF 1JF1B 2VLLB 5IVXE 2KDGA 1MHHB 2VXSH 1S5IH 1W8OA 1ZOXA 3TC9A 4LQFH 5FO9B 4PP1D 1NJ9A 1WICA 4O2FB 1KELL 2BNRA 1AJ7H 4MQ7B 1FL3A 1RK0B 2OSLB 3C5SA 2R9HD 3EW3B 4OCSL 1YEDB 1IM9B 2X9WA 4QO1A 2GTZB 4TNWF 5T1DL 4F33A 4B5EA 2EYTA 2YWYA 5BO1H 2A83B 1D6EA 3SGJC 1GYAA 4KROD 4OT1L 1GGUA 2DTML 3M1BB 2GK2A 4QHLA 3W9DB 2PXYB 3TESA 5F9JB 4RFEA 1K8IA 1F90L 5FOJA 4MNHB 3K1KC 1Y18B 2Q8BL 2ITDA 4RIRA 3MACL 4FP8H 3D6GA 3ZYIA 5I8CB 5FUZL 1BJ1H 3TBWA 4LAQH 4Y2DA 4EI5A 4K71B 2EZ0D 2R0WH 5IMMB 2AK4D 4JFPA 3ROLB 4UMGA 5FKPB 3DVIA 5L7XL 3HCVB 5IQ9B 4I13B 4XHJC 5BV7H 3CVIL 5DD0L 5C0BA 4OD1L 5IB1B 1NBYB 2ZCHL 1B0RA 5IVZB 4UIMB 2RJMA 4Y88A 3FO2A 3G6JA 1KACB 1WZKA 5I9QB 2XV6B 3IF1A 2BSSA 2OM5A 1U93A 4PGCB 1WIOA 3ZE1E 4LSUL 2DQGL 3AREA 2IFFH 5E2VH 3ZT7A 3QI9C 1D5ZB 3KPSA 1BOGA 1YEJH 1K4DB 3N0PB 4KUCF 4Y7MA 1JGLL 4BQBA 3C6SB 1CN4A 2EO9A 2GJ6B 2Q87A 4WTXA 3ULVH 1MFEL 5SX4I 1DANT 3H3PH 3C9NB 1T6VN 3MBXL 3V52H 1JNNL 1ACYL 1ZK9A 1HILB 1J1PL 4PY8I 1OWWA 1OSZB 4JO2H 4BYHA 2O5ZH 4OKVB 5F6IC 1KB5H 4HUVB 2ZUXA 4Z7VF 4R97B 5GGVY 1AGBA 4NQDD 1TXKA 1PZ5A 5TE4L 2ADFH 3C09B 5M7QA 2R0KH 4F3FA 1F13A 5HYJB 4JFXA 3NN8B 5F1KC 5I1JL 4J6RL 3JWNC 3W39B 4X5XA 1FE8L 4GLRH 4LQ1A 3WDHA 5C0FA 2D7PA 4G42A 1OT1A 5DQDL 5DXWA 2FJHB 2FEDD 5DC0A 3ZKXC 2J88L 3B6SB 4OJFH 5BJTA 1RJZA 2ZOLA 2BVTA 4IM8A 4TOYH 1RULH 3HAEB 4CL7A 4WI5A 5C2BL 1ZEAH 2GCYB 2H9GB 4PRHA 4PRAA 4PYHA 3ROOB 3H6JA 4QRQB 4IHOB 4OLZH 3SKJH 1PG7H 1U8PA 2X70A 4LASL 2BOBA 2CRIA 1A6UL 1ND0B 5ALCH 1HSAB 3DRTA 2FH6A 5C08D 3VDBA 4IOFD 5BMFL 3QAZB 2VH5H 3GK8H 5JPNA 1MCIA 3CJJA 5GRUH 4EKXA 2AQ2A 4MXWH 3CLFL 1G0YR 1VPOH 4RZCB 5IBUB 4OCNC 3MLXL 1DVFA 4HIJB 4HJ0D 3RWJB 4Q97A 3EDJA 4YDVA 3O3EB 1ZHBA 5FO8A 5I1HH 3F6LA 2MJWA 3TT3H 2BMKA 5AUMB 3KLAB 1RPQA 3GHBH 2HT4D 4KI5D 3ARBC 4PJ9C 2HMIC 2HJKA 4NRZA 1BBJA 5D93B 4DOHB 3S35H 4KC3B 3DSNA 1V5JA 4W81A 2C3XA 4P46A 4Z18A 3TH4T 1HXYA 3DV4A 3U0WH 4MQSB 2XWTA 2VUYA 4OCMC 2IFGA 4QY8A 2NY2B 3C60D 2GT9A 1DBKH 5EOCJ 3HI5H 5D1QB 2FD6H 1KB5A 3EHBC 4XVJH 1BVZA 3MLSH 1Z3GL 5DUPL 1N5AB 3UYRH 2VC2H 2Z8SA 3OKEA 4OLVH 5J11B 1T1XA 2HWZH 2W9DL 5CUSL 2E5EA 1PJ9A 4TSBL 5F7FA 4JFFA 3ES6A 3P9LA 3ZSSA 3SKNA 1ES0B 5INCB 3KYKH 5J9PA 3VFPB 4JLRB 4ERSH 3NZHL 2NR6C 1KTKE 2NX5B 5IG7B 5HYFA 1N6QL 1L4IA 4D3CL 3RIAK 3FAXA 4CN6A 4KHTH 2FB4L 5A2KH 4S1SH 4P2RE 1ZT4A 1FH5L 2QTEA 4G9DA 1YJDH 4FQXD 5EO1B 3BUYA 1KNOA 4MAUH 3H9SE 4PLJD 3MLUH 1T2QL 5EA0L 5EUOE 3T8XA 4XB8A 4ZODA 3EFFA 2XY1A 2B2XL 4PJAB 4WY7H 3K74B 5DURB 2PR4L 4NO0D 1A6VL 1CR9L 1NC4B 3F12A 3TO4B 4ZFFA 3QEUA 1ZLWK 1BJMA 3PE9A 3RDTB 1Y6KR 3QWOA 1JUFB 1S8DA 5A3ID 1A3LH 1UM6H 5CP3A 2QQLH 1YMHA 5DO2C 5F1SA 4Y8AA 3QUYA 3BEWB 2JE8A 1D5BB 1DANU 1Z0MA 1T22B 2M26A 3QUZD 2CK2A 3KHQA 3MRIB 5DJZB 3VH8G 1WIUA 3FRPA 5DFWH 3WL9A 4M61A 3SEPA 4CJ1A 3MOAH 3U36A 4X7EC 3ZO0A 3BISA 3PWPE 5ITBL 3BEVB 1A1NA 4NM4H 5MERA 4Y5YA 5KOVC 3RVUD 2VLKD 4Z7WA 4H0GA 4F15B 4F7MA 3VFMB 1NGPH 4JGJA 1M7XA 5DD3L 1KSRA 1WV7T 1FLTX 2BFVH 1CE6B 2J8OA 2FWOB 4L3EB 4LVOC 4KJPC 4K55A 2XTJC 3DJ9A 4H25B 3DLQR 5L9DH 4JQVA 4HUWA 3O11A 3O2DA 1CFTB 3P77A 3ZL4H 4BZ1H 4P5TB 3OKOB 4PB0L 3HC4L 5BZDB 3LRHA 4HPYH 4K3JL 1Q0YH 3AXLB 3PWUB 2PUQT 5CJOH 5BCAA 3RAJH 2UUDH 2V5YA 1P6FA 3P0GB 3CFDB 4HJGA 5B39A 2W91A 2GSIB 1AQKL 4NPYA 3QO1A 2AK4A 4C54A 2Y7QB 2IGFL 1AH1A 1S7TB 3X13A 3IYLW 5DWUH 5ICYB 1AKJB 1ZA3B 2NY1C 2NY7H 4B7LA 1T21B 3MRBA 4U1JA 4QTHA 4HJJH 4HUMB 3WJJA 3U7AA 5KANG 4OQTL 3F5WB 4Y4KC 4J7RA 1J0HA 5HVFB 3JV4A 1MIEL 2Z9TA 4KV5E 1TZGL 1Z5LB 1B4RA 1JRHL 5DVOA 1WWWX 1HQRB 4OLWH 3WEXB 1HOCB 4TVPE 3VFRB 4HUUB 1FIGH 1X5IA 3H9YA 3IDUA 3K8KA 2QHRH 1XCTB 3WCYA 3IFLL 4X98B 3JV0A 5E2JA 3UPRB 2BXYA 1A1MA 1E4KC 1SM3H 3GMMB 3QQ4B 5AG9A 1ZLWH 3GI8L 4XCFH 2EO1A 4HC1L 3VGAC 3DNKA 2H8PB 3BKJH 2WY3A 4OZHA 3THMH 5D2NE 5DJCA 3B43A 3RWIB 1IKNA 4PJIB 1XZ0A 2IJ0C 3L95A 3K80A 1KF9B 3EFDL 3TNMB 4L8SB 1GL4B 2NMSA 2XI9A 2IALA 4XCNA 4WO4D 3WIFB 5I2IA 3U4BH 3EOBB 1C5DB 4XXCA 4IIQB 4NQDA 3RWCB 4NZTH 2QSVA 1INDH 4R2GC 5FDWB 3V5KB 3WHE0 5IUSA 3CXDH 4XP4H 1LEGB 1AGCB 1WJ3A 4X4YA 3QUXC 4K3DH 2DQCL 4J3WA 2IPTH 2Y5TB 4JN2B 4GG6E 5INDA 3DX7B 4HPOL 3SE8L 1CD1B 3QHFH 4OM1H 4JM2F 2AXFA 2V5TA 2VB5A 3G08B 4HZAA 4QRPD 2YD6A 5KVMC 2KH2B 1E4WH 4M6OL 2IF7A 4BZ2H 5LQBH 1WBZA 3P73A 3GFUA 4QXWA 5KVFL 4RAUA 4X99A 4F7PA 4K8RL 2QADB 3VXOB 3GMRB 4XI5C 5C08A 3OWEA 3U6RA 3MV8B 3W11D 4U1IB 3MOBH 3QUMH 4J3UA 1F97A 5TH2A 3WXVL 3UZQA 4JG1H 4DGVH 1QFWL 1ORSB 4BK5A 3PXJA 4GKSA 2HFFB 1VFBB 3B2VH 4JM2C 4N0YH 4URTB 4ZAKC 5H37G 4AL8H 3I2CL 3IAGC 1DP0A 4ALAL 4NBXB 1I85C 5ESQA 2CO6B 1N7ML 1X5LA 1BHGA 4WHCA 4GRMA 3HUJE 1QEWB 5GPRA 4N90E 4G8FA 3VXRB 3UTZA 4UILH 4W6WB 5FO7B 2VXTH 3BXNB 1JZ8A 4S1QL 2F54E 2KL6A 5TJWK 2X4RA 1FVDB 3KPMB 2NY0C 1RV6X 1XF3A 3RFZC 1LD9B 4JRYB 1JIBA 2ZSVA 3IDGB 5C0DB 2MOVA 5FYKE 4F80A 2GJZB 2DJ4A 5GS0D 4WW1A 1SY6L 3NA9L 2FNBA 3Q5OA 4U6XA 3N06B 1FL6B 5J3HC 3C60A 3B5GA 4XVTH 2AQ1A 5DD5H 3LQAL 3C08L 4XAKD 5HD8D 4OZIB 1BIHA 1MIML 3KLHD 3BH9B 5HHNB 5JDSB 4NN7B 3G5YA 1OSPL 3LCYA 5E2WH 3VRLE 2YRZA 2EH8H 1NCWH 4NNXB 2K1MA 2A1WH 4L29B 1PVHA 3BPCA 1ZVSB 4OCRH 3PWJB 4OZ4A 1IC4H 1MRDL 3F8UB 1F6LL 4IRZL 2NZIA 5F3HB 3PUCA 1HIML 3MCKA 4G3YH 5ISZD 1QVOA 1CBVL 3DOSA 3ARDD 1ZXQA 4LSQL 3DV6A 3P0VH 1JZ3A 1NL0L 4JANA 1HCVA 5DUBA 4FQXA 2J3SA 2UVEA 4YC2C 3PDOB 2B20A 3MRKA 4JO4H 4LLYA 3E6FB 1INQA 2UZIL 3LN4A 4JHAH 1JYVA 4HCRH 4NO0A 4V1DD 3MRFB 1CL7L 3MLRH 5GHWL 1YQVH 3IXAB 1BVKB 3UZEA 5CZKA 5I73B 5GGSA 5KAQG 1IC7H 4RMRA 1ETZA 1QBML 4YZFE 2EKSB 3UJJL 1RUML 5FOBA 2R2HB 5D5MB 3LSOB 1TPXB 1HXMB 1P2CA 1NAMH 3I75A 3PHQA 5DJ0B 5JW4R 2VE6B 3O6LL 2I24N 2ZUYA 5TE6H 4RQQA 1IEAB 3E3QA 3MCG1 4PJGB 3QUZA 5DS8A 1C12B 4N1CA 3RL2B 4QHKJ 3S8WA 5DJDA 5B8CA 4XNQB 2H3NA 5F93C 5TDPA 1RU9H 1RJYA 1G6VK 5L6YL 2VLKA 4JDTH 1JCKA 4JR9H 4YH6A 1T7VA 1H5BA 3NGBB 4YE4L 1QLFA 3F7YB 4L9LC 4HGWA 3UYPA 1EFXB 3LS4H 3OKDA 5I1AB 4IRSC 5LGKA 4HLZH 3HMWL 3NMEA 4P57B 4WI3A 1MLCA 3GNMH 5HJ3A 3GBMH 4QHMA 5J7CC 2DLIA 5CGYC 4HV8B 4KQ4H 1J5OL 1XEDA 1BZ7A 5E9DB 3OKMA 3U46B 4PJ8C 5IMLB 4J8RB 1V7MH 4LSPL 1YN6B 2XZAH 1DQJB 3HTLX 2X1WL 1RMFH 1HH9B 4L5FH 3CX5J 2OCFD 1A5FH 4APQD 3T0EC 1JTPA 1E6OH 4Z7VE 1JWUB 4QWWC 3CH1B 4X6DB 1XGTA 2R2BA 1YUHB 2BVQA 1WF5A 2G75A 3BIAX 2LTQB 5GRVL 2RGSA 2XZCL 1FAKT 5D6CB 5E94B 1UZ8B 2BNRE 1FG2A 1TTFA 2ATKB 4JFED 1ED3A 3ARUA 3RZCB 5I15L 2NY6C 1CD8A 5L2KB 3ARFB 5I1LB 2DLFL 3D25B 1A0QH 5EU7C 5L2JB 1CGYA 4ZUWA 2AW2A 3LPFA 4XHQA 3RWEB 1VFUA 1RY7B 5JW3H 3JWOL 3OAYK 3QIUC 2AABH 3OKKB 4JDVB 4R90H 2OMBA 4JKMA 2Z91B 5E8OA 3OKNA 1BPVA 4LEOB 1NAMA 1EJOH 4CVZA 1NGWA 4LBEB 2ICWJ 5H94A 2VZTA 5EIIB 3BZDA 3LQZA 4Z8FL 5EZLA 1ZGLM 1MQ8A 4XNUL 5C0BE 2H1PH 4RGNE 4F7EB 2R8SL 3OJ2C 2NW2A 4HAFA 3LKQA 4OIIH 4HH9A 1FO0B 5AZ2H 2YN3A 4YX2L 3HHRB 2VDNL 3TN0D 3V5HA 3H3BC 1NLBH 4HXAL 3S7GA 3SN6N 3QHZH 3T65A 4WO4A 3U9PH 5EBWB 4D0DB 1N8ZB 3FFDA 3IJSA 1N3NB 1Q94A 3UBXG 5C0ND 4A6YB 3OKLB 4XVUD 5HGHA 2R23A 3ORJA 3MRRA 4CGTA 2E8ZA 3MA7A 43C9B 4F7CA 1FVEB 1E4XL 4RRPA 3CSBA 1OQOA 1QBLH 4NUGL 4PGBA 1ZHLA 3KPSE 3LEXA 3ARGD 1RSFA 2AV1A 1HHJA 3LH2H 1G9NC 4LU5H 4W4OA 1U42A 4MDIB 3TBVB 5IMKB 4Z0XA 4QRPA 4CN1A 4S1DC 5I75C 3FQTA 1U9KA 4E41E 1FVCA 3CZJA 3V6FA 5T3ZD 4FFEX 4U1NB 4QT5A 4YGVB 4Z7UA 4YHIA 3X14B 4IRJC 3VGBA 2BVYA 3B2UD 1YNKL 5GJTH 1UWXH 2VR9A 1N64H 3QQNA 1UQSA 3VD7A 1U8MB 1XGYL 1ZS8B 2XN9D 5EU6B 3HI6H 2P5WE 3T2NH 1BD2B 1KPVA 2DQIH 4ELKB 4NYLA 4YDIH 1NGXA 1AY1H 5IWLC 1OAZL 4LCUA 5ESVA 5T3XL 2D7QA 1AXTH 2AJYL 4GW5A 1FZJB 4MA3B 2QL1A 1EEYB 5GGUB 2X1PA 3HZYA 3ULUL 4JREB 1UACL 3UO1H 2VMFA 3O8XD 4TNWK 2Y5EA 4XBGA 2W0FA 4K7PH 3PF2A 4NQEB 3BVNB 4QTIL 1MHCA 2NZ9C 2PW1B 2PN5A 5CJ8A 2F5BL 4OGAC 1QSFB 1U95B 3D69B 3OAYH 4GW1B 2IH1A 5DHYA 2AEPH 5DMGD 1YN7A 4DQOL 4BQ8A 2JK5A 2D31A 2NQCA 5F88B 5GS2D 1LNUB 4MJIB 2D2OA 4XPAL 1CGTA 5BS0E 2BCKA 3U4AA 5HGAB 1FFOA 2MKWA 4X9GA 5KBNC 5EZJA 1EEQA 3KPQA 5K9KB 3UX9B 3FO9A 3P9WB 3VFSA 3HE7C 4LPYA 3KPRD 2C1PB 5K33A 1M7IB 3RNKB 5D2LB 1S7SB 4JKPH 4NOBA 1VGKB 1A14L 5CSZA 1XF1A 4HFWB 5DJ2A 4XAWH 3TIDA 1YC8A 5IEHB 5GGQL 3C87A 1UM4L 4GXVL 1CT8A 5ISZA 3GB7A 3ARDA 4GRWB 4OV6F 4PY8J 3ZKNC 1B4JH 3MV9A 4UDTB 2X4SA 2CLVB 3HZKA 1CE1H 1N59A 2P5EE 3LQMA 4HBCH 2N1KA 4HDIA 1KB9K 2OR9L 2K3TA 1EA9C 1VKXA 4BFIA 4DTGL 1RFDL 4Q6YA 1JF6A 3O3AA 5T1KB 3U9UB 1F4XL 4Y5VC 1SEBA 2ADJB 4Z7UF 4V1DA 1CXLA 1OTUD 4C4KT 3D0VA 3PHOA 3WN5A 4PJDA 5D7LE 3RNQB 4QNPF 4PP8C 3FQXA 4JZOA 4OZGF 4PJ7B 4LCYA 1C7SA 1IKFH 2OK0L 3S3SA 4O58L 4TULH 5D70H 5T5NG 5JQ6L 3CFEB 4RFNC 3QEQE 2HLAB 4LHUG 3D9AH 1FORH 4YWGH 3V4PH 4DAGH 1A7BA 1OAXL 1NGQH 4ZPVA 2VABB 4AEEA 2VDOL 3V0VA 2XRAH 2V2TB 1I1AB 5IGXH 1CF8L 1MRCH 4ZDHA 2BNQB 5IJVA 3DX6A 1UB5B 3QZWA 5KOMC 1UWEL 1XF4B 2EYSA 3H42L 4AJ0A 4AH2B 2Q7YA 4PV9B 1F58L 4PTUB 4KZDH 4I0PD 1A02N 4UNTA 3RKDC 2A6KA 1CZ8L 2G5BB 3S5LG 3S36X 1B9ZA 3RWFB 1WBXA 4PRID 1VB9A 4M1DH 3U79A 1S9YB 4APQA 3GSXB 4M6ML 4OGYL 3U0TB 3IETA 1GSMA 1KC5L 2O26U 3NBNA 5AWNL 3V8OA 1G9ML 4UNVA 5HY9B 3QQ9C 4WEUD 1RZ7H 3SBWA 3CDCA 1MPAH 3W2DL 4X4MA 5E8NB 2P42B 3SDYH 4N5ED 4OV5B 4JFEA 1LMKA 3P4OB 2AXHA 3LKNB 4U6VH 2XACC 5IK3B 2XTJD 3E6HB 4LLMA 4KFZC 4LLUB 3S37H 5TFSL 5LWYL 4NHUA 5MI0B 5EFIA 1J0IA 3ETBF 3O3BB 5DJAB 3V6ZB 4LF3A 4NKMB 5DRXA 1QUNA 2OQJA 3AFLA 4PJDF 1XGRA 5DMIL 3H3KA 1JPTL 2V2XB 2ZKHH 4FQ2H 1MFBL 1U6AH 4GRLB 4HFUH 4ZFOA 4I18A 4P0DA 2Y4SA 3RVXC 2EE9A 2PXYC 4YXHL 5CJXC 3WFHB 3WLWD 2V7NB 3SQOL 2PYED 1EO7A 2DBJA 3ULSB 1R3HB 4OQ1A 3HB3C 3BGMA 3TN0A 1S5HB 3FQRB 2JLLA 4K71C 1FYTE 5IV2A 2XFXA 2DQHH 4JO3H 1TZIB 3LMJL 4P23D 4XRCB 3EJYC 1IT9H 3F7VB 5C0CD 2I60L 1KN4H 3ARGA 4QLRA 4YHOL 2ZNWA 2BP3A 1MCOL 1GGBH 1ZTXH 1NGZB 1MWAA 2Q76B 5AZEL 2HTKD 5JHLL 2QKIA 1TQBB 2ED7A 4L4TD 1IGCL 1ZGLP 3MGOB 3QXDA 5I9QC 4YUEL 3GGWA 4UBDD 2QQNL 3TPUA 1P7KA 3ALPA 1WWCA 2IG2L 5DQJA 3MV7D 1XR9B 2WQ8A 1OGAD 5L8JB 1SJHB 3L5HA 4NT6B 4UTAL 2XN9A 3RGHA 2HT3C 3CFJB 3S3PA 3VXUB 1DLFH 3WE6A 1DBAH 1RZGB 4MX7A 1PKQA 5CIPH 1JMZA 4LSRH 4A2MA 1I75A 5D4QA 5AG8A 4XNMB 2Q6WA 3I3BA 4Y19B 2MKLC 3E2HA 3HN3A 2FL5B 3O8XA 4EOWL 3CDYA 4R97C 4CVXB 2BOCA 2UZXB 1A2YB 1MI5D 1MAMH 3QUKB 1I1RA 3TJHC 4R96B 3C09C 5CJQL 1U8IB 3LQAC 4MNGE 2OJEB 1EBPA 4AEHL 1WISA 4F58L 1QLEH 3DX8B 1N0XL 4KJQC 1MAKA 1FO0L 3BGFB 1C5BL 4JFDB 5C08E 5T1LA 3MRLA 1YNTA 3G5VB 3HMXL 4OFDA 1AQDB 5TGBA 3UTSD 2F19L 5ICZA 4Y1AB 3B3IA 3L5XL 4U1HA 4U2ZA 4RISH 5GIRB 4OM0H 1FNLA 2DRUA 4Q2ZA 2R29H 2VAAA 5K9OA 1CLZL 2VLRB 2E7BA 4M93C 3UDWA 4J12A 5F97E 3RY4A 1CTNA 5EOCH 5FYLD 3QAZC 1U8OA 4YPGB 4WUUD 4QEGA 3HI1B 2WBJB 4EDWH 4N0UA 1AE6L 1IZJA 2HFTA 3AS3A 1REIA 1QHPA 4LIQH 1AXIB 4WI8A 3VI3F 3BKCH 1SYSB 3JVGA 1HYRC 2ZWLT 4NKOB 3PP3H 3UBXB 5J1TC 1BWMA 4U1MA 1UC6A 5JR1L 5LJYH 1GGIL 5EU7E 3GIVA 2UY7A 5T33H 5DHVH 1BLNB 5D93C 4HLZG 3N1QC 2YC1B 4QCIB 2Z31D 3KYOA 4NZJA 1YPZF 5J1AB 3HNVH 5CIPA 5BVPL 1NGYA 3IDIB 1KIPA 5I30H 2ICEA 1A7PH 2NY2C 4LARH 2IAMC 2NYYC 5D1QC 2CH8A 4WI9A 3F62A 3PP4L 4Z76A 2W1NA 2WWKT 1QNZL 1UA6H 3G6DH 5J11C 3MRQA 4NKDA 3ESVF 3GZKA 4HWNA 3L3DA 3FQUB 3WFEL 1L7IH 2HKHL 2R0ZH 1KPRB 1T03H 4M62H 5IJKA 2YWZA 5DZNA 1A8JH 3SDXB 2HFGL 3EYQD 5C0EB 1VFOA 1S3KL 4W68A 2AK1H 3FQNB 3MLYL 2ZSWA 4G6MH 3BW9B 3FQWB 5C1MB 6FABL 4OLUH 5IMOA 4IMKC 1JPSL 3RI5F 3WIHH 4U6TA 4KHXL 4EUPH 2VDMH 4JAMB 3DUUA 4XVSL 4ZNEE 1L8JA 2X7LB 2A0LC 3FB5B 4K3EL 2DM3A 4YR6B 4MD0B 5KZCD 4I0PA 2J4WL 4I3SH 5GSVB 2QV2A 5F7DA 3MJ9H 5C0AB 3TWCH 4MCZA 1IQWH 3C6LD 4FQLH 4LLDB 4PRIA 5JHDB 4OF6A 3PL6B 3P4NA 3JWDL 3Q6GL 3TO4C 1P4BH 3HPJA 1I1YB 5D96B 3CFKA 4ZO9A 2B0SH 4XX1E 4OCXL 3RDTC 1GCFA 1J88A 2VLJB 4X0KA 1MJ8H 3KR3H 4HX1B 1HH6B 2PYFB 4R0LB 4N5EA 3M17A 3L9RA 3EO1A 4GLRI 3DBXB 4KAQH 1J0ZA 4ODXB 1FBIH 1A6ZA 2UYLB 4HKBA 1IGYB 1IFHH 1MVUB 1GC1C 2V2WB 3QFJD 5ECJE 4DFHA 4F15C 1FZKA 4YHML 1NEZB 3UXFA 3D3VB 5DYOA 3VWKD 2VDRL 4JFOA 3E8UH 4MVBD 3QDMB 3NCJH 3MGTB 1KOAA 4ZTOH 4QWWD 4DN3L 4YK4B 1HEZA 1A64A 1G7HA 4P5TC 1MF2L 3I50H 4CJ0A 3FKUS 1X7QA 5GGTA 5DRNB 2ATPB 1JHLH 1ZWIA 3BO8A 4UV4H 4W4NA 2PYEA 4TYUA 5EN2A 5HDOA 3GRWL 3WIHA 1SEQL 1CIDA 3G5XB 3SE9L 1PZUB 4V2BA 5FHBL 3GMPB 3NABL 4LFHD 5E2UL 4AM0A 2DD8H 4WIQA 1BGXL 4P23A 5ETUA 1HQ4A 4N8VA 4JHWL 3QCTH 1D5MB 2WUBL 3V6BR 5C0CA 1OCWL 3M8OL 3MC0A 3ERYA 1AGFA 3L3OA 3MJ9A 3KPPB 4TVSa 1FGVL 1QRNB 1IGFH 3JTTB 2F5AH 1T5XA 3STLB 2BVOA 4L4TA 1BAFH 3TBYB 2JELH 3BKML 3FONA 2HRPL 2QQQA 4LLQB 1D7FA 1MHEB 1EO8H 3W5MA 4AENA 2LFGA 1G6RH 3QCVH 3MV7A 3ZTJH 2OP4H 3SQBA 3RJQB 1MCQA 2BERA 3LKOB 1OGAA 25C8H 3QRFM 2DWDB 5KSUA 3X3GL 1UYWH 1R3IH 1IAIH 3UPAA 1Z0NA 2D03H 1KXVC 4X4XB 4PS4H 1RURL 1U8JB 3S5LB 1NSNH 1SJXA 4OCLC 4YIQA 1DDHA 3BH8B 1GZQA 4LVNB 1KT2B 4L8SC 4P2OB 1HHIA 3CC5B 5MEOB 1MFDH 3V8CA 1T80A 4LQFL 1WEJH 4Z77B 1I7UB 1MI5A 2DF3A 1JE6A 1KLFA 5EPMA 5EB9A 1J10A 1I8IB 4F7TA 4Y4HB 1C1EH 3K2UL 1J0KA 4Z7UE 3EYUH 3L5WA 1UJ3B 1Q9WB 4H1LH 3BSZL 1TNMA 4OZFA 4QNPE 4XC1H 4OZGE 1DQQB 3BP7A 2YD4A 3JUYA 3UTSA 3WMSA 1VESA 1U8QB 4U3CA 4I77H 2FGWH 2NW3A 3ZT6A 4AQOA 3OMZA 2NY4B 1YC7A 2QADC 5FXCH 1V3JA 4P2QD 3U48A 3WIIL 3SDDB 5ID1B 3LB6C 1CDCA 4AIXA 1G7IB 2X4OA 4CADB 2GW5A 3MRDB 4F9LA 3FN0L 1BEYL 3D18A 4Y5XB 4PV8A 4WUUA 1KELH 3KNBA 2GSGA 3MV01 4OUUB 1I9IL 4JHZA 4I5BB 4GSDL 3SCMB 4OCSH 5CD5D 5T1DH 2HG5A 3SJVD 4WEMB 1CQYA 5D1XB 3PABB 3V9FA 5I6XB 4OT1H 2DTMH 2C4FT 3DYOA 3G9AB 5I66A 5E03A 4NRYB 1F90H 3F65A 4E0RA 3DROA 4BH8B 2Q8BH 1L9NA 3MACH 5HYSB 2BRQA 5FUZH 2Z31A 1QQDA 2G60L 5I8KL 3OJDB 12E8L 2VNCA 4OAWA 5SWSD 5DJYA 3HE7D 2KZ1B 4NJAL 3MRJA 4RGOL 3RY5A 4KMLB 5DT1L 5L7XH 5LVEA 1BFVL 2R2EA 3DO7A 3TFKD 2OL3B 3MRPA 2Y72A 3O41B 5DD0H 2YSSB 4OD1H 4N9GB 2F74A 3SKUD 2ZCHH 3BRFA 5A40E 5ISZE 2X4TB 4DZBB 5EUKB 2EDJA 1OW0C 3ARQA 4XCEA 3TP4A 1LE5B 3IDNB 1IC5L 5CWSB 4ZYKB 5CLTA 3MV9E 2OXGA 4KY1L 3P11L 4OUOA 4AT6B 4IOIB 1MH5A 3NAAL 4OJFL 4LSUH 4FQIL 2DQGH 3BZ4B 4MZ3A 5J6HB 4W6YB 4M1CC 2C3WA 3BKYL 1NKOA 5GGRB 4KK9C 2FEEL 3H9ZA 4M7LT 1JGLH 3NA4A 1NCUA 4PJDE 4Y4FB 3PJSB 4G6AD 3VXPA 3OAUL 1MFEH 1XGPB 5DVMA 4O2EB 1FFNA 3SKJL 1XIWA 4PJGF 4WTWA 4DKFL 1U92B 3QSKB 1JNNH 1ACYH 4M6NH 4NDMA 1J1PH 1UGNA 1OQXA 5B38B 3QJFB 3BZFB 3C6LA 1HKLH 2BZDA 5C0IA 4EEEA 1K5NA 5KW9L 4JJ5B 1ZHNB 5TE4H 4Z7QF 3GDBA 4V3DB 2GQHA 5I73C 1XFPA 2HJLA 3CCHB 1E28A 3DI3B 3WO4B 1W0WA 1UG9A 5I1JH 4J6RH 1FE8H 4FRWA 1TPXC 1QLRB 5DQDH 5IKCA 1S7VB 4HIHA 1FL5A 2ITCB 2J88H 2GITB 3AUVA 3KYAA 3F58L 4JEGB 1KJVB 3OF6D 2XPGB 1FZMA 5HHOD 4TSCL 5C2BH 4TN9A 4AQ1B 1RZ8B 1WQVT 5JXAL 1X6LA 5IHZA 3CUPB 5I17B 1C5CL 5ICXA 1HWHB 3GSRA 3QFJA 1DSFL 1AGEA 1RHFA 1V05A 1A6UH 4QRUB 2GFBA 4YDJB 1T0MB 1X4ZA 3NGBC 3HA0A 1MNUL 5HYJE 1CWVA 5FV1L 3VWKA 3T4AA 3TNNB 4G59A 3QDJE 5BMFH 4MVBA 3GMQA 4Q9RL 5EU4A 4ZTPL 3TZVB 4ZO8A 1Q0XL 4HWBL 1NMCB 4BA8A 1U8NA 1DE4B 3V79C 5HYIA 1M4KA 1KJ2B 1VADA 4OLVL 5B3NA 1P9MC 2DWEB 3CLFH 2A9NL 2JJTC 3C8KA 5FYJU 1KN2L 3H9SB 3TYGL 5HYQA 3OB0H 2V5RA 4P4KD 1WCQA 2QQKL 5E1AB 4KKLC 3MLXH 4YO0A 3VFGL 1G7MB 3WLBA 3MNWB 1FV1B 5JIPA 1T2XA 4JKKA 3BUTA 2A73B 3DGGB 4WWKB 4NHUE 2LTQC 5IVOA 3STZB 3W0WD 3FAWA 4P9ML 2CIKA 2Y06L 1YEKL 3I6GA 3RPKA 1R5WB 3PWVA 4KRPB 2GTWA 2FBJL 5J89A 3E0GA 2EDYA 4KJYB 2QR0B 1L0QA 3RZCC 2M8XA 3ARFC 1Q9KA 2ILLA 1H3WM 1B6DA 3IDJA 5I76B 4N0FA 1Z3GH 4M00A 3FB6B 1QR4A 3PWPB 3V6OA 1WFUA 5DUPH 4CUCA 4C59B 1T66C 5F1NB 4OIBA 2W9DH 3PWLA 3CX2A 5CUSH 4ODHL 1LHZA 5B22A 4TSBH 2GAZB 3MRGB 3X11A 5LBSL 5IF0A 1U2HA 1EO5A 3P30L 2FATL 3O3DB 4CMMB 3NZHH 4K94L 1HNGA 4J4PD 1L0XA 3T08A 1S9WA 1N6QH 1LEKA 4D3CH 1OTTC 3VI3E 4JB9L 4GS7C 2FB4H 5CGTA 4K8RD 1XIWC 4YXLL 1FH5H 3P4MA 5FCUL 1KIUA 3H9HA 3L3JB 4ETQB 1T2QH 1OAQL 5EA0H 5GZNC 1K4CA 1CYGA 2XTLA 3MV11 2AAVA 4WW2F 4ZUSB 5J13B 2VO5A 4LGSB 2B2XH 1AHWA 3GBLA 5T3ZE 3TPUE 1JFQL 2PR4H 3AGVA 4XP1L 4HAGA 1A6VH 1CR9H 2ARJQ 1YPZE 3LS5L 4KTEL 4X5WB 3TLRA 2P7TA 1CDYA 2F53E 5F7UA 4BZ1L 4C56D 5I1GH 3HZMA 2CKBB 2DS4A 1OP3K 1I8LC 4MJ5A 4P9HL 1I8MB 2ICWA 4UUJB 2XN9E 1U3HB 3LKRB 4DW2L 1KIQA 4PBXA 5CD3B 1PKQE 2VQTA 1DTUA 1AR1C 3S4SG 4WFHD 4ONHA 32C2B 4WW2C 3RTQB 2CMRL 4MD4B 1F4YL 5ITBH 4U1LB 1D9KD 2X4PA 4U6YA 5JUEL 4BSWA 4F37K 1T89A 4O51A 2VWEE 4L4VD 4M7KL 4PGEB 3SGKC 5DD3H 1J8HA 3VRJA 4D0CB 5D2NB 5DSCA 1NANH 3SJVA 4OF5A 2J2ZA 2QEJA 5CAYB 2LAAA 4Q0XL 4N0CD 4PB0H 2VITB 3CSYA 3HC4H 5TDOA 4U1KA 1NBVL 4ISVB 2XY2A 3CPLA 4K3JH 4N1HB 5AAWA 3KWWB 3WFDL 4EUPG 1ZSDA 4FFWC 4I2XA 4MQTB 1LK2B 4GG6B 3ECBA 5SWSA 1JVKA 3OGCA 5A16B 2JJSC 1AQKH 1U8HB 4MAYB 1PY9A 2IGFH 2B4CC 2Y9RT 1A7RL 2RFXB 3TFKA 3LD8C 5IFJA 1ORQB 4N0UE 5H2BB 2AJSL 3VXMD 4U1SB 4M8QB 1S78C 2RB8A 3PGDB 2NXZB 4PRNA 3H8NA 4JN1L 4GAGL 4GJTB 5IW3A 5LGHL 4MA1C 1MIEH 4FTVB 1TZGH 3U1SL 4MXVF 2R4RL 1JRHH 1MCPL 3MLWL 2DLGA 2I25N 1NFDA 3V5DB 1OLZA 3QIWB 3CFCL 1A6TB 3QHFL 5A43C 5DHXB 1F3JA 1U8KB 5IBLC 3IFLH 1VERA 2NXYD 4PJXA 2MMXA 3KAAA 1LWRA 4J1UB 2AJ3B 3HUJB 4NCC2 3GI8H 3MPCA 5GQBA 4HC1H 1XR8A 5CEYB 1OP3H 4WI2A 1KYOJ 3CXHJ 4LPVA 1A4KB 2CDGB 1EEZA 3EFDH 1M6OA 2NY5L 2H2PC 3BRDA 2YN5A 3EYFB 4JG1L 3FRPG 4UT7L 1NMAH 2V7HA 2CIIB 2DQFA 2WINB 5DRWB 2OS7A 1UZ6E 3V4VL 1QO3B 4GXUN 2XKSA 4PGJA 1Q9LB 2DQCH 1RUAL 2CPCA 4HPOH 5DTFB 2ZUUA 3SE8H 1G7PA 2BVPB 1UJTA 1KCSL 3BQUB 4UILL 4HT1L 1BZ9B 3OF6A 1N2RB 5HHOA 1YEHL 4M6OH 3CDFA 8FABB 2XKNA 3U83A 5EBLB 1WBYB 4RNRB 2EH7L 5KVFH 5F7WC 1ITCA 2W59A 4K8RH 4P49A 2H2SC 1XF5B 3IFOB 2YPKA 4Y16B 4L8BB 4B0MM 1CICD 4AMKL 4G8IB 3WXVH 1F3DH 2Q8AL 4WENB 4ZXBD 1DUZA 4OQTA 4NO2A 1QFWH 4TPRL 2P48B 3RWGA 1T4KA 1NBQA 3I84A 4WDIA 3DARA 4NQSB 4M03A 5EO0B 3I2CH 4P4KA 4ALAH 4JE4B 1KLUB 1H3PL 1F02I 1N7MH 2A1WL 4FOMA 3WUWA 3T1FB 4LRNL 3T3PF 1JZ4A 3IJHA 5C7XL 1VFAB 3TBTB 1PYWB 2BK8A 5K59F 3JXAA 3MBEB 4S1QH 5I8EB 1JHTA 1I8KB 2WUCL 4RAVA 3MV8E 3W0WA 4PJ5A 1PDKA 1BJ1J 1NFDF 4N1EA 3HNTL 1BVLA 3EYOA 1TDQA 3O45B 4MXQC 3L5IA 4O2FA 5F7HA 4FXKA 4JGMA 3FB7B 1FHGA 2FIKB 1SY6H 2HN7B 4OI8A 4PJXF 3NA9H 1JWMA 1RK0A 3GMNA 5KSAB 2CUMA 3LQAH 3C08H 4LLVA 4LK4A 5IOPA 2YUWA 1OAYL 1MIMH 2FO1A 2H26B 1OSPH 4S0SD 1H9VA 2P24A 4H1LG 2HH0L 5KSBB 3OXSB 4GMSL 1FZOB 3FHQA 4KVCL 2CDFB 5JW4N 2PYEE 5GRVK 1FC1A 2O61A 4MS8C 4PJFF 1X5XA 5TDNA 3HAEH 3BE1L 5JNYA 1JGEB 3TVMD 4PDCE 4MB4A 4NUJB 5DZLA 3R8BB 3GJEA 4GRLC 2WSKA 2YD1A 4WJ5B 4AG4L 4IJ3B 4IRZH 3NZ8B 4J4PA 3Q48A 1HIMH 4PJHA 2IBBA 1CBVH 1AKJD 5C0CE 4M9PA 4LSQH 5HYEA 5EIQA 1NL0H 5E5UB 3P4LA 5DEZA 4M5ZL 4YQXL 5IVZA 5D9SA 1KJ2L 3ARSA 3KJ6L 2EE3A 1ADQL 2UZIH 4HKJA 4EN3D 5IESH 2BHUA 1NJ9B 2RR3A 1CL7H 5GHWH 2BNRB 3I3EA 5IHBA 1FL3B 2X09A 1B2WL 4LVHB 2XQYK 1YECL 4C56A 2CO7B 3C5SB 5C07D 1Q9OB 1K4DA 1V7ML 3ULUD 3FB8A 4F33B 1QBMH 4NOFA 2F8XC 2EYTB 3MJGX 3UJJH 1RUMH 4TTGA 1D6EB 4QXTA 3ZDZF 4YBQC 1TQBC 1KGCD 2QBWA 3O6LH 4QHLB 3MNVA 4RFEB 1K8IB 2DKUA 4JJHA 2DLEA 3RL1A 2ITDB 3IVKB 5F9DC 4RIRB 1IM3A 1ZKAA 3IFPA 2BY2A 2JJUA 3MLTB 4ZNCD 5FAAA 3TBWB 4OKVA 4Y2DB 1QG3A 4LDOB 2WWMC 1FNGA 1D9KA 4JFPB 3N1GC 5IROA 1ZLSL 5L6YH 2ESVD 2SEBA 2YXFA 5ITFA 4U05A 4YE4H 4L4VA 3GMOA 4XPTL 3OV6A 2VIRA 5C0BB 1JV5A 4RGNB 3HMWH 2PTTA 1B0RB 1T6WA 4YXKL 4FQHA 2X4QA 4DZ8A 2AJUL 5FGBA 1B90A 2D9CA 1PQZA 2W0PA 3FO2B 3QNYA 4R90L 4PJGE 3ZKQD 3G6JB 3UTSE 4N0CA 5IFHL 3QFDA 4G9FA 4G6KL 4LSPH 5E0QA 5FA4A 3IF1B 2BSSB 2H9GA 4MMXC 1U93B 3VI4F 3WS6A 3FRUA 2MWCA 4Z9KB 3DSFL 4Y89A 3KPSB 3OL2A 1NDGB 5GRJL 2OYPA 3BGFC 1BOGB 2E6PA 2Z4QA 1MCSA 2NTSP 2QSCL 3N85L 3LB6D 3N50A 4GQ9L 1U8LA 2XZCH 4M3KB 2DJSA 4ONGL 1U2CA 1WAAA 5FK9A 4UAOC 3VXMA 5E9DE 1BQHA 5I15H 2VL5A 3SO5A 5I16A 1AP2A 1OT2A 3I02B 3RVWC 1HCFX 3ME0A 2DLFH 1HINL 3RWJA 1UXSA 1AGBB 3ZDXF 1LO2L 4JFXB 3NOIA 1MEXL 5FUOL 4FZ8L 4LU5L 2WBJC 4X5XB 4TVPL 5C0FB 4G42B 1RVFL 2P46B 3H0TA 1CGSL 1LO4L 4FMKA 5AYUL 2GIYA 5FYJE 2K9UA 4CW1A 1FNSL 1RJZB 5K9QI 4Z8FH 3SKMA 1MCCA 5L2KE 5L0QC 1QKZL 4XNUH 3QXVA 1C08A 2DLHA 2J6EL 4PRAB 2R8SH 1FAIL 1NMBL 3BGAA 4MJ6A 4YX2H 4HGMA 1U8PB 2X70B 2VDNH 2BOBB 4HXAH 3NFSL 3NCBB 5BV7B 3L6FA 2DIJA 3VW3L 2HLFC 1KCLA 5E4IA 1ZLUK 2MHAA 7CGTA 5JPNB 3GKWL 2DKSA 5HHQA 5F89A 4X4ZA 2H41A 3UTOA 5BS0B 3JV6A 4FG6D 4NUGH 1D5XA 4JLRA 1ITBB 3PIQA 5K93A 1AR2A 4LHQB 2ADIB 4LMQI 1DVFB 4YHPA 3O9WD 1ZHBB 5FO8B 4OTXL 1X5YA 4P3DA 1BIIA 3TF7A 2BMKB 3U82B 2EXYC 5GJSL 5CZVL 4BQCA 5EO1A 1BBJB 5IR1A 2G2RA 4OI9A 4XCYA 3S6CA 3HZVA 3IB4A 4D9QE 1X6NA 3QDHA 4ZSOA 1CICA 1HXYB 1XGYH 3V7AE 3DV4B 4LCWD 1EUUA 2XWTB 4KPHL 2FJGA 3H7BB 3BAEL 5F96L 4ZXBA 4QY8B 5EULV 2GT9B 4N8PA 1KB5B 3QDAA 1OAZH 4X7DC 4Y4KB 5T3XH 2AJYH 1WAAF 4MYWB 3HS0A 5JW5A 5BZWA 3DMMD 3UJIL 3ULUH 3OKEB 1T1XB 1UACH 3VE0A 1OAKL 3PL6C 1T22A 5D96C 4JFFB 4QTIH 3ES6B 5F7EH 3P9LB 3SKNB 4X6BB 4ODBD 2F5BH 4KRNA 5J9PB 4K2UL 2J8UA 3UAJD 1ONQA 3RX5A 3ZZ1A 4H5SA 4R0LC 4DQOH 4CU8A 2KKQA 5DEFA 4TQEL 5E4EB 5FYKL 5I1CL 1RK1A 4RAHA 4GG8A 4XTRC 1TJGL 1ZT4B 4G9DB 4XPAH 1R24A 3BUYB 1KNOB 3IKCA 3T8XB 3EFFB 1QTYT 4NQEE 4R2GB 1CU4L 1ROWA 2H32A 3WXWL 1FG9C 3O2VL 4H26A 4ZFFB 3QEUB 4Q6IA 4FA8A 4HG4K 2I9LB 3TVMA 1OHQA 1A14H 1U41A 3QWOB 2OI9A 3WO3B 1CLYL 4YK4C 1S8DB 3PGCA 1YMHB 1ZLUH 4X6EA 5GGQH 3KPLA 1UM4H 3MUGA 3QUYB 2RCSL 4GXVH 4RRPG 5F70A 5CEZD 3EGSA 4JM4L 2WBWB 1IAKA 1ZA3A 4KK5D 3RKPA 1T3FA 4M61B 4R4ND 3A6OA 3U36B 2O5XL 2OR9H 3QHTC 4X6CA 5EC2A 4DTGH 3V6OE 1A1NB 1EHAA 1KFAL 1RFDH 4Y5YB 1FRGL 4EN3A 4Z7WB 3VXTA 3Q6FA 4F7MB 5SX5K 1BZQK 5JZ7D 5C07A 3HRZA 4X98A 1ERNA 3BN3B 3WSQL 4HUWB 2OK0H 3MJ7A 3O11B 4KROB 3GMMA 3P77B 4O58H 4OGXL 4JFHD 4M1DL 2EEDA 3GSNL 4WV1A 5JQ6H 2YUXA 2OTUA 3LDBB 1CDHA 1FGNL 5C71A 4ZOEA 2PF6A 2CDEA 1OAXH 1J05A 2VAJA 3VD3A 4MXVE 5B39B 4HJGB 1YMMD 3SY0A 1E0OB 3QEHA 2VDOH 1C5DA 4NPYB 3QO1B 2AK4B 4HIXL 4F2MA 2D0HA 1MREL 2ESVA 5TQ0L 3X13B 3B83A 1CF8H 1II4E 1UWEH 1AGCA 3H42H 3MRBB 3HNSL 4U1JB 4QTHB 4JZJA 4LVNC 3WV0A 1F58H 4P2OC 4X7SL 1JPFA 2IC2A 3FL7A 3EO0B 1F8TL 1HSBA 5DJ6A 3G08A 5L8LB 1B6UA 2Z8WC 3JV4B 4UNUA 1CZ8H 1RD6A 4Y4HC 5SWQA 3HPLA 4FQCL 4M6MH 4OGYH 1QPXA 2VSCA 1NC2D 3C2SA 1KC5H 2BNQE 3AC0A 5AWNH 1G9MH 1A1MB 3D48R 1HKFA 1UFUA 5IB2A 3NCYS 5HVHC 5D71L 4R7NA 1BD2D 3BT2L 3W2DH 4X8XA 1F11A 3C5ZD 1J8HE 4NC2B 4OZHB 5DJCB 4LRIA 3SDAC 1XZ0B 3L95B 4NQVA 1F2QA 5CCKL 2NY4C 2YXMA 1AFVL 2IALB 2EDBA 2IMNA 4JQXC 4XCNB 2GK0A 5I2IB 5TFSH 5LWYH 2NY3D 4YHZL 4X6CF 5EZOL 5MEND 3O4OC 4Y5XC 4I2XE 4PJBA 1G1YA 4MHHI 4X4YB 3OR7A 1QSFD 4ZOBA 15C8L 4J23A 4PRDB 3IFNL 3RVTD 3SCMC 2NY5C 5INDB 5DMIH 2PO6D 5SWSE 3WKNA 5SX5H 1JPTH 1MFBH 2AXFB 5D1XC 5I6XC 1NH6A 3I6KA 2JJVA 4LGPB 1F45A 3R0NA 4K23L 4MD5B 3RZWA 4YXHH 2X05A 1ZMYA 4IEFB 5C8JA 1UH2A 1WIPA 1WBZB 4MNGB 3SQOH 2ERJB 1S78D 3P73B 4RAUB 4X99B 4F7PB 5KSVA 4OSUL 4NBZB 4B53A 2ZG3A 5C08B 3T3MF 3MLZL 4DVRL 5K59E 1TCRA 1YY9C 4ZO7A 3KVQA 3U6RB 2VXVL 1ZVHA 4LSRL 2X1XR 5TH2B 3LMJH 5GS1A 2X4NA 1NFDE 2IADA 5D7JA 4ZUTA 1XH3A 2D0GA 2I60H 4GKSB 4KKAD 2R1XA 3GSUA 1MJ7L 3KS0H 1MRFL 3MMEA 4PJ8B 3T4YA 2EDHA 4YHOH 3QZWG 4PJXE 2YOCA 3V0AC 1MCOH 1MSPA 5ESQB 3FFCD 4KKBC 2FX9L 3O9WA 4XBEL 5AZEH 4NRXA 5JHLH 4GRMB 5CP7B 4DUWA 4MMZC 1IGCH 3C5JA 4G8FB 4YUEH 3TA3D 2QQNH 3UTZB 1OARL 5FYJH 5JOFA 2C7UA 5ACLA 4ENEC 2IG2H 4TNVF 1BWWA 2IAND 2X4RB 4Z78A 3IS1X 1XF3B 1G7LA 3PWNA 3QXUA 2ZSVB 3SKOB 3CFIC 1G1CA 4PJFE 2ARJA 3DURA 3L3HA 4XNYL 4Y4FC 4WFED 2Q3AA 2BSRA 4UTAH 4LCWA 4WW1B 2XZQL 4U6XB 5J6GA 3C60B 3QBTB 2EKSA 4NQTA 5D5MA 3LSOA 5MEQA 3G5YB 1IAII 3DMMA 4D9RD 3QIUB 4U0RB 4EOWH 4WEBL 1BFOB 1IEAA 1AO7D 5DEGA 4FNLL 4UQ3A 5HHOE 5CJQH 4ZS6C 3BRGC 3BDXA 3BPCB 3WO4C 1A7NL 4AEHH 4EVNA 4OZ4B 4F58H 3QIBD 3U30B 1N0XH 1FO0H 4PJBF 4P3WA 1I1AD 1JBJA 1C5BH 1IVLA 2CXGA