4U2BA

Crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
molecule tags Hydrolase
source organism Pseudomonas knackmussii
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
total genus 80
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2bA00
3R41A 1LPNA 2Y1KA 2QXTA 1TKRA 3EQ7A 3C6YA 1SFRA 3STVA 4G9GA 4YPVA 1ZGCA 5HF6A 5IVIA 1EB8A 5ALQA 3IURA 4F0JA 3KOOA 3DQZA 4P08A 2ONCA 5D3KA 4K6GA 1UOOA 2QVBA 5JAOA 2XUIA 2ACKA 4AN1A 3WQHA 4HXFB 3PDCA 1U2EA 3SK0A 3A2LA 2V9ZA 3C43A 1EINA 1QIEA 4D9JA 1THTA 4KE9A 1C7IA 2GYWA 3HSSA 4KR0A 4KAFA 1XQXA 5K3FA 4DSZA 5LZ4A 1FFEA 3VISA 1XROA 2O7RA 3O9VA 5A7GA 1YB6A 4X6XA 2XQKA 3LIIA 1DWOA 1XZHA 2QUBA 4U2EA 1YA4A 1E66A 3I28A 4AO8A 1DQZA 4UBOA 3C70A 1QIFA 3GFFA 1XZDA 3FYUC 3HJUA 4OYYA 3VXKA 2CJPA 1MAAA 4CIAA 1GKKA 4Y2QA 4TVKA 1X2BA 5F4ZA 4IH1A 1ZIYA 1D07A 1A7UA 4XVCA 4UBIA 4UFOA 2HA6A 1ZI6A 4U2FA 1VJ5A 5IKXA 1IZ8A 4ZV7A 1O6GA 5CH8A 3LS2A 3NOXA 4PQEA 2JEZA 4BP8A 1BU8A 4HVTA 4OB7A 3C8HA 3G0CA 4IH9A 1H2YA 1GPNA 2DR0A 2RHWA 2PPLA 3CCBA 3WK5A 2I3ZA 3MGAA 4FNGA 5EHZA 3NWOA 4HZGA 2XT0A 3OG9A 4H18A 3MUOA 4HRYA 3WKBA 2CZQA 3ZPXA 4N8SA 2XMZA 3WWDA 3BL8A 4ZI5A 2DHDA 5DNWA 2NW6A 1XZBA 2HFJA 1JJIA 1L7RA 4BC0A 2VT7A 1CUIA 2WUDA 4J0IA 1QO9A 4DNOA 1RP1A 2QUAA 1NU6A 4KAJA 1H2ZA 4UFPA 4LIPD 1DINA 4LYDA 3X3HA 1GQRA 4BRZA 4ETWA 1AURA 3CCCA 4INZA 4ARAA 2FUKA 4EY6A 3U1TA 4DYHA 5JADA 3O0DA 1XKTA 1CUHA 3OURA 1FSSA 1XRPA 1G66A 1EA5A 4Y2YA 4C4XA 4OYLA 3F9CA 3ESBA 5AK4A 5DNVA 1EK2A 1XQVA 5AKKA 3G02A 4JYPA 4BDSA 4DMKA 3KWJA 3R3VA 3WWOA 3DS8A 2BGRA 3GZJA 1L7QA 1AMNA 4B84A 4QDUA 1WPRA 4KACA 5HF9A 4B81A 3A2NA 4IQ4A 3WYDA 2BFNA 1CFJA 3T4UA 1P0QA 2YASA 4FOLA 3FYUB 4DNPA 1VXRA 1SC9A 1NX9A 3HRHA 4Q3OA 1AQLA 4P92A 5K3FB 5AICA 1CQWA 2PUJA 3ZI7A 3PF9A 3QBJA 5JALA 3H2KA 1BS9A 3H04A 1UOQA 1XZKA 2QJWA 4WCVA 2XUOA 5HK8A 5JAHA 3KWFA 1MAHA 4KRYA 4BC1A 3AINA 4Y9SA 3PE6A 2PX6A 4EA6A 4X90A 1TAHA 3AZOA 3R3YA 1CUEA 2WFMA 1KU0A 2WG0A 3W04A 2YXPX 3QH4A 2PUHA 1N5MA 2XMQA 2HDWA 3MVEA 3HZOA 1SCIA 3L1JA 4BDTA 4C87A 4AMZA 5C7YA 3OTQA 4UHCA 2OGTA 5BOVA 3I2JA 3I6YA 1HQDA 2IX9A 1MNQA 5E4YA 5A7FA 2XUAA 2HM7A 1IUPA 4QZVA 4PNZA 2ZYHA 2GYUA 4BAUA 3I6MA 4L72A 4Q3LA 4JH0A 5CMLA 5LZ7A 5AM4A 1R3DA 2ORYA 2XUFA 1BRTA 5KWJA 4EB0A 3C45A 5CW2A 5K3CA 4X94A 2WIKA 2EDCA 4J0GA 3G8YA 3WZLA 4NZZA 3PUHA 2ZYIA 1UKBA 4GHWA 4BAZA 2XUQA 5ALLA 4W1QA 2JGMA 2XLBA 3SX4A 2JGLA 1OCEA 4RGYA 4K2AA 5EIAA 2HA5A 5K3AA 4Y2TA 1JFRA 4K6KA 1QONA 4Y2JA 1IUOA 1WHSA 5FP0A 4MXDA 4BZZA 1GKLA 1BEZA 4B7ZA 2CKMA 2JF0A 2Y6VA 3W2TA 5AHXA 3WJ2A 3IUQA 4MJ3A 1WOMA 5FOQA 2O2HA 2XMBA 4PSUA 3SC2A 2VEOA 4M0MA 1ZIXA 1JKMA 2WJ4A 1K4YA 1GGVA 5AKZA 2WHQA 3D5EA 4HS9A 4Y2PA 1B6GA 2HU8A 2ZJ7A 4KE8A 4B9AA 4XJVA 2RGUA 5AI9A 1NU8A 1QIHA 1XZIA 3IVMA 1J07A 2WG2A 3IB3A 5DLPA 3V1LA 4GEGA 5FLKA 3H0CA 4DTCA 1JU3A 3DEAA 3K9BA 1EX9A 4UHFA 1W6RA 2XMDA 1R1DA 1EDDA 2CMFA 4BYMA 1J2EA 5CH3A 4KEAA 3C6XA 4E11A 5E4JA 1K5PA 2XUPA 1EK1A 2XI4A 2X8BA 2WG1A 2R11A 4X91A 5HQ3B 4X3CA 2ZSIA 2WUFA 5J3JA 4L0CA 4XX1A 1QLWA 3G9UA 3I2KA 3I6ZA 2Z3ZA 1AC5A 2ECFA 1MN6A 4G4GA 5AM5A 4B0PA 5CBKA 2XUGA 1LZLA 4QE3A 3EF3A 4PF1A 5IVDA 3S2ZA 3WIOA 1RYYA 3STYA 1XLWA 1U4NA 4MWSA 2PSFA 1ZJ4A 2G63A 2JGFA 4AZ3A 1Q0RA 1K6EA 1N1MA 2OCKA 1XLVA 3JYHA 1G42A 3FSGA 4H7HA 1R50A 5LZ8A 5ALYA 1E89A 1ORVA 2VJCA 3D7RA 1GPLA 3BIXA 2B9VA 2D5LA 1KEZA 3FLEA 5AI0A 2BUBA 4X71A 4G9EA 2XUHA 5D7BA 3D59A 5AKYA 4EUSA 3OPMA 5C8XA 2DCMA 1VLQA 2E3JA 2VJAA 5AOAA 1AX9A 4LKOA 1L7AA 3DDUA 3I2IA 1IVYA 1CLEA 1W52X 5AK5A 1BE0A 2HRQA 5A62A 4AQDA 5A2GA 4AO6A 4J0CA 2JGKA 3BDIA 2H7YA 1YS2X 1JU4A 5KBYA 1LBSA 1PFQA 5CXUA 2G5PA 5LIPA 2OPHA 1A88A 2ROQA 4QLAA 2WIDA 2AJ8A 4W1PA 3A6ZA 2B4KA 4G8DA 1ZD2P 3HI4A 1YASA 1R4ZA 5A7HA 5AI5A 4U2BA 3M83A 1O6FA 2RONA 4J0KA 3WA6A 3H2GA 1BEEA 4M0FA 3Q0TA 2HHAA 3ICVA 1C4XA 3FNBA 4WFKA 2JEYA 2O2GA 3IUMA 4Y2UA 3FWHA 4BVLA 3DL7A 2EEPA 1XFDA 3KDAA 1EH5A 5ALOA 2C5GA 4JUIA 5ALRA 5DYYA 1FJ2A 2ES4A 5EFZA 2OGZA 3L1IA 3L1HA 2PSHA 2BKLA 4OUKX 5BWBA 2HIHA 1CRLA 1H2XA 4DMHA 2HA0A 4BBZA 1CUCA 1ETHA 2JGJA 4X6YA 5ALIA 4KAAA 2PSJA 3W9BA 2HRRA 4EZIA 4P9NA 3WKCA 5LZ9A 3ZLVA 5CT9A 1VE7A 1QE3A 2H9YA 1UXOA 3FLBA 1EDEA 4FHZA 5HQ3A 3BF7A 5ALNA 1FFDA 3D3NA 2V97A 4FWBA 1BN7A 1F6WA 2K2QB 1HKHA 5AOCA 3D2CA 1QIMA 4H7KA 3G0BA 2OAGA 5HFNA 2VAXA 4DNQA 3W06A 5AM2A 3QPCA 5C8VA 1LLFA 4S0XA 2OCGA 1QO7A 2Y2VA 4Y2XA 1H22A 2O7VA 1ORWA 2XUDA 2YYSA 3N2ZB 1CQZA 1ZOIA 2VQ6A 2WFLB 4UBNA 3WL7A 4I3FA 3BE8A 3O4JA 3VJLA 2PU7A 2WUGA 3C8DA 4RPCA 4E46A 3DL4A 3V1KA 1YS1X 3D4LA 4WY8A 3HACA 4J0HA 1ZJ5A 2JIDA 3WLAA 1YB7A 5AH0A 2QTBA 2XMSA 4MQLA 3IUNA 4G8CA 5AI6A 2D0DA 2XMGA 3Q8WA 5FUMA 4BVKA 3TRDA 2WU4A 3UMJA 2WILA 4Y2VA 5HZGA 3C5WP 3AFIA 2XQIA 3PFCA 2OG1A 4XWGA 3ILSA 1JJBA 5K3DA 7YASA 4CG1A 1MX9A 1MU0A 2VJBA 1VE6A 3WK8A 2I78A 2WTNA 5A71A 4FLMA 1XZJA 1CV2A 3HLKA 3HYSA 3V9AA 3AZQA 1GPKA 2WJ6A 1BCSA 4Z49A 1QGED 1ODSA 2BJHA 4KRXA 3LLCA 3RK4A 4UBJA 4E15A 3WI7A 5T4BA 2BUAA 1JT2A 5CXXA 3WK6A 1I6WA 1VZ2A 2WFZA 4MWTA 4QNNA 4Q3KA 3STXA 1YCDA 3E1GA 2XQGA 2BUCA 2HL6A 3IULA 3ED1A 2AJLI 3IIIA 4BATA 2Z3WA 5KWIA 3FBWA 5ALMA 3DYVA 4ITVA 5T4HA 2WHPB 5AKXA 1DWPA 1VKHA 2WSLA 4ROTA 5JZ9A 2OXEA 5JD6A 4B6GA 5DJ5A 3VJMA 5EHNA 3O4GA 4LYEA 5JAPA 5CTAA 1XZCA 4B83A 2GBGA 3TJMA 3CN9A 4DSAA 1EHYA 3QVMA 1DQYA 3ESAA 2GYVA 3EBLA 3AILA 3DJYA 4EBBA 2BGNA 2WTMA 5EGNA 3QPAA 3NGMA 1BN6A 1ZI9A 4GXNA 2QS9A 3YASA 5JIBA 1CUVA 4WDRA 4RE6A 4KYVA 4K6HA 3VVLA 2IITA 5CH5A 1WB4A 5K3EA 2DFPA 1MX1A 3IDAA 3HEAA 4W1RA 3WMRA 1QTRA 4ZGBA 5FPQA 3R0VA 2WIJA 4C88A 2QT9A 2XUKA 3H17A 3W05A 3AIOA 4WJLA 4P93A 4JYMA 4UUQA 3FOBA 5BV7A 4GBGA 3KXPA 1E8MA 4FLEA 4X00A 1VZ3A 1CUZA 4AMYA 4QDZA 1XZGA 3FLAA 1JMKC 1JI3A 1THGA 2WUEA 1CUJA 2OQIA 1U65A 1LGYA 5ALWA 2QOEA 4TPKA 1R88A 3S8YA 5CT8A 3BIWA 2HADA 2ZYRA 4BE9A 2ZSHA 1UWCA 1J06A 3ICWA 3OC0A 5ALEA 4U2DA 4UBMA 1UKAA 4LXHA 2G4LA 5EI5A 5JARA 1FFAA 1P0IA 1XLUA 4AX4A 1AKNA 1JJFA 2WM2A 1XKLA 2AXEA 1M33A 2WIGA 3VDXA 3F97A 2HA7A 4HTAA 5ESRA 1EXWA 3H1BA 5HKAA 2PSDA 5FV4A 1P0PA 2Z5GA 4FNMA 3HABA 4GLBA 3AUKA 5ALUA 2P8SA 4X7BA 3M82A 2JGEA 3QMMA 1TK3A 5HF8A 1E8NA 4FBLA 5IVHA 2RAUA 1UZAA 3TEJA 4J7AA 1K8QA 4WFJA 2G5TA 4YX9A 4H7DA 4UHHA 1QOZA 3ANSA 1U8EA 2RI6A 4BZWA 2HU7A 2J3DA 4IO0A 4O08A 5ALXA 1Z68A 4YK7A 2GBCA 3QITA 4BVJA 2DHEA 3RKSA 2H7XA 2I3DA 4PW0A 2VTVA 1CVLA 3LCRA 5ALVA 4J03A 3PICA 5FRDA 1MNAA 1TCCA 1XZEA 4PSCA 3F98A 4CIBA 2VATA 2C7BA 1LNSA 2CEKA 5CT5A 4U2CA 1AZWA 5JATA 3D2BA 4FDMA 4B82A 5EHXA 4HRXA 5ALKA 3E4DA 4L9AA 3C6BA 5JASA 5DNUA 5DTIA 3VJKA 3WWPA 3G9TA 5JAUA 5JD4A 1QIIA 1LBTA 4G4JA 2JGIA 1MO2A 3ANTA 2QJRA 3ZLUA 1E8DA 5JYCA 5C81A 2WQZA 2O2IA 4Y7DA 4EY8A 3I1IA 3I2GA 3DD5A 5JD5A 4UHBA 2H7CA 4CG3A 1N5RA 1KU6A 3DNMA 1EVEA 1FFBA 1WCYA 2XDWA 4X92A 3H18A 4KE7A 3EIOA 1XZAA 3B5EA 4ZV9A 1USWA 3IBTA 5CT6A 1N8SA 1XRNA 4I4CA 5HF5A 2QMQA 2GZSA 2XLCA 2FJ0A 4WY5A 1XQYA 3STWA 5LYYA 1GZ7A 1CR6A 4UBKA 4DMCA 3I1YA 2AJBA 5CURA 1R9MA 3KSRA 3VKFA 2PL5A 1ZICA 4H7IA 4FFVA 3MUNA 4J3JA 4MYDA 3JWEA 1ACLA 1UK7A 2WKWA 1ZGBA 5ISMA 4PO3X 4JEIA 5LZ2A 4LXGA 3PUIA 2VSQA 3GUUA 4AB1A 5HK9A 3PF8A 1MX5A 3RARA 3HXKA 1EDBA 3C5VA 3NUZA 2J3QA 1W4LA 3M81A 4L3WA 2WIFA 5KREA 4CCWA 4GDMA 3BJMA 1CUFA 3R3ZA 1G4HA 2AJCA 1LPBB 2XB6A 4BCBA 3V1MA 2WFLA 6YASA 2C5FA 3H19A 3P2MA 1B41A 4BP9A 5C8ZA 4FMPA 4LHEA 2YH2A 4N5HX 1CUGA 4F60A 3GROA 4RE5A 3OOSA 5EHQA 1WB5A 1CEXA 2HA4A 1IMJA 1RWQA 1EVQA 1CUBA 5I7UA 1DT3A 3DKKA 1HPLA 3C6ZA 4CG2A 1Q84A 2QRUA 3FSGD 3FVRA 1MTZA 4NS4A 3WWCA 5D6OA 2GBFA 2PM8A 4DM7A 4N5IX 1XRQA 1VA4A 3AZPA 2ACEA 1OILA 2OCIA 2CUTA 2HFKA 1CUAA 2OAEA 1S8OA 4OU4A 4OD0A 2DSNA 2B20A 2VJDA 1CIJA 1DT5A 1UT6A 2Y6UA 5I9IA 3AIMA 5ALGA 1DTEA 3N0TA 3V48A 2ZJ6A 4X85A 2HA3A 3W9UA 3B3QA 2PVSA 5AK3A 4C6HA 1CUWA 3DKRA 4BRSA 1YAHA 3WK4A 4A5SA 1MT3A 4B85A 2B61A 4UBLA 4CCYA 2DQYA 1LPAB 4A23A 2Z8XA 1HDEA 4WDQA 5IH7A 5AK6A 3G0GA 4OPMA 4Y2RA 4UHDA 1UK6A 4G4IA 4DNFA 1VXOA 1LPMA 1MPXA 1XZFA 3WKDA 2LIPA 1DX4A 2OCLA 3IA2A 3WJ1A 1HBJA 4X6UA 3DYIA 1QTIA 2BAGA 2ZYSA 5I8PA 4F5ZA 3DCNA 5AKJA 4QEKA 4W1SA 2V96A 3A70A 5LZ5A 1TQHA 1ZI8A 2H1IA 3QPDA 4FKBA 3DLTA 1GQSA 4AN0A 4QWMA 5T4FA 5FPPA 4FLFA 3UUEA 2J4FA 4X95A 4Q34A 5ALHA 2EDAA 2W22A 4BCDA 1F0PA 5AM1A 3WZMA 4YASA 3ZLTA 1GXSA 2WHRA 1W75A 2XQJA 4RNCA 3BDVA 1IZ7A 1WM1A 1XRMA 3FCYA 3O95A 3TGLA 1ODCA 5EIEA 5H3HA 2DQZA 1JMYA 1AUOA 4F21A 1ZD4A 3QMVA 4FTWA 2HU5A 4PSDA 4PV7A 2BCEA 1YAJA 1VOTA 5LKRA 1QIJA 4AXBA 3H2IA 1WPXA 2WHPA 4J0JA 3OM8A 4E14A 1G5FA 2Y2UA 1A8SA 1X2EA 4IH4A 5ALFA 3BJRA 1XZMA 4A16A 4ZXFA 4OCZA 4QA9A 3R40A 5HCUA 1Q0ZA 4FFWA 2C58A 2QXUA 3WL6A 5K5EA 2RHTA 1C7JA 4C01A 1ISPA 1BCRA 5FKJA 3GBSA 5JZSA 4W9RA 3I2FA 3V1NA 1CUDA 4MEAA 2VT6A 3R3UA 1Q83A 1Y7IA 4X97A 4OB6A 3I2HA 4CI9A 3G0DA 5HKBA 1SOMA 4Q82A 2RIPA 2FX5A 4DIUA 3QZUA 5CRIA 3O9MA 4UHEA 5CT4A 3BF8A 1F0NA 3O4HA 1EB9A 3M3DA 4BE4A 4M0EA 1E5TA 1A8UA 3F8SA 4N8DA 1UOPA 2I03A 1BROA 3RM3A 1SCQA 2WLSA 5IVKA 1ZD3A 1QIGA 3EQ9A 4U2GA 3WK7A 2VA9A 4QWWA 3D2AA 3LIPA 1WB6A 4B0OA 1UFOA 4MYSA 3DOHA 3O4IA 3D0KA 4CFSA 1CUXA 4K5QA 1TCBA 1TRHA 4KE6A 1ACJA 4H0CA 4ARBA 5EIHA 5A6VA 4UPDA 2PBLA 1CPYA 1ZD5A 4C89A 5FDFA 1OXMA 5DYTA 3G0IA 1TCAA 5LLSA 1TIBA 5E2IA 2C0QA 1QFMA 2PU5A 2CB9A 2V98A 4G5XA 2UZ0A 2W6CX 3ZWQA 5ALJA 4UFNA 2C0PA 5ALPA 5K3BA 3FYTA 1HLGA 4N8EA 3C87A 1J1IA 2X5XA 4H7FA 4V2IA 3WK9A 3RLIA 1K63A 3AJAA 4ZRDA 5LP1A 5AKGA 5ALSA 4G8BA 1HL7A 5AKIA 4B80A 1QJ4A 2Z8ZA 1W76A 4C4YA 4J0DA 3WL5A 2ZVDA 3STTA 4B9EA 4MEBA 1CUUA 1CUYA 3PFBA 4I19A 5AOBA 3JW8A 3E0XA 1P0MA 4AO7A 4BTLA 2QM0A 4IHAA 3E3AA 1EI9A 3LP5A 2QZPA 1GT6A 3F67A 2OQVA 5JZBA 4H77A 2XMCA 4QDOA 4OB8A 4QDXA 5HFAA 3PI6A 4CCYB 1PV1A 1WHTA 4TGLA 2HA2A 4ZWNA 4EY7A 3R3WA 4H7JA 4QDTA 5AJHA 5AIAA 3WKAA 1MJ5A 3H1AA 1QFSA 4EY5A 3WKEA 3U0VA 3B12A 4KJXA 1FFCA 3AIKA 3IUJA 1LZKA 3WL8A 1LPPA 2AJDA 2QKYA 4EHBA 1E3QA 4BTVA 5AM0A 2XMRA 1DU4A 3QMWA 3H2JA 1DWQA 2XQFA 3FYUA 3GELA 4BB0A 4GECA 1Y7HA 5AI4A 2DHCA 4HXEB 2GZRA 4H7EA 1H23A 4ZREA 3CN7A 4Q05A 1XQWA 1A8QA 3K6KA 4GWLA 1LPOA 1IUNA 1F8UA 3T52A 2J4CA 5D3ZA 4LXIA 1YR2A 1ODTC 1VA5A 4OU5A 5LKAA 2X76A 1Y37A 2GBIA 4FBMA 5DWDA 3QM1A 5DTJA 5AKHA 1UKCA 5AKLA 2CBGA 3R3XA 1QZ3A 4BCCA 1YA8A 3G9ZA 3K2IA 4GW3A 3BWXA 5AKEA 3KD2A 4W63A 3BXPA 4EY4A 5BWCA 1QIDA 2PKYX 2WU3A 1SCKA 4DMFA 2QR5A 5AO9A 1UK9A 4WFIA 2VF2A 1XZLA 3FVTA 5ALDA 3A2MA 5ALZA 1YSCA 4OSEA 5AI8A 2FJPA 3SWWA 5T4EA 3GA7A 5DYWA 2IIVA 2OLEA 3F96A 1AGYA 4QLOA 1XRLA 3ESDA 4HXGA 1W1IA 1T4MA 4NMWA 1PJAA 2R8BA 2XE4A 4NVRA 4XIIA 3G9XA 2C4HA 5JANA 4H35A 5E4TA 5AIBA 1H2WA 4JNCA 1CUSA 1QIKA 4DGQA 4HAIA 3WA7A 3G7NA 2Q0XA 5SYNA 3DOIA 2VAVA 1LPSA 2OGSA 5SYMA 1X70A 3FAKA 3QYJA 4C4ZA 1T2NA 1R9NA 3STUA 4MQMA 4Y2SA 3EQ8A 3CXUA 4DLNA 1DX6A 5FXMA 4GI1A 1UK8A 2WJ3A 1XRRA 3WYNA 3WIBA 5AP9A 3ESCA 5ALTA 2JBWA 4Q1VA 4AZ0A 4X93A 4G1FA 3FCXA 3H2HA 3WWEA 5AM3A 3VVMA 3HC7A 2XUJA 3ZV7A 3UUFA 2PSEA 2ZJFA 4BAGA 5YASA
chains in the Genus database with same CATH superfamily
1XCJA 4JC8A 4KV9A 3EGXA 1TGVA 2H08A 2Y1KA 1E6EA 2IA5A 1TKRA 4ND3A 2GLUA 3GN2A 4HFMA 3OTWA 1YZTA 1J22A 3L77A 3MOIA 4LOAA 3ECSA 4OQYA 1OFGA 1SFRA 1S0UA 4HLUC 4G9GA 1I2AA 4I1SA 1ZGCA 3KDSE 3GD5A 1P1IA 1EB8A 1OAOC 3HWSA 4NG4A 5H4GA 1CIVA 1RLIA 4KSCA 1O97C 2RGRA 1JWAB 1B00A 1X94A 3F9IA 3ER8A 1ID1A 2AMVA 3RTCA 5EKTA 5ADVA 3MJCA 1G3RA 4GVXA 1JSZA 1Y6RA 3VH1A 3X43A 3I34X 3K9FC 2PS9A 1UOOA 3UPUA 2WKQA 4IO1A 4M37A 4WH0A 5TY0A 4CMIA 5KHLB 1ZC4A 2QM3A 4WZAE 4V0KA 1N78A 4KMSA 3ZOKA 2ACKA 2J7KA 1JG4A 2UYGA 3DTVB 4NCNA 1RXIA 4MVJD 3X1KA 3A14A 1QO0D 3T95A 3WQHA 4HXFB 5EEGA 2PRSA 4I8IA 4HG2A 3OOEA 4C30A 3SP1A 2ZM5A 3TFOA 5CA1F 4B7CA 3ZU3A 1CHDA 1J0EA 3A2LA 4RZIA 1OYOA 4S0ZA 4D9CA 1QGDA 2GXQA 3L4BC 4MUGA 4IJMA 2JH9A 4AU1A 2BI8A 1Z6AA 1Q1EA 3MWJA 4CJXA 5AOVA 3ZWYA 4JX8A 4B3CA 4EHHA 5FTJA 4HYQA 9ABPA 4P7GA 2AKAB 1SWWA 3FOWA 4KR0A 3NHAA 1FTQA 1H1LA 1K5GA 4XZ3A 4E4TA 2O3UA 2WP0A 4HUQA 2H0QA 2BFEA 3G5LA 2XGOA 2BF4A 2XIQA 2NTEA 3D4NA 4OJQA 3Q1KA 4DJEC 5BN1A 4BO0A 3PIDA 3OMLA 3P2EA 4P53A 1Q57A 4MR9B 3U31A 3KLOA 2ZJ3A 3ITKA 5D5HA 2J32A 4RLQA 3LWZA 4UVIA 4RSMA 1R5NA 3A6JA 3T61A 4DW8A 4Y2GA 1L5NA 4DQKA 3QVVA 3B9BA 4HEHA 3FWPA 5CHYA 3JD0A 5EZYF 4II3A 4X6XA 2BHSA 3B9PA 1UFVA 3LIIA 3NWJA 3QBTA 1XZHA 4O33A 2QUBA 3SDZA 4U2EA 1Z6GA 4ARSA 5JEEA 1P3JA 1J8FA 1GA4A 3MELA 2JFZA 1MD9A 3FWNA 1DQZA 4RW0A 5E8RA 4AO8A 4B71A 1F4LA 3B8EA 5FYDA 1FPQA 1PT7A 2W2LA 1LV7A 4XM0A 2G5CA 4C2BA 2CC2A 2WUVA 1E59A 4CNBA 3PUWA 5TARA 3FNQA 1Y1TA 4FZRA 1IJBA 1E2GA 1Z9BA 4CT0A 3G5MA 3IQDB 3KJQA 2OFXA 3FBTA 2QJTA 4KIUA 4B46A 1Z2DA 3QUBA 5DNDA 3L0YA 2RK6A 1KXZA 5I7WA 1TRKA 1P4JA 1ZLXA 4O4LF 4S2EA 4C5CA 3AF5A 4IH1A 4ND8B 4F8YA 2A4MA 3V8QA 1D07A 4G25A 2V7VA 4GAEA 4XVCA 3BMOA 4JY7A 2P91A 1JZQA 1N7HA 3QRWA 3WXMA 2Z5VA 5GZ6A 4MQBA 2A1TS 1YQTA 1TW2A 2HRZA 3C3YA 3ITDA 1DZ3A 3QXHA 5IDQA 5C8YA 4TTTS 3KJGA 4IUYA 4POAA 5D1HA 4OJKA 3TOCA 1QHSA 1Z5WA 1KEVA 1NVUQ 1WMEA 1QVWA 2ZAGA 2ILTA 5FYQA 4KXXA 1FNNA 3QJ5A 3H3JA 2OXTA 3RSQA 1QVAA 1D9ZA 4OQNA 4U2FA 3SS8A 3TQOA 4LRWA 4RHFA 3O2NA 4I1RA 8AT1A 3JR3A 4GFDA 1YI1A 3H9GA 5CH8A 4RTJA 3VHQA 1QRRA 2ERCA 3LS2A 3QW4B 3B70A 1P9NA 3AR7A 5E9JA 4QPZA 3TRJA 4DQDA 4BP8A 4MI3A 2XBMA 1ODKA 2EC5A 4H0NA 3V2IA 1JAZA 1GPNA 1RZ3A 1TA0A 1XQ1A 4TM8A 3CCBA 1SHZA 3K71B 1Y5NA 2HY7A 3ETJA 3JD2A 2BT4A 4AN4A 4DJTA 2ZB8A 3L84A 3AEZA 3DM9B 1ZMOA 4N3BA 1F4PA 5KYWA 1T0IA 3GP3A 2JAOA 2IWRA 2XT0A 5IKEA 4H18A 1EVLA 1P33A 1OWOA 3K1JA 1WQ1R 1GTMA 1KC1A 3R7WB 3TXYA 2PNFA 4N8SA 2XMZA 4EPTA 5FOXA 3MD9A 3NBYC 4RVSA 1K2VN 2R8OA 1K8XB 1UDWA 4YRDA 4L08A 1SUBA 1XZQA 3GQVA 2FW6A 3I42A 2Y77A 2R1VB 3H5IA 4D7AA 3B38A 4DRYA 2IZ6A 1NQWA 2R9VA 2HFJA 1U90A 3E15A 2I7DA 3BJEA 1OPXA 4RK1A 4XVRA 4LMAA 1SUSA 3IDSA 3KEGA 1TI7A 2AFHA 1MDBA 3F49S 4FYHA 3GWZA 4INJA 4DLZA 3RYIA 1U6KA 1DZIA 3ZQUA 5SZKB 3K0KA 2PNJA 2OOSA 4YDQA 5LPNA 1GA6A 1S2LA 1V9CA 2Q1XA 2V6BA 3PE4A 2OLKA 1QO9A 4J0IA 4A82A 2PRIA 1GTZA 3AHDA 4P3NA 5FI3A 1V7CA 4I3HA 1NU6A 5BSRA 2JLWA 4CM8B 1AS0A 2A33A 5KYTA 1OYYA 1QR2A 2GK3A 3IBGA 4UTXA 4UFPA 5MFZA 4LIPD 4LYDA 1H9AA 2R751 2ADOA 2Q4DA 3KEFA 3UVEA 4H17A 4L9SA 3U49A 2OBYA 3SC4A 2Z95A 4INZA 4YAOA 1X6VA 3S40A 4OMFG 1RWOA 4M9RA 1N2OA 2XKBA 2HX1A 1R4NB 2GXUA 1H2RS 2NTVA 1QH9A 3TPCA 1QBGA 1MB2A 3G2JA 4LWOA 1B6RA 1RI5A 1SKYB 2JH8A 4XQCA 3KKEA 2NZXA 3G8AA 1R74A 4OQMA 3W5SA 1PCXA 5KYNA 3UJNA 1W5AA 1OMOA 1WO8A 2GXAA 2VOEA 1CUHA 1EG2A 3ADKA 3CINA 3DUFA 2RHCA 4YMWA 3RC9A 1XRPA 5F5LA 3IB6A 1N6LA 4NOKA 1G8YA 1SBCA 1VHTA 2F1OA 1G66A 3NNSA 3M34A 4E07A 4DR4B 5I8WA 3U39A 2O23A 2H2GA 2P9CA 2YNMA 5EQDA 3PDWA 1E92A 3AETB 4KPUA 2XCTB 2PUCA 3WMFA 1MVNA 4MQEB 1RQXA 4M88A 3H1TA 1OXBB 2J6HA 4U1RA 3VPBA 4N6OA 1LX7A 4MUEA 3TIIA 1B0AA 4YJ3A 1K06A 1J99A 2AN5A 2VYVA 4KO8A 4OKSA 5EMMA 3SLGA 2ZR0A 1NLZA 2OAP1 3WHPA 2K87A 5JSZB 3R3VA 4RVFA 3WWOA 4XI9A 4GEKA 3DS8A 2HI0A 3GZJA 3WYBA 2PUGA 1Y3AA 2ZI9A 3K4HA 1AMNA 2AVNA 5JS6A 1OR8A 1WPRA 5F9HA 5FHQA 5HF9A 2AK2A 3ANMA 4IDCA 3ZE1B 4B81A 3UH1A 3GUVA 2CF5A 4MRPA 2AEMA 3QOFA 4MCIA 4OXXA 4K7JA 4Y30A 5K0NA 3H11B 4A92A 3NALA 4RELA 3AXSA 1QDEA 3WGGA 3CJTA 3GQBA 3DZIA 3SSAA 3PDHA 1VLZA 2VP9A 1VCOA 3E82A 2AOTB 4FN4A 3R9WA 2DUUA 2XX3A 2YASA 1UBRS 2YWJA 5EMNA 3PPXA 3SZUA 3T1TA 2GNOA 4ZCQA 4ZP1A 2D2FA 3ZZNA 4LF6B 1RQ2A 2SECE 1O9GA 2XADA 2GT1A 1NX9A 4Q3OA 4TT3D 1E2FA 5DM4A 3N2IA 5GY7A 4DQUA 2VRCA 1VRWA 2VN8A 4JCCA 4OKIA 1JBKA 4OMUA 5BSGA 3RVLA 4D45A 1C7QA 3QEMA 2ZWIA 3SS7X 2Q8QA 1FQWA 1PL8A 1U5AA 5KKNB 1F5NA 1CQWA 5BUQA 2PUJA 1QGAA 2QENA 3PF9A 3ZI7A 5ICSA 3PT9A 4Q9NA 3EK2A 4G3XA 4TKLA 4NXNB 4UVHA 1PBNA 4N5DA 1V16B 3FN4A 3EIQA 4IFIA 4UMFA 5HCNA 4QTYA 3CVWA 3ZHTA 1M2WA 4YCSA 2B7CA 1R0KA 1XZKA 2P9TA 4HSGA 4KRGA 1VBNA 4BO6A 1J0AA 4FZJA 4Y7CA 2WTUA 3P32A 2YFYA 5COBA 5EJEA 3GPBA 1XTIA 2P40A 2XUOA 3GH3A 3QFSA 3U56A 2Y05A 4QT0A 2P2ZA 1NBOA 2WPNA 2YYYA 4PVCA 5LDGA 4CW7A 4M1ZA 2EJWA 1HEUA 4UHKA 5JR3A 5CYPA 1T6XA 4O0MA 1MAHA 2I71A 1E6LA 4KRYA 4PFKA 3ZQ4A 4PC1A 3O1IC 1N6OA 1YU9A 4A1OA 4PLYA 2ECOA 3HCEA 4Y9SA 3EXFA 3FGOA 3EZLA 4C4PA 5J2TB 2CNKA 3MTBA 4PS1A 1ZQ9A 4CVNA 1H0SA 1TAHA 1E1QA 4KH1A 1H6BA 2QG9A 1AUVA 2QTHA 4OHPA 1IBCA 2YS7A 3R3YA 1PQ4A 2Y3IA 4YAGA 1ZNWA 1T6ZA 3QKUA 1D1TA 3NS7A 4QFCA 4UW9A 4EB3A 5LDDC 1ISIA 4GWKA 4CLDA 1J2TA 4JBWA 3QI2A 2X13A 4MMXB 2GN6A 2O4UX 1WY7A 4CEHA 2A94A 3OI7A 1V1RA 3RVDA 2FXVA 4M53A 4KN8A 4D97A 3HZOA 3WGQA 1CF9A 1E2MA 1O97D 2QTLA 3LH5A 1TZJA 4HRVA 5JFTA 4C87A 2X0FA 1T0HB 2H7VA 2QD3A 2VA8A 3I9LA 5C7YA 4MP6A 1VG9B 3IO5A 3OTQA 4Y0AA 1CEYA 3ELUA 2HQ1A 1R8JA 3BFPA 4RS4A 1TU3A 5KVSA 2CMGA 5IXJA 1O08A 2P4UA 4TYPA 1JJAA 3ADOA 1UZLA 3EMVA 3QBDA 4CM6A 3H5VA 2VUSA 5GOTA 1N34B 4FYYA 4AY6A 4ZT2A 1YNSA 2P2GA 5BRAA 1UJ2A 4HMPA 4P54A 5E4YA 3WO0A 1Z3CA 2BEVB 1JILA 2NUTB 1GN8A 4LECA 3UAVA 3PYXA 2NVOA 3HN7A 1KY4A 4P2GA 1KERA 1ADCA 4YUAA 1XIVA 3H99A 3JZIA 5JWHA 4PNZA 2ZYHA 5HZKA 1BCRB 3RVMA 4ZAVA 4BAUA 2QQEA 1E1QD 1K66A 4YLEA 1QRAA 5EE0A 1S3IA 3WP0A 2ZYAA 4EQ6A 1NUQA 1DO0A 2A30A 2RFLA 3PB3A 4ANFA 1V39A 4NL4H 3PRHA 1RVDA 3CMCO 2BFDB 4RQTA 1Q16A 4WCFB 2EJTA 1C5KA 5LZ7A 5BOSA 3OEWA 4TLBA 4DSNA 4FK8A 4DF3A 3AM1A 5FIUA 3DAYA 4GRDA 1BRTA 5HWSA 3C45A 5CW2A 4IRMA 5K3CA 5IM4F 1YQXA 4X94A 1Y0BA 3OKFA 4KQFA 2ARKA 4GYJA 4MA5A 4F97A 5I8ZA 2EDCA 1IHXA 4J0GA 4PQYA 6REQB 5JNTA 4MUBA 3PUHA 3R7LA 1KZ7B 3KKLA 2XUQA 3F4LA 4DOMA 4EYGA 1PS8A 2GBLA 1NVDA 1T36A 1D6SA 3EC7A 3L0SA 1XRSB 4DKXA 5KU1A 3DL2A 1AIPA 2D3WA 3I30X 3I92A 5LOVA 2JGMA 1CIPA 2X8LA 3EXHA 1DKPA 3EXAA 2XLBA 3KXLA 1P5ZB 3KVYA 3MGKA 1RM5A 4FCCA 3QF7A 2PT9A 3AEKB 4LTDA 4AKSA 4YJHB 3ZV3A 5EIAA 2P77A 1LA2A 4BIIA 4EGJA 1I3MA 2QTZA 4JBYA 2P3LA 5FP0A 1VLVA 4UD2A 3UUGA 3DEIA 1F2UB 4ZALA 1YMVA 2P0AA 2W2OA 3N58A 4KCGA 3FF1A 2ZSJA 4YJ2A 5B2EA 2VZLA 2CKMA 4D41A 5JTTA 1GIAA 3IQFA 3SBDA 5AHXA 3PEFA 5C4GB 4C3OB 1T1EA 1Q44A 2DHQA 3ECCA 1R00A 5F51A 2NP6A 1P77A 4ZO4A 4Q7JB 4HATA 5EPOA 4QU9A 4DRXB 3ZYCA 1EK6A 4UUBA 1R37A 4AMUA 5FOQA 1DJMA 5A9RA 1EX1A 2XDAA 5HGJA 3WRVA 4Y67A 1JHXA 5A3SA 3CNQS 5DOZA 2QTMA 2IGTA 2ZEJA 1JKMA 2P5YA 1V2GA 5EKSA 5EY5B 3AXTA 1GG8A 4GR4A 1IXZA 1DIGA 3GPCA 4XEUA 2IHUA 2IKSA 3KXKA 4JK3A 2PZAA 4M0DA 5DDIP 1YJAA 2HB6A 3C1AA 2IYZA 3PWKA 3L0OA 2G70A 2HU8A 1DQRA 4KE8A 3A9VA 3OLYA 4JJ8A 4EECA 1EWKA 3H42B 3KXDA 2RGUA 1W96A 1E2PA 1NXSA 1IU9A 4XJVA 3K0HA 4OEHA 1QIHA 1VE5A 1XZIA 3IVMA 1J07A 3J7TA 4GSYA 1U8FO 3ZWWA 1OXUA 4G41A 2HK6A 3ZHBA 5TMPA 1UQTA 4IGKA 1KYTA 3D3QA 3L7NA 2HDNB 2KPOA 2Q2QA 3MIIA 3HZZA 4ENVA 4ABTA 1KQPA 1HQCA 3FJ1A 2RKBA 1EX9A 4UHFA 1BYIA 1W6RA 3DEZA 5K8CA 1U9IA 3R5JA 1R1DA 3GJ5A 3B1FA 1EDDA 1W49A 4LZPA 4HDKA 4MVJA 2QN6A 3KVNA 4S1WA 3TR6A 4CUKA 3GLFB 3DCJA 4E11A 3C7AA 2C7VA 2LXNA 4MGZR 2E18A 1SKYE 3FB4A 1XO1A 1OT3A 3FXAA 3R3HA 3PC8C 1KI4A 2V6GA 4G85A 3G8DA 5E7IA 4L5IA 2C5AA 1DAEA 4C05A 3KWLA 2PN1A 2ZSIA 4X3CA 1QCYA 3MCAA 1VFPA 5HJ2A 4CEJA 3A9WA 3PEVA 3VH2A 3GEPA 4XX1A 4EFMA 2AQHA 3DHVA 5E95A 4RK6A 5ESXA 2Z3ZA 4BFXA 1P4RA 1ZMBA 4F6RB 4XGKA 4E4RA 3ASYA 1PGPA 3PUJA 1K89A 3OO0A 1MN6A 1PFYA 2I22A 4YACA 5JMOA 2R47A 5AM5A 1A4IA 4NH4A 3ZY4A 1UP6A 3ZGZA 3LG2A 1LFDB 3ZU6A 4EFDA 1XMQB 3JRXA 3RRNA 4JS0A 5EC8A 1SUPA 2XUGA 1JHAA 1XD2B 3ERCA 2REQB 4QE3A 1RYYA 1Y8RA 3QTLA 1TPYA 2ZDGA 4GNKA 3BXEA 5C1DA 1DLIA 1EUCA 3D6NB 3JASB 5DSXA 4RJ2A 1ZJ4A 2G63A 2PJDA 4YMHA 1BX1A 4QXAA 2P1RA 4CEJB 3CRRA 3GXBA 3I0MA 4HNHA 3BULA 4AULA 1EGMB 1YBHA 4RAOA 3WJAA 1IMOA 2NIPA 3VI4B 5KU7A 3CLTD 4JC4A 3VOSA 1S3SA 5ALYA 4J7XA 3TW4A 1YNOA 4UNSA 2RE8A 1MJGM 3ZXXA 3GPDG 1EFPA 1DEAA 4B40A 4IWXA 4G5OA 2JVKA 3D7RA 1FRZA 3JARB 4MZXA 4P4SA 1X1TA 4KMOA 1CHNA 3E5RA 4MR8B 5H9VA 4D8XA 3BIXA 1C9KA 2ODTX 3QOXA 3D7NA 1V95A 3ZD6A 3H16A 1PZEA 1UEXC 2VP3A 2D5LA 3KUXA 1KZHA 4A4DA 5KHOC 4DV7B 2BR5A 1KEZA 3KUDA 3R4CA 2QZSA 2WHYA 2JCXA 4IZOA 4BZXA 4MTLA 4DUZB 1E5XA 3UYKA 4URFA 1T9AA 2ZQZA 2AYXA 2GYYA 5GOZA 3UK6A 2BL4A 4HDSA 2XUHA 2G6TA 3Q98A 3D59A 2O06A 4ZQEA 4O63O 3RRXA 5KQLA 2AGVA 4EUSA 1KQ3A 1YQDA 3ULKA 2C8VA 4C21A 2VJAA 2AT1A 5AOAA 4XWOA 1ZM3A 4LKOA 1L7AA 4NIMA 1DJNA 1TC2A 5IT5A 1IVYA 4XLLA 4H1TA 3NTOA 5AK5A 2HRQA 3QNWA 2CDAA 4AQDA 4LC0A 1OLUB 1RMQA 1M6NA 4K0RA 1C1YA 4BNYA 4EZBA 3RS0A 3BDIA 1TUBA 4RS3A 4XPZA 2H7YA 2MSDB 5LLTA 4P98A 3LXXA 1LBSA 1E1KA 5BSVA 5A4AA 2ZXUA 1D6MA 1YOVB 5CXUA 4FE7A 1LQTA 3CO5A 4F5WA 4N39A 2WMDA 5HQJA 1Q2XA 1ZP6A 2H1RA 1RMTA 3D4BA 3EC2A 2OPHA 3GRKA 3HUDA 5JJBA 3NBKA 5DWVA 4ZYWA 1XPOA 3RYTC 1ZS9A 1RWPA 4OM7A 4BB9A 3KTDA 4P31A 3WVNA 1PG2A 3RJ5A 1CE8A 4DBZA 4XM1A 4FM9A 2WIDA 1NC3A 2AJ8A 4W1PA 3A6ZA 3UV6A 4PYLA 2ZDQA 2B4KA 3A3KA 2RB5A 3FGZA 1L8XA 3RNOA 2WBLC 1FXWF 2B4QA 1DPGA 1M2EA 1GZ6A 1ZD2P 3N6XA 2H2IA 3PHIA 1EXVA 4WRRA 2X3FA 4XLTA 5H82A 4EJSA 3FNEA 1GPYA 1AQ6A 2PAAA 5H68A 5KTPA 4ZJUA 3A1WA 3L01A 4I8DA 1CS0B 4ZV4A 3K5WA 5CJPA 2YJ5A 4GL4A 2BN4A 4R8SA 5AI5A 2XW6A 2R6ZA 2V59A 3P27A 3M83A 5DBIA 5KJ1A 1BDHA 3F74A 3OC6A 3ETGA 7ABPA 1IPFA 1PO7A 3ZVMA 3H2GA 3MXTA 2VPQA 4GG1A 3D9QX 3F6RA 1ZH0A 5BW6B 4HDKB 4HVAA 3E1SA 4LDAA 3L8YA 3ICVA 1C4XA 3BSYA 3CBGA 1E1CA 4IDNA 4J6FA 5DBEX 4RVCA 3I12A 3LL4A 4IHKA 1LDBA 4FIZA 4WFKA 3BK1A 3IUMA 1BXRA 1SKUA 1LBQA 3NHBA 1L5OA 3HKBB 2PDAA 1M34B 2HCFA 3AR4A 3DL7A 1JQKA 1IN5A 2V0CA 3GX1A 2VPTA 3GJQA 4QODA 1B0PA 2WYWA 3OJFA 5BR8B 1GUZA 3OF3A 3DM5A 1U28C 1HE8B 1TVKB 5ALOA 2C5GA 3NTVA 3IVXA 3EXG2 1MIOB 5ALRA 1SUWA 3VNUA 1H2BA 1UMDB 5EFZA 5AHOA 2F9LA 2CSUA 3KOUA 2OGZA 1HETA 4F1WA 2OBNA 5CM9C 2X0IA 4NMHA 1KDYA 3RLFA 2C7RA 2PSHA 4M0KA 4X54A 3C1TA 4H1VA 2PMBA 2DQ4A 5ANRB 2RC6A 3Q9LA 1GXSB 2AOXA 3HGQA 3TIGA 4OHKA 1AOXA 1JE0A 5INTA 4G1VA 1H2XA 4DMHA 1DC4A 2QI9F 2A3NA 2HA0A 3RJMA 1BU5A 1X3SA 4H0FA 3ABRB 3CR7A 4PPQA 1YRBA 3OU6A 1ETHA 4DLUA 3RBAA 1IDOA 1V7ZA 5B4TA 1R27A 1WXIA 4WE3A 1W4AA 3PD0A 4Y9RA 4BO4A 1P45A 2FW7A 4JP5A 1NJ5A 4YRBA 3R7FA 2P5UA 3W3AD 1QU2A 4L74A 4LYJA 2PQMA 1BQ4A 4MAAA 1FDWA 2O5EA 1VGQA 1TZBA 4ZVSA 4UAJA 2PGAA 1JJ7A 3QY0A 4JQOA 3IQZA 4JBXA 1SB8A 2UYYA 1X1SA 1URPA 3KQYA 2HWUA 3CIFA 2ZAIA 3FLBA 3EFHA 1V45E 4OHUA 1EDEA 5DOVA 3LL7A 2GCNA 3V7NA 5SYAA 1Z4NA 2IYVA 1FFDA 4RQBA 4WGGA 2V97A 1Y9EA 3KOWA 3AHFA 4AROA 1BN7A 1SU8A 2TSYB 2UUPA 4Q7KA 5T57A 4QU8A 1JEEA 2A9RA 4JUBA 3W7BA 4EKIA 1VI5A 4MUIA 2E87A 3PZRA 4AWXA 2IYNA 1XNJA 3QFTA 4BRWA 4FHFA 3SBEA 2CHGA 3AOEC 3ZXYA 3C2QA 4CMHA 4I4TB 3T3HA 3DE7X 1M1NA 3DXZA 5JSFA 3LZ6A 1KMCA 1JXAA 1I8TA 2WPDD 2Q49A 3UJ8A 3W06A 5K8LA 1PD0A 1GU7A 1Z06A 3PFGA 2V7WA 4L0QA 4CFZA 1XB2A 1HUQA 1ULAA 3O84A 2VXYA 1U8YA 4HAWA 2WD7B 4EPYA 4ISBA 1WPQA 3NAQA 4S0XA 1JZTA 3EFOA 4C2AA 2UDPA 1W9HA 5LXTF 2OFFA 4DQLA 2BMFA 1FYFA 3JQEA 3R6GA 3A06A 3X1DA 3ZJYA 5IWAB 4OREX 5KEIA 3GZNB 2WA2A 4B6RA 2C5EA 3UAZA 1KKLA 1C7FA 1OC4A 3N74A 3NGXA 1CQZA 1FUYB 4LV6A 3OECA 1X7ZB 4NZMA 2CCKA 3K0FA 3K8YA 5I48A 3U44A 4AJJA 2TRSB 1A50B 2QU7A 1RR6A 4FE4A 1GRCA 5DLQC 2QP9X 4AF8A 4XFJA 2YDXA 2DE0X 1JIKA 4D5GA 5C1BA 3VJLA 3AJ8A 3KQPA 1T4DA 3QUSA 4OAQA 3BGIA 3RWOA 2Q1UA 1P18A 3C85A 3FTPA 2H11A 1U3WA 2WVHA 1EQ2A 1WL8A 5ARDA 4AXXA 3RADC 2WDPA 4RPCA 2AD1A 4E46A 4B6FA 3FRJA 1G20A 2GRAA 1WD5A 3SSOA 4EBFA 3ABZA 2D1TA 2I4MA 3GLHE 3DG9A 4AG5A 4BQIA 4JJ7A 1R0SA 4MS1B 3WMEA 1SVSA 5BSKA 1YS1X 3D4LA 3H5AA 3TCXB 4WOKA 2G9UA 2VL7A 4YQFA 2GBPA 4XGIA 4HGYA 4CNQA 1DTWA 2OE2A 2XRFA 3HM9A 1PR0A 3UC9A 3NV9A 1L8AA 1MOZA 2I33A 1VCNA 3FSJX 2LGJA 1TAGA 2ATVA 5KCMA 1LW6E 5DW0A 1Z2CA 3E9MA 1T1JA 2TYSB 1HYBA 1VMAA 2H6EA 2XMSA 5L3RA 2D5CA 4E6PA 5HMMA 3I01M 4WY2A 5A4JA 2D0DA 1NMZA 2YMPA 3GJ6A 1PQPA 3BJIC 3CX3A 3IELA 3OQIA 5GV8A 3OX3A 4JSRA 3CE9A 3IA7A 2VNJA 3IP8A 3M5WA 4ZVRA 1M0TA 4JEMA 3I9FA 2R00A 4HTFB 1GGNA 4NFHA 2PUEA 1KGDA 1NOJA 1PZFA 2GJKA 1FUUA 2HMWA 2I1VB 3W5AA 1GKYA 2JK0A 3I58A 1FQJA 2WILA 4I55B 1NNEA 3OZFA 4X1OA 1KJWA 4Q19A 4MRMA 3AFIA 4RIGA 4DV5B 1DX9A 2J07A 3EPRA 1NZJA 2BMWA 1E58A 3F73A 2P9BA 3PFCA 1FUIA 1TYDE 5A6SA 4I5EA 1L7NA 1I0IA 4GI2A 4WSOA 4XWGA 1BXGB 3T1QA 3I5XA 1JJBA 3N0WA 4QUJA 4YMLA 4B45A 3IEMA 1M7BA 3QQ5A 1JFFA 3K72B 1MX9A 1U3TA 1YB2A 2B2CA 4D0LB 1E7WA 2FOLA 2I4TA 3K6RA 5HEKA 2F7SA 1GAXA 4EAAA 1PKEA 2YUIA 3PWTA 4L6CA 4NJEA 1AM4D 3V4OA 1QQ7A 4M0LA 1SU7A 2FJUA 3CRMA 1WBBA 2NQ2C 4REOA 3BK7A 1XHLA 4BO7A 3EJWA 2Q4RA 4Z49A 1ISRA 3UK1A 2M98A 2LIVA 4RIFA 3D8UA 2BJHA 3EZYA 4D99A 4Y9UA 5B4VA 3QHQA 1VM6A 2FEPA 1RKVA 3EXEA 4YJGB 3UTCA 1JPNA 3ZWPA 2AFHE 1O2DA 2XPCA 4M36A 3BBLA 3I9KA 2EGGA 1S5PA 3CPHA 3UWKA 1VBFA 1X0XA 4B2YA 2FE4A 2BE7A 3HJAA 5T4BA 4DEVA 5IBCA 2V03A 2YHAA 5BUSA 1G8PA 2Q3EA 2FPPA 1A77A 1JVNA 1Y4SA 4LZZA 2Q46A 3FOAA 3OJLA 5G3YA 4EHLA 3B36A 3LQQA 2WFZA 2QYHA 5F21A 3T34A 3O38A 1FP1D 1W2GA 4MWTA 5KTRA 1EBUA 5CX4A 1BWRA 2CHUA 3CZPA 3VYVA 3H86A 1AHHA 3GRVA 3UAWA 2CFSA 2VH5R 1W36C 1HDOA 1JX6A 2XQGA 3F7TA 1K6IA 4I36A 3IEVA 4Z7NB 1DG9A 3KBBA 4DB2A 3MQ4A 3PDUA 1FY2A 3AQ4A 1YZUA 2ZJBA 4C04A 4NENA 4AYXA 4IUBS 3IJRA 4B43A 2X2OA 4YDSA 4BATA 1CC1S 3COZA 4CKBB 5KWIA 4M8LA 4HH0A 2NUAB 4UZSA 3F2VA 1QO0A 3LKBA 4KPUB 5DHQA 3ZJ4A 2FPIA 4G1MB 3PWSA 1G98A 3HO1A 4U0JA 3WGNA 2V8OA 3S7TA 1OZAA 1UXIA 5AKXA 3VZRA 5CIYA 4K46A 1Z0JA 2ZJ2A 2WSLA 4D25A 1HLDA 2DC1A 3BGVA 5JD6A 4AW9A 4EG4A 1NY5A 1CZRA 2G6BA 1TJ3A 1L6IA 1W0KA 3JALB 1P7CA 4H6XA 4ZCPA 5EHNA 3VJMA 5IASA 3TSOA 3NM5A 3MD0A 1CRQA 1WQ4A 2BDTA 3R76A 1IL0A 3QLVC 2YWFA 2XVMA 3Q5EA 3R44A 4O8CA 5CTAA 2GBGA 2W4MA 5EFOA 1XZPA 5EINA 4YN3A 1N32B 1R6BX 2J0UA 3FA2A 5BT9A 1PDVA 3OPYA 4NJOA 3GT4A 4MPRA 1WP9A 3UUWA 1Z4JA 2RK3A 4PGHA 1T0UA 3BHIA 3EBLA 3IAS1 2ET6A 3JYNA 4HZUB 3MWDB 1C4WA 4LMPA 3NHFA 3IOCA 4O2AB 4O4LA 5E9WA 4AJIA 4EBBA 3ZU2A 4GI7A 3NYRA 3IXQA 1M74A 1OLXB 1JZSA 1REQA 3GK3A 1SD1A 2Q1SA 4KQ1A 4YO8A 4G4SO 3SIWA 4NZ9A 5EGNA 2H52A 4KQGA 2K7ZA 1J8YF 1DC5A 1NVWQ 1P75A 2VJMB 1QX3A 4DLBA 5F3WB 2V9PA 5C8DA 3IBYA 1G2PA 2JD2A 1YVRA 4YP9A 1TA4A 1ZI9A 3WOVA 4G4SP 3P2KA 1OFUX 3RIHA 5I7SA 1TFRA 3TW8A 2DPXA 4Q7EA 2WWRA 2PX2A 1CUVA 1LBEA 1S2IA 4RE6A 3BFJA 5DK4A 2W2TA 3R2JA 3RS5A 3RS8A 4JXKA 2ZT8A 4YDRA 3JQFC 4QOIA 4RETA 1U2GC 4K6HA 1QE0A 1RACA 2XAAA 4TSRA 2ABWA 2VF8A 3GGOA 1LDGA 1MIHA 2B7LA 1WB4A 5ER9A 1F20A 1PE0A 4IUCS 3SJUA 2JCYA 4R2WA 2DAPA 1MX1A 3H1PA 3RIMA 3IDAA 2PEZA 3X44A 4B87A 2ZIXB 5HRUA 5A03A 1YT5A 4EPWA 1E9EA 5FUXA 1QTRA 3LC1O 4GKAA 4P86A 4RZ3A 3V8BA 2VFAA 5FPQA 4B7UA 3R0VA 4ZGBA 5KMGA 5ITVA 3B8HA 3U6KA 4PFQA 3RASA 1GPAA 2JHFA 2VNIA 1TE2A 2JA1A 3AKYA 1I14A 2QT9A 1OXVA 3F78A 1GCUA 3FYHA 3HXTA 2BMDA 4XVUA 5D8DA 1NJ1A 2RH9B 3I5MA 3ZHRA 6Q21A 3W05A 2HR1A 1V5IA 3PITA 4WADA 3GR6A 2P9FA 1XK6A 1ZM9A 1EJ6A 3JU3A 1U0TA 4QG7A 1R12A 1IHYA 2JI7A 4R9UC 4Z0PA 3UBMA 3MHPA 5BV7A 3P0EA 2TS1A 1JF8A 1R0YA 2IXTA 4QSMA 2XXBA 2C3UA 3DOUA 4Q4CA 3MOSA 4EL5A 4X00A 1O96B 3SYKA 3WTCA 4BFWA 3DDCA 1DUSA 1RTKA 2HWYA 4AMYA 2RGBA 5K0CA 3U1VA 2O0JA 2PZGA 3RNLA 5ES4B 2JFGA 3FLAA 3QKTA 1AQUA 3BX1A 4EUEA 1JI3A 1MX3A 1XDUA 2ZTSA 2WUEA 4O4HA 1EDOA 3PEEA 3IV6A 5FWAA 3WMGA 5ICGA 2A5YB 4DVGA 2VUHB 4W5WA 3FKSD 1F6DA 1TYCA 3FLMA 1MCZA 1SBNE 2DHRA 2QAGC 4YMSA 1FTGA 4HQFA 1L8QA 1PT9A 1Z4IA 2YQ4A 2HADA 2JJ1A 2ZYRA 1I4OA 3LKDA 4FE3A 4U7GA 3TXAA 3SI7A 2ATEA 5BN5B 1UWCA 3KZXA 2O2CA 3HLTA 3OLVA 2BWJA 2RHDA 3BZUA 4LZWA 3IVRA 1WSAA 5P8WA 2GAFA 2P9QA 4UBMA 4LXHA 4OI4A 4CM3A 2FZ4A 3OBBA 2G04A 1BH2A 2W2KA 5KYYB 3LX5A 3P9PA 1QK3A 2X0JA 3G23A 1TK2A 3PHLA 1AKNA 1P1HA 1U3DA 3BUSA 3AJEA 2X1HA 1QM5A 3VDXA 4EVSA 2I62A 2HA7A 3A6GA 3EVGA 1NQUA 1EXWA 3UG7A 3HZHA 3THWA 1X7YA 5KVAA 2EZ8A 5ENDA 4NK4A 4B4DA 2DECA 4NBSA 4X6LA 4BX0A 5JYEA 4QGBA 5BYJA 2H07A 1G6OA 5IJXA 2M9MA 4PIVA 1IM8A 3WYEA 3GLSA 3RS2A 3U3JA 3U4AA 3EIXA 2A0UA 2FSUA 2H31A 3BKWA 3HABA 3ADPA 4Q03A 2PRKA 2R44A 4GLBA 4IIDA 5U4XA 4ENQA 5J4LA 1F0YA 2K5UA 3OQIB 4QBIA 4COOA 2AXNA 4RK0A 3KSMA 4BPBA 4YLYA 2JGEA 2HWXA 3QMMA 1TK3A 1U7UA 2WOOA 3A4VA 5HF8A 2NVUB 4Q4LA 1KYYA 1NBMA 2G71A 3KZNA 5A3RA 1FMTA 1JDBB 1UMBB 4XAQA 4CFYA 2D54A 3OPXA 3PFNA 1PEYA 5I4CA 1M2VB 4NWIA 2ZJ4A 4BU0A 1MJHA 4REMA 2YVAA 4TWRA 2RAUA 5KIAA 2V6FA 4WK4B 2GEVA 3I09A 1VIMA 3WMWA 5JH7F 3MJ4A 3W8RA 1G20B 3DE5X 3B60A 1RQPA 2G76A 1GV0A 3LO8A 3LPMA 1TEVA 4QUDA 3WLTA 4C0LA 4OI0A 3D7MA 3O8LA 5CB6A 2D8AA 4HEA6 2BFPA 2QLNA 3MCVA 4XB6B 5CA0F 3Q6MA 4ZQBA 1TAQA 4UE6A 1J2RA 3OTGA 2Q9BA 1X7HA 2RI6A 4KQWA 3UAOA 3ZCUA 1ULHA 2JL1A 1JBEA 4HWOA 4O08A 3DTVA 4CV0A 1SIBE 2Y9PB 3LTEA 5BNIA 5L3SB 5GADl 4FD3A 1V47A 2WYVA 3C74A 1T2FA 4EFKA 1ADJA 4Q4HB 3OT1A 1UBNA 4YK7A 2NP7A 3DT6A 2H2WA 2NU6B 4BVJA 1SWVA 4DA8A 3AOGA 1HG1A 2H7XA 1R64A 2ZBGA 1DUVG 4OO3A 4XGQA 5LMUB 2GSWA 4J16A 2BW0A 2IU4A 5EMHA 2VTVA 3KLPX 2QVZX 1NRJB 5EUMA 3LCRA 2O2DA 4AZTA 3BH0A 3NTXA 3OD5A 1FP4B 4J03A 2B4RO 3GFVA 4RPLA 3VO2A 3PKIA 4C29A 4QM6A 4EIWA 4Z9YA 4D4LA 5D86A 4F96A 1DARA 4PHTA 4UU8A 1MNAA 1E2QA 4GOXA 3IDFA 1XZEA 2QN1A 2WD7A 3OEHA 3LDUA 4PSCA 1QFJA 4D98A 5KVVA 4TX1A 2E1PA 2JHAA 1NWHA 3LVFO 4CMBA 1FJGB 5LBIA 3S2UA 1SXJC 4FOSA 5KKAA 4GUDA 2H54A 4D4JA 3KOXA 5B4UA 3GZ4A 3L04A 4UREA 2Z57A 4IGEA 3OQHA 5KB3A 3AK4A 5EZSA 2W2MA 3BEDA 3EF0A 5CYGA 3BE6A 1EIZA 5DHRA 1PFWA 4G8JA 5G1PA 2XZPA 1T8WA 4J3FA 3PHBE 1KBOA 4BLQA 4WK2B 5EHXA 1TU4A 2WYHA 4NOMA 3OZIA 3VC3A 1YU6A 3I04A 2CVQA 1R5JA 4EYKA 5EIBC 4MS3B 3KSBC 4U7HA 1WLYA 4F5EA 4R3UC 2R48A 2O8VA 3HYRA 2ZTMA 3HCOA 4UUPA 2KJQA 2WM8A 4YCJA 2C1EA 1Z6QA 4BOYA 3AT1A 3G9TA 1MRZA 1A9YA 1NJ6A 2ERYA 2AC4A 4AM8A 1LBTA 1DCMA 2ESRA 3LF1A 4B3IA 2N3ZA 4X8HA 1GNVA 1E7MA 2GS9A 5C53B 2ZS9A 3VR5H 2PGOA 4N01A 4Y18A 1T9GR 2NO5A 5DNCA 4KPYA 1A4UA 3K6SA 3ZDXB 3SVTA 2GVNA 3QA3E 4KHZA 1BS1A 4Q3NA 1MMFB 4Y7DA 4DILA 5JD3A 1JDNA 3QSGA 4V0QA 4YGYA 4EABA 4TZ6A 1T5OA 3COSA 2VUUA 1T91A 3PCXA 4HK4A 3RHSA 4US2R 5B12A 1FS6A 6LDHA 3I2YX 3PQDA 4KH0A 2IYXA 1VSQA 1FW6A 1N5RA 2QQGA 1EWQA 2FR8A 3G2QA 3VSBA 1NNUA 1FYDA 4ERNA 1KU6A 3PUKA 3VSEA 1U1FA 3K6JA 1L3CA 2ZUVA 3DNMA 2NM0A 2BZGA 3HJTA 2YOGA 3QBEA 5FTMA 1EVEA 5DXAA 1SELA 1SNYA 4FZ3A 1ELOA 5IW8A 3VR2A 3UAYA 3Q8KA 2XWJI 1YR9A 3QF4B 5J23A 5BXQC 2I3BA 3ND8A 2IOFK 4RWEA 4MV5A 4K81B 3V4LA 1KH1A 2FLKA 3FTDA 4FFDA 1RZRA 1Y1KE 3VYUB 2X6RA 4ZMBA 1RLMA 5CCDA 3IAUA 3OT5A 3LBHA 5ES3A 5L7WA 1QORA 2A78A 4PFJA 1SHUX 4PYMA 1B14A 3ZHZA 4PHHA 3IBTA 4KDRA 4AZ0B 5CT6A 3FD8A 2FFQA 1N8SA 2H1CA 3FETA 3OOYA 4C4SA 4D8VA 3OH8A 1OBFO 2F67A 3IP1A 4GX5A 3EZ7A 4ZVVA 1J6UA 3BB3A 1M1YA 4YP1A 3JYPA 3SQXA 1DBQA 1NONA 1YR3A 4YXWD 2XAUA 4R40A 2FF7A 3D7KA 2CB0A 1DC8A 1XQYA 3PVZA 2OOKA 4YAUA 5LYYA 2NT4A 1C1HA 3V42A 3OZSA 4EZEA 1GZ7A 2HQOA 5BSUA 1ZJJA 2I4NA 1X8JA 3NWPA 4BV3A 2X15A 3DMRA 1YCGA 3H4MA 3FCOA 3MJTA 4LRXA 3TZCA 2YJ4A 3ND7A 1AE1A 1Z45A 1YJBA 3VDRA 5JNVA 2PUFA 3DB2A 2C9MA 1IHPA 3MWEB 2FX2A 2WV9A 2C7QA 4JXJA 2BD0A 2PL5A 2V9CA 1M2FA 5FJJA 4H7IA 4HDRA 2E7ZA 3CHYA 2OSBA 1E1NA 1NN0A 1RRMA 2C8JA 3TBKA 1EK5A 1Q7EA 5JRDS 3RPEA 4BQFA 1ACLA 1RYMA 2VAMA 2WKWA 3AF0A 4G5FA 3P19A 3PR2B 4QU5A 4RGQA 4D4IA 5ISMA 1UKZA 3LWBA 1FK8A 4LXGA 2NZ2A 3PUIA 1NYTA 2CLFB 1JQ3A 3H5WA 1DTWB 4FEEA 1AUQA 4OSOA 4A8JA 3ORRA 3LUPA 4AB1A 2PMWB 3QXJA 2ASVA 3TO5A 3D0OA 3IALA 5F64A 2R1UA 2J7PD 2P2YA 2TECE 3SNHA 3HH8A 3O4FA 1GLVA 4KU4A 2EX4A 3MINA 5K4GA 4MIEA 5AJXA 2DBZA 4MI9A 1NT4A 5F1OA 2IV7A 5BT8A 2GTPA 1E2IA 2N0SA 3DUFB 2HNBA 2NO1A 3H83A 1K08A 2OC9A 2YVLA 2ZT6A 1W4LA 1MGOA 2Z6VA 1EYZA 3ESYA 1NA5A 4L3WA 3X2FA 4JB2A 9LDBA 3INRA 1KFBB 2WIFA 1C8KA 3CEJA 3B3AA 4PIMA 4YV2A 3A26A 1K75A 4ZVTA 4AICA 4DA7A 4BQPA 2XB6A 3TWOA 4MUNA 4EYQA 3CF0A 3SJ7A 3MW8A 4MZDA 1F2DA 1KEWA 1Q2UA 2C5FA 2JAXA 2B6NA 2Z5LA 3CURA 1II8A 3L7AA 5TVGA 4O2AF 4BS9A 2IEYA 2SKEA 1J8MF 3VX3A 5FAXA 4KFCA 1R6XA 4TV8B 2E4AA 3QLVA 2HPZA 3SG0A 1JEQA 3DT9A 3CG4A 4ZOEA 5BQOA 3VBEA 1PJRA 4PC6A 1PYDA 1E6CA 3T7EA 2WKSA 3MEQA 4MLCA 4PTLA 4E7OA 4F60A 2YIVX 5EESA 3P71T 2PGJA 3PP8A 4CL8A 2D7JA 2KM1A 4Q3CA 3BHMA 4FEYA 4I9UA 5F4BA 1C3LA 3QGMA 1JXMA 5AJYA 3AEYA 1ND6A 4CDGA 1LUAA 1EVQA 3CSUA 1D0IA 1DLJA 5LXTB 1DT3A 3DKKA 1HPLA 1P7WA 1O5IA 2FP4A 3WADA 3U7FB 3PCRB 3R24A 5DMXA 1JG6A 4KPFC 1QG6A 2Q3JA 1Q84A 4B7XA 5K05A 2CNOA 1Y4ZA 4OQXA 4EHKA 1SXPA 2QRUA 2PKRA 3FSGD 2EU8A 3CTMA 1W47A 2AUTA 3FVRA 2E4XA 3QLJA 5BMVA 3KQLA 4OX9Y 3W6PA 4OV6B 1SG9A 4ZJZA 2ZIUB 3PNKA 4BIMA 5B3JA 3N76A 1QQ6A 3UGKA 2QN2A 2RDMA 1YQGA 3EXIA 3QX8A 1SA0B 3ORSA 3WWCA 1K6XA 2BMJA 3AFOA 3ROFA 1G7TA 2PM8A 4DV3B 1R16A 2XH8A 5EJAA 2OYRA 3A1VA 1OGIA 5I45A 4C78A 5I7RA 4UU1A 1VA4A 2YJ3A 4W8GA 4UMEA 3FF4A 4ZIRB 3GGPA 1DRJA 2ACEA 2HO5A 3L9WA 1JDBC 4GVLA 4YMUA 1YL6A 2CHFA 3K5HA 2CUTA 2DMRA 1Y5IA 2HFKA 4OBBA 5DRYA 3IFSA 3I45A 1WWKA 1TM1E 1BX3A 4MWEA 1QYIA 3HU5A 4KGVA 1EFPB 4NDAA 1WHSB 2WU1A 1MABA 4OD0A 2DSNA 4B2IA 3D4IA 1XNHA 5AVQA 2XGJA 1N2BA 3AUFA 2C2YA 2Q21A 4LBVA 3OJ0A 1LJLA 1CIJA 1DT5A 2YHSA 2A57A 1UT6A 3FZEA 3H3XA 1NXVA 1IY9A 1F2VA 5TV2A 2BY4A 3UHFA 1JS1X 5ALGA 5AVUA 5I9IA 2IF0A 2JDID 4EK9A 4XDHA 4V0SA 3M89A 4FI3F 4L9WA 1R8SA 3PNYA 4KSYA 4MGKR 2QPLA 4QGHA 2GPYA 2HGSA 2A9PA 2ZJ6A 3KYCA 4JJKA 4X85A 2W90A 4CKBA 4WZBE 5JPDA 5MN5A 1PNOA 1T8TA 4I6GA 1C2TA 4J75A 5GZ3A 3R1IA 2CUNA 1IEXA 1IDN1 4C6HA 1P19A 4J0FA 3HCDA 3UT5A 3DKRA 1YAHA 1D1QA 3B3FA 2F3RA 3JD3A 1ZJYA 2FQQA 2EHJA 2Q0QA 4IG4A 5B7NA 5FBWB 1X77A 2X1MA 4J90A 1DQNA 1WW8A 3ET5A 1LPAB 1N2ZA 2AJTA 4A2PA 4B35A 3VHXB 4QBKA 3FMGA 2ZI6A 3AGQA 1XEXB 5IH7A 1JG2A 3KE9A 2ZTVA 2A14A 3T3MB 4TMWA 3THYB 3PJRA 3WFJA 4WLUA 1MO3A 3U6BA 1NZFA 2G7ZA 2J5RA 1RJDA 2MMCA 1TM3E 3G2OA 3QV2A 1UK6A 1JGTA 2FETA 4G4IA 4DNFA 4DV2B 3HPRA 1LPMA 3ACDA 3FNIA 2B21A 1EQUA 3LKVA 3GLFA 1K8RA 4XR4A 2ZUDA 1WIWA 4QYIA 3RS7A 3EEFA 2C1ZA 3AEUA 5LJIA 5BWOA 2R4UA 1K5DA 2BTQA 4TYWA 2B34A 1HBJA 4GVPA 2Q3LA 4X6UA 3WJ1A 2JLZA 5KJ6A 1N0VC 1QTIA 1PW7A 1BFUA 2BAGA 2CZCA 2D0PB 2OD2A 1E63A 3COWA 4Q24A 2VT2A 5REQA 4EA9A 3O73A 4BVEA 4HAUA 4I2VA 5A9SA 5I8PA 1OFIA 5AKJA 3ZD9A 5IMBA 2NV2B 3ZE7A 1Z16A 4W1SA 3ZTYA 1Y9DA 3A70A 1DEHA 3DVRX 2ODEA 4RHCA 3IAXA 4JC0A 3UWPA 4BMCA 3W5CA 5B6JA 1CYDA 2P4EA 2B0CA 4NABA 2FEOA 3CEAA 3OJOA 4M22A 4ZHQF 2G09A 1T13A 1P1CA 3FKSA 3A0RB 3P9QA 5KNCH 3LA6A 1PU2A 2Z6UA 4FKBA 3LX4A 4N41A 1EFRD 4BGEA 1XA4A 1GQSA 3DLTA 5A4DA 1BMFD 1M6WA 5AXAA 4UM9B 3O2SB 3PUZA 1QP0A 4MW5A 2REBA 4WT7A 1NPTO 1Z35A 4AN0A 1S8NA 1RBQA 3LVRE 5KVQA 3AY0A 2GO1A 3BFVA 4IIJF 4DMRA 4EUKA 3K70D 1RHJA 5L4NA 4Y6QA 5LYJB 3MWGA 1BD3A 4FLFA 4R1PA 2FK8A 4YJ2F 1KA9H 2EDAA 1I2DA 5JE8A 2O2XA 2PS1A 2X4GA 1QCCA 2BCGY 3CM0A 3MTIA 1SXJA 1V6CA 2GQ0A 3FMOB 4Z1MD 3WZMA 4PX3A 3Q40A 3FPCA 3DO6A 4KG7A 4NBLA 3ZLTA 1X1BA 4N5LA 2FH5B 1B8OA 4P82A 1SQ6A 2Y27A 3HKDB 3ML1A 2XQJA 2OYCA 4A8HA 5LQKA 4ZZ3A 3RHZA 4ER5A 3F1KA 3M6LA 2CK3A 2OYSA 3IEXA 4IQ0A 2OXFA 1WM1A 2QEQA 1C7EA 2WLTA 3QVUA 1FMLA 3QVTA 4D8TA 3RRYA 5EIEA 1O58A 1K7YA 2WHEA 3EMBA 3LQ2A 3PL1A 3PNVA 3VAAA 2P11A 3GNQA 3L7KA 2V4ZA 4MX8A 5CX1A 4B74A 4B3FX 4QKQA 1PV2A 1JMYA 2EYUA 2PZEA 4XB2A 1AUOA 4F21A 3BTVA 2R5WA 3QMVA 1TPZA 5ELMA 2CDBA 4BO2A 5J58A 1XA3A 3RTDA 1GRVA 4Q7QA 1IWPB 2G1PA 1N2JA 3D8TA 4N4AA 1YZVA 4KKVA 4RJLA 5JW6A 4YXFA 2JGRA 1KAMA 2FW9A 3IAM6 6ADHA 2V0NA 3E8XA 3ANYB 3HKEB 3CO0S 3KCQA 4ID9A 3RS4A 4ALJA 5AW3A 5JSUA 3AUYA 4XQGA 1T9CA 3H2IA 1WPXA 2R3SA 2WHPA 3LLSA 3DA8A 4PANA 2H5IA 5KOHA 2LBPA 3HB7A 3O9ZA 1E96A 5A3QA 2I6QA 4YRPA 1Z88A 2LCFA 1JIQA 1M6HA 4WZAA 1EIWA 5SY9A 3E9EA 1JI0A 3O90A 4D3YA 3ST7A 1PLJA 3HY6A 4KOAA 1Z17A 4M49A 3VU0A 2DTEA 3R40A 4AIRA 4JVSB 3NUGA 1EFAA 4BMDA 5I5EA 1KDOA 4N3NA 3C7TA 2XZDA 5BWNA 3S44A 2B69A 1GADO 5K8JB 2EFGA 2YWGA 4DBLE 4OLAA 2C58A 2Q5EA 2ZBDA 2RGAA 3WIUA 4HJXA 3L7DA 3NLLA 4B3MB 3AGPA 3P0HA 1BEUB 4LXYA 1HWYA 3HB0A 4EW2A 3UA3A 1CFZA 5B7GA 2EWMA 2RHTA 3L02A 3NGLA 3FZQA 3E9QA 2OMKA 2A0YA 2FEAA 1HI9A 1UANA 5IF9A 4K40A 4BBPA 3FNGA 4W9RA 4LJSA 3V1NA 2HSJA 4MEAA 1RQLA 1G38A 3R3UA 1RYBA 3A1NA 1GZHB 1Q83A 3IJPA 5TX7A 3TOXA 4ZPXA 2ENWA 1RHMA 2EX1A 4RHXA 5JRJA 2JGNA 4KR2A 2B7BA 3I2HA 1D0VA 2BGMA 1OFUA 6PFKA 4MW4A 1EFDN 1VL2A 4B6PA 4OXKA 2ZTLA 1NXWA 1EVYA 1I3NA 1PUJA 1KSFX 2GUWA 3DMFA 1SOMA 3JZFA 3N75A 1C3XA 2XF8A 1SCAA 2RIPA 2ZXFA 2OQ2A 3CEHA 4XFKA 1H2HA 4QTUB 1ZCBA 3SMQA 3T3DA 3VH3A 2RHJA 3WQSB 4I81A 1TK9A 3O9MA 2B83A 4PU0A 3TPFA 3HBAA 2BI7A 2PAFA 1V26A 4IOMA 1N0WA 3TUIC 4JGBA 3QLUA 2W8ZA 1KFEB 3Q87B 1CS0A 1G1AA 2ZVPX 5I47A 4E03A 3OCYA 3OO1A 3A9TA 6NULA 3V8VA 1A96A 1E5TA 1A8UA 1JV2B 1PL0A 2CWDA 2NPFA 4CE6A 1KMHA 4YRCA 4OI2A 5GVRA 1DIRA 1SRQA 3VM6A 5JZOA 2I03A 1YJ8A 3RT1A 3L6DA 1E5VA 1FQOA 1HTTA 1WU8A 2R7MA 4F9EA 1CDZA 3N28A 1XNGA 5KSYA 3DOOA 1T6YA 2OZLB 2QE6A 4GGMX 1A8PA 4RLFA 1A4XA 4FCVA 2IFTA 1GCIA 4UNRA 5BW8A 4EOGA 1V16A 1T3GA 2BH9A 1P7ZA 2G9QA 4TKVA 2UVPB 2ZI4A 3TUJC 4XVHA 4MV3A 4JT4A 4N03A 3ELWA 4L5YA 5IKPA 4D2IA 5COAA 4TQAA 1I32A 5KOHB 2G4CA 3LIPA 5IABA 2ZPTX 2HTFA 3HCWA 1GSOA 1QMGA 3GFPA 4OQZA 4LSWA 4I6JA 4LOLA 1V48A 3D3WA 3DOHA 3IO3A 5LBTA 4YCMA 3L4BA 1KYVA 3Q3IA 521PA 3D4PA 4O2BA 3HKEA 3GYBA 1AKQA 2LUOA 5IT0A 1B73A 5JFGA 1TCBA 4A0GA 3X1XA 2JCBA 1AK1A 1TUBB 1ZQ1A 3IESA 4IXNA 3HGTA 1Y1RA 4K2HA 5H0IA 4WA8A 2C03A 2Z30A 4H0CA 4IOLA 4QYWA 5FBHA 4Q9IA 4AIIA 3L4KA 2QPAA 1L4FA 3A6FA 1RZUA 1Y48E 4UPDA 5KTSA 4D4MA 4OIMA 3UWOA 3MJDA 5CG2A 4B8WA 2Q41A 2VPWA 1ZD5A 3OM9A 5CNKA 5T3UA 2X0DA 1CQIB 1MG5A 1OAAA 3ZDQA 3DZDA 1HL3A 1TCAA 4KI0A 1EGAA 3FFWA 4BEBA 1H0HA 5KI6A 1VJ1A 5LLSA 3JS5A 4YT5A 1J20A 3JWJA 1XC7A 4KITB 3NR2A 4ZDIA 2O07A 3ZCVA 5JC8A 4DSUA 3AI3A 4WHMA 3KL2A 2C0QA 1A8HA 2I1WA 3VHRA 1NUPA 3JY6A 3LW7A 3WNVA 2V98A 4G5XA 1C29B 5LP6B 1SXJB 2F8TA 5CK5A 1M8PA 3QNUA 1I30A 2D2VA 2R2AA 3NDPA 2C0PA 4H59A 2I7XA 2OG2A 2ZB3A 2QL6A 4D80A 2O8BA 5KDDA 1N7JA 1PS0A 3FYTA 3AESA 3AJ9A 3ZI4A 2LZ0A 2R87A 3QIAA 4H6WA 4TLLB 5C3UA 3KYDA 4RF4A 3NWEA 3IPXA 3WK9A 1QC5B 1Z0ZA 4HQOA 2DKFA 4MAFA 1ZU5A 1YB5A 4NK5A 4MIYA 2GARA 1VGVA 3BM5A 1SCNE 5K45A 3ZIAA 2H5LA 1AQNA 2DJ5A 3P9XA 1T5LA 5EQTA 4GDFA 1NQXA 1RJFA 1QK4A 2GN4A 2VC2B 2WF5A 3L6RA 1P3Y1 1QJ4A 4BGUA 2ZCUA 1QKJA 5L7TA 2E48A 1AKVA 1ZO8A 5F3DA 4BFSA 4F3CA 4H2DA 2R8RA 4PZZA 3VDNB 4H27A 3RVPA 4HWPA 1KIMA 1Z7YA 3LF2A 1FFXA 1D7AA 3AP3A 4Q3EA 3O92A 1YJ5A 3G5UA 4UM7A 1YZFA 1DIBA 5E3JA 3ZBTA 3IT0A 4ML3A 1X86B 4OGFA 1HLFA 2C8LA 2HRBA 2XF2A 4C0AC 3OQBA 1NR7A 5TJ9A 3U7JA 3TG8A 1ZSYA 3A4NA 4BMOB 4EKGA 1CUUA 1SVKA 3HFGA 4PAOA 1GNRA 4NX2A 4S1OA 4Q5IA 2BBSA 1US8A 4L8WB 3U9LA 4I19A 5B1SA 5HIAA 1JHZA 1MV5A 3OPYI 2OHGA 4PHFA 1IZZA 2EBUA 4BTLA 2B6HA 4NPCA 2WPDA 3LP5A 4GP7A 2WF9A 1WDWB 3LQ4A 4G1CA 2OQVA 1E3WA 1JPJA 3EVCA 4OHMA 3ZIAD 1A2KC 5KVCA 3AW8A 3QYPA 2PVCA 5CBPA 1A9QA 3PPVA 4YJFB 4PPGA 2W48A 4URUR 5HFAA 1JHQA 2B78A 3PI6A 5EE9A 4OX9B 1PV1A 2G36A 2PHZA 2FPIB 2OGWA 1D3AA 1M54A 4X24A 1HYHA 3W2GA 2HA2A 4ZWNA 1WS6A 1IULA 1GITA 4P0TA 4EY7A 4HB4A 1MJ5A 3ANXA 1QFSA 1ZKDA 2HXYA 2F62A 1MIOA 3HO6A 2CDCA 1W8DA 2O57A 3HVHA 3L06A 3LDAA 2N1MA 1E62A 3F5MA 2ZB2A 3KPUA 2G8LA 3B12A 1UBGA 4MVJM 3UCXA 3GO4A 4DZTA 2WM9B 5LU8A 4I6EA 2PLWA 1KVUA 1QYWA 1FMJA 3A1EA 3P2IA 4XX0B 3WL8A 4KWHA 1LPPA 2JIQA 2XECA 2XWSA 5FA5A 5JCPA 5AJUA 4GR5A 4EHBA 4M89A 1ADGA 2BGIA 2XGMA 3QJGA 3ZGOA 1XAHA 1BSVA 3WBBA 1XLTA 1KH2A 4AS1A 2P9JA 1XX6A 2AF3C 5C32A 1V4BA 2X1LA 4M21A 1DU4A 3VGPA 4TTPA 2VJNA 3KLMX 3H2JA 1DWQA 2JH3A 2XY4A 4XRRA 3GLIB 2O0MA 3GELA 3KZ1E 4M8KA 5GJVC 2IUEA 2AXPA 2ZK7A 3ND9A 1WKBA 4ILKA 1Y7HA 3FKJA 1XTVA 4BB0A 4EWLA 1NXPA 2M2IA 2O48X 4HXEB 4Q4DA 4UAVA 2ZIZA 1HQKA 4U6QA 5A5DA 3EIEA 2Z9BA 2NTYC 3QXCA 3DQPA 4Q05A 3ZD8A 3ZK7A 4YCLA 5KC8A 1HDGO 3BDAA 3PNSA 4O6VA 1R10A 3KR0A 1R15A 2AC2A 1TKAA 4YRKA 5JNUA 2DT8A 2GA8A 4ZOLA 4DT1B 1TF7A 1KEEA 5DGDA 4I5FA 4L5JA 3X0DA 1VA5A 1SU4A 2ONZA 2P2LA 2CJWB 4OU5A 3RVKA 1JEAA 1KBZA 3IIEA 2PXHA 4I99A 1P5JA 4KQMA 4UVDA 4LV5B 3ZCPA 5JT1A 1RZVA 4GKBA 3W5JA 1CDOA 1HE2A 1L9KA 1X7GA 2F3TA 1HDXA 4IHJB 1ZW6A 3WLNA 1X39A 3IUPA 2TMGA 1QPGA 1OWLA 2PGIA 3K05A 4BZQA 4KREA 1U7DA 1OFTA 2ENUA 3LNTA 4G0QA 5DWDA 5EUCA 1H4TA 1T36B 4R2XA 3IQXA 1B76A 2Y1LA 3BMQB 4JLKA 4K9NA 4KVZA 3W4KA 4LJ8A 4BNJA 1ISGA 3IOEA 1XTRA 3LUCA 3K1YA 3PQ5A 4S2UA 4YYZA 2FDRA 4FPXA 1RDFA 4ICIA 1P1RA 4OSPA 3QVJA 1H4VB 1ZITA 4CIWA 3TI7A 3ENKA 4EI9A 4ZANA 1Q7GA 3D7LA 4P3YA 5BY2A 1QZ3A 3AB8A 4PFSA 3ILYA 1Z15A 3FDJA 4TWZA 1KHHA 4V0ME 3G9ZA 1ECPA 1PR1A 3ZCQA 1A2OA 1FEZA 5IAOA 3RS3A 4EG3A 1NSTA 2IKQA 3OEYA 3OTIA 2Q4OA 5HIJA 4RK4A 3ZZUA 3OPVA 1E5LA 5HTKA 1PZXA 4DUPA 2BRUC 2OC4A 2FSFA 4W63A 3QY9A 3F3KA 2DWPA 5IC5A 1KAEA 2VR1A 3OMXA 3GU3A 1OUMA 5AXBA 4A26A 2CLKB 1MW9X 3A58B 4C9BA 1KO7A 4DMFA 4OY3A 4MVWA 8ABPA 5U1PA 4GM1A 1KS2A 2W6ZA 3FJOA 4TMXA 2IEZA 3WNBA 3JYOA 3QKWA 4JJ4A 1QVVA 2GCOA 4BV9A 3HYCA 1PLKA 4GPZA 3OT1B 1RM3A 4BNIA 3IQHX 1ESEA 1W1UA 1RKBA 1SC3A 3FWYA 1SOVA 3I61A 5HS4A 3VO1A 1PF7E 1EGVB 3QTBA 1YSCA 5AI8A 5EAIA 4DCTA 3MS4A 1NVXQ 5EJ8A 3LQ1A 3R77A 1T5HX 3HZRA 5DI3B 4O5AA 2EJVA 3DFZA 1R5OA 3OCVA 3F96A 3ONEA 5BMOA 3AI7A 4PYQA 1QH8B 3PXEA 4S24A 3RHFA 1QC5A 1K9SA 2HN9A 3MQFA 4CR7A 1W1IA 3LDFA 4LXTA 3UJ7A 1PJAA 5K7SA 1O7JA 4JFRA 3L4JA 2C4TA 4NMLA 3V4VB 2C7OA 1C4OA 1ZONA 3AWIA 3G9XA 2XYVA 4N9QA 4O2BB 3RIEA 1SK8A 1VPTA 4DMLA 1XWIA 3QE4A 2X77A 4IMIB 2C9CA 3C8UA 4O29A 2AFIA 1U0NA 3JRNA 3LO5A 5FL7A 1SQ0A 2VDPB 4LY3A 5E4TA 4A91A 3JCZA 5CPBA 5DE3A 2ATXA 1ZRHA 1NF3A 3KYIB 3C39A 3DBHA 4N6GA 5HE8A 1KQFA 1VC2A 1ZNZA 3ENZA