4U2BA

Crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas knackmussii
molecule tags Hydrolase
total genus 80
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2bA00
5YASA 2QT9A 2OG1A 3FVTA 2CZQA 5D7BA 4ZV7A 4AZ3A 5EHXA 1VLQA 1ZI9A 1UKBA 4HTAA 3F9CA 3H18A 4W1SA 4Y2VA 2I78A 4K5QA 4Y2YA 2AXEA 3D2CA 1CUSA 2YASA 3HZOA 5SYNA 5I8PA 2Y6VA 1OILA 2C5FA 2B9VA 4G1FA 4QEKA 4DM7A 1UWCA 3WWCA 1EHYA 1E3QA 4DNPA 2HL6A 4CIAA 1CUZA 5JARA 4AX4A 3WL6A 2VQ6A 1XZJA 4H7DA 1QTRA 2RIPA 3D59A 4UBJA 1GQRA 4LIPD 2XB6A 3MUOA 4DTCA 1P0QA 1GXSA 1MO2A 4AXBA 1RYYA 3GFFA 2WUFA 1BCSA 1AMNA 1QLWA 1EDBA 3IULA 4UBMA 4F0JA 5DYWA 4HXFB 4Y7DA 4LXGA 2IX9A 5IH7A 1NU6A 4CCYA 3BJRA 1JU4A 2ONCA 2Z3ZA 4LHEA 4IH4A 3ESAA 2JGLA 1EX9A 3EQ9A 3C70A 4Y2JA 5HF9A 4INZA 1XKTA 4IO0A 2GBGA 1GPNA 1CEXA 2WIKA 4BVLA 1EVEA 2WIFA 1EK1A 1ZJ5A 4UUQA 4C87A 2XT0A 1XZFA 3HC7A 2BFNA 1CUIA 3M83A 4Y9SA 1DT5A 3BJMA 5A62A 2XI4A 3C5WP 3STVA 1LPNA 3PICA 1VJ5A 3AJAA 4U2FA 5LP1A 4X85A 1LLFA 3MGAA 4GECA 1XRRA 2C5GA 4L9AA 3GZJA 4HXGA 1SCQA 5ALSA 4Y2QA 5AK3A 2GYUA 5E2IA 4BAGA 4B9EA 2XQIA 2XMZA 4NMWA 2Z5GA 2ZJ6A 3DS8A 2QS9A 1ODSA 4KAAA 5CT5A 2JGIA 3O0DA 1XQVA 4UHFA 4PW0A 1QIIA 3ZPXA 3IIIA 1G42A 3DJYA 4AMZA 1IVYA 1A8QA 3GA7A 3V1NA 3WI7A 3IDAA 2HU8A 5AM0A 1DT3A 3NWOA 1DU4A 2DQYA 1XLVA 1XZIA 5HK9A 1ACJA 1XLUA 1W76A 4X71A 3EQ8A 2XMDA 4BB0A 4EY5A 1EINA 1CUXA 3A6ZA 3BF7A 3I2IA 1CV2A 2QR5A 3ESCA 3I6YA 5CRIA 2HA7A 4LXHA 3DKKA 4KE8A 1QO9A 4UFOA 4BC0A 4C4ZA 4QNNA 4HZGA 5CXUA 3R3WA 5AK4A 5KREA 5K5EA 3B5EA 3OTQA 1VZ3A 4UHEA 5JAOA 2RAUA 3I2GA 1FFBA 2Y1KA 1MX9A 3DOIA 5BOVA 5A2GA 4CFSA 4CG2A 1DX4A 3VJMA 3GUUA 3VVLA 3HACA 1CUCA 1B41A 4G4GA 1HLGA 4BVJA 1AKNA 4KAFA 3ED1A 5A7HA 2WFLB 1VE7A 1YSCA 3D3NA 1E66A 3C8DA 5AK5A 4L3WA 2AJBA 2I3DA 4OYLA 4GDMA 3U0VA 5EIAA 4IQ4A 1ZI6A 1BS9A 5LZ4A 2VJAA 1CUGA 2VAXA 5AI9A 3K9BA 3QPDA 5K3FB 3E3AA 2XUDA 3N0TA 2O7VA 4LYDA 2V97A 1TK3A 1XFDA 4W63A 2RI6A 3BL8A 4FNMA 3G0GA 4G4JA 2C0PA 2RONA 4BP9A 4XJVA 4ROTA 5HFNA 1MU0A 1BE0A 2WSLA 5JATA 4QWMA 1K4YA 1UFOA 2J4FA 1SCKA 1WPXA 3W9UA 2JEYA 3BDIA 2PBLA 1R3DA 5AIAA 2JGKA 5LZ5A 4OUKX 1JJBA 1SCIA 3HEAA 4LYEA 2AJLI 5FUMA 1QIMA 3HLKA 2VF2A 4OPMA 4F5ZA 2G5TA 4GLBA 2WHRA 4DSZA 4MWSA 1AX9A 2VJCA 3H2HA 5T4FA 1XZDA 1YCDA 1CUHA 1XZCA 2VT6A 2XUFA 4MWTA 2HFKA 2X76A 4E14A 3HXKA 4DMCA 4CG1A 2WQZA 5AI4A 4BCBA 4KJXA 1HBJA 3G8YA 3H04A 3QPCA 3QPAA 4YPVA 2YYSA 2K2QB 5JZ9A 4EBBA 1QZ3A 5JAHA 4J0CA 5EI5A 3S2ZA 4W1RA 2EEPA 3BWXA 3UMJA 3AILA 2BJHA 5ISMA 2O7RA 2HADA 5BV7A 1LPPA 4FKBA 4B6GA 1H2WA 3R41A 4EUSA 1ODTC 4O08A 3C8HA 4LKOA 3VKFA 1J1IA 2HA3A 4KACA 4N5IX 1XZBA 3QMVA 2GYVA 4X92A 4P9NA 5HFAA 3F97A 1B6GA 4BCCA 4G9EA 2QUBA 1R4ZA 3VJLA 2WU4A 1GPLA 4WDRA 4RE5A 2WG2A 1ZICA 4J0HA 3YASA 5CURA 1ZOIA 3UUEA 5JD5A 2CMFA 2XMSA 2XMCA 5AOCA 3H19A 5EIHA 5A7GA 4HS9A 3X3HA 3QH4A 4Z49A 3FWHA 1Q0RA 4QE3A 2AJCA 3G0BA 4PSDA 2JGFA 3KWJA 2XUOA 4IHAA 4A5SA 4U2DA 3HJUA 4BRSA 5AP9A 4M0FA 4PNZA 4C89A 4HRYA 1XRQA 4JUIA 3LLCA 2OGZA 1CUBA 5JD6A 2J3QA 3F96A 3O4JA 5LZ2A 4U2GA 1DQYA 2HU5A 1D07A 5HQ3B 4K6KA 5DJ5A 5AI0A 2PPLA 1UZAA 3HI4A 4W1QA 1THTA 1E8DA 1YB6A 1MX1A 4DSAA 3WWEA 3SK0A 1HL7A 4N8DA 4BP8A 3DL4A 1Q84A 1QGED 5FDFA 3TRDA 2O2GA 5H3HA 1F0NA 1GPKA 4ARBA 1G5FA 1MT3A 1FSSA 4BVKA 2XQKA 2ZYRA 2W6CX 2QJWA 4PO3X 2GBCA 1PFQA 1U2EA 3IUNA 3KOOA 4B0OA 3EQ7A 3W04A 3WWPA 1CR6A 4H7JA 4H35A 4B83A 1VA5A 5A71A 5LZ8A 3PUHA 4M0MA 5ALEA 4DIUA 5K3EA 1XQYA 2PSHA 1BROA 4RGYA 2BGNA 4DGQA 3D0KA 5FPPA 4DMFA 3E1GA 4I3FA 1DTEA 2OCIA 3WL8A 3GROA 2B20A 1I6WA 1IZ8A 3W9BA 3PI6A 4HRXA 3D7RA 3H2JA 3O9MA 2YH2A 4G8CA 2OQVA 2JGEA 2PU7A 1A8UA 4KYVA 2ACEA 2OAGA 3D2AA 1N5MA 4FLFA 1Y37A 4DLNA 4P92A 4ZRDA 2RGUA 2Y2VA 4YK7A 4BE9A 2OAEA 4Q34A 1ETHA 3R40A 4WFIA 3AINA 2ZSHA 1TRHA 1HKHA 2WFZA 3QVMA 2PSEA 4QWWA 5CT4A 1E89A 1H22A 5C8XA 2DHEA 3QYJA 5CH5A 1F6WA 2D5LA 2XUJA 1WB4A 2WUGA 4C88A 2B4KA 3C43A 3G9UA 2QVBA 4MEBA 1XROA 2WFMA 2XQJA 1R50A 3O4GA 4Y2XA 5HK8A 5JZBA 3AZQA 4Y2RA 4MXDA 3C6XA 1IZ7A 1P0PA 5AKHA 4KE6A 1QFSA 3ANTA 1OCEA 2WIDA 3A2NA 4OB7A 3BDVA 2XUQA 2I3ZA 1ACLA 3S8YA 4K6HA 5CT6A 4Q3KA 1CQWA 2XMQA 5I7UA 4HXEB 1AC5A 4ETWA 5ALDA 3C6YA 4P08A 2JEZA 1XZGA 1YAJA 1K5PA 4BDTA 3NUZA 1O6FA 3JWEA 1CUYA 2DCMA 3ZLTA 5ALRA 3OOSA 1GGVA 1ZGBA 3OG9A 4GI1A 1CFJA 5LYYA 4CG3A 3IURA 4Q82A 5AJHA 5F4ZA 3MVEA 1JJIA 3TEJA 1H23A 1JJFA 2OGTA 1XZHA 1JI3A 1YA4A 1XKLA 4H7HA 3G9ZA 1UOPA 4PV7A 3WL5A 1R9NA 1LGYA 3TJMA 3ZWQA 2FX5A 1A88A 1CVLA 2ZYHA 3H2GA 2WLSA 3ILSA 4ZXFA 3WJ2A 4FLEA 1C7JA 4LXIA 3EBLA 3PF8A 5AKJA 3OURA 1UT6A 5AOAA 1XRMA 1XQXA 1QIGA 4X91A 2QRUA 1J2EA 4J0DA 4NS4A 1LZKA 4RE6A 1DWOA 2ORYA 3WZLA 4E46A 3QMWA 4PF1A 4UHCA 5J3JA 3O95A 5CW2A 1CQZA 4GHWA 4OSEA 3A2MA 1A7UA 1TIBA 3LIPA 4D9JA 4EY7A 3CN9A 5D3KA 4DYHA 3FYUC 2JGMA 4PSUA 1QJ4A 3LS2A 2XLBA 3I28A 4FFWA 2G63A 3M81A 5FXMA 3FSGD 5AKKA 3DKRA 4B7ZA 2C58A 1MJ5A 2GZRA 4FBMA 1JMYA 2RHWA 3QMMA 1GKKA 4Y2TA 1Y7IA 3I2HA 5DNUA 2VAVA 5FP0A 1WOMA 1TKRA 2Q0XA 5IVIA 2X8BA 1T4MA 5CH3A 3O9VA 3WYDA 3R3UA 4HVTA 4J03A 3F8SA 4OD0A 1CIJA 2OLEA 1DQZA 3STXA 5FOQA 1H2XA 3K2IA 2HDWA 1WHTA 2WJ6A 4GXNA 1P0MA 1QOZA 5AH0A 3WK5A 1TCCA 3WWDA 4JNCA 4KRYA 2BUCA 2HA6A 4DNOA 5ALNA 5JIBA 1U8EA 1WCYA 2UZ0A 1GKLA 1UKAA 4L72A 5I9IA 4S0XA 2ZJFA 3STUA 2BGRA 1JKMA 1N5RA 1ZI8A 5IVHA 5ALUA 4NZZA 1AGYA 5AKGA 1IUNA 3SWWA 4E15A 1MN6A 5AKZA 4KAJA 4ZI5A 3FYTA 4AQDA 2Z8ZA 3DYIA 1LPOA 4E11A 4W9RA 5EHNA 4UBNA 3STTA 4H7KA 1S8OA 4MQLA 1MNQA 1UK8A 5E4JA 2P8SA 4EY4A 3Q8WA 4MYDA 1USWA 2DQZA 2ECFA 3WIOA 1LPBB 5ALVA 2HA2A 3RARA 2WM2A 4ARAA 3AIOA 2V98A 1K63A 2WKWA 5KWJA 3D2BA 1YASA 2CUTA 2JGJA 1MAAA 1CUWA 5ALXA 2O2IA 5A7FA 2GYWA 3MUNA 1DX6A 1K8QA 3AUKA 2HRRA 5KWIA 1R1DA 3CCCA 1EXWA 3G9TA 3AIKA 4QLAA 3AZOA 2VATA 5AM5A 3V1MA 2WHPA 2CEKA 5DLPA 4C4YA 2VJDA 5AKIA 1YB7A 2AJ8A 2WJ4A 4ITVA 2XLCA 4WY5A 4FDMA 1XLWA 3FAKA 2PVSA 3H1BA 4C6HA 1ZIYA 1CUAA 1UK9A 4AZ0A 4AB1A 5EHQA 3NOXA 3I2FA 2HA0A 3LP5A 3E4DA 1QE3A 3ZV7A 1CUJA 1ZIXA 3FYUA 3WMRA 4DNQA 5FKJA 5JASA 3FSGA 2C7BA 4NVRA 1BN7A 5JYCA 3IUJA 1UK7A 4X97A 4FWBA 3A70A 3K6KA 3R3ZA 3WK6A 1G4HA 3BIWA 3JYHA 3GELA 4U2CA 4V2IA 1FFDA 4N8SA 2ZSIA 5LLSA 4Y2UA 5E4YA 1Z68A 4X6YA 1IMJA 4I19A 3ANSA 3I6MA 1KU6A 5AI6A 2PSDA 1C7IA 5CT8A 1GQSA 1XZKA 2LIPA 2WTMA 3CCBA 4EY8A 3WKAA 4QDOA 1W6RA 2R8BA 3PUIA 3DCNA 3WL7A 1LBTA 1F8UA 4J3JA 5A6VA 4C01A 1N1MA 3FCYA 1J06A 3UUFA 4BYMA 4U2EA 3G0CA 2QXTA 4WJLA 3WQHA 4GEGA 4MQMA 5AM1A 2BUAA 5HCUA 2H7CA 3I2JA 4X3CA 4B84A 1AURA 5AM2A 2PU5A 1F0PA 5ALLA 1XRNA 2XUKA 3DD5A 5C7YA 3DLTA 1N8SA 1Q0ZA 2HRQA 3WWOA 2ZYIA 1RWQA 3T4UA 3KSRA 1YS1X 4ZREA 2ROQA 5K3AA 1OXMA 4B81A 3FOBA 2Z8XA 2PUJA 4FMPA 2WU3A 3SX4A 2XMBA 2H7XA 2EDAA 2O2HA 2FJ0A 1XZMA 2R11A 1MAHA 5DWDA 4UHDA 5SYMA 4OU4A 1EDDA 5AIBA 1LZLA 3C6ZA 3HRHA 3H2KA 1XZLA 1L7RA 1RP1A 1KEZA 4UBOA 3ZLVA 1UKCA 1ZD4A 3ZI7A 3DQZA 3JW8A 1EI9A 2GBFA 3E0XA 4XX1A 5AKLA 1XRPA 1TAHA 4JYPA 3V48A 2HFJA 1QIHA 1ORVA 3T52A 3I1YA 4UFNA 2JBWA 4XIIA 4WFJA 4AO7A 1THGA 1W75A 1UK6A 5ALQA 5ALJA 3DNMA 1LPMA 5ALHA 2Y2UA 4Q05A 4XVCA 1HQDA 2VJBA 5ALGA 3C6BA 4G4IA 2H7YA 4AN0A 3WK4A 1EK2A 1EA5A 1TCAA 3OC0A 3OM8A 2XUPA 3R3YA 1YA8A 1R9MA 3C45A 3PFBA 3W06A 7YASA 1EVQA 5JAPA 1IUOA 3IB3A 3IBTA 1QIEA 4FOLA 3WYNA 5ALFA 1CUFA 1ODCA 2D0DA 5EHZA 4BDSA 3LCRA 4K2AA 3IVMA 4RNCA 1E5TA 3IUQA 4CCYB 4F21A 3EIOA 2B61A 5EFZA 1J07A 4J0KA 4IH1A 3RK4A 4Y2PA 2I03A 1A8SA 2IITA 4BBZA 3I1IA 2HM7A 4BZZA 1ZJ4A 4WFKA 4AMYA 3WKCA 1AQLA 3DDUA 2QOEA 5AICA 1PJAA 3H0CA 2OGSA 4KR0A 1KU0A 2G4LA 5FPQA 2QKYA 1U4NA 2V9ZA 4G5XA 1XQWA 4J0GA 3W2TA 2XQGA 3V9AA 4AO8A 4MJ3A 4CIBA 1DINA 2DHDA 3QZUA 1EDEA 6YASA 1T2NA 3NGMA 4EHBA 1ISPA 2EDCA 2XMRA 4UHBA 4M0EA 1MNAA 3O4IA 1R88A 3HABA 2Z3WA 4UPDA 5IVDA 4BC1A 2WUDA 2ZJ7A 2BAGA 2WIJA 4Q3OA 3WK7A 5T4EA 1TCBA 1UOQA 2NW6A 5DTJA 3WKEA 3AZPA 2DSNA 2YXPX 2WG0A 3PFCA 3QM1A 2CBGA 4UHHA 5JADA 2PX6A 3WJ1A 4BTLA 2WJ3A 1GZ7A 3I2KA 4DMHA 3F67A 3WLAA 1BU8A 3KWFA 2FUKA 4K6GA 2CJPA 4HAIA 1NX9A 2Y6UA 4X94A 3VDXA 4G8DA 5C8VA 3WA7A 1ZGCA 1H2YA 5K3CA 1QONA 1VA4A 3AIMA 2H1IA 1XRLA 3BE8A 2DFPA 5KBYA 5CT9A 3P2MA 5ALPA 1QFMA 1O6GA 3ESDA 2XDWA 4WDQA 1X70A 1W52X 4EA6A 2QXUA 3I6ZA 3CXUA 4UFPA 3RM3A 3TGLA 1QIDA 4OCZA 2WUEA 5ALTA 3G02A 3G7NA 4BCDA 1MTZA 3L1JA 4B80A 4QLOA 5ALZA 4EY6A 1FFAA 2G5PA 3ICWA 4FNGA 3Q0TA 4GBGA 5AO9A 3W05A 2BKLA 2H9YA 1QO7A 1VXOA 1JFRA 5CBKA 4JEIA 4RPCA 4CI9A 5ESRA 4FFVA 4KRXA 3B3QA 4ZWNA 3DL7A 4PQEA 4X7BA 1GT6A 2BUBA 4N5HX 2HU7A 5CXXA 5T4HA 4GWLA 1JMKC 2QUAA 1HPLA 2ACKA 2J3DA 2OPHA 2C0QA 3IUMA 1HDEA 1SOMA 4YX9A 4Y2SA 1CLEA 5AKXA 2QMQA 4H7FA 1ZD2P 1WB5A 4B82A 4X95A 5FRDA 4BAUA 1VXRA 5ALMA 3WKDA 1MPXA 2IIVA 1AUOA 3M82A 3D5EA 1LBSA 5DYYA 3L1HA 4XWGA 4I4CA 1W4LA 5IKXA 1TQHA 3KDAA 2W22A 4Q1VA 4W1PA 4KEAA 5D3ZA 3STWA 2JIDA 5HF5A 1SC9A 4J0JA 2OCLA 4KE7A 2JF0A 2HIHA 1ZD3A 4GW3A 4H7EA 3D4LA 1QTIA 1IUPA 4L0CA 3FCXA 4QDZA 1DWQA 3FNBA 1XZEA 3BF8A 5CH8A 3BIXA 3WZMA 4EB0A 3PF9A 4QDUA 1LPAB 4DMKA 4OB8A 5CMLA 1JT2A 3WK8A 2V96A 4B0PA 2WHQA 2E3JA 4BTVA 1BEZA 1NU8A 2DHCA 4G8BA 4KE9A 2OQIA 3HSSA 2XUIA 5EIEA 5LIPA 5ALIA 3EF3A 2FJPA 3O4HA 2WHPB 5C81A 1BEEA 1UOOA 2WFLA 4QDXA 5LKAA 3M3DA 3B12A 2PM8A 1BN6A 1VE6A 3G0IA 4H18A 5AI5A 3VVMA 5AKEA 5DYTA 1C4XA 2XE4A 1W1IA 1YS2X 2CKMA 3QITA 4FTWA 3ICVA 4FBLA 5C8ZA 2WIGA 5K3FA 3A2LA 3PDCA 2VTVA 2ZYSA 3FYUB 2ES4A 3GBSA 5DTIA 4A23A 1CPYA 4J0IA 1CUUA 1PV1A 4FLMA 1EB8A 1LPSA 4J7AA 3QBJA 5BWBA 4JH0A 4MEAA 3C87A 5AI8A 5HZGA 4BATA 1BRTA 1YR2A 5HF8A 3STYA 3PE6A 4BAZA 4QA9A 3BXPA 1U65A 3FBWA 5JD4A 2HHAA 1AZWA 2RHTA 4PSCA 1Y7HA 2XUHA 3WKBA 3FLEA 3N2ZB 1VOTA 4H0CA 4A16A 3H2IA 4X93A 1DWPA 5JZSA 4OB6A 3DEAA 4B85A 5CTAA 2X5XA 2PSFA 5AK6A 5K3DA 5LZ7A 4F60A 5EGNA 2QZPA 5HKAA 1E8MA 1XZAA 4H7IA 5ALYA 2VEOA 4G9GA 2QTBA 5AKYA 4UBIA 3LIIA 5FV4A 3DOHA 1H2ZA 2WTNA 5HKBA 2J4CA 4X90A 4DNFA 3OPMA 4AN1A 2GBIA 2OCKA 4JYMA 3IA2A 5IVKA 4OYYA 4YASA 4BE4A 2VA9A 1K6EA 5D6OA 2XMGA 4QDTA 1VKHA 1CUVA 3WIBA 1QIJA 1X2BA 2XUAA 1LNSA 5AM3A 4N8EA 1X2EA 4EZIA 3U1TA 1CUEA 3C5VA 5BWCA 2HA5A 2OCGA 5AHXA 4ZV9A 4Q3LA 1EB9A 4OU5A 5AOBA 3KXPA 3G0DA 5E4TA 5LZ9A 3FVRA 1WPRA 5ALWA 2AJDA 5DNVA 1FFCA 1Q83A 1E8NA 1VZ2A 3RLIA 1FJ2A 2DR0A 4ZGBA 3CN7A 2QJRA 1WHSA 4TVKA 4FHZA 5T4BA 4CCWA 1WM1A 4C4XA 1FFEA 2QM0A 3VISA 5LKRA 5JANA 4X6UA 3DYVA 3FLAA 4P93A 5DNWA 4TGLA 2WILA 4MYSA 3WA6A 2XUGA 3R0VA 2WG1A 3G9XA 4U2BA 5JAUA 1L7QA 3R3XA 2VSQA 3L1IA 1QIKA 3RKSA 3AFIA 2CB9A 4WCVA 4UBKA 4H77A 5HF6A 3V1LA 3VXKA 4BRZA 5HQ3A 3F98A 2OXEA 1CRLA 3H17A 3HYSA 1ORWA 5K3BA 1EH5A 1WB6A 1CUDA 4X00A 2XQFA 3FLBA 4AO6A 3H1AA 3WK9A 2PL5A 5JALA 1JU3A 1UXOA 1MX5A 3R3VA 1YAHA 2PKYX 4IH9A 2C4HA 4B9AA 2HA4A 1QIFA 2VT7A 3V1KA 1M33A 4X6XA 1L7AA 2ZVDA 5ALOA 4BZWA 1ZD5A 4UBLA 1BCRA 1SFRA 3ZLUA 5FLKA 2PSJA 1G66A 4TPKA 3KD2A 3SC2A 1P0IA 3ESBA 2PUHA 2GZSA 3VJKA 4QZVA 5AM4A 2BCEA 4WY8A 5ALKA
chains in the Genus database with same CATH superfamily
5KWEA 1KKLA 1FW8A 2LCIA 4RESA 3C1AA 1NI4A 3FVTA 3QOYA 1L7EA 2HJ9A 1R6UA 1ULBA 5EHXA 1ZI9A 2R9VA 3B5JA 3LD9A 1UKBA 5SY6A 3EGDB 4OQNA 3C6KA 2PSSA 4W1SA 4G84A 3KYCB 2IPOA 1F20A 3JATB 3K8ZA 4M8KA 3R7SA 1MV8A 3PNSA 3D2CA 1CUSA 3F3YA 3I73A 1Q1BA 4KSCA 5LXTF 5SYNA 5I8PA 1REQB 4W5QA 2QTVA 1ONNA 1ULHA 4MV7A 4G1FA 3TRKA 4LCBA 3RCBA 4JEUA 2VXBA 2I4TA 1DQNA 2WZBA 3DAPA 4EO7A 1E3QA 2Q45A 1ZK2A 1PDVA 4Q1FA 2WI8A 4XEUA 5EWJA 3DEYX 2C83A 1VHWA 1CUZA 5JARA 4AX4A 2IPMA 5IVPA 1X1EA 2C99A 2GD0A 2G72A 1OH7A 2VPIA 1L4HA 3CLKA 2OY0A 2JIPA 2RIPA 1WR8A 3D59A 4ZQGA 2CFIA 4M4SA 2IS4A 2FMIA 1RE1A 3RUPA 1GQRA 2W6NA 3EDMA 4LIPD 5G0UA 1KQGA 3HCEA 5EEGA 1NLYA 4RJJA 4DTCA 4XZ3A 3GT3A 3NLLA 1ZFNA 1VG9B 2PR2A 1SBNE 2FK7A 3ZGZA 3FPJA 2VQDA 4M9RA 5BMVA 3IUEA 1P0QA 1RNLA 3CZCA 1MRSA 1HEIA 2VT2A 4QQ8A 1XTJA 1JL3A 1B76A 1RYYA 3GFFA 4G25A 3T7CA 3OESA 3WB9A 4BFLA 1PYGA 3AFHA 1XU4A 1UCFA 4OFXA 5FLYA 3O83A 4RV9A 1SQ6A 3RAJA 4OFZA 5BSHA 3EH2A 2H16A 2HSGA 1RI1A 4HBGA 3H7AA 4B33A 2HD4A 1L3BA 5KX5B 3N6VA 1AMNA 1QLWA 3IULA 5A5EA 2QJTA 3G17A 1H9CA 1UPTA 4UBMA 4B7UA 1H8EA 3GVXA 1UPUA 1EUCB 1NGSA 4CM9A 4D3ZA 4Y7DA 3SQMA 1TQ2A 3S4YA 3ZGLA 2AOXA 2J0UB 4LXGA 2IX9A 5EZ6B 5HZKA 3NDPA 5IH7A 2O14A 3CZMA 4IHJF 1TYZA 2YHBA 2BV3A 4MIYA 4NBVA 4F9FA 1EGAA 3OWHA 4FDTA 2VAMA 2W70A 1E9SA 6REQA 4DY6A 1RC0A 1SOWA 1KP2A 3PUZA 1W0KD 3OCJA 4LHEA 1VMKA 4ZOLB 2C8LA 1BGVA 1Q3TA 3ZNOA 3TG2A 3DDWA 1NT4A 4RK6A 4CM3A 3FDZA 1S2NA 4PZUA 1BXZA 1C1HA 2X7HA 1ABEA 5AJTA 4ME6A 3R74A 1Z0FA 3ED5A 1XNJA 2DBRA 3BJEA 3Q7IA 3VDMA 4EKGA 5K2OA 5DCWA 2FZGA 3A04A 2V6IA 3D3WA 4MS3B 1FX1A 2BGMA 4WKPA 1GVNB 3HL4A 4OGFA 1XVUA 3RC9A 4EX6A 5DGTA 1U0SY 2Q1SA 2QT1A 1ZMRA 3COWA 3S28A 3EVEA 2P9EA 3KV3O 4O4JB 1SH7A 4DPLA 3LT4A 1MKYA 4O2BB 3RAGA 1L7VC 5JAIA 1M2WA 1E7MA 3O8LA 4CETA 5IT5A 2CXSA 3RIHA 5LQMA 5HZMA 1VLZA 2XNSA 1FTYA 3VZQA 3I6BA 3L0DA 1M76A 4M46A 1F5NA 2GBGA 1EFAA 1VBKA 1UP6A 1JYFA 5JS2A 3L4JA 3IP3A 4A92A 1U63A 4BFUA 1AKRA 4TSFD 2CVPA 4DIMA 2ZSDA 4R2MA 4UCXA 3JAMA 1ZN9A 2YIVX 1V47A 4E5KA 5KTNA 4M60A 1C5KA 3A1UA 3GEMA 2V3VA 1CJKC 2R7LA 3HKEB 1JP7A 1MDBA 3OJEA 4P5EA 5DBEX 1KRWA 2WTAA 1UC5B 1ISJA 4CUZA 3EMKA 1UJ6A 1EK1A 1EWQA 4V1CA 5FWAA 4G0WA 3JSAA 3CBGA 1ZGJA 3NYRA 1QVZA 3J81A 3X2FA 1OBVA 1BVRA 3FDFA 4EKYA 1T5OA 3M83A 5U4QA 2PJZA 4KUHA 1DTWB 5SZJA 4Y9SA 3TWOA 1J8DA 3EC7A 5MDHA 5SY9A 4Z4QA 2ZVPX 2GESA 3RVSA 5DBOA 3DDZX 5BSTA 4P36A 4F93B 1GN8A 3BJMA 5BP7A 3GGJA 2OC9A 4KPUB 1SXJE 2H7VA 4B4WA 3ZJVA 2OD7A 1XMOB 1LPNA 1JIUA 2O1XA 3O91A 3PICA 5EVCA 3AJAA 2GK4A 3W5CA 1GA6A 2QRLA 2WM8A 2CUNA 2CVOA 2PRSA 4X85A 4L7VA 3GUYA 3H2YA 5F3RA 2BM0A 5K2MA 3GLIB 1O96B 1X15A 4GECA 2Z1MA 2ZE7A 1JEJA 1CS0A 2OR3A 3A9VA 2R6JA 3I42A 3IEPA 2GTIA 3DAOA 3GY0A 2VI5A 1MJGM 2JD1A 1W47A 3VBCA 5KYWB 1P7PA 1SUWA 4IJVA 4HL6A 2WYVA 3E53A 3EC1A 4G6ZA 1D3AA 3L7YA 4K81B 1X7YA 2FWBA 3DMPA 2R47A 2Q3CA 1ZH2A 2F8MA 2QL7A 1Z74A 2CLKB 1Q1AA 1YDWA 1QX4A 3L0CA 2NU6A 1AA6A 4DLKA 1DE0A 2AK3A 2Y0BA 1E98A 5DTEA 1Q74A 4R4JA 3SHVA 3EIQA 1ZC4A 2GFQA 2JGIA 4XWYA 5CT5A 2HF8A 3G2LA 3FBTA 1XQVA 2ZCVA 4UHFA 4WEQA 1YR1A 4GOKA 4BV8A 4HNTA 5JBNA 2FMKA 1QIIA 3DV2A 5LU9A 2AKYA 2FNAA 4AS3A 3K1TA 3BQ9A 5FX2A 1J56A 3OZXA 2QN1A 5DYNA 5A05A 4B6OA 1GA1A 3BVPA 1F6BA 3V2IA 4F3NA 1YMVA 1ZOSA 4MA5A 1Y8AA 2R1VB 2YYYA 3MAJA 3A0RB 4ER0A 4BL5A 2WYOA 1X8XA 4A8PA 1MT0A 1L5FA 4OK5A 1WSDA 4HQRA 3GA7A 1RKQA 3NZEA 3WI7A 4TL6A 2HRDA 1HE4A 4Z54A 5DGIA 3GJXC 3NWOA 3KQNA 4GQAA 3VH1A 3N74A 1LJLA 1IY9A 2Q6IA 3X1ZA 2AOTA 1JIJA 1XZIA 2AMJA 2CCJA 1LW7A 2ZJ4A 1BDJA 4MMXB 4PRKA 5COQA 3KKLA 4LAFA 1ACJA 1DJLA 3H0EA 1XLUA 1U9YA 1INLA 1XZPA 3KZ1E 3MTAA 3OE1A 4M3NA 4HQ0A 4OI1A 1TEVA 3O8NA 2IYLD 3W5AA 1XP5A 4XQGA 1QC5B 1XF1A 3S55A 1HWYA 3EQ8A 5F1OA 2LUOA 4A4DA 3SD7A 2FQYA 4ODIA 3ZBPA 2NQTA 1QKJA 4ZYXA 1MMFB 4BB0A 5BXYA 3WLHA 4ARVA 1YUNA 1ELOA 1KYXA 2KBEA 1NVXQ 2IX3A 2WY2D 4WXMA 3I2IA 4NH0A 1XEAA 3KKZA 1RHUA 2IJGX 5IXYA 2ZBQA 3MT7A 1POXA 3GAFA 5HGXA 3I6YA 3OO0A 4FGUA 5CRIA 1UPAA 4DCOA 2HA7A 2W6QA 2NZVG 4LXHA 2PH3A 3P9QA 3JXEA 1XIVA 3C7AA 2C9BA 4AY5A 4BNUA 3GEHA 1JQLB 3EXHA 4PYIA 4D0GA 4RVCA 5F9MA 5IDWA 2QZSA 4QNNA 2JJMA 1NLUA 4HZGA 5AK4A 4Z1MA 1F8FA 1FZTA 1UKZA 4HEA6 1X9GA 4LNAA 4YO8A 3OTQA 1QLHA 5KKAA 3BHIA 1W7AA 2P65A 4MLCA 5C34B 3TR0A 3PQ6A 1X1SA 3DTVB 1WDMA 4OFBA 5FOUA 3S2SA 3C41J 1KIAA 4CQNA 2H8KA 1NJ1A 1Q16A 4R3UC 5JAOA 4IOJA 1CTQA 2AR9A 3HYLA 3UKOA 3ND8A 2X2OA 3ROFA 3SF8A 3PTAA 4OTZA 2I1QA 4CFSA 1GZ4A 5H70A 3VPBA 2OCXA 3GFVA 1BJTA 4MDYA 1ZUNA 3VU9B 4DR5B 3DBIA 4GKJB 2FDCA 1CUCA 1A27A 4UDOA 3UVEA 4YJ2F 2VDMB 4LVCA 3RS8A 2H92A 1UM8A 2P0AA 3OOHA 1SHKA 1PJCA 2WFLB 3FF4A 3FTEA 1VE7A 1YSCA 1Z56C 4JB0A 4ZYVA 3USCS 1W36B 2KX7A 2OO3A 1UH5A 2R6GA 3FOWA 3JVUA 3C8DA 2AKAB 2GKGA 3B1VA 1RSZA 3IAM6 3NHWA 5AK5A 1UR5A 4GL2A 4AAYA 2AYXA 3MT8A 2CJFA 3NM4A 4IQ4A 5KYNA 2ZPAA 4MUJA 3VOTA 2ZCUA 4LJ5A 4LRSB 3ZLTA 2CLSA 4ZI7B 4YRZA 3H1GA 4DWWA 1Z0DA 1PD1A 3DQPA 1VJRA 1T5SA 1BNCA 3IVAA 4G5FA 3W5IA 1G8GA 4H1WA 3TQQA 4B3CA 5IP5A 3ZS8A 3KR0A 5AI9A 3PGA1 3H4IA 1I13A 2VP4A 1KBOA 5UKDA 4HDKA 2VHQA 1QS0B 5K3FB 4AD8A 1M1UA 3GXBA 1KH2A 2V58A 4IQGA 3THRA 1CJCA 5EZYB 2ZWVA 4YT4A 1DPFA 1BRMA 1ENYA 1JEDA 3CA8A 4RV4A 3IHTA 2REQB 4H16A 4FIZA 1JHYA 4KQHA 4TN5A 3IAS6 2PY6A 2WJVA 1YIOA 2ZUSA 3S40A 5CTJA 5AUQA 4D44A 4TTPA 2O3RA 5CIWA 1T4CA 4FVTA 5AVXA 1CSEE 3QF7A 4YDSA 1YQXA 2EAUA 3RYIB 1R4MB 5L7WA 2FUNB 3G0GA 3UWPA 3I62A 1UDRA 4JJAA 3CVXA 2RGGA 3MOIA 3T3DA 1ZJZA 2C03A 4XI9A 3LPLA 2RONA 4MR9B 4BP9A 3H97A 3U3DA 2I62A 4UAGA 3DZIA 1ORTA 4G0NA 5CK4A 5HFNA 3WADA 3ILVA 1H2RS 3OHSX 2WSLA 3VGPA 5JATA 4QWMA 2EGGA 1SCKA 1H4VB 1I3CA 1F0KA 3HYTA 4D3DA 2GYYA 2E4AA 2DUWA 2YCBA 3BDIA 2V55B 2P30A 2PBLA 1A9PA 1R3DA 5ESDA 3DHWC 2P5YA 1NFFA 5BWOA 1H6DA 3B13B 4OUKX 3ADCA 3H6HA 2Z56A 3S1AA 3A1NA 3TLZA 2Z1DA 1U5AA 3PX7A 2VCEA 3ENVA 1QIMA 1Y5IA 3HLKA 3ZXXA 4EAQA 4PO8A 4G0VA 2FN3A 3MN1A 3O8QA 4GLBA 2BFPA 5AHRA 1HFJA 1VE5A 2D2FA 2Q1YA 2EFYA 2XKAA 4I50A 1G1AA 1O95C 1Z2DA 1XZDA 1VBNA 2HDNB 3F9IA 3KJXA 4LNUA 1BVYF 4TS4A 1UM9A 5D3QA 1NMQA 3B3GA 5L95A 4TSFA 3WSTA 4Z0NA 2VTDA 1EM6A 1OT5A 2LDXA 2AG6A 2XUFA 2F1KA 4PVDA 4JP8A 3W8NA 1JLLA 1WL8A 2HFKA 1P91A 5J2TF 4ZO6A 2P69A 5JHHB 2X76A 2I2DA 1OSNA 1NIJA 2PD6A 3HB4X 4CG1A 1SCUA 3GX1A 2DFVA 3WGJA 1BE1A 1DPGA 3K1JA 4CM6A 3IDFA 4OHYA 2V5UA 3OEHD 1J0EA 1KMHA 2NX2A 3E6AA 3F5QA 4B34A 2BZSA 2BGIA 3E8XA 2O8DA 1RXEA 5PGMA 1ID1A 4DIFA 3R3HA 4JUAA 5DOZA 5JZ9A 1GPYA 1U3WA 1WKCA 2EW8A 1YB4A 3OPXA 2IE0A 4O63O 3RVQA 2Q1UA 3TQOA 4RD0A 1M1NA 1MVOA 2Q5IA 2YIDA 1CBUA 3KEOA 4P38A 3CZQA 4W1RA 4MQUA 1OZGA 1RYZA 3PQEA 1Q12A 2QX4A 1TC1A 2VNAA 3UXYA 1Z6AA 2FSHA 4RL6A 3AILA 2HBYA 3IDQA 4NPHA 1CRQA 2O1EA 4BVEA 2ZRDA 3TSAA 4RGQA 1KI4A 3L8MA 5DI9A 4UCFA 1Z0IA 3NC4A 1GL7A 4EKEA 1L5HB 1PWZA 5ISMA 2O7RA 4PO1A 4HFJA 3N0VA 1R6XA 1QZXA 4IBOA 4FKBA 1CLUA 1H2WA 3PXUA 3VR5H 4B6GA 2PIDA 4BWFB 2OZVA 3QV2A 2H6EA 4NOLA 3U4GA 4FEAA 4EPVA 1IWPB 3HB7A 1V5FA 4RKFA 1VTKA 1MB4A 2HA3A 1NXQA 1VE1A 2QPAA 3N2NA 2AYZA 4KACA 4NU8X 4TXNA 2AFIB 2BSQA 1LWNA 2I65A 3CW2A 1WIWA 1L7NA 2GYVA 2Q5QA 3EZ2A 4IL5A 4YPOA 4IJQA 2UYGA 1KWGA 1U9ZA 3GAAA 5IJZA 2YOHA 4F6CA 4KIUA 1B6GA 3LG2A 4G97A 4BCCA 5L45A 5IM4F 1PFGA 1D7OA 2NSLA 1R4ZA 2QTTA 4PZPA 3VBEA 3ADPA 5EGSA 2BEUA 2F43A 2NUPB 5CX4A 3G1WA 4FILA 1A8PA 1P9WA 4J0HA 3W6UA 3C1UA 3ABOB 4KWEA 5AD1A 4LF4B 2MSLA 1BHSA 1NC3A 1XCJA 3H5RA 3JQPA 3DZGA 3MM4A 3H19A 3FHLA 4GZLA 1QMPA 3SQOA 2JFGA 1G8JA 3BWDD 3OLQA 3MGGA 5A7GA 4LBZA 1UJ5A 1CR1A 6CHYA 1T4BA 1VL6A 4U9UA 5KU1A 4ICIA 5TS2A 4J7XA 1GKIA 3M89A 4WNAB 5LA6F 3HY3A 4NBWA 3D7LA 5E38A 3BRSA 3ZJUA 3OTHA 4KGXA 1CHNA 1JKIA 1PUXA 2CNOA 2QA5A 4WLNA 3VU0A 4FCTA 1H2BA 4KXUA 4C4OA 3JWHA 1U7ZA 4BNDA 2ORWA 2QVZX 1K92A 1GA4A 2D06A 2ODNA 3OUTA 3P71T 4LY3A 4S1VA 2D1RA 3BJZA 4GP7A 5IN5A 4CMEC 2JGFA 5LXTB 5DP2A 1TJPB 1YB5A 2BTOA 1KE2A 4DA8A 2XTAA 3GOQA 1EJ2A 1GDHA 2G0TA 3PUWA 1I2DA 4ADSG 2PRYA 1HE8B 2VH1A 4M21A 5GZ3A 3HXTA 2X4LA 3ZK7A 4BRSA 13PKA 4JI7B 2G9NA 5DM70 2FCRA 4Y0NA 3NKLA 4PNZA 1Y1PA 2XPCA 1NUHA 3I76A 3BG5A 2OL4A 3W7BA 2XVMA 1YTUA 3U7QB 1U8AA 2VDWB 3H9JA 3HEBA 1GSIA 5HS6A 5EIWA 3EMBA 4C3VA 2Z2JA 1YBMA 3TF5A 1A04A 1JFFB 5JD6A 3F96A 3HJNA 2ALJA 5E2BA 3NFYA 1M2NA 1SZDA 1VPWA 1D07A 4PLWA 3E22B 2B6NA 2D1SA 4Q4JA 3EEIA 4Q9JA 3PQ2A 5M34A 1U4OA 2EEZA 3OIGA 4U00A 5T3YA 4R1TA 3ZV3A 1MJFA 1GGMA 4I1VA 1YZUA 4WASA 5IT0A 1LSOA 2FQWA 1WW8A 2ZIXB 4D98A 4LOLA 4RW0A 2ZE8A 2QENA 1HR0B 1WD5A 3G6KA 4FOTA 4P33A 3SN6A 4BMYA 1EFUA 4WOJA 3AVVA 3ETNA 1U9JA 3V4FA 1GN9A 1E9AA 4AC9A 3ZOKA 1QH9A 2FGJA 2YWFA 3QF4A 4FKMA 3WWYA 5JCJD 3RK0A 3ANYB 2NO6A 1ICEA 5IC4A 1KP3A 4BP8A 5TQ0B 2R8YA 4M53A 4MUKA 3DW1X 4OBEA 2AV6A 3MCAA 4QTZA 2JCXA 1JN0A 1R0BA 3E70C 1AXGA 4YRMA 2C2BA 4DMUB 5AW7A 4URUR 5CDGA 1GTSA 2RIRA 5JSKA 4WXYB 2XNHA 2W6JD 2BT4A 3TBFA 1GEEA 5F4BA 5E1DA 1MT3A 5TNXA 4ZYLA 3PX3A 1EDZA 3VSAA 2NMVA 3Q3EA 3F6CA 1PFQA 2Q5LA 3H9GA 3MBIA 1IL0A 3EQ7A 1V6SA 4R41A 2K7ZA 4TKVA 2XNCA 2C57A 2NACA 3PZRA 2Z1NA 3OQVA 4OLFA 4X7PA 4B3XA 3JD1A 4OGKA 1Z4KA 4J6FA 1XMJA 4OIFA 5ESXA 5LZ8A 4PWZA 4M0MA 4GOXA 1KR5A 1P6XA 1RWNA 3T12A 1SKYE 2WSMA 4ETMA 5FBVB 3N87A 3B1KA 1I5OA 2PSHA 1SHZA 2OMEA 5ADWA 3R8CA 4JT4A 4RGYA 4BNFA 4U2KA 2Q21A 1NW6A 2FPXA 1BQEA 2BE7A 4J3NA 3WAJA 5DXAA 1GGFA 3PKZA 2JLZA 4I2VA 3E1GA 3UH1A 1N75A 4M8LA 4UZSA 3SJAA 2EBHX 4N3AA 2BDEA 3KZMA 1NQAO 3WL8A 4LVOA 4YMHA 3TXXA 3SHWA 3PZBA 1WTAA 2EOAA 2P79A 4EY8A 2VPPA 1VCHA 4CVNA 5JEDA 2B20A 1TYAE 1JIIA 3NYIA 1J09A 3O03A 4K03A 4OLJA 1JPUA 4AJNA 4HRXA 4X84A 5FA8A 3I58A 1H3EA 5DIZA 3DFUA 1T2DA 3HB0A 1QGYA 4BQRA 1PG2A 2Y71A 1V1RB 2JFUA 3A1VA 4F8JA 1MABB 3O9MA 3QLUA 2QD2A 2V45A 1JHZA 1R64A 4G8CA 1YQGA 2IW3A 4F6RB 3AHHA 2IYVA 4ZTUB 2JGEA 3H5TA 5JDCA 3PQ4A 1A8UA 4MTCA 1EFVA 1SAYA 1XA4A 1ZNQO 2OOKA 4EUEA 2WWWA 2BY4A 1VL0A 3OEED 5KCMA 5KNBD 1N5MA 1PU2A 1G9XA 3AI2A 3OIVA 4KLZA 5DHRA 3OIUA 4RA9B 1NXWA 1V39A 5F78A 1HQCA 3G89A 2QGZA 4P92A 2RGUA 4PG6A 5K0LA 4FYPA 4ZVSA 2EP5A 2CHQA 2MWMA 3IR5A 2EQAA 4M1WA 4BE9A 3R40A 4WFIA 2D5IA 3ETHA 1O57A 2PZ8A 5H0IA 2C3YA 2X40A 4FFBB 4ERNA 3LHDA 2DQSA 1DAEA 2P4SA 1TMYA 4JLUA 3AINA 2ZSHA 2O1WA 4ZQBA 3PNQA 1SVOA 1L5OA 1XDSA 2RCNA 4C07A 4EZBA 5B4UA 4YRTA 3H9CA 3OOYA 4A0QA 2BR5A 1X8KA 2PSEA 1II0A 4K9LA 4QWWA 3S70A 1P3JA 1PZEA 3HFJA 3LXRA 2QTHA 4JEHA 1E4YA 4DZTA 4HAVA 1UAGA 1GRCA 4DC9A 4TYNA 1E89A 1H22A 1V8DA 3I4CA 4NAHA 5ABPA 3B6EA 4LRYA 2VJLA 2QVYX 4C6RA 2ERXA 2Q29A 4KQCA 2UKDA 2OA0A 1KMQA 3GDWA 1X7WA 2XUJA 3LRTA 3OEHA 3KJFA 2WUGA 1JGTA 2DEUA 1Z47A 4DV5B 2ZETA 4GE3A 2B4KA 4IF4A 3UYLA 4BNVA 5B12A 1LK5A 2XQJA 3EIHA 1FU7A 3A1FA 3JYOA 4TYQA 2EFDB 3O4GA 1Z17A 1NWHA 1MAWA 4O4LF 4IDEA 5HK8A 3QV1A 4Y2RA 1PL6A 4E7PA 1BMQA 3MA0A 1KEUA 3FMGA 4BBPA 4RHFA 3RTCA 3G68A 3ZX5A 5CB4F 4NCAA 4WUTA 2AVNA 2YRFA 3TMAA 5HUHA 4G0UA 1OKKD 3X1MA 4ESEA 3ROXA 4HHEA 1HORA 1D5CA 2WIDA 2H0QA 3A2NA 3R7WA 2ZWPA 1FZQA 2I55A 3KX2A 2V7QD 2H4YA 2J5KA 2IYUA 3H4VA 4MH0R 4OB7A 4YPFA 5FORA 4DLXA 2HMAA 1WBDA 4TWIA 2LD4A 1ACLA 3HPQA 2YMQA 3JQCA 5DNDA 1ADGA 2Q0QA 3U4IA 5CT6A 2GCOB 1D04A 3GLKA 3KT6A 3GRAA 4R1UA 1A9ZA 3FYSA 2Y1WA 4WQMA 3QU7A 5FA6A 1RFGE 1W96A 3DB1A 2I3AA 3SBDA 2YFQA 3H8JA 5I7UA 1Q5PA 2AD1A 5G0SA 2BFFB 1I51A 5JH7A 5I9NA 2UZIR 3VOBA 1ZSNA 3QY9A 5ALDA 4H31A 1HT0A 1ZH6A 3NUZA 4QQRA 4MUBA 1L5SA 1YRHA 3JWEA 2QL5A 4EFNA 1Z5NA 1IAQA 1R16A 2VSFA 1R15A 3BDAA 1I6MA 1OA0A 5B2FA 3O3MB 2MSEB 2AWNA 4OHUA 3VR4H 3EB9A 4KFSA 3UW1A 2WC1A 1SD5A 3B2NA 2OORC 3QRWA 4KXFB 3R9IA 4F4CA 1ZGBA 4BEJA 3S2GA 1L6IA 8MHTA 1NL3A 1HQKA 4FHGA 1E59A 2E5FA 1TM4E 3V3KA 2PZKA 2K2WA 3A9TA 3EGDA 4PIVA 3IURA 3MRTA 4GDFA 1YA6A 5AJHA 1IY2A 3OQNA 5LOVB 3K92A 2JFYA 4WK0B 2ONYA 4QUIA 5CVJA 1Y98A 4RGVA 1REQA 2I1LA 5F4ZA 3T7JA 2EJVA 2VC2B 1M6YA 4C7VA 1USGA 3MJEA 1XKLA 2WNSA 4CLRB 1ZRMA 2L17A 3C8ZA 1C4KA 1VSTA 3G9ZA 4KNWA 4M9QA 1UOPA 4PV7A 4B5LA 2DZDA 4ATNA 3GMIA 1BDMA 1R9NA 2WYWA 2H1FA 4LFAB 2OK8A 1IN4A 1A88A 2ZYHA 3PVSA 1ECFA 3H2GA 1EZZA 4Q9DA 2OHGA 4Q1AA 4ZXFA 1N92A 4JI4B 4XJSA 3JASA 1SEVA 4HAZA 2W93A 4DSTA 1MFZA 3PF8A 2ZU6A 1UZLA 1XOIA 2P9TA 3OURA 4FMCB 1UFQA 5D01A 4ZALA 1VL2A 1DQPA 2GN4A 3KEMA 1STOA 1NV8A 2A7QA 2B69A 4X0EA 4D46A 2HRCA 1RQNA 2A5JA 2QK4A 1ECJA 3MERA 5LD2C 3VMMA 4N0DA 4DJJA 3DVRX 3G5LA 1DBSA 5KX5A 3OCUA 1L4UA 1J5EB 1ORDA 4BQPA 1TK9A 2JFHA 3VR2D 5CAEA 3FWPA 5FFMA 1BGWA 2QN8A 1USVA 3GFGA 3WZLA 5BR4A 2XD9A 4E46A 1E2MA 2NO5A 4HX9A 2H3EA 2J0UA 3H6KA 4O25A 1DG3A 4G41A 5JCJA 3PXAA 1W30A 1Z6XA 2DH6A 3GPDG 3RH0A 1TA9A 3EYWA 3ZNQA 4ALKA 2IEGA 4UAUA 4A0RA 4BLVA 5CCXA 5TARA 3GUVA 3R75A 3V8EA 5K8IA 4N5DA 1TIBA 4FPXA 4AJ9A 4D9JA 3UBTA 4LNHA 2D7JA 3FBGA 4M1OA 5BNZA 5L3SA 1YL7A 2GZ1A 3WGKA 3ZDQA 2EFGA 1IRXA 1G17A 5I51A 4ZVTA 3THXA 3QE4A 3LLSA 1XXHE 2W6JA 3E0QA 5BYBA 3T4PA 3GJ7A 4YP5A 5GONB 3L84A 1QJ4A 4BO0A 2HQSA 3LS2A 4KBYA 3VU1A 4GPTA 3UJHA 2AW3A 4MQ6A 1DJOA 1OBOA 1PKXA 1XDGA 4O4JA 4DR3B 1TTQB 2X9NA 1JYEA 4FDAA 1ZWLA 4Z4CA 4GKAA 4YNBA 3RS2A 3RSGA 5KOJB 3M81A 2EIHA 3IYLW 4BNTA 2IV7A 1FS5A 4CLHA 1U1IA 3DKRA 1N5DA 2AD5A 1WD7A 3TJZA 5KJFA 2GZRA 1SXQA 1QFZA 1OZ0A 2O50A 2W83A 3N8KA 4Z9YA 4XIJA 1CCWA 2P2NA 2Y68A 3LYAA 1GKKA 1NUUA 2P2DA 3JQ6A 4X1IB 3TDMA 1U80A 3NOOA 5JE8A 3PXBA 1E18A 3GCWA 5GAJA 3RSFA 2CSXA 1ZK4A 3C14C 2OG2A 3HU5A 4MVJP 2Z6UA 4ER6A 1ML3A 3BCRA 1SMKA 4JK3A 1DTWA 4CKBA 4DZRA 2E6KA 4YMWA 3P0IA 3HR8A 4CDNA 1NVDA 4JJGA 1XTQA 2WSBA 3UGJA 3IBCA 5CDUA 4KPUA 3T99A 2GF0A 4RGBA 3VOAA 2IK8A 4N12A 1KOLA 1FJHA 1PHRA 4IDNA 2ZSKA 1SG6A 2ZRHA 4DRZA 1V5IA 2NU8A 2FKNA 1D2CA 4TM8A 1YNOA 5LYJB 4WBSA 3ORSA 2OE2A 4IUCS 1QOQB 3GLIA 1M34E 3FMVA 3Q8XB 5KNBA 3OEEA 2CNDA 2FMXA 5CPFA 4Z9XA 3O9VA 3OOEA 3WYDA 3R3UA 1I4LD 4G8JA 4MITA 5LSAA 1BOOA 2C4NA 4J03A 5DYGA 1DQZA 2G25A 1V1MB 2J9FB 5FOQA 2PMBA 4L16A 1U1FA 3P8ZA 2VRCD 3B82A 5CDFA 4J9UE 3ZVLA 1E6WA 1JBKA 1X7XB 4ACAA 4EPTA 1RKXA 4PYLA 4Z5XA 4LYFA 1N0IA 3V4VB 2Q9BA 1JAYA 3VNSA 1YDEA 4ZCMA 3SMVA 3TUZC 2OESA 4HDSA 3ADBA 2YW9A 1T6NA 4KDCA 2FSIA 3T5GA 1YJCA 4M1SA 4IGEA 3RV3A 5BW4A 4P7KA 4ZFNA 3WK5A 4EGAA 2AN9A 1LBQA 3MC1A 3QPUA 4PC2A 3Q3VA 2HHLA 3F6PA 1KL7A 3NBYC 4TWBA 1TCCA 3P2OA 3RTGA 4AIIA 1CJSA 2I6XA 1LDYA 5JSZB 4AL4A 1ZJJA 1OV6A 1RM4A 4JA0A 1NDHA 1CY7A 1Y8QB 4RAOA 1L1FA 4KHPB 1HF3A 4JBGA 1K7SN 2HBZA 2VIIA 3COSA 5FFFA 3JU3A 4BLSA 5IXSA 4ZICA 1KEVA 1G3MA 2UZ0A 3ZIDA 2JFBA 4KWTA 2I66A 3H05A 1I3OA 3GRPA 4L72A 5LCXA 3SDBA 5I9IA 5TGDA 1C0IA 4S0XA 3T4EA 2FEXA 4PNEA 5BUSA 4US2R 2O8EB 1YK1A 3STUA 3C48A 4ZDJA 4FNOA 3WLSA 4GLLA 2A7XA 3BE6A 2PUAA 2JAQA 1UT8A 2QGNA 1JZQA 1JKMA 2VSYA 2J85A 3N39C 4PYQA 3RT9A 5IVHA 1OKKA 2ZS9A 2P2YA 5ALUA 1FK8A 3UN1A 1G8AA 3IP7A 1MVNA 4HN2A 1P80A 3VZSA 1TMKA 2NYAA 3Q3JB 3S5UA 4B3HA 1RZ3A 1J4AA 1VG0B 4ZZ2A 4AKTA 1IUNA 1TLTA 1MN6A 3OOJA 4KAJA 2QMYA 2YN0A 5EWLB 5AVWA 1K0UA 4WVFA 3MTQA 2GEKA 4HWGA 1BTOA 1NUQA 5ETJA 1A1SA 3TW6A 3I9LA 1UKVY 1P5RA 1Q1GA 4RKWA 4OL0A 5KYGA 1JA9A 1AMOA 5JYDA 1NW4A 1Y8CA 2I80A 1AT1A 3OJLA 1FPMA 3RR2A 3RROA 4Z3OA 1YJXA 4TTTS 1ZXXA 2O2SA 3ZZNA 1E9CA 4TMWA 5FBZA 5A5FA 4DV1B 5IARA 2XXAB 2FVYA 4KSYA 1LRKA 3QVUA 1FY2A 4H7KA 4MRSA 4XA8A 2I2XB 5HDBB 5EPEA 5KYKA 3BRCA 3T6KA 3LUPA 4KXYA 4DKXA 1BWQA 3QNWA 2O8VA 1NXSA 2P90A 4MV6A 4JOSA 3LP8A 1AF7A 1XWFA 4EY4A 4JBYA 1MIOB 4WN9A 3LQRA 5BV2P 4TYYA 1H2FA 3KL4A 3TKYA 4DQDA 5IULC 4IYJA 2ECFA 2W37A 3H75A 4P2BA 2QLNA 1ZNZA 3KJIA 3VU9A 1I7QB 4KI0A 1G4UR 1LPBB 2I71A 3GJTA 4PZCA 1ABFA 2YN4A 3BEDA 2HA2A 4JVOA 2AI3A 3S1SA 2ZJBA 1D5WA 2AFRA 3INNA 1P9LA 4PLFA 3PHGA 4KYUA 1UMBA 2V98A 4E2WA 1AQ6A 5I8ZA 3L4BA 5LD2B 5C5CA 4D26A 1L4LA 1GNPA 2WKWA 2J5RA 2A59A 4S2UA 3GCXA 5ERXA 4QKQA 5IKMA 2E6UX 2ZIFA 3ASVA 4HNAB 1Q2UA 4J7CA 4PINA 3D2BA 5SZIA 3ZBUA 2Q07A 1UQUA 5KWJA 4D25A 2CUTA 3LOQA 1U0NA 1OWMA 1DAGA 1OLXB 2OM6A 2XJ9A 2IP1A 2UZAA 1NNEA 5ALXA 5DHUA 2YFKA 1KY2A 3ILXA 2QY9A 3R44A 5A7FA 2Z04A 3H3XA 2GYWA 2FPRA 2BRUC 4TROA 3REQA 3GG9A 3S99A 5BV8A 3SYRA 3WRVA 2D4HA 4OGLA 3IC5A 1Y6ZA 4M36A 4NL4H 3GLFB 4R7ZA 3WS7A 1G5QA 4ARZA 3PGXA 5KWIA 1QS0A 1YC2A 1F1JA 3RK1A 3EZ7A 4JJ8A 1GPWB 4Q9IA 1EXWA 3HNOA 2PLNA 1FC0A 3O9ZA 1E99A 2K5UA 4TTVA 3DZJA 3A6LA 1A2OA 4AECA 3L6CA 3D7KA 4BLPA 3ZS9A 1G8MA 3L3BA 4RD4A 3D0QA 3H3FA 5AM5A 2MSCB 2I7TA 3PGKA 4RCYA 2CEKA 2Q3BA 3UJ8A 5DLPA 2ZRMA 2VJDA 2AR7A 1A9TA 4J7UA 1XRSB 4YALA 4YRKA 1R4MA 2GOYA 1YB7A 3GT0A 1O94C 4J1NA 1JDTA 1WV1A 4YRIA 1T1JA 1FPQA 2J3LA 2WJ4A 3DH0A 3NAQA 1Z2EA 2KJQA 3HUUA 4G81A 4WERA 5DZSA 1ZJYA 1D1SA 2IVZA 2XLCA 2VUTA 2YMPA 2PUTA 4CQJA 4CM8B 4EI9A 4GXTA 4M1ZA 3NHZA 1U11A 5BNIA 3GP5A 3OJXA 1I0IA 1MF7A 2X1HA 3IOCA 1JH9A 4F92B 5FI1B 2ZRNA 2GJ8A 1IEVA 1KRXA 3N8DA 2GDZA 4FW9A 1TJYA 2BBSA 3R0QA 5FA5A 3UZUA 1TW3A 3IBSA 1HE1C 1NJGA 4A73A 1IK6A 1N5KA 4CT4B 3H9QA 4KR7A 1XMQB 1P6QA 2IDMA 3FCUB 3OF3A 4DN6A 4B47A 4UEOA 1Z7EA 3DEFA 2JLVA 3W2GA 4MGKR 4YACA 1DUVG 3W9YA 3VR6D 4U7DA 2G76A 2GZ2A 2D5BA 2E49A 3CPJB 4RVFA 3U48A 1E69A 4QPDA 3WMRA 4FZ3A 3NS7A 2M1ZA 5ICFA 1SQFA 3DNPA 3NQ41 4B09A 3AOGA 2M98A 4UW9A 2X15A 4P82A 2RGDA 3RJZA 2BHNA 1LLDA 3VKHA 3RV4A 5JASA 4BMSA 2YS7A 1QXSA 4PRZA 4RFVA 4RTLA 4MI3A 3LGXA 3N2GB 1W46A 3K6KA 4KOEC 4ABTA 1G4HA 4K6FA 4TYWA 5C1DA 5E7IA 4D9BA 5DBGA 4KDEA 3Q6IA 4D99A 4JLBA 2Q2WA 5JLJA 1T9GS 1R10A 3GELA 2B8TA 1MO6A 3IILA 1O0CA 5AUOB 4KQEA 3RAEC 2Z6QA 3UT6A 5A0TA 4PXAA 2V6MA 3P2JA 4Y2UA 4E5UA 5EHIA 4INPA 3WSVA 1PX2A 5TEWA 1G21B 1T6XA 1BFKA 4KQIA 2GBLA 4B17A 3UJCA 2Y67A 1C8KA 2HNAA 2C7VA 3BH6A 2ADOA 2A86A 1V8PA 3IV7A 3OM1A 1RRGA 1WHSB 3WGNA 3CM0A 4LYGA 2QRJA 4TWAA 2J6IA 4Y2HA 2JHPA 3CVVA 3JX9A 4R2HA 5FHRA 4Q7LA 5K0FA 2XT9A 5CT8A 3T7KA 1Q0PA 5J63A 2N1MA 1AS2A 1Q22A 3K9WA 3M9LA 1HDIA 3CCBA 2CLEB 5F77A 5EWMA 4CL8A 1W6RA 3KB1A 4EFDA 5JXWA 2J0SA 2Q1XA 4G1MB 4RIEA 4YBZA 2C2HA 4C43A 1IY0A 2R8BA 4YLEA 3UB4A 4EA8A 4II3A 1G20B 4MI9A 2VJYA 3ZWAA 1Z5UA 3UMVA 5CB4B 2BKEA 3WL7A 1EBBA 1LBTA 4GUDA 4O8ZA 5J2UB 4MLZA 2OBXA 7MHTA 1BOFA 4C01A 3LK6A 2Q28A 4L6AA 2I6TA 1A4IA 4U2EA 1J39A 1NZFA 2ZDHA 4TXMA 4C7JA 3OC6A 4P4UA 1C7ZA 1NKTA 3P9XA 3WQHA 3L8FA 1JQDA 1ZYUA 4MQMA 4ZVPA 3EGIA 4CNQA 3K20A 1RQGA 1O9HA 3SYKA 2IU6A 4NF2A 4P6VF 4FDUA 4WCFB 4YQFA 1JHQA 1PGPA 3BZBA 3GBVA 1LTQA 4EHHA 3QX3A 4PO9A 2PT7A 2XMPA 4D9EA 3DZHA 5BVHA 3UTDA 3AJRA 1AM4D 3BZWA 4KH1A 4F5DA 1SU8A 3LDGA 1YQUA 1Z5PA 1RBZA 1ZLXA 2DUUA 3T7EA 3TR5A 3KD3A 3KT0A 4Y0VA 4LE2A 1L7BA 4XQCA 1WDWB 5E8RA 4BWVA 2GCEA 4D9NA 2YJ4A 3CBQA 4P86A 4YI5A 2C8VA 2JLXA 3C7TA 3ZE2B 3QW4B 4ZREA 1YS1X 5IASA 2ODWA 3SZ3A 1Z36A 3QFSA 4PLHA 4WNAA 4K9SA 3W90A 1ZAKA 1U2TA 1E1NA 4XFDA 1W1UA 3F90A 4FYMA 4LOHA 3HCAA 4XGNA 2Z8XA 4H1UA 2PUJA 5EJ8A 3VAAA 5C8YB 2DWUA 3CRQA 4FMPA 4XRRA 1QANA 2AZTA 1GG2A 1JHVA 2WU3A 1MORA 3UPTA 2XMBA 5JPCA 2W2VA 4JOBA 4K9PA 4IMJB 1W2HA 2O2HA 5DGCA 5LXTA 2BGGA 1XZMA 4BB9A 3ORQA 1JR2A 3L01A 4FXOA 4A1FA 2PVCA 3HVRA 2IGBA 2N3ZA 4N5NA 4KUGA 3EJ6A 5AIBA 4H9GA 5E6RA 1OZHA 5EA2A 1PN3A 2G0NA 2GJKA 3D8BA 5M3BA 3U7QA 4TLEA 2C3PA 2VDWA 3TEFA 3ZHTA 4CUJA 2JJ2A 3GLTA 2YJTD 3EXEB 3HRHA 1F3LA 3ZHQA 3HXQA 4QYTA 2ZLBA 3T5AA 4MHOA 1L7RA 1RP1A 2C7OA 1U2SA 3DZCA 3REFA 4RTQA 1LDGA 2A9FA 2IYPA 1NURA 2ZIZA 3AUFA 3EWIA 1UKCA 3NHRA 3QPVA 1T2CA 5TT1A 3V8RA 2RBEA 3DQZA 3E22A 1G1MA 3LUGA 4P5PA 5AW0A 4GUAA 3JCZA 1UC8A 2B0CA 2OC4A 2R2AA 4UREA 1P4AA 4GFDA 1XRPA 1TAHA 2C2ZA 4M0LA 5JO0A 1KOJA 3EYAA 3KWLA 1YCGA 3QVWA 4WLOA 4PGFA 3TQHA 3PC7A 4R2KA 5ER9A 2PFKA 2WIAA 2DBQA 1ZESA 3IEXA 1YU6A 1IH8A 2AFHB 1ORVA 1QBKC 3T52A 2C7GA 1SULA 2OZEA 1NQVA 1SIUA 3FX2A 2ET6A 1THGA 3R5HA 5EJFA 5IKOA 3E18A 5TQ0A 2P4EA 2AOVA 1ZJ6A 4UDNA 3QELB 1IBKB 1UK6A 1PV2A 1YI8A 4LV8B 1RXSA 1V4NA 1DAOA 4XPIB 5ALJA 4GLFA 4LTDA 3QSGA 1DG9A 2Y2UA 4IHJA 5KOIA 1C4OA 1L5NA 5FTKA 3PXDA 4RYLA 3K0CC 2QTZA 1KY4A 4M1EA 3H1TA 2KS6A 3ZBTA 2FPPB 3TH5A 2W2MA 5BR8B 1DXHA 3AEZA 2NZXA 3DAGA 3NG1A 1S2DA 2ZROA 3JRXA 4QOJA 4ES6A 3RKSA 4NJMA 2F1IA 3L0BA 3HTXA 3S68A 1DDOA 3NDRA 3ZXIA 2COUA 1LH0A 2DOKA 1XDZA 1WBBA 3ZLBA 4IIJB 5FWNA 2QHXA 2XUPA 1HDZA 1QRTA 1QORA 1I1HA 4ENSA 1VPTA 2NTEA 3PFBA 5DULA 1CR0A 5FBWB 2WPNA 3IB3A 3WHIA 1UPXA 3HWRA 3TZEA 1AU9A 2P1DA 1X9HA 4HNGA 3PE4A 4IHQA 4CTKA 2YVQA 3LQKA 4FOLA 2QXYA 1BHJA 5DN6A 1U2DA 2CXTA 5DNAA 1QDLB 3V8VA 5K99A 1JIXA 2FW7A 1VP9A 2HJGA 7REQA 4OXQA 5EHZA 3FOCA 1KZ7B 2FOLA 3D02A 3FGOA 1OI4A 4QDJA 4WZAB 4Z8YA 3VTZA 5HJ7A 2R79A 2M6RA 5LUAA 2YZ7A 3DMRA 3K0FA 4FU0A 1MABA 1CS4C 4ITRC 4YRQA 4BFVA 1RRCA 4GAEA 4IFBA 3BORA 1BVUA 1USUA 3JYQA 4LDRA 3AW8A 1G2QA 3RVBA 1WXWA 2FMHA 1O5IA 3LSYA 4CCYB 2IYZA 1ZBQA 2VZ8A 4F21A 1ZO8A 1OFVA 2ZBRA 4LJ7A 3LC2O 1U02A 4J0KA 4M1KA 3RK4A 4Y2PA 1T2UA 3D1LA 3WLIA 4J90A 3TIGA 4IXWA 4MYRA 3ZXUB 3B9QA 3ZU4A 1PS0A 4XXHA 4ABYA 1WJGA 4NPAA 5JRJA 2P6MA 4BBZA 5FF9A 4X6LA 3ST7A 3VR6A 2IFTA 4GQBA 4U7FA 1VCIA 3A6GA 3ZQKA 2O9JA 4NZNA 4TVBA 1Z2NX 2H4WA 3A1TA 4WFKA 4YA6A 4AMYA 2HIMA 4CMIA 4I1UA 2NZWA 2VDVE 4NBTA 2HT1A 2TYSB 3HADA 1AQLA 4OQPA 4OM8A 4RZHA 1JF8A 5AVSA 5C4GB 2W98A 5KC9A 4TWRA 3D8HA 2P11A 5IANA 5BV0A 5CBPB 5AICA 4NV0A 5J58A 2RARA 3PEEA 2OT3B 3BYZA 1U8ZA 3K0AB 2OGSA 4YAIA 2CT8A 3CINA 3D5TA 3BN3A 4JELA 1Y9EA 4KREA 4GP6A 3E5RA 1UINA 3ELBA 4YMVA 1LUAA 1U4NA 2EKBA 3C24A 4M1MA 3HCWA 3TD6A 4BQIA 3EF1A 1NUAA 1A2BA 5KB3A 1U3UA 3OSUA 2HQOA 1EUZA 3GJZA 3HCCA 1JNXX 4AO8A 4D3FA 1IHYA 2YHSA 5B58T 3ZGVA 2IY8A 2A4KA 4EEZA 4BKUA 1FW6A 2V7GA 4BXOA 1WY7A 3OQJA 4GLJA 4DLWA 1U0BB 2O59A 2DHDA 4HB2A 3H86A 1VLVA 4B74A 1XD2A 5EP3A 1Z75A 1PR0A 3NGMA 1ISPA 3DTTA 5HBRA 4EHBA 4MROA 5L7YA 2VUIB 1TDJA 2J08A 2YBEA 2ZZNA 1EAYA 3O4IA 1BJKA 2R5WA 4DADA 4XWAA 1EP2B 3V6MA 2RGBA 5D85A 3VI3B 4OXKA 3ZVNA 4OHKA 5ARBA 4ECEA 1RZRD 1G8FA 1OC4A 2KLBA 2WNHA 3EY9A 1S01A 3AUAA 1YV9A 2A33A 2IHUA 4J2HA 3PXGA 3IP9A 2PXHA 2IY7A 2JKZA 3TIVA 1CD5A 2Q1WA 4JEMA 5IJ9A 4R2LA 1WXXA 3QKWA 4KQ9A 2ZJ7A 3KOUA 3LHSA 3JQ7A 4R1LA 4CGYA 3KE9A 3F6EX 3IJRA 4Q3OA 1DZIA 1ECGA 5DI3B 3P2EA 4UTZA 4ZYZA 5AJUA 4GO1A 1ZCJA 3U16A 2PUDA 1OFTA 3QW2A 4IXDA 3QVKA 4KMRA 5DHSA 1P75A 1UOQA 4LG1A 5KNDD 3EPLA 2RHRA 3UHJA 3T7IA 2J9RA 1LLQA 3IQEA 4D4IA 1RKVA 2N1BA 2WG0A 3ICPA 3QM1A 1NXOA 2D59A 3GR6A 2ZANA 1E3WB 3WGZA 5CYPA 2HDHA 2IODA 4M6WA 3C3CA 1ECLA 2PX6A 4BNJA 1DKOA 4BWGA 3EC2A 2GPBA 1H4SA 3E61A 1C7EA 2AB0A 4TUYF 4DMHA 3T3EA 1T0JB 1FMLA 2VKTA 2WWTA 3WLAA 3ZW8A 4EUKA 3ZDDA 3HB1A 1X74A 5EJEA 5GV8A 5CW1A 2ZI5A 2CJPA 4HAIA 4EYEA 3A14A 1NX9A 3D4IA 3VDXA 3DDNA 2FR1A 3OEYA 2X2FA 1JJ7A 2XX3A 3QLVC 3H2SA 4Y9UA 2VNSA 2C9YA 3HKBB 1E1RD 1QAOA 2FZLA 3IAFA 4HGOA 4YJKA 3ZIUA 1ZGCA 1WDKA 4DCCA 2VDRB 4IQ8A 5CCBA 1XALA 4ENVA 4RPLA 1GDTA 1VA4A 2Q5JA 3WRXA 1OR8A 3KQPA 4LK3A 3L49A 4QTXA 2FE1A 1RHJA 2V54A 4A9AA 1N0WA 1TM1E 3WDKA 1D1TA 4ZP1A 3ESDA 1V3UA 3BXFA 2Q9UA 3KHSA 1RW4A 2AH5A 3CLTC 3NBAA 3UATA 3EEFA 1ZUD1 1NNI1 4MV8A 5I7SA 3GCZA 5KSYA 4V24A 4YJ2A 4EA6A 4NOKA 4MKIA 1QCDA 2PGNA 2QXUA 3IS3A 1V71A 3GVPA 1HDXA 4DUYB 3P0JA 4D5EA 4DIBA 5AVRA 5ARCA 4XVRA 3K5IA 4HLUA 1QIDA 3WNZA 3S3TA 4QIHA 1JKJB 1DRJA 2ZQYA 1AB6A 1KEKA 2WUEA 1GU7A 2YWRA 2JI9A 3G02A 3G7NA 3VX3A 4A8JB 5C4MA 4BCDA 4LY6A 5CG2A 3IKVA 2FSFA 3KQSA 4KNVA 1IONA 3OPYI 4EY6A 3IIEA 4JT9A 3AVXA 1S2OA 1G16A 1PK9A 1QB7A 1R6VA 3COZA 1DFGA 2FFAA 2IPAB 2WJAA 2ZOSA 3DONA 3IXQA 4G65A 5DYIA 3OQHA 3QVGB 2OKCA 3RS9A 5ED0A 4EF6A 1BX0A 3M5CA 3Q0TA 3DDOA 4PHGA 1XLTC 2B2NA 2BKLA 3FKSD 5E3HA 1IXYA 3NB0A 1UBGA 3ZCRA 1XCGB 2FE4A 4JIGA 1M3SA 3GV0A 1DEXA 1KAHA 3X1KA 9ATCA 5E1MA 4QUDA 2Q3FA 4CI9A 1UDXA 3BL5A 2IEZA 4IVRA 4RVGA 4XGIA 5BT8A 1T0IA 3IPRA 4MP3A 4YUZA 4LDPA 2GM5A 2PNJA 6NULA 3JPWA 2P2ZA 1RBQA 2AXQA 5L51A 3ZU2A 3B3QA 3GLHE 4PQEA 4X7BA 5JZMA 4YT2A 4GMXA 1ONBA 1NP6A 2BUBA 4N5HX 1HDOA 1MA0A 1FSFA 2UV8A 2RJOA 2HU7A 5CXXA 3G2MA 5GY7A 1FDUA 1HDCA 1ZIOA 1U8UA 3I04A 3M1AA 2VHZA 1T0HB 3SZOA 1KK1A 4I4TF 2DM6A 3QG5A 1HDGO 1GQOA 3QU5A 4DYVA 4UVEA 5KSPA 1XU9A 5G1NA 3W4JA 3QTTA 2E82A 2OPHA 1Y8RA 3DFIA 3P4YA 4GSYA 4YCMA 1E63A 1ODLA 1GZ6A 2ZUCA 2PT9A 3OZEA 4JL6A 5BY2A 1EDOA 3A26A 4BO6A 1FRFS 1PE0A 3O6VA 1G63A 3EHDA 3K8OE 1NVEA 3X1WA 4YX9A 3A3YA 4FSDA 4Y2SA 3KL2A 1A7JA 2X5OA 3DE3X 3T1YB 2YVAA 4UPVA 2QMQA 1MIHA 3GHHA 1RHKA 4J1TA 4JSRA 4XGKA 5CVCA 1ODIA 4LSMA 4E03A 3CW9A 3CF0A 4S1PA 3PL1A 4G23A 4RY8A 2FUG6 1NAIA 1NONA 1EX7A 1SCNE 3U17A 4X95A 1XJ0A 3KQOA 4BAUA 1VXRA 2Q1TA 2QBYB 2GLXA 3FYDA 1C7QA 5G41A 3G5MA 3GA5A 2OXCA 2ON6A 5JAZA 1P9NA 1G3UA 1DC4A 1D4AA 2IHJA 4FFLA 2NUBA 4N03A 3WYEA 1SUDA 3LT2A 5DYYA 3MYRA 4YONB 5J23A 3GWZA 2YWJA 3L1HA 2PCLA 5JNSA 1SJ9A 3ONFA 1C1DA 1AV6A 5HIIA 5CA0B 4WOCA 4R1NA 1TEHA 4OUDB 4C0SA 1TVMA 2W22A 3L9WA 4OP3A 4B3RB 3O92A 4Q1VA 1RPTA 3CNNA 1ZK3A 2CMDA 3INRA 4YDRA 1BWRA 5JVDB 2TS1A 4BRUA 2A0UA 2OCLA 2H2WA 3DZBA 2E2WA 4KE7A 4MPTA 3SE7A 4MRRA 2IXEA 1ZD3A 2V7EA 3PFFA 1GP2A 4Z0TA 4GI2A 2QQEA 2C5HA 2RJ3A 4XW2A 2HPHA 1H9AA 1IUPA 1UC9A 1V4BA 3ANNA 3D7SA 3LQYA 3IJ5A 1DIOB 2XSZA 3DOUA 1JB9A 3FCXA 3HJHA 3IB6A 4L0CA 4MVJE 2EERA 5CX1B 1KDYA 1QPZA 3WQQA 4A03A 2B1RA 3K53A 1OV4A 3MG9A 3AJ9A 1WEKA 2J32A 2LKDA 2GRAA 5CJ2A 2JLWA 1M83A 2J87A 1S2MA 3M6MD 2J9FA 3BIXA 3WZMA 4EB0A 4NBSA 4GZ6A 1X7XA 4GGOA 5IABA 2HPZA 1OE0A 5SV2A 1TUGA 2W58A 3SNHA 4JKIA 1GQYA 3NTQA 4MJXA 3W5SA 3PNKA 4QARA 1G2PA 3LZ6A 4QQFA 4EL5A 5K8UA 3WJ7A 3OLVA 2V96A 4L4XA 3ROPA 3OKCA 4INOA 4HFMA 1WP4A 4GOND 5CYOA 4DCMA 3I5UA 1M1ZA 4EFLA 2SECE 3FPEA 1BEZA 1GCGA 1NU8A 2J3KA 1C29B 4I55F 3PNVA 4TQUS 1ZOOA 2IUFA 1I9GA 2BMEA 4KGZA 4JJEA 4OAPA 3B6KA 3LBHA 2C4WA 2CL0X 1P61B 3CG0A 1W49A 4L9WA 3M5PA 4QAJA 4TTRA 1YCHA 4UJ5A 1Y8QA 5CPBA 3FGZA 5HJ5A 3KQWA 4Q3DA 2FMFA 3K9QO 3VPHA 5LIPA 5F2OA 2CBXA 2C88A 3U9TA 4MWDA 5IM4A 2XCRB 3IO3A 4UM9D 1ZHHA 2V6JA 5BMOA 3AB3A 2CXUA 2D1TA 4C08A 3RVDA 4HPJB 2IUYA 3TVYA 1T35A 2QLJA 1J0DA 2R8RA 2R7MA 5LKAA 1CT9A 3CSDA 4B6FA 4KWHA 5BQOA 2C94A 1NQ5A 2PNFA 4M22A 5AI5A 2BTQB 5BN5B 4UHKA 1RZRA 4H27A 1U7HA 2AN1A 1A4XA 5KQRA 1N5IA 1YS2X 2OXTA 1ZSVA 2GH1A 3SFZA 5LJIA 1U3TA 2JLYA 4F4DA 2EZTA 4ETIA 1B8NA 1K8ZB 1DKRA 3ICVA 5B53A 3RVMA 3V1YA 3EBOA 4JQOA 2G06A 5LMNB 2EXXA 4UVDA 4D9HA 5EWLA 1BD4A 4LF8B 3WVNA 4DT1B 2WIGA 2GD1O 2RK4A 2VP3A 1Y81A 4N41A 3A2LA 2JBAB 1CHDA 4AP5A 3ZDZB 1Y4DE 3DLCA 1ZK1A 1E6CA 1SG9A 2ZYSA 3HGQA 3R6TA 4QDKA 3RDPA 5I7RA 5KNDA 2ES4A 3GBSA 5DTIA 4DRXB 1AS0A 3GH1A 3L6EA 4LN1A 1AUVA 6LDHA 3FTNA 3F4KA 1E0JA 1QVVA 1LF5A 1BX1A 1CY8A 1N0VC 1O9BA 3PD0A 1UJBA 4K8RB 4E08A 5HKOA 2X6TA 1T9BA 2WTEA 3CWCA 3FCCA 3OZUA 1N6IA 5A9TA 5TLSA 2FQXA 2QTWB 3C3DA 2XCSB 1Z39A 1HMPA 3U61B 1YL6A 2QT0A 1E2FA 4KXNA 3SIXA 3QBJA 1F7UA 2GUGA 3G3EA 4JJ7A 4JH0A 4DCUA 1NYLA 3U4CA 2ZKLA 3ONDA 5BYJA 2OO7A 5IUKC 1RYEA 3N7AA 1CQPA 1LDNA 5LQRA 3ABRB 4C0HA 1WY5A 1BRTA 1B8PA 2X23A 4ZODA 1SURA 2IBSA 4QX6A 1A9XB 1YZTA 2F48A 2OV8A 4ZD6A 4PAWA 4KQMA 3GEPA 2I22A 4KMOA 1G6HA 3CNBA 5C51B 2JLUA 1IZZA 1CQJA 2MHCA 3PE6A 4FHCA 3NRJA 4JXJA 5HA5A 1D4ZA 1TUBB 3DMTA 3T9AA 1CFZA 2Q5CA 3L07A 4R2WA 3T54A 5ENZA 2BKXA 1C0KA 4OEHA 1HK7A 4RS3A 4PPFA 4MVYA 3TOZA 5JD4A 1UQRA 4HNAA 1H3FA 4MS4B 2VDJA 2RHTA 5IT9A 1M1XB 1UQTA 4PSCA 5DK6A 1Y7HA 3K31A 3VVCA 2XUHA 5HVNA 3QYPA 1AUQA 4XB2A 1PR9A 2F62A 3CLUD 3AKZA 1ZVKA 3AL0C 5K51A 2XYPA 3FLEA 3N2ZB 1E9FA 1TD9A 3R77A 2AMLA 4OY3A 1SB8A 4H0CA 4QGHA 1NVVR 2QSUA 3PT5A 4YO7A 3K6RA 3GLFA 4I9HA 3TD2A 4R1OA 2B1GA 3O73A 4B85A 4DGSA 5CA1B 5LC1A 1EM8B 2WWYA 3TMYA 4D9IA 2Q9CA 4D9CA 3U19A 4WJKB 1ZD8A 3TIIA 3VYVA 1N2OA 4MPRA 3WLPA 4EP1A 4LF7B 2QAIA 3WRYC 2H2HA 2JZOA 5TXGA 3LWBA 5HQTA 3LPMA 3ZCTA 2AN3A 2ZAIA 1XZAA 3L1KA 3L1VA 4OA8A 4DZZA 5HNKA 3J7TA 2FW6A 3CRZA 1GL6A 3FKSA 3WLMA 3LPNA 4JI8B 2F9MA 3DZDA 4KQGA 5ALYA 1ZG3A 4FE7A 3MCUA 4IV8A 1GKUB 1KZ9A 5LQAA 2VUUA 4UDYX 4AYXA 2PKCA 1TM3E 1QRUA 1S3IA 2QPTA 1GV0A 4GM1A 5HKBA 4PN3A 4X90A 4LBYA 4CM8A 5ESWA 4BGIA 3V4PB 3O8DA 1SWVA 4AN1A 1FQOA 5A4KA 3L82B 1H5UA 3OD5A 1FUIA 3T95A 4UM8B 2DYKA 4FNAA 2AKEA 4JYMA 1GADO 4DSUA 3IA2A 4LISA 4HUTA 4OYYA 5CFZA 5B5SA 3ZVRA 2NUAB 1A97A 1O7JA 1ZN8A 2MTBA 1NVAA 2VDNB 1R6DA 2Q3HA 3FUXA 4MVJM 4E4RA 1XUOA 2GM9A 4FN5A 3UUGA 5HBGA 4LJRA 1CJMA 2IU4A 1X2BA 4KLNA 5DASA 3DE5X 4QASA 1LNSA 3ENKA 4UOEA 1IJKA 1GZHB 3GWGA 2BFWA 4MKFA 4MMZB 4N8EA 1P1CA 1U3CA 5A5DA 5MFPA 2CHVA 5DSXA 2CXQA 3BKWA 2HMSA 2QP4A 4URWR 3P5BA 1DARA 4PCVA 3C5VA 4EVQA 3EGWA 4NQRA 3ZN2A 2G8NA 2ZT7A 3NH9A 2P1RA 5E7JA 3DT9A 1EB9A 1XKQA 2UYQA 3N2GA 3KXPA 4X24A 5AOBA 5K0BA 5GZ6A 4LC1A 2C31A 1S89A 2XYQA 5JLAA 4EL0A 3NAMA 3CUVA 2RGYA 1WPRA 2MJLA 3ZY6A 2AJDA 3EXFB 4L4SA 5DISB 1RXCA 1VB5A 3AEYA 1FFCA 3IVGA 5TT0A 1QV6A 1UEXC 4EVIA 3HFGA 4DYDA 2A9QA 4N48A 4N7JA 1I3MA 3CT6A 1FJ2A 2G6TA 4ZO8A 4E13A 3K2BA 2DR0A 5K6RA 3A6EA 1WHSA 3ZHBA 3HO8A 5T4BA 1N9KA 1EGMB 1PWEA 4W7IA 3GFBA 3S7ZA 4FYIA 2G6BA 1B4DA 4HLNA 4NHOA 1JAZA 1EJ6A 1ILEA 5KTMA 1MJNA 1XP8A 2HMYB 1PZFA 4C4XA 2CY0A 5KVCA 3QOFA 2XBMA 1PO7A 2QM0A 3GFTA 5LKRA 4BE7B 4PZZA 4WZ6A 4JJKA 1GZUA 2PBZA 3VHXB 4DBZA 4GE0A 3RVJA 1QU2A 1HFWA 4O4LA 4Q4DA 1NVFA 3KPJA 4N7MA 5LP6B 1ZKMA 1G5IA 5U1PA 3GGSA 3BB3A 3SEAA 2IW1A 2X8LA 1JB1A 1G20A 2I91A 2ZB4A 4QVIA 3SR4A 1S1CA 4YRAA 5CB4A 3G9XA 5J4YA 3ZI4A 1QZZA 2DGDA 4W99A 5FUYA 6PFKA 5CLJA 5JAUA 3JWGA 1K2VN 5CD1A 5J2UA 1QG4A 2NO7A 1A9SA 2VSQA 5EQJB 3A4LA 2FY8A 2E18A 2I33A 4H4EA 4YROA 2CB9A 2BISA 2ZRKA 3IP6A 4H77A 5AR1A 1I1QB 1Q7BA 1U0RA 3V1LA 2WABA 3CS3A 4XYEA 4BRZA 1CY0A 1PZMA 2FPWA 4DJTA 4YGYA 2BR3A 1JFLA 5HQ3A 3F98A 3G2PA 3K2EA 2PV7A 4PLPA 1WSWA 3PJGA 1RQLA 1XN1A 1AQJA 1Q50A 2OZPA 4MGEA 2CVQA 3H17A 4WCFA 5KJEA 1JAHA 2CDRA 4PZYA 3TLGA 2K87A 3WNVA 5IHXA 2VLBA 4FN4A 4MUMA 1R18A 1SXJB 5BSUA 2XNJA 3HA2A 4N5LA 1TVCA 3AL3A 4E51A 1TM7E 4OA5A 3MWKA 2P9GA 1RI5A 5LB4A 3M7IA 5H82A 4ZIRA 2GJ4A 1QHHA 2RHGB 3FLBA 4TT3A 4AO6A 3H1AA 3WK9A 4ZOQI 4YP7A 5JALA 1WQ4A 3ND7A 1PJQA 5LIRA 3BTOA 2JASA 3N2YA 4GC9A 4O4HB 4TTAA 4ALIA 1M0SA 4PZLA 1BH2A 1RYNA 3FOAA 3HUFA 3A7DA 2XCQA 4ZN6A 3UJ3X 4YDQA 4BO8A 1HURA 4IH9A 2WM9B 4AZWA 3EDRA 2ZAMA 3I9FA 3LVBA 4FHFA 3BMCB 1K97A 1ZGGA 1UWLA 1QIFA 2B94A 2LXNA 5DCYA 3W6NA 2WIBA 5IU6A 2AQHA 1NE7A 1DJNA 1M1YA 5B7GA 4JIMA 4EKIA 4O2RA 4B4OA 3RS4A 3IQWA 4JP1A 4HYYA 3Q7TA 1ZD5A 1BCRA 4GT1A