4U2BA

Crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas knackmussii
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 80
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2bA00
1LPBB 2W6CX 5EFZA 4XX1A 4K6GA 5ALVA 5K3FA 3N2ZB 4ZI5A 4UBKA 4UHFA 3B3QA 3WA6A 5JASA 1BRTA 4G9EA 1T2NA 5T4FA 2WHRA 3UUEA 2QVBA 3H2KA 4WDQA 1CUDA 3DKKA 3V48A 4FTWA 5SYMA 4HVTA 4HAIA 3QPCA 4TVKA 4BE4A 4KAJA 5ALQA 3D0KA 5JZBA 5I7UA 2I78A 3BIWA 1LPAB 1JI3A 1CEXA 4CCWA 5ALDA 4J0IA 4FHZA 4PO3X 2V9ZA 1ZI6A 4G1FA 1CUVA 3A70A 2XUHA 3OTQA 5AO9A 2WFMA 3C6YA 2PU5A 5DYWA 4FLMA 4UBIA 3H2HA 1SCQA 4FKBA 1OILA 1ODSA 4G4IA 5T4EA 2IIVA 1XKLA 3RKSA 3EF3A 4N8SA 4KE6A 2JGJA 4HXFB 1TKRA 3OOSA 5C8VA 3MVEA 4MQLA 1XRLA 2QXUA 4Y2JA 3WK6A 1WB5A 4GLBA 4DIUA 1XRNA 3G0DA 5CT9A 4XWGA 2OGSA 2WFLB 1N1MA 2WIJA 3DS8A 3O4HA 5AHXA 5AKJA 2XI4A 5J3JA 3FLBA 2JGKA 5DNUA 3JWEA 5YASA 3CXUA 5AM0A 1XZEA 2BGNA 2PSFA 2PSJA 3I2KA 2XDWA 3G9UA 1QIFA 4BRSA 4BCDA 3G9ZA 2ZJ7A 3NGMA 4BP8A 1H2WA 1VE6A 4RNCA 3G02A 3C6XA 2Y6UA 3STYA 1EVQA 1EK1A 5A6VA 4ROTA 3MUOA 3OPMA 1IUPA 2OG1A 3HXKA 1XZCA 4NVRA 1XQYA 5ALTA 4HRYA 3CCBA 4WJLA 2QKYA 4BRZA 4J0DA 3AZOA 3QPAA 1EB8A 4UHDA 3KXPA 3AZQA 5AIBA 4Y2QA 2H1IA 2EDAA 1E8DA 1MU0A 1AUOA 3WJ1A 4IH9A 5LZ2A 3FAKA 4Z49A 4EY5A 3FBWA 4BTLA 2XLCA 1E8NA 3WK7A 2HM7A 4BE9A 1EDDA 2DR0A 4EY8A 2XMCA 4FLEA 1LBSA 2PPLA 1QIJA 5EIAA 1GKLA 2B9VA 2PM8A 4YK7A 5EGNA 3STUA 4OCZA 4E11A 5I9IA 1CUFA 1EINA 3PFCA 4PW0A 4WFJA 1K8QA 3KOOA 1CRLA 4AZ3A 4X95A 5AI6A 5LLSA 2I3DA 4Y2YA 3QH4A 1YA8A 1GPLA 4FNGA 3H2JA 3O95A 1FFDA 5JALA 1WPXA 1G66A 1TAHA 4H35A 5SYNA 5DWDA 2JGIA 4A23A 2XUJA 1SC9A 1WM1A 1CUAA 1CUIA 5ALNA 2XUOA 3BXPA 5IVIA 2HU8A 5E4JA 3DOIA 1XRQA 4BAZA 5LKRA 1TIBA 3GUUA 4X92A 3DDUA 2H9YA 4U2BA 5D3ZA 2WU3A 1JMYA 2ZJFA 3ANSA 4X71A 5ALMA 1LBTA 4CIBA 3V9AA 3KWFA 3ZLTA 2GYUA 3IB3A 4W1RA 3OM8A 1G4HA 3DL7A 4X91A 2YASA 5HF8A 4QLAA 5ALHA 1XZIA 1P0MA 5JANA 1E89A 2VJBA 1EXWA 4E46A 4OYYA 1OXMA 2PU7A 4C87A 4U2CA 5AM4A 2GBFA 3DD5A 3C5VA 4GEGA 2OAGA 3HI4A 1ZD5A 4BDTA 3AUKA 2QR5A 1JT2A 2R11A 1QZ3A 2CB9A 4QA9A 4Y2UA 3WYDA 1AQLA 2CZQA 4GECA 1FFAA 3F67A 4UFPA 2OCGA 4N5IX 1XROA 3D7RA 1VZ2A 5EHXA 2HFJA 1SFRA 4CG2A 2XMSA 2Q0XA 4B83A 5A7GA 4QLOA 1QE3A 3H2IA 3W2TA 3JW8A 3IUJA 2FJ0A 4UBMA 5FV4A 4JYPA 1TCAA 2H7YA 1WHTA 1U2EA 1USWA 5FRDA 4K6KA 5DJ5A 4QDZA 2IITA 3NWOA 3HRHA 4DNOA 2WFLA 3GELA 3HZOA 2XQKA 4ETWA 4Y2VA 4EY6A 3HJUA 1W6RA 3E1GA 5E4YA 2C0QA 3V1NA 5HKAA 1DX4A 3STXA 2XMGA 5EHNA 1H23A 3HACA 2WFZA 5HZGA 2V98A 3A6ZA 1CUBA 5HF6A 2HDWA 4UFNA 2ACKA 4OUKX 1UK8A 2HIHA 1R3DA 5HFNA 4AO8A 3WKAA 4DMHA 2PSHA 5AOAA 3H0CA 3M83A 5AOBA 4MWSA 3IURA 2W22A 2HA7A 1UK9A 1XLWA 5LZ4A 4BAGA 2BCEA 5AKYA 2C5FA 4OB6A 1JU3A 3R3YA 4W9RA 4Q82A 1C7JA 4ARAA 4UBLA 1B41A 3WIBA 3T4UA 4GXNA 4CCYA 4EUSA 3K6KA 3FSGD 4QDTA 3IUQA 3F9CA 4U2GA 4X00A 2DHCA 4AO7A 5FP0A 2WLSA 3QMMA 1Q84A 3R41A 2J3DA 3FYUB 1W75A 5AK5A 1P0IA 4J0GA 1UK6A 4X93A 1AX9A 1XRPA 1ZD2P 5ALGA 5AKGA 4LXHA 4NMWA 1N5MA 5LKAA 5CT6A 4FBMA 4LXGA 4G8BA 5FUMA 1ODCA 1WB6A 1XRMA 1CUEA 5DLPA 3FCYA 1YS1X 1BCSA 4B0OA 1ZOIA 2QUBA 4Q3OA 1AKNA 5EI5A 2HA6A 2XUQA 3SX4A 2XMDA 5ISMA 4H18A 3BJMA 4E14A 4I19A 3C43A 3DEAA 4WFIA 1H2ZA 5K3BA 4KE8A 5IVDA 4P08A 4MYSA 5DNWA 4IH1A 2ACEA 2QJRA 2JBWA 3G9XA 1CR6A 4G9GA 5T4HA 2J3QA 2VT6A 4Q34A 3AINA 4QNNA 1UK7A 1HDEA 5FOQA 2PSDA 4GDMA 1K6EA 4B0PA 4S0XA 3VKFA 1DQZA 3P2MA 3WKDA 2J4CA 1UXOA 1CUUA 1DU4A 4LIPD 5LZ9A 3WL5A 5BWCA 4WCVA 2CEKA 4LYDA 1NX9A 5AIAA 5ALWA 1E66A 2C7BA 3ZWQA 2YH2A 1H2XA 1L7QA 3BF7A 3GBSA 4QDOA 2ES4A 1E5TA 3IUMA 4J0CA 1A88A 3WK8A 5JD4A 1U8EA 1VXOA 5HQ3A 1RWQA 5A7HA 3YASA 2PBLA 1BROA 4KAFA 4IQ4A 2AJBA 5AM2A 2E3JA 5LYYA 1LNSA 2ZYHA 4W1SA 4QDUA 3AIKA 1WCYA 1ORVA 3I2FA 1CQZA 1DWPA 4HXEB 1QIEA 3PF8A 2C58A 3FYUA 1ZIXA 4YASA 1UKAA 3R3XA 3VJKA 4W1QA 1JKMA 6YASA 5ALUA 3FCXA 1HLGA 5C7YA 5HCUA 2DHDA 1BN6A 3WK4A 5AI0A 1GGVA 3G9TA 4RGYA 4Y7DA 2D5LA 3OG9A 1MAAA 2JEYA 1J1IA 2B20A 1N8SA 1MTZA 3U0VA 4B81A 3LCRA 1UKBA 1HQDA 2PSEA 3PI6A 4B9EA 4MXDA 1EB9A 1HL7A 3DL4A 3O9MA 2X8BA 1E8MA 3RM3A 1JJBA 1GXSA 3D2AA 1E3QA 3HYSA 4QEKA 4Q3LA 5AKEA 5DYYA 2QRUA 5ALYA 3DLTA 1TCBA 5FDFA 1FFCA 3I2IA 4AZ0A 3HEAA 4KR0A 3L1HA 3WZMA 2XUFA 1ZD3A 4K2AA 3DKRA 2JGEA 2WJ6A 4L0CA 3D2CA 4JH0A 2OQIA 2WSLA 4GI1A 1X70A 1JFRA 3M82A 4FMPA 4FOLA 2OCIA 3WK5A 1ZI8A 2Y6VA 2BUCA 1IUNA 3FOBA 1QGED 4EB0A 5JIBA 4M0EA 4QWMA 1MNAA 3OC0A 4OU4A 1VKHA 1ZJ4A 4B7ZA 3SC2A 3PE6A 2WTNA 3MUNA 4PV7A 4CI9A 4DMCA 3ESBA 4KRXA 5AI4A 3I6ZA 4UHEA 2O7VA 1JMKC 2XUDA 1EHYA 1XZKA 4X6UA 2HADA 3I1IA 1EI9A 5K3EA 3TRDA 4L3WA 3JYHA 1XLVA 4MWTA 3L1JA 4DGQA 4BATA 2ZYIA 3AZPA 2G4LA 2QXTA 2Z8ZA 3AIMA 3W9UA 7YASA 4CCYB 2VQ6A 3N0TA 4PNZA 3U1TA 4PF1A 3C45A 1L7RA 1MX9A 4G8CA 4EHBA 1IMJA 4WDRA 4UPDA 4Q1VA 3E0XA 5JZ9A 1CUZA 4C4ZA 1BS9A 3BWXA 5A2GA 1CVLA 4N5HX 2WG0A 1RYYA 1BN7A 4JYMA 1W52X 4H7IA 1FJ2A 3SWWA 3ESDA 3LIPA 1A8QA 1CUHA 1DWOA 1T4MA 4OB7A 2CBGA 2OAEA 2Y2VA 2HA4A 2WJ3A 1SCIA 4Q05A 4OPMA 2VATA 2H7CA 3STTA 1TK3A 1U65A 2R8BA 3WL7A 2XT0A 2XUPA 3DOHA 1Q0ZA 3ZI7A 4LKOA 2VSQA 1C7IA 1YCDA 3QMVA 3R3WA 2XMRA 3IIIA 4JNCA 1JJIA 5AI8A 1EA5A 2VTVA 5LZ8A 5AM1A 4CG3A 2RI6A 2WUGA 5D3KA 4H7HA 1O6FA 1Y37A 3FLAA 3G0GA 1QIIA 2WG2A 1IZ7A 1YS2X 3C87A 1R9MA 5ALSA 1MX1A 4NS4A 5AM5A 4BVLA 1W1IA 5BOVA 4RE5A 3V1MA 1BE0A 3C5WP 4PQEA 4J03A 5LZ5A 2BGRA 2XQJA 3A2MA 3H04A 3H18A 1CUXA 3EQ9A 2WUFA 4FFVA 1ZJ5A 4B84A 1CFJA 1X2EA 4BVKA 4CG1A 4AB1A 4KJXA 4AQDA 4DYHA 3BDVA 5CURA 3IA2A 2HRRA 5LP1A 5AH0A 2P8SA 2Z3WA 2XUIA 3R3ZA 5AI9A 4N8EA 2OLEA 2HA0A 3CN7A 3PICA 1THGA 3WZLA 2WILA 2Z5GA 1OCEA 5ALJA 2JF0A 4WY8A 1G5FA 5HQ3B 3QYJA 1CUWA 2FUKA 1QIGA 1EDEA 5K5EA 1MT3A 3PFBA 2WIKA 1EH5A 2CUTA 4UHHA 4KRYA 1QONA 1YAHA 3WWEA 4XVCA 1HKHA 5KWJA 4RPCA 4JEIA 5AJHA 3AJAA 1QIDA 5AM3A 2HU7A 2HA2A 1EK2A 3L1IA 5JYCA 2I03A 3CCCA 4F21A 4ZREA 5FXMA 2XB6A 3DCNA 3X3HA 1XZMA 2QS9A 2ZSIA 2O2IA 3I2HA 5ALKA 4DM7A 2ONCA 1XZDA 3VXKA 4X90A 1LPMA 3O4GA 5CXUA 2WHPB 4UBJA 3OURA 2XUAA 3GFFA 2DFPA 1UWCA 2CKMA 3E3AA 4QWWA 1QTIA 1A8UA 5CBKA 2QJWA 5AKHA 2JGMA 5EHZA 4LYEA 4KEAA 1ACJA 5I8PA 5IVKA 1EVEA 1LZKA 4ZRDA 3B5EA 4C6HA 3FSGA 4D9JA 4INZA 3I28A 4UHCA 3D59A 4K6HA 3EBLA 4IHAA 4F5ZA 4M0FA 1XZJA 3IUNA 1DTEA 3KD2A 5CH3A 1LZLA 5JD5A 2WJ4A 1ZICA 1HBJA 2VT7A 3ICWA 1VXRA 2B61A 1MPXA 1UKCA 4E15A 3K9BA 5JAHA 1XZFA 4G8DA 2XLBA 2VAXA 3TJMA 5FLKA 4X97A 2BAGA 5D7BA 1QTRA 2JIDA 3B12A 4UUQA 4J0KA 2DQZA 1ZGCA 4P92A 2Z3ZA 4X6YA 5EIEA 2K2QB 3ICVA 1R50A 3D5EA 5HFAA 1ODTC 1AGYA 1JU4A 1VLQA 1F8UA 4LHEA 3C6ZA 2H7XA 5CT8A 2AXEA 2XQGA 4X3CA 4BC1A 3TGLA 5ALZA 4FFWA 4Y2TA 4ARBA 1IZ8A 5HKBA 3AIOA 3G0IA 3R40A 2AJ8A 3RK4A 2ZYRA 3I2GA 3F96A 5JARA 4KE7A 5CT5A 5A7FA 3WKEA 1G42A 2HU5A 4FDMA 2XUKA 2D0DA 1ZD4A 3TEJA 3O4IA 5D6OA 4BCCA 3UMJA 4OB8A 2Y1KA 2OGZA 3WL8A 3Q8WA 2Y2UA 2OXEA 4GW3A 5HK8A 1K4YA 2O2HA 3O9VA 2GYWA 3BDIA 3AFIA 4W63A 4TPKA 3WLAA 3H19A 4BAUA 2FJPA 1YA4A 3EIOA 4XJVA 2G63A 1LLFA 1CUSA 2OCLA 4DLNA 1UOPA 1YB7A 3G8YA 4H7JA 1XZAA 3I6YA 2XE4A 1MJ5A 2HA3A 2PUHA 4EY4A 5T4BA 3ED1A 5E4TA 1K5PA 2B4KA 1QFSA 3QMWA 2OQVA 1DX6A 4BBZA 5AKXA 2VF2A 3VDXA 4H0CA 5HK9A 4ZV7A 3WKBA 2AJCA 1Y7HA 5IH7A 4ITVA 1SCKA 3T52A 2BJHA 4F0JA 5ALIA 3PF9A 1QIMA 4JUIA 1XZLA 3O4JA 3BJRA 1IUOA 1IVYA 4J0HA 4Y2SA 5AK3A 5LZ7A 1MO2A 5ALRA 2RONA 1KU0A 5KBYA 2VJCA 1VJ5A 4DNPA 5KREA 5ALEA 1LGYA 1WPRA 4P9NA 4FNMA 5KWIA 5JAOA 3MGAA 4IO0A 1R1DA 4C89A 2XQIA 2Z8XA 1ISPA 1R88A 4G5XA 3R0VA 2OGTA 3WI7A 4B80A 1R4ZA 3STWA 3VVLA 1C4XA 5CRIA 2VAVA 4UBOA 4ZGBA 2ZYSA 3ZLVA 1HPLA 3FWHA 5EIHA 5AP9A 4OD0A 4QZVA 3D3NA 4C01A 3R3VA 1UZAA 2PL5A 2WHQA 4AN0A 1A8SA 2ZVDA 1AZWA 4J0JA 4YPVA 4I4CA 2UZ0A 2ZSHA 5AKZA 1P0PA 4DMFA 4U2FA 4PSCA 1GZ7A 2WTMA 1U4NA 2ROQA 5C8XA 4HTAA 5ESRA 5JAUA 2J4FA 3STVA 2GBGA 5IVHA 3LP5A 2CMFA 2V97A 1YB6A 2G5TA 3I6MA 1GQRA 4L72A 2ZJ6A 2RIPA 1NU8A 1QO9A 2X76A 4ZXFA 5JATA 5DTJA 3DJYA 4GWLA 4DSZA 1A7UA 4P93A 2DQYA 2GBCA 4OYLA 4Q3KA 4DNFA 3C8HA 4C4XA 2WIFA 2BUAA 2QT9A 5AKIA 5BV7A 2WQZA 2HRQA 4B82A 2HHAA 5F4ZA 5K3DA 3H1AA 2JEZA 1LPSA 1PV1A 1CUYA 4BCBA 2JGFA 3ZPXA 1J07A 1MX5A 4AMYA 4UHBA 4H77A 3KWJA 4H7DA 5E2IA 1L7AA 3G0BA 1VE7A 2RHWA 4A5SA 5FPPA 4HRXA 4GHWA 1XQWA 3W06A 4FLFA 3WIOA 3WWDA 3I2JA 1I6WA 2WKWA 1TRHA 2YYSA 4BZZA 3WJ2A 4AMZA 1CUJA 5DYTA 1XLUA 2OPHA 3FVRA 1MNQA 3KDAA 2GYVA 2XMZA 4WFKA 3VJLA 1WB4A 1F0NA 2PVSA 1XZGA 3FYUC 1DT3A 1CUCA 4DSAA 3SK0A 1XFDA 3D4LA 4I3FA 4BDSA 4Y2XA 2DSNA 4EZIA 1QLWA 4C4YA 4N8DA 4MJ3A 1GQSA 1MN6A 3V1KA 4BTVA 2OCKA 2NW6A 2PKYX 2IX9A 1VOTA 2ECFA 1KU6A 3ESCA 1SOMA 4DNQA 3W05A 2VA9A 2V96A 2GZRA 3VVMA 5FKJA 3E4DA 4H7FA 3ESAA 1PFQA 4HS9A 4OSEA 1GT6A 3NOXA 3V1LA 2XUGA 4QDXA 1QO7A 3WWCA 2WIGA 3FVTA 3R3UA 1WHSA 3QM1A 3M3DA 3C70A 3LLCA 1X2BA 3KSRA 4MEAA 5K3FB 2HA5A 2XQFA 2WUDA 1GPKA 4MQMA 3G7NA 3WYNA 4G4JA 5H3HA 3VJMA 2LIPA 3A2NA 1YAJA 4X85A 4H7EA 4PSDA 2PX6A 4BZWA 5AOCA 1Q0RA 2VEOA 2BKLA 4KAAA 4HXGA 4X6XA 3C8DA 3QZUA 1Y7IA 1P0QA 3UUFA 1EDBA 1QFMA 2WHPA 2DHEA 3WKCA 4AO6A 4V2IA 4MEBA 3WMRA 5A62A 5JD6A 1XZHA 3H1BA 3FNBA 3W9BA 3S2ZA 3ANTA 2AJDA 4KYVA 1CV2A 4X94A 4Y2PA 1J2EA 1CQWA 1LPPA 1CUGA 3H2GA 3QVMA 1VA4A 2C0PA 5CH8A 2I3ZA 3WA7A 3FLEA 1QIHA 2EEPA 3W04A 4ZWNA 3ZV7A 1YASA 4O08A 1BEEA 1UFOA 1F6WA 3RLIA 4J7AA 1RP1A 1Z68A 1ZIYA 3WWPA 3GZJA 5JZSA 5AI5A 1BU8A 1BEZA 4FBLA 5ALFA 3GA7A 5DTIA 1J06A 1ETHA 5CXXA 4KACA 4BP9A 1QIKA 3Q0TA 1JJFA 1O6GA 3LIIA 1M33A 1UT6A 1S8OA 3AILA 2GBIA 3F98A 2CJPA 1YR2A 2X5XA 3LS2A 4BVJA 5BWBA 4M0MA 3O0DA 1TQHA 4OU5A 5JAPA 2BUBA 1XKTA 1ACLA 3IDAA 4BC0A 1BCRA 2WG1A 5AKLA 3HC7A 2HL6A 1DT5A 1GKKA 5JADA 3EQ8A 3WL6A 5AK6A 1XZBA 3PUHA 2VJDA 1XQVA 2C4HA 4AN1A 3BE8A 3QBJA 1AMNA 5CT4A 2WM2A 1KEZA 3DQZA 5ALPA 3BIXA 4TGLA 4IH4A 3C6BA 4DMKA 4L9AA 1AURA 4EBBA 5CH5A 4EA6A 1ZI9A 3WQHA 3FYTA 4NZZA 4W1PA 5CTAA 4A16A 5K3AA 2BFNA 5C81A 1UOQA 3I1YA 4U2EA 1XRRA 1K63A 1THTA 4QE3A 5AK4A 2FX5A 3K2IA 1N5RA 3RARA 1R9NA 3HSSA 1D07A 1CIJA 3QPDA 3DNMA 4FWBA 4DTCA 2QTBA 2WIDA 4BYMA 4YX9A 1PJAA 1NU6A 1WOMA 3NUZA 3EQ7A 1GPNA 5A71A 5K3CA 1H2YA 2O7RA 4HZGA 1YSCA 3BF8A 4ZV9A 2G5PA 1QOZA 4CIAA 4F60A 1W76A 1Q83A 2AJLI 1ZGBA 2O2GA 3F97A 5EHQA 1W4LA 1FSSA 3IULA 1UOOA 3WK9A 1AC5A 2RGUA 1DQYA 4CFSA 2VJAA 1MAHA 3ILSA 3M81A 4H7KA 5IKXA 3GROA 1FFEA 1VA5A 2HFKA 1CPYA 2PUJA 2DCMA 3HLKA 4C88A 1H22A 3IBTA 3DYVA 1QJ4A 2JGLA 4Y2RA 4B85A 5CMLA 2YXPX 4B6GA 1VZ3A 3BL8A 4K5QA 3QITA 1CLEA 3H17A 4MYDA 1LPOA 4AX4A 5HF5A 2QUAA 5C8ZA 4G4GA 4PSUA 4Y9SA 2QOEA 4UFOA 5AKKA 5ALLA 1DINA 4LXIA 3D2BA 1B6GA 2EDCA 1XQXA 2QMQA 2ORYA 1ORWA 2GZSA 4RE6A 4B9AA 2QM0A 4J3JA 3PUIA 1FFBA 4AXBA 4X7BA 2RHTA 1F0PA 2RAUA 4XIIA 3A2LA 4WY5A 3WWOA 5FPQA 1TCCA 3S8YA 3CN9A 2WU4A 2C5GA 4KE9A 3G0CA 4UBNA 4BB0A 1EX9A 1DWQA 5CW2A 5HF9A 5AICA 3DYIA 4EY7A 3F8SA 3HABA 5LIPA 1LPNA 4GBGA 2QZPA 2WUEA 3IVMA 5ALOA 2XMQA 3PDCA 4U2DA 2XMBA 3VISA 3ZLUA 5DNVA 5ALXA
chains in the Genus database with same CATH superfamily
1LDYA 2WUWE 1QQ6A 1YWGO 1GGJA 2RBGA 4B3CA 5JSKA 3Q7SA 2N1BA 4XX1A 3MWFA 2VOEA 3KZNA 3U6KA 1OH7A 3AI7A 3CZAA 4D4HA 3EYAA 3N2ZB 4BLOA 3DKPA 1KY4A 1CP2A 2IHTA 3PSAA 3IQDB 4ZI5A 3JWJA 3FOZA 2COEA 4WEOA 2VP3A 4HVAA 5JZVA 3FTCA 4UHFA 3BWVA 4FYIA 1NYQA 2FUEA 1DC3A 2W6PA 1T5SA 4OJTA 4FWIB 3WA6A 2VF5X 2IEIA 2HEGA 4K9DA 4I1SA 5BSKA 3T7JA 4RPLA 3IP3A 5DULA 2WHYA 2WHRA 3AETA 2J07A 4TKVB 3UUEA 2CK3A 4C2AA 1DG3A 4CM4B 3H2KA 2FP4B 4HLUC 3DAFA 4A0RA 2PV0A 1KMMA 2ZIAA 2DWQA 5BQ3A 3ORFA 4NBNA 3FMOB 2VUTA 3EY4A 2YXLA 1RRCA 3ZJTA 3JQEA 1UMDA 3L7JA 2FH5B 5HVNA 1MH9A 2H52A 5AVSA 3KSBC 5EE1A 1CY8A 4NHEA 5C5IA 1VBMA 2VYVA 1Z7GA 1E5XA 1D3AA 2PD4A 2OHOA 2I1LA 2N3ZA 3HY4A 4KAJA 5T57A 5CFNA 3Q8LA 4GT1A 4XUGB 2XWQA 4ZVKA 4W99A 1TVMA 4B3TB 3MAAC 5ADVA 4QDJA 4HDAA 4B09A 2ZLBA 2ZKLA 4QHYA 1SUCA 4E0BA 5JHGB 1ESZA 1D0IA 2VHCA 2JARA 3NORA 4CLXA 1J0XO 1SB8A 1QFZA 4BMNA 1CEXA 1H3NA 3DNFA 1DELA 1UZNA 3C98A 2O3TA 2WJIA 4H59A 4PO3X 3O2QB 2V9ZA 2P8JA 4L50A 5DTQA 3SLKA 2CDCA 5DBHX 3SSNA 2A1UB 4JSTA 2KBEA 1YH3A 4XIYA 1PBTA 1LBQA 1MV8A 2UVPA 4G1FA 2C7RA 5FPTA 1KMHA 3EYWA 3DKVA 4OJQA 5L3ZA 1AIPA 3N7UA 3SEZA 1Z6TA 2XUHA 4JJ8A 4EA8A 3IOBA 1HQCA 1SCQA 4FKBA 4M1YA 3JQQA 5JS8A 1OILA 3PUJA 4XLTA 2QMHA 1E1RD 1XJWA 2IIVA 5DNDA 1L6RA 4YECA 2Z83A 3U26A 2AG8A 9ABPA 3A1CA 2Q3LA 3UH0A 1I4TD 3MMNA 4ARSA 4D9NA 2XYVA 1H0RA 2V7XA 3L0ZA 4OJKA 4QOEA 3RKSA 3ZGYA 2QBYB 4G8JA 2WWRA 4GMFA 3FSJX 5D5HA 3U4MA 3NBMA 4QUGA 4XDHA 4HXFB 4MJ7A 4XYGA 3QKWA 3TJZA 4BQRA 4M9CA 2H2WA 2P7IA 4DV2B 1WBBA 3LPAA 3OOSA 3ILXA 3Q6NA 1I1OA 4TWIA 4UVDA 1ULUA 5C8VA 2X1HA 1WJGA 4FFOA 3IBGA 5FBRB 3HCEA 1JA1A 3LU1A 3ODPA 3DFMA 1H4QA 1VIMA 4CM8B 4WZAE 4QJ3A 5GZ3A 4PC2A 4TYPA 2I2FA 3SXUB 3D3EA 4NDNE 4HN4B 3AEQB 3OLQA 2NTVA 4FPXA 4MVJA 4LGCA 4JVNA 4ED9A 2HGZA 4RXUA 2Q4OA 3INRA 4ZMRA 2OGSA 3WGQA 2WFLB 2ETVA 4MROA 5DNYB 1NXPA 1ZH4A 5C1OA 3E82A 1M7BA 4P8RA 1BWRA 2ZYVX 4D6XA 1FNBA 3NHJA 5LXTF 4M1TA 4M8KA 1R0LA 1RDFA 3CXRA 4ARCA 3BWMA 2JDIA 3EDCA 3FLBA 4RAQA 3OQ1A 1RAFA 1N2SA 2ZYDA 3SGLA 1CX9B 1HI9A 2AOUB 4FE7A 3UMFA 2PE5A 4MQEA 5JI3E 2GCEA 1SXGA 1KNQA 1DBWA 2FZCA 3MM4A 2NUAB 1A50B 5I47A 2P9YA 5CNMA 2XDWA 2CWDA 2V8BA 4OK5A 4OP3A 4ZTUB 2D1QA 1Q22A 3PA6A 2Z2YA 4AS2A 4OUDA 1JKJB 1OFIA 5CLHA 3ZZTA 2DFKB 2ZJ7A 3TR0A 1JVSA 1DAGA 1TDJA 4K88A 4QJ4A 1KI8A 2QR2A 4DV4B 3EVGA 4BP8A 2OAP1 1E98A 2B4TO 4XYMA 1JDNA 4RNCA 3PC7A 2OLJA 4UNQA 1SGWA 3G02A 3EIUA 3C6XA 3C3MA 1QPGA 4OJNA 4P35A 3TS1A 3KC2A 2VTBB 3FDZB 3LF1A 3LHDA 3PUXA 2DB3A 4ROTA 3ZS8A 1ZOOA 3FHJA 2B94A 3U81A 1I3CA 4ZAZA 4BNXA 2GS9A 3HLTA 4JJGA 3N0WA 1E3SA 1JDUA 3HV2A 3SJCA 3ISVA 3LXRA 4PIPA 5PNTA 3A9VA 2K87A 3GHYA 4LRYA 3LCUA 5HKLA 1SZPA 3CW8X 3S2EA 2JIZD 1CIVA 3UAYA 4BXOB 3DEZA 1G2QA 4R1NA 1P7WA 3QGMA 3EWAA 1LJUA 1O8BA 2GYYA 2XTZA 2QW1A 3DA8A 3LPMA 2V6MA 4EMBA 1ILWA 3BK1A 2EGHA 1SD5A 1NUAA 3CGWA 2V0CA 4NE2A 2Q99A 5THQA 3ZOZA 2VYNA 3SBOA 3VYWA 1AUOA 1QORA 4LDJA 2N42A 4GIBA 3MTQA 4IH9A 3RQIA 1FZTA 1T5LA 1I1QB 2W58A 4YDRA 1KF0A 4Z49A 2FMUA 3ZW8A 2O5EA 4BTLA 1BKSB 3IVRA 4ZTZB 2NN3C 1LBIA 3AM4A 3CX7A 1FX0A 4EG6A 1VRCA 2QROA 1MB0A 1X8JA 3CLRC 2RHCA 3AEYA 3IAUA 3KS9A 3VZPA 3WK7A 1ODFA 3ROTA 3LWNA 3KWMA 2FN4A 1X8LA 1T9HA 3AHCA 3HKEB 4E5MA 3LT0A 3MTEA 4NMMA 4OQNA 1UKZA 5EVJA 4F3TA 3VC7A 5IW8A 1AD2A 1BNCA 4LDRA 5JAQA 2C7PA 2RHGB 4FLEA 1KZHA 2ZCJA 4C5BA 1PJQA 5KKAA 1EUYA 5F1YA 3AJDA 4EI2A 3DTVA 1Q1AA 3AJ8A 2BFCA 4N48A 1C1XA 2ZTLA 1WL8A 4MOWA 2DJIA 3CVUA 1QHYA 3R7FA 1HA3A 4OCZA 4E11A 5B1EA 4F9GA 1CUFA 4V0MA 2DTEA 3PFCA 3JPYA 5BMVB 1R6TA 1WQ3A 3OQPA 1O03A 2FWNA 4WFJA 1VJTA 4E09A 3EGXB 1I3NA 4HWKA 3UG7A 4AZ3A 4CN9A 2VHJA 3DKIA 4X95A 3BXOA 5AI6A 5CLFA 4LYHA 3VR3A 1S8NA 1UJNA 4JY7A 3ODGA 4EUEA 4RHCA 3PXBA 1W5FA 1WQ1R 1Z4PX 3AKYA 3GPIA 3JYOA 4YUXA 1EFPA 4M9SA 3BH0A 1A2KC 1QKIA 1C9NA 2B4YA 3W79A 3NTQA 3B3JA 1Y63A 4FNGA 4U9UA 4FNAA 1A77A 2X7XA 3TW6A 1E64A 1VIAA 2QAIA 3PVCA 3HVRA 1FFDA 4REQA 4LZZA 4IINA 3SQNA 5JALA 1PV2A 1EWTA 1NQWA 5LA6F 1KDVA 3NM4A 5DLDA 1G6Q1 1SVUA 1QS0A 1KTVA 3I9OA 5SYNA 1RHQA 3PUVA 4E6PA 1GITA 2Q5JA 4A23A 4C2BA 1P45A 4R6XA 2PIDA 5IP5A 1GTVA 3O0TA 3WNDA 3OEED 1SC9A 5CGQB 1TMOA 2PFGA 1CUIA 2SKDA 1S2MA 5IVIA 5CX4A 2HU8A 3G49A 4OQYA 4DRZA 1T3GA 1ZEMA 1PTJA 2IVZA 2HRBA 1HYQA 1N6KA 2PNJA 4ZEMA 3LCMA 4HP8A 3QPVA 4FB5A 5LKRA 3H3JA 2IZ5A 2BGKA 4M9QA 2QZZA 2O8EB 3PPXA 3UF0A 2V3VA 2W6JA 4GGMX 2X22A 2BPOA 3W5VA 4DRXB 1GCOA 3DDUA 3QJYA 5JVDB 4PYNA 3M34A 3H75A 1E1DA 1SHLA 3QXCA 5JLAA 3ANMA 1ADYA 3BTVA 3EAQA 4K1LA 5JTTA 3I76A 3EXFA 2QUJA 4E32A 1Z62A 1JLSA 1HDGO 3H8WA 2BEKA 4JS0A 2Z04A 2REBA 2WU1A 4WACA 5JG7A 1P75A 5KHAA 4JP8A 2I8LA 1QF6A 4X71A 1N2ZA 4RTOA 3WGOA 2DPHA 3ZNOA 3BTUA 1NNUA 2BE7A 1YL6A 5ALMA 2HLDA 2UZ1A 4IDEA 1X6VA 2XF8A 2C4VA 1E7SA 1P1FA 1LWOA 1TTTA 2OWEA 2VA8A 3UJBA 1NF2A 4KXWA 3ZLTA 5LQDA 2SBTA 1K75A 5T7BA 4EL0A 1KAMA 2P5YA 1XU7A 3GRUA 4G0YA 4KQJA 4ZYYA 4WBNB 2V1UA 4R1LA 3IB3A 3G9QA 4W6ZA 1TD1A 1ISMA 1JXQA 1SC4A 1G4HA 3OM8A 5T3UA 5BQFA 5KTOA 1SOAA 2I1QA 3DL7A 2A30A 3TTUA 3K96A 5DM60 4V1CI 5HRUA 4X91A 2YASA 3GLIB 3THYB 4H17A 4KSCA 4IJMA 4QGSA 3KJXA 5JYDA 5JJIA 4BKMA 1DFHA 1KJ8A 1T1GA 1MVLA 4JJ4A 5B12A 5CA1B 5JANA 2B4AA 3RYFB 1FBTA 5E7IA 2X8LA 2VJBA 3UQZA 3KEQA 1X14A 2ZROA 5EPUA 3RIGA 3ZTWA 5D5PA 2EERA 5KJCA 5FL7A 5FTJA 3BN3A 3LZDA 4ZOEA 4II2A 4IXNA 3VHXA 2H1OA 1E0JA 2AHOA 4JVOA 4B3BA 3H8VA 1FYDA 3WOVA 4ZALA 1JQDA 2P7HA 2WHXA 3AYXB 5EP3A 3VNUA 5DEIA 3AHFA 4ILKA 5JFGA 1HE5A 2IVFA 1R00A 1RYDA 1EEXB 1DE0A 2Q46A 4H3VA 4TQAA 2OQ2A 5FBHA 1V37A 4YLYA 2HRDA 4ER3A 3HYRA 1Y9AA 3C5VA 1CKEA 1Y9ZA 4GEGA 2XGJA 2OAGA 2QYSA 3MTIA 3CLKA 1XELA 3GMIA 3L5OA 1Z5PA 3OIDA 5BVGB 4CQMB 4FMDF 5E7JA 3TTVA 4ZK6A 1JAZA 2DUMA 5IXSA 4E88A 1FK8A 3LP6A 4O2AA 4BWVA 3PG5A 1YF3A 2WV9A 4OAOA 4Q1EA 1QZ3A 3I5XA 1RHJA 4CMKA 3UW3A 4TS1A 5G2OA 2AR0A 4Y2UA 1E1QA 2WNIA 3RT7A 1FFYA 5E6RA 1Y82A 2ESRA 2OE2A 3KAKA 3MPOA 1WUJS 4JC5A 4V3CA 2EV9A 2PRYA 2ZVPX 2GHQA 3EY9A 4FMBB 4N5IX 4PIMA 3EX7C 4PM4A 3A1SA 4Z4IA 3K1ZA 3R20A 4ZC8A 1QH1A 4MUXA 4AKEA 3A4TA 2C1EA 3OT1A 4R31A 2AX4A 4U1RA 4CG2A 5IN4A 2Z3VA 2BD0A 2VPIA 4OHWA 3AX6A 4PGFA 4IKEA 1ZSVA 4RVHA 5GOTA 5EJAA 5EINA 2BT4A 2RJNA 1TGVA 3L93A 4DJDC 5BSHA 2DULA 2OO5C 2R4UA 1W9MA 4MS3B 4PR0A 2FJ0A 5ELLA 1NQTA 4B45A 4EY3A 2BH9A 1J2TA 4O4IB 2COUA 4GPIB 4DLAA 4UBMA 3W6NA 1KQFA 2JJ2A 4WESB 3U16A 4YFYA 1A82A 1INLA 1USUA 2HSJA 2H7YA 1JFVA 4HDMB 4ND2A 2JZOA 1WMEA 3F7NA 3GB9A 1SAYA 4D0SA 2QVZX 4ZGWA 4QDZA 4YT4A 4GLJA 2Q8PA 2ZREA 2DJ5A 3DZIA 3EGIA 4N3GA 1X74A 2E5FA 1YDMA 1IHOA 1O94D 3R7WB 2XQKA 4ETWA 4A26A 5JEDA 4Y2VA 1SU6A 4WERA 2ICAA 1KOLA 2HQOA 2WSMA 4MV1A 1I5RA 3W9YA 4CPDA 1PKXA 4DRXA 1P5RA 1DQSA 1EK0A 4R9RA 5E4YA 1ORIA 3PWSA 3V1NA 4F11A 1F1BA 3TLGB 3ZD6A 2D5BA 3PDHA 1DX4A 3DDNA 4TMZA 2R1TB 2PTHA 3O2NA 3R9IA 3FFBA 5LB4A 2XMGA 3IMKA 1KPHA 1OASA 3RFUA 3GUYA 2DECA 4S1NA 2P6NA 4QTZA 5B7PA 4Z0HO 2ZEJA 3A9SA 4OLFA 2WFZA 1ADBA 1AVTA 1E2IA 2ZATA 2MINA 3G23A 3H5VA 4XUCA 2EQ5A 5EE9A 1RLJA 1PLLA 3TVDA 2V98A 5HF6A 1HFJA 1E6LA 2HDWA 3GJ0A 1DJLA 1A76A 2F4VB 1WXDA 3K2EA 3RS7A 4TYMA 4G5QA 3LFTA 1J0CA 3IIMA 4YXWA 3SQMA 3S70A 2FPXA 4F5WA 4R71A 2I54A 1OX4A 2HREA 1FMCA 1YMVA 4R9SA 3ZY4A 3UGKA 1W44A 3L4EA 4N7BA 4E2FA 1FDIA 3NASA 2O54A 3KV1A 4L6IA 5LD2B 1R3DA 3GNTA 1TJYA 4S1PA 5CFMA 1H5QA 1T4DA 1HTWA 4EW6A 4R0MA 1BO6A 2E37A 3GEMA 3GVIA 1KYTA 4RDHA 2J6IA 5CK4A 2N46A 4MW5A 3HB5X 4IQGA 2O7QA 1IAVA 3CLRD 1TADA 1L7VC 1NVTA 5TVKA 2WYHA 5LQAA 1DJQA 1SXIA 4RCZA 2XNCA 3UJ7A 2VDNB 2H9AA 4ILEA 1OXXK 1P29A 2XD4A 1YK1A 2CD7A 3R3HA 4ZQGA 4OXKA 2IU0A 3ZHZA 1JJVA 2W22A 3NVMB 3C3PA 2HA7A 3K73O 4LZLA 3TLZA 2O8BB 4LQDA 5A05A 4G09A 1EFAA 1QQ5A 1XLWA 4NV1A 4POAA 1C4KA 4RMJA 2ZRJA 1DTWA 5LZ4A 1K89A 2BCEA 4MJXA 2IPMA 1ZLYA 4RESA 2C5FA 3EDQA 9LDBA 1F48A 1UEJA 2JLWA 1JU3A 4HQ0A 4J0QA 3BKWA 3K92A 4MB6A 3ZWNA 4XGNA 2UYOA 5FTNA 4WVLA 1E3MA 4K9PA 1RXUA 1X1TA 2FHPA 4Q82A 3GCZA 2AKYA 3MT7A 3ZDDA 3C3DA 4JQCA 2X1MA 1UDCA 3OFKA 2AFHA 2I6QA 5K0TA 5DK6A 4RY2A 1XVAA 5BVGA 4BLQA 1GPMA 2QJFA 4QXAA 4C29A 4XQ9A 1RLOA 1VBKA 4Z9YA 2A86A 2PS0A 2FZWA 1M10A 3ZV4A 3EGXA 4B3RB 4HXYA 1G2OA 4YH1A 5GV8A 3W3AA 4OHYA 3U3JA 5K05A 3V4ZA 3JAMA 4BNIA 3F9CA 3DXFA 1JSXA 1OKKD 2DHCA 3GK3A 4AO7A 2PZLA 3H9EO 4KZPA 4D79A 3GGGA 4GVPA 1SXJA 5EXPA 4C0BA 2ZI5A 3H6HA 4P4SB 2ZB7A 3OBBA 4U7WA 2R00C 4Y1RB 1XA0A 5LC1A 3AUSA 3DWEX 1STOA 5DYNA 1GQ2A 3I4CA 4MKIA 4NG5A 1I9GA 2XCRB 5JQGF 4ESOA 1YOVA 2OUKA 1AX9A 1FUEA 1XRPA 3ZCRA 4MRMA 1DGQA 2Z1MA 3O8OA 1T0JB 3CLSC 2JD1A 2O0HA 4JU9A 5LKAA 5CT6A 3K9HA 4HN2A 4FBMA 4ZHQA 3HXQA 5FUMA 2JAUA 1J24A 1KVRA 4QU5A 1LRLA 4RETA 2XQVA 2LW7A 2IKQA 2RHHA 3RGWS 4CODB 3K7EA 4YONB 1WV0A 3FGZA 5D7NA 2XVYA 1LUAA 2ZETA 4RH3A 1SQFA 3HA2A 4ER0A 3ONDA 4DV7B 2GN9A 4KYUA 3GIDA 1WB6A 4KFRA 4NYJQ 4Z9AA 5C8YB 3VX3A 4FNOA 5CD1A 4EUFA 4R1UA 4DLYA 5C4IA 3FCYA 1JDBB 4TMWA 2DPGA 2B99A 2KLBA 3GLGB 1MG0A 1OVMA 5FV7A 1E3EA 1JR4A 5A0VA 1N0IA 1S3GA 2VSYA 2WOJA 4K6CA 1XQ6A 5D84A 3U3RA 1ZOIA 4ZCTA 2WAYA 5EI5A 2OV1A 3E1SA 2GZDA 1MQ9A 1NUPA 3KR9A 4AP9A 2Q0SA 3BJMA 9LDTA 2FXIA 3GNQA 1TM5E 2WWHA 1MEJA 2JGNA 2PH1A 2AI1A 3R77A 3DQQA 4XOIA 3C43A 3TECE 2IEAA 4O25A 3DEAA 3ZHUA 1H2ZA 4O1HA 4S2UA 1GAJA 4TZ6A 3UAWA 1K2WA 1VRVA 1F2UA 2WUVA 3T7RA 4ZANA 1M2VB 4F8JA 1SXJC 3VNVA 1I0ZA 3QXHA 3KALA 1KNXA 3EVCA 5JAIA 1XTPA 1PHPA 4Q12A 1QYRA 3DO5A 4DQUA 4Y0AA 3PCRB 2AUMA 2GN2A 4XWTA 4CT4B 1UJ2A 1Z82A 3CB2A 4JP1A 4K28A 4UAJA 3HK2A 4J91A 3AKDA 3G0OA 3CW2A 5FR2A 1T13A 4PPFA 1PL7A 3GAMA 1T10A 5SY9A 3S5UA 3EPPA 3IR6A 3JASA 3WL3A 4BMSA 2B1RA 3IMGA 4MQEB 2IU4A 3AINA 2N9UA 4LECA 1W5EA 5JMOA 3HM9A 3GRAA 1HDEA 3AF1A 3UUWA 1KAOA 2PSDA 1FLAA 2PLAA 3OP4A 4B5KA 2QM8A 1IM5A 3T7EA 3B1YA 1HV8A 2QMEA 2F43A 3VKFA 4ZPJA 3WDLA 1S2IA 2R5FA 2X13A 5LA6B 7GPBA 5HJEA 5LYJF 2IX3A 1U0LA 2NXCA 2NSHA 2RGAA 3I39X 3PQ2A 1O87A 2FWRA 3FHCB 4I5IA 4LWQA 1EJ2A 3WKDA 4EF4A 5HKOA 1UXOA 3GP8A 2RKOA 1TEHA 3L0DA 2ONJA 3D9QX 1VMIA 1XRJA 5IMBA 2CVQA 1BHO1 4EKDA 2F62A 2E87A 1BHJA 2VTEA 3DEHA 3EIHA 4XI9A 1M1XB 4S1TA 1I32A 3DUFB 3QHPA 3SYTA 2C3YA 5ABPA 1ILEA 2QTVA 3Q3EA 4EJSB 3U09A 2DWOA 5JDCC 1BFUA 4UCFA 1QANA 5AIAA 2RI0A 2HBYA 1WPGA 3UJAA 1U8UA 4HGOA 1G3UA 1Q0LA 3CBGA 1KSGA 3KZMA 5LP6C 1J2YA 1WCV1 2BZ1A 3AB7A 4Y6LA 1WHSB 3BQMB 4OJMX 1PQUA 5I3ZA 4EHKA 2GVDC 4WGFA 1MORA 1FVHA 3HZRA 2O3SA 1L5NA 4RADA 4YV1A 3K1AA 1JB1A 4JUDX 4S1VA 2BFDB 5EG5A 4M0KA 3JV7A 4BMXA 2BLLA 2VC2B 2V6GA 4TTJA 3RFFA 3TUZC 1W8DA 1D1QA 2DC1A 1DG9A 4RKEA 3NHZA 1BJKA 1PAUA 3ICQB 3FPFA 2BMFA 4PO8A 3V4FA 2YRXA 4DIKA 1L3BA 1IEQA 1ZVJA 4IQ4A 3RSQA 1T3LA 2WTAA 2P2DA 4Q47A 1X13A 3PDIA 3PA8A 2I1WA 4DARA 1DAKA 3KOWA 4TUYA 4QKQA 2ECKA 5AM2A 4CV0A 1D2RA 3R76A 5HUHA 1GP2A 1LNSA 1VKNA 5LYYA 4YMUA 4W1SA 2PAAA 2NZVG 3EXFB 4FXOA 3WL4A 4LFCB 4OGFA 5KNDA 1LC3A 3HCAA 4M1MA 2FWIA 1I14A 2GERA 1TMYA 3N53A 2VDOB 4I50B 3OZBA 3ROEA 4A0HA 3PF8A 4FJ2A 5H4HA 3NNSA 1JHQA 2OZLB 3L7LA 1XCBA 2M32A 3FYUA 2OYSA 5TQ0A 1KO1A 2VCHA 4NZNA 1D8AA 4W1QA 1YHZA 2YBDA 2EKLA 3RVQA 2P77A 5ALUA 5FI0B 1N4DA 4PTYA 4POOA 4B8ZA 3KJHA 1JEQB 1P0FA 2IUTA 1Z4QA 3Q4GA 3T7IA 2DHDA 1N3LA 3MSXA 4L8VA 1E9CA 1JHXA 4REMA 2ZUUA 3M6AA 4JROA 1GGVA 3G9TA 4MRNA 2R68A 3LL4A 4YJ3B 3RLFA 4AQ7A 2IQIA 1OA0A 3SN6A 1GSAA 3EDYA 3ZQKA 5B7GA 1T24A 1Y5LA 4WSOA 2PKXA 1FNCA 4GF5A 1ZG3A 1AGRA 3JWPA 1GPBA 2PBFA 1MAAA 2BMWA 2NUTA 1ZWLA 3W77A 1W0JD 4AAYA 2QTFA 4MITA 1JHMA 2GR9A 1S5PA 4MS1A 3IE2A 1DXOA 4NPHA 2H4WA 1YR3A 3GJZA 4GZ5A 2XR1A 4KXUA 3ZDEA 3CUVA 1N8SA 4C06A 1N2CB 1IN5A 5EJ8A 4DDVA 2I71A 2LPMA 2PHZA 2V6IA 3QEJA 3HJNA 2CXXA 2OM6A 3NOOA 4ASUD 1QJCA 1V8FA 3OEWA 4TV9F 3TUIC 3O9MA 1BWQA 3G2LA 3L49A 2O2EA 2FWPA 2VDRB 4Q3NA 2EFHB 3HPRA 4XLLA 1YKSA 4OQXA 3N0VA 1QVRA 1R27A 3S2UA 3V6LA 3P4XA 9GPBA 1E3QA 5EIXA 4Y9DA 2A0YA 2HI0A 4DUPA 2F1JA 4CMGA 3OU2A 1Y7LA 5HEKA 4BFUA 2BE9A 1ND5A 2JRLA 3RB8A 3KJEA 3CNLA 5DYYA 2IH2A 1GRRA 1Q12A 3PC8C 3QKSA 1ZW1A 4MGIR 3SR0A 3IHKA 1VECA 3DLTA 3HHEA 4CM9D 2FWMX 3Q3VA 2MINB 4WL0A 5LWHA 1FFCA 2M6LA 3B82A 1X38A 1Z6QA 4CIXA 2VBGA 1NQOA 1A1VA 5GIPE 3NRBA 3HEAA 3L1KA 3U4IA 3TNLA 5BWMA 1AK2A 3L1HA 3GUVA 2ZJ1A 1W93A 1ZONA 1ST3A 1EUCA 2RB5A 2W2TA 4H3SA 5IC6A 1T2VA 2DPYA 2Y1FA 2ZVJA 3DT9A 3HKCB 4JR2A 3BM5A 2DPMA 3IAS1 1RYMA 1TFUA 2O3RA 1E63A 4WZBE 3CNNA 2PX2A 2UZIR 4PGMA 1X77A 4YJHA 2AKEA 4GPEA 3AUJB 2PN1A 1C2TA 3EH1A 2XKJE 1GEEA 4LCBA 2E0IA 4GD3Q 2RHLA 2WJ6A 3BSWA 4JSRA 4L0CA 3ND6A 4RD0A 3R8XA 1J5EB 4RJLA 2B82A 4ZAYA 4Z4CA 1AKYA 3FVWA 2H4ZA 4CF5A 3PQ4A 1WY5A 4GI1A 5GQSA 5T8KC 1G4UR 1Z4LA 2CDAA 3IRVA 3M82A 3PRKE 2GFHA 3W78A 5KNCH 2UZ4A 3NU1A 2VDWA 3A6JA 1UADA 4EI8A 5K8IA 1BMFD 2Y6VA 1P6XA 1WD7A 1YTLA 2YUTA 3IEIA 4N18A 4WV3A 4ADSG 2HF8A 3RVMA 3MS7A 4C20A 4HTFA 2OFXA 2W70A 5JIBA 5ICCA 1KQNA 2V58A 3N3BC 4DLWA 3ZXUB 1VKHA 1M5UA 3I6BA 4B7ZA 1N0VC 4EKYA 1KH2A 2P78A 4QYWA 4UMDA 4PRYA 3JYNA 3IXLA 3MEQA 3NHKA 4DM3A 4EPYA 5IYZF 4YAKA 2I80A 3LBYA 3M0EA 4KRXA 1YC2A 1XTRA 3SFVA 5LL6P 5ES4B 2ECOA 3I6ZA 4UHEA 3EOBI 3TRFA 2BTEA 2NACA 3OOHA 1SCBA 5EJ7A 2G1KA 4H6PA 4F97A 2HNBA 3TD6A 3AQ4A 3LQRA 3S55A 2WSBA 5EUCA 3OQBA 3ZCTA 4DQ0A 3O1LA 2ZJ2A 4KR9A 1JH9A 2R4TA 4LUCA 3EQ2A 4YJGA 4A03A 1YZUA 3RHFA 2VAPA 4MWTA 5B2EA 2VLIA 2JEOA 5JRJA 1NHWA 3SOZA 2VNAA 5KVCA 2V3CC 1NT2A 1PZNA 4P3PA 1R2QA 4ZCMA 2QXTA 3WS7A 5L53A 4NMLA 4DILA 2WC1A 2Z8ZA 3AEUA 3VZQA 4BO2A 5IMSA 1AO3A 3TMYA 2XRYA 3I9MA 4XYEA 2QV7A 2JATA 5IDYA 2F55A 3EGDB 1BTOA 2C5AA 1Y5NA 5F77A 5TRTA 3BHMA 3PFWO 4PF1A 4QSMA 1FS4A 3P71T 1ZD1A 4BL5A 2ZXEA 1EFRD 5CX1B 3M6VA 2FG7C 4DQXA 1MX9A 2IYZA 3WSWA 3MBKA 6CHYA 4JOBA 1AXEA 1P2DA 3COVA 1IMJA 2A5YB 4WDRA 3K0KA 4Q1VA 4Y98A 5ERYA 5BR4A 1F12A 3EJWA 4J1QA 1CUZA 3D4NA 3B8EA 1UXJA 1L4FA 3JQCA 3D1LA 1U0TA 4C4ZA 4EO7A 4Z4GA 1BS9A 1I5OA 2RG1A 2QNBA 4YRQA 3Q7RA 4KMRA 4ZT5A 3RROA 2KX7A 3EA4A 3CZ5A 2GCOB 2GHRA 3EUAA 3NIBA 2H5IA 3HDJA 1RYYA 2HW8A 3FZYA 4EDHA 1ZA2A 4CUZA 2B92A 5MGBA 4JYMA 1ECFA 1K86A 1RI2A 1W52X 4BV8A 5D6NA 4JI6B 2H4HA 5HZMA 4PC6A 3SWWA 2W6JD 3HUFA 3ESDA 2QVXX 4R1PA 5EPOA 1DVRA 3LIPA 1A8QA 3M9WA 5L3VA 1T4MA 1U2GC 1YJXA 2PPVA 3H99A 3P1JA 4OB7A 2Y2VA 3DMTC 3FHLA 3IQWA 2WJ3A 1Z4NA 4BFCA 3TNFA 3BIFA 4C7VA 8GPBA 1C3XA 3HU1A 3IDQA 1HO3A 3MJTA 3QOWA 5C37A 1JEJA 1OX4B 2H00A 1KS2A 3C1TA 2VQFB 1C8LA 1P1CA 4FD3A 3LSTA 1ZDMA 1P7ZA 2HLDD 5TS3A 3TQIA 1WO8A 4WEQA 1XPUA 3TRIA 2B78A 3MWDB 5FO0A 3ZI7A 3DP7A 4HOYA 4JMPA 4EHIA 1GTRA 1MZPA 2P0YA 3IR7A 2FN7A 1MMFB 5DBOA 4TN5A 1OROA 4LJSA 1KY2A 1RHUA 2X9VA 2DFDA 3OIWA 4UULA 1MIHA 1C7RA 2EATA 3IV6A 1Q1ZA 3OICA 2R48A 1YBVA 3NHRA 3R3SA 2CNLA 4TYYA 5EQTA 3MB8A 1Z0SA 2QVGA 3WX0A 5JWRA 2FKNA 3SAJA 1RIFA 5SY4A 3PCXA 4DA0A 4RSHA 3KKQA 4BNUA 2VTVA 4C7MA 4Z9BA 3B2QA 1B0ZA 3L06A 3PYLA 5AJUA 4LGYA 1MDBA 4WECA 1S9HA 1U8ZA 2CDRA 2RI6A 4DY6A 3OCYA 4RFVA 5J5AA 3GFOA 3TFWA 1KAQA 4K0KB 3QU5A 1AUPA 2YX1A 4OSPA 3H2YA 4YJ3F 1S9DA 3G0GA 3L6DA 4F5DA 3HYTA 2WG2A 1YS2X 4LNAA 1Q17A 3B5JA 4V03A 5ALSA 5EGSA 1S2LA 2QG6A 4FSDA 4DBZA 1I4DD 4REQB 3AF6A 4IUYA 5CCDA 4E94A 1R9GA 2DFTA 1T25A 1W1IA 1I5EA 4MVJD 2JGAA 4RJTA 4MUMA 4OGKA 4ZZ0A 2H08A 1HRDA 1BE0A 1R0SA 3FCOA 1NR7A 1ZH2A 4K6FA 5I9SA 2AN5A 1MA3A 1Y1SA 2AQ8A 4NC9A 4LC9A 4X24A 5BP7A 1N2HA 1G18A 3GP3A 3Q3CA 3SX0A 5B7NA 3GLFB 3VPCA 5LZ5A 1QOQB 3LZCA 4YUWA 1QC5A 1NNSA 1O94C 2BGRA 4MQ4A 4DWJA 5JXGA 4Q3DA 4XX0A 1ZJ5A 2FZEA 1W5TA 2A9RA 2AG1A 3ZR4B 2FFJA 2V7UA 4ARZA 4LXTA 4B84A 3W8DA 2GUGA 4AB1A 4CG1A 3WMXA 1YZGA 2P11A 4WNIA 4AQDA 1Z6GA 1TU4A 2ZZKA 4HDOB 4R40A 1GA1A 3VU9B 2ZR7A 1FXWF 3V7NA 5C1PA 2GRUA 2O0MA 3KEOA 3GAFA 3PV0A 2C3MA 3EGDA 3BHIA 1HOTA 3IDZA 4XLZA 5HW0A 1K8YB 4BZPA 3VH1A 8LDHA 3BZBA 5AI9A 1RTKA 1X19A 3TOCA 2OLEA 2VRNA 3ZGOA 1D1TA 1E2EA 1WA5A 2BH2A 4B4OA 1POWA 1V8DA 2FN3A 4LI0A 1IWBB 2C77A 2PMWB 3LX4A 3PICA 5TLSA 4RWEA 2GFQA 1THGA 3OQHA 4LGVA 3W5BA 4KK4A 4MUNA 2O1EA 2Y1GA 3PDIB 1T91A 3DEIA 5L4LA 4OHMA 3DTVB 4EI7A 4HWRA 4M99A 1Y9JA 2O6LA 2WINI 4ND1A 4GOND 1U94A 3D02A 4J76A 4R0VA 2JF0A 3V8RA 3WBJA 4ANFA 4B3SB 2F17A 2GEFA 3TLXA 2AVDA 1R5OA 4PFSA 4UHKA 4URFA 3IBYA 3U7HB 4XSVA 2VP0A 4M1QA 4Q18A 1QIGA 1QGUB 1VL1A 2IQ5A 2J48A 1DXHA 1K1EA 2BL4A 3PWTA 5J2UB 5KMGA 5LQRA 2XDYA 1G20B 2WEKA 1XMOB 4FQ7A 4AIIA 5IT9A 1U8AA 2XKAA 3PFBA 3THYA 1WMDA 1PO7A 3W0LB 2HF7A 3GHHA 3P9NA 4O0LA 2BHRA 3V2UA 1N32B 5JC8A 1EBBA 3OF2A 4QPJC 1GPAA 2W2VA 1JT9A 4LX0A 2R1VB 4HLCA 5K1ZA 4XVHA 3V7YA 3VHXB 2YJ4A 1SIWA 4IICA 1YAHA 3WWEA 4CI0B 3SQLA 2UYGA 2VDQB 5C8YA 3TQCA 1NJ1A 5MGNA 2JASA 5KWJA 1RAGA 2HC9A 4QRIA 5FPHA 3UBMA 4CCAA 4C7OA 2V55B 4QU0A 2ISCA 1DOAA 2O7NA 2IUEA 4YJGB 2GETA 2IY9A 2V7VA 2A2ZA 4G86A 4C3ZA 1TF5A 5K20A 4R0NA 2CZGA 2YV5A 2OGUA 1X3LA 2P3OA 4P7GA 4UDNA 4F1JA 1UWKA 2FQXA 3I12A 4HGRA 3VR5D 5EKXA 4HT3B 4L4UA 2QTCA 1N2CA 4JQOA 2SKEA 4G63A 1H8HA 1YZLA 1CS4C 4YAUA 3JR7A 2CXQA 2Q6KA 3L1IA 2I03A 3V9PA 1ZS9A 4NBUA 1VRWA 2X4LA 1GWNA 4L8WB 5AJYA 3WMFA 2L0XA 3BK2A 1E1CA 4WXMA 3QYPA 4ZREA 1X8XA 5FXMA 3X3HA 1XZMA 2I9KA 1OMOA 2QS9A 1P4JA 5T64A 2X1VA 2XHEA 2CV0A 3U61B 1KP3A 4LSGA 1ABEA 1KI6B 4TL9A 5DK4A 3L43A 4TM7A 4B6SA 2ONCA 5JU6A 5E9QA 2XWBF 1C2YA 3ILYA 3PXDA 4YT8A 2GTIA 4H2DA 2A67A 1C3OB 1YK0A 2R751 2VTKA 4QDKA 1RNLA 1M2JA 5THKA 3Q41A 1LPMA 1PHRA 3O38A 4P22A 5FIUA 3O03A 4MI3A 1MZVA 3KXKA 5EQFA 1JEDA 1Q20A 1FUKA 1Z0AA 2XUAA 1JHYA 1YDGA 3GFFA 4AG5A 3ZGVA 3K9FC 2FEWB 1YJQA 2Q3MA 4PYMA 3L1UA 4Z99A 1XCLA 4IQ8A 3BMNA 3FOWA 1VMDA 1ZZGA 2W11A 5F23A 2FZKA 3HGMA 4Y7CA 3DHVA 4IDNA 2CMKA 1PJ2A 2HV9A 3E2IA 2R6DA 4IV0A 5AXDA 1ACJA 3I09A 4G85A 4BEJA 4KXLA 4EPTA 2BFPA 1UF9A 5IVKA 2YV4A 3B6KA 1DAHA 1REQA 3I58A 1I2MA 3KR0A 3N9IA 4H3KB 2GLTA 5E4FA 3FKJA 3GA5A 1U7XA 2QE7D 4LDAA 1XLTC 1X87A 2NXEA 3B5EA 1DTSA 5ECGC 3W3AD 4IHQA 2PKEA 4WXRA 3LCCA 4GQAA 3M4JA 1XYVA 2XNKA 2SECE 1OKKA 2ZB8A 1KZ9A 1ATZA 4GYWA 1FFGA 4Q6BA 1WXIA 3D59A 4FT4A 1XALA 1ISIA 5CA1A 4P86A 1DIGA 2H29A 1ZUHA 1VLHA 1AE1A 2A5LA 4D9CA 3DOOA 5JJ5A 1XA3A 3TQFA 5I7AA 1LDNA 1YJAA 1AY0A 2IHVA 2XYGA 3DHNA 2FCRA 2VJLA 1WCIB 1IDN1 2JA1A 2QZJA 4N3CA 5IPFA 3HN6A 2VT7A 3ICWA 1VXRA 2B61A 3OCUA 4CDMA 3UV3A 4Z3DA 2ZIFA 2FOIA 2X3FA 5HSGA 1Z83A 4DJTA 5JAHA 4EJSC 1SKAA 5KOJB 1EAYA 2PXXA 2JLXA 5B5SA 1UBHS 2AYZA 4B3MB 1WNFA 1DMRA 2J7KA 2FMKA 4YRIA 1SA0A 5CDYA 4DNXA 2XLBA 2IXEA 4NRDA 5LQCA 4LVNA 1GM5A 1LTQA 1VJDA 1L1EA 3IE0A 2VAXA 3Q3GE 1IK4A 2WF6A 3HFSA 3CF6R 4RK4A 2BAGA 1LF5A 2WTBA 3PDUA 1N33B 2BDTA 1EJ0A 2G76A 3QU4A 4PGGA 5H80A 1QTRA 4XUEA 2O05A 1QH0A 1J8FA 3B12A 4FOSA 1QDEA 4YRPA 1YE3A 5KYGA 4KR6A 3WBFA 2W4MA 4NI5A 3UMSA 5FA8A 2E48A 5JMTA 2XB2A 4IHJA 2J08A 3SOPA 3TEFA 4FBGA 5JLJA 1PQWA 3EGEA 1RWXA 1LSSA 1ZP6A 2VXBA 3ICVA 3RNOA 4BVBA 3A8TA 3D5EA 2FWAA 5DYIA 2O8DB 3RRZA 2BW0A 1R6BX 5IFKA 3QVKA 3VOSA 3FOCA 2ZSBA 4G37A 4LHEA 3USZA 5BPFA 1NJ8A 3A04A 2YWRA 1BW9B 4UOZA 2V9PA 4OHPA 2P3QA 4BNYA 2CDBA 3K5PA 4W5WA 4CJXA 4NOJA 3E7DA 4HDMA 4DPKA 2X8AA 3VNSA 4B7UA 5CVEA 5CM2Z 5CYPA 1IJBA 1TFRA 3D1JA 3IH5A 4FFDA 8ABPA 4K1XA 5ULLA 1LQUA 1IZ8A 4IV5A 3RFTA 3RRYA 4WPGA 2AJ8A 3RK4A 5A06A 4UXJA 2IXFA 4FIZA 4L5JA 1XGKA 2AFHB 3C48A 4MAMA 3X0DA 4J9UE 5IEJA 3CSSA 4TKUA 3PFNA 2AX3A 1WSWA 1XEFA 3Q5DA 2IBMA 5ERGB 4ZVTA 3U60B 5DKFA 1VCMA 2ODAA 1JG6A 4FZVA 4XB1A 1OXUA 2X5NA 3E58A 1WP4A 1KC3A 4FI3C 5EMKA 5H81A 4G26A 3RJ9A 5K99A 2IYEA 4IDCA 3Q72A 4JLSA 4IY1A 7AT1A 4BFVA 1CJUC 2WTUA 2CYCA 4F2WA 4G07A 4PZZA 3TDKA 3U3ZA 3FPHA 3RSZA 2P2ZA 4EVSA 3OWXA 4WWHA 3OC6A 1FFSA 4DWOA 3BRWD 1MTOA 1PDOA 3WKEA 3WL8A 1XC7A 3IPXA 1H6DA 4RPHA 5AVUA 4CNQA 1H93A 3RC1A 1QE0A 1VE5A 2DGDA 2FTKE 2FPMA 5FQNA 4X8OA 2I9PA 3M6FA 3M6LA 1OU4A 3LQQA 4GW3A 3T3DA 1A0OA 2QENA 2C2ZA 2O2HA 4E4TA 4EG1A 1GUZA 3KB8A 5ICGA 13PKA 1ODLA 4Y9UA 4HDKA 1LB1B 2G82A 1GDDA 1YOVB 2XCLA 4UAVA 4NYMQ 4W63A 2VP6A 5JE8A 4AJ9A 3TG2A 2QN1A 1P2VA 1T15A 2G63A 2FA9A 4ARZB 1Z56C 4MLCA 1LLFA 3HJCA 3D7SA 4NONA 2NZJA 3ETNA 4DLNA 3VFDA 3AVQA 4AZWA 3B3AA 3T9AA 4LBZA 1S7CA 5EJGA 4PN7A 1ZVKA 2BKXA 1HL3A 1Z16A 4HQFA 3V8MA 3WC4A 3RRFA 3ZCSA 4DDMA 3OWOA 2BN4A 4EO9A 1JKFA 4YCSA 3S2IA 4Z4QA 4DS3A 3TMAA 3CZMA 1NI4A 3VOBA 1MJ5A 1SXQA 2GK4A 1FF9A 3MTGA 4NH4A 4WA7A 5TF4A 5KYWA 4O4HB 1Q16A 4JK3A 4JL8A 5E4TA 1IN1A 1ZM3A 2TS1A 3QMWA 4IO1A 5G53C 5EWJA 5E3HA 1U1EA 2BFAA 2CN1A 4ZQHA 4CVNA 3IPAA 2FUG6 1RD4A 1RJDA 2VF2A 2XTMA 1PVOA 4URUR 3DDSA 4PGAA 4EG5A 2PMCA 4RIIA 4YAIA 3T3PB 2XRZA 2GDJA 1GQYA 3MPUA 1G9XA 1NG9A 4FFNA 4BFWA 2BMJA 3L0PA 3L7NA 1SCKA 5FBVB 4CEHB 2IW3A 4OY3A 5ALIA 1LDMA 4IZ6A 2K7FA 1RRFA 4GUDA 2YR0A 2HKIA 3O9ZA 4N6OA 3HDHA 3KHKA 3N8IA 1GU1A 4NCAA 1M73E 1GAEO 1DFGA 5KTNA 3DAOA 3UYLA 4NCHA 3RO7A 2QD1A 1RBMA 2JHFA 1XZLA 2GEJA 1C9DB 2YCBA 4N01A 3OH8A 4YP7A 4E70A 3BJRA 3D8HA 1UPAA 4MPJA 3BGVA 3PHHA 2XT6A 3ZTTA 3ZU5A 4CKBB 4EFLA 4ZVMA 4V0RA 2V0GA 1PEAA 5BNIA 3FMGA 4J0HA 5AK3A 2UYCA 3THXA 2X8WA 1GRVA 1ZGJA 4RSMA 2VNHA 2J7PD 1V39A 2X9GA 5AJZA 2PUDA 1GR1A 5KYYA 3VKVA 4NX2A 5BSGA 1V4NA 1RMYA 1RR6A 4OIMA 3VKHA 2VUIB 4HY3A 2YMLA 2VJCA 1ZNWA 2Q1UA 3TW0A 4CKEB 1NQ5A 3DONA 1JLLB 1UPFA 2CYBA 4DNPA 5ALEA 3MBOA 3ACCA 4TKMA 2PL3A 4LWZA 4HYQA 4U3JB 3RS4A 7REQA 4ER5A 5KWIA 4MVJF 3K5IA 5DT2A 1CDOA 1DRUA 4B3GA 1NN1A 4JBXA 3T5GA 5DT9A 1UR5A 3D0QA 2FMXA 2IP1A 4L5IA 1MABB 2H85A 3NUGA 4JBWA 3EQ6A 3ANNA 3ORQA 1RI1A 5KVVA 1UC9A 5TJ9A 4LQLA 2GBLC 2WY2D 3UTCA 3HCCA 3ORHA 4B2IA 3AFGA 4FZ3A 3WIEA 3QWIA 1YRQA 4EKGA 2QLTA 4TYQA 1B1CA 4YS6A 1VJRA 2BFFB 3GPCA 3OA0A 5LVAA 4IFTA 4BNFA 2EX0A 3BB3A 1C8KA 2IEYA 1SB9A 1BXGA 3EE6A 3LVBA 2JJ8A 4UBOA 4JI5B 3SZMA 1ZK1A 4N9WA 1MRSA 1JXMA 2W6ID 5BNZA 1CR1A 4C01A 3NHYA 3W34A 1UZAA 1VPTA 2FWJA 4URVR 1S7GA 4BUZA 1QO0A 3OQIA 4Z5XA 4EJ0A 1UFQA 2D5CA 1FTSA 1XQ1A 5AXAA 4WASA 5K4AA 5AKZA 1P0PA 2F8MA 2Q4DA 3MLAA 1UMBA 2B7CA 4E5DA 4UM9D 1LK7A 3VUEA 3T0FA 1U4NA 2ROQA 4KV7A 2MR6A 4HTAA 3L6BA 4JJFA 2YFHA 5ESRA 1IOZA 1HQKA 2RDMA 1T36A 3STVA 3KUUA 2XCQA 4X8MA 2JGRA 4ZVNA 4GKVA 5IVHA 4ZU6X 4BQQA 1KRXA 1KK2A 3I6QA 3IMEA 3CLTD 5BSTA 3QNMA 5HFJA 4B75A 2G0TA 4QPDA 1SCDA 4X1KB 3I6MA 1BOOA 4ND4A 2WKSA 3DE0X 4AWBA 4QYIA 3L8ZA 2RIPA 2DETA 4D9KA 3V4PB 1NU8A 1F8YA 2FU5C 4MA4A 3VR6D 2R96A 1GQFA 2VNJA 4P0QB 2YQ4A 1NJ2A 4FE3A 4GWLA 4DSZA 1IN6A 4HCJA 3EPKA 4PQYA 1VL8A 4PPQA 5KHLB 3TXXA 4R41A 2KB0A 1FUUA 2ID7A 3ONEA 4A5OA 3OMXA 1ENOA 3ZVRA 3H4VA 2XF2A 3BHNA 1QDUA 2XVZA 5I6DA 3C8HA 3CO5A 3EIWA 4C4XA 4JJ6A 3LNCA 3C85A 3MCTA 1KS9A 3UWSA 4UCQA 3QRWA 5J23A 4HDRA 1M66A 1WVIA 2FY8A 2Q5QA 1R0XA 2IELA 3N07A 4I46A 3IPYA 1N2GA 3RAGA 1EWQA 1Q15A 4C0WA 1XP8A 3IOEA 4TMYA 3OZUA 4D4KA 3WB1A 3AI1A 2C03A 1V43A 2Y71A 3R4CA 4AF7A 5DLQC 3LHIA 2PFSA 2JAOA 1ADGA 1TLFA 2KE5A 3CRW1 4NAVA 4J0FA 4BMYA 4QLBA 2EW1A 3GT7A 1LPSA 4O2RA 3V7FA 5KNCD 2P9QA 2JGFA 4GICA 1A72A 1DDOA 1RWKA 2PYIA 1CJMA 2XJ9A 4KOAA 4LYGA 2HAEA 1VYTA 3NATA 1AK9A 1FDWA 2EHDA 3KETA 5AESA 3OD1A 2PCJA 1JQ5A 4Q93A 3JZDA 4FFRA 1P73A 1TL7C 4G1MB 3WLTA 4BLTA 5K8CA 4DV1B 1E0AA 1L7AA 2NV6A 1E6CA 1NLUA 3DF9A 5CBPA 1V7PC 1ZVVA 1FW8A 2I2XB 2E4YA 3A31A 2XADA 3G8BA 1C0IA 3K53A 2O0JA 3O82A 4IM7A 1Q7BA 4BO1A 1A7JA 5D2CA 3NMUF 3RSHA 3P27A 4ATNA 3H0EA 1E2LA 3E8XA 2VK4A 3LUBA 4BGUA 5LN1A 1XDDA 2R00A 4OI1A 5CG1A 1ZMBA 2IRWA 1A9YA 3GOHA 3JY6A 1TRHA 2W8BB 2YYSA 3JSAA 3OJLA 4UZFA 3K9QO 3LKZA 2P9GA 1CUJA 2X4GA 4XSGA 3KLMX 4N3BA 1YIOA 5FWYA 4RVGA 1W85B 4JYAB 1YS7A 2NQTA 1G7SA 3CZCA 5FFMA 3E18A 1KL7A 5DMHA 3FB1A 1VFPA 4I5GA 3CRQA 4RF3A 1EFCA 3VJLA 5KOJA 3USCS 4CUKA 1K3UB 2B8JA 2HMVA 1GAWA 3LY7A 2JHGA 3TSWA 4C0HA 4PLWA 1DT3A 3AY3A 3D64A 3TO5A 4QFDA 4V0ME 3GU3A 3I2YX 4NENB 4LJ7A 4EGAA 4Y2XA 3I52A 5B1SA 3LBIA 4JLDA 2E1PA 4MUEA 2DSNA 4YP6A 4EZIA 3TEMA 4L6CA 3LGAA 4N3AA 3RGGA 3UB2A 4MRMB 5JV5A 1H05A 1FXWA 1VSUA 4J6FA 1DZIA 4RY0A 2CHEA 1RKXA 1S89A 3NVDA 4UPVA 3ZY5A 3WLLA 3WRYC 4I8IA 2WQ6A 1IHUA 1PZGA 4IYRA 4DYVA 2NW6A 1Q11A 1JSLA 2PKYX 4EPVA 2GM4A 5BRAA 2ECFA 1OZHA 3DFFA 5MN5A 1EM8A 2KM1A 4LOKA 2PGXA 3HY3A 1YQDA 1W581 4LJ8A 3KAPA 2I62A 2JH3A 1ESCA 1EGHA 1SOMA 3E8MA 1PX2A 2PR7A 4I1IA 1JPUA 1Z4KA 2C99A 1YCFA 4KWEA 4JXKA 4B32A 5KYVA 3EGWA 5CJJA 4PSAA 4EEKA 1HT0A 2GZRA 2WTEA 5DXFA 3TTWA 1ICIA 4H7FA 4L2IB 1PFQA 2YJ3A 2YQ5A 2ZIUB 3GAAA 4HS9A 4WLUA 3S5JA 4P0PB 3IPLA 4DCTA 2O2DA 2IYQA 3NOXA 1PR4A 4LXUA 3SMQA 5B64A 3SIPA 2ZRKA 2GXUA 1DJNA 2X15A 5FB3A 3HCFA 2JCYA 2VJMA 2WIGA 2R86A 2QRZA 3HH8A 3KBBA 4Y0NA 4HFRA 1BXZA 1FU4A 3FWYA 3M3DA 3X43A 3C70A 3R44A 3LLCA 5J5CA 3ZDRA 3RAEC 1QYVA 1XPRA 3L8CA 4DBVO 5K3FB 2YXBA 1JXOA 3M4ZA 5C4MA 4IMRA 1GPKA 4PY2A 5P8WA 1RWOA 2J9RA 4MQMA 2W00A 1NI4B 4G4JA 4X1YA 1OREA 4QXRA 4I9NA 4DCCA 3EPLA 1SKMA 1B2LA 1P5FA 2GCNA 2V7TA 1KI6A 1VGRA 4KVFA 3RRJA 3MWKA 3UWMA 4O33A 3R7AA 5K7SA 1M83A 4IKOA 4JUCA 4TX1A 3RC3A 3BJEA 2YY5A 3LLUA 2IYVA 5BYAA 1Q0RA 2J9GA 1W0JA 4QQRA 1Z47A 4RL6A 1DC8A 1DIAA 2BKLA 3WV4A 3SSAA 4L0MA 1T6NA 1E92A 4JQZA 2HCRA 4HXGA 3KVOA 4X6XA 5JPIA 3ROKA 1O96B 1ZD9A 4K40A 5CEEA 3C8DA 3LJKA 1Y7IA 1SRQA 3VX4A 4DIMA 1NN5A 3OZVA 3UUFA 3PE4A 1PJLA 2DE0X 4GPAA 3HWSA 4CTNA 2WF8A 2WJGA 1EDBA 2WICA 4RX1A 5JS1A 3R9XA 3OZFA 2MT9A 2W2LD 1EBUA 1KDOA 1DV1A 5DBEX 4D57A 2OXIA 4HDSB 2DHEA 4AO6A 4FB4A 1SXPA 3I5MA 3DMDA 3HZZA 4V0LA 1Z8NA 2QPTA 6LDHA 1JG3A 1M7HA 2YMMA 4XR4A 2G09A 3RBZA 3UMMA 5AW6A 1OV6A 1QHNA 1ND6A 2ZSAA 2J3JA 3ANTA 2ZBVA 4QPZA 3F4KA 3OOJA 1Z6YA 4NQRA 2OGWA 4PRZA 1CV2A 1LRKA 5EJ2A 4Y2PA 4CM9A 4FWTA 2Q5FA 2PGOA 2HJGA 4LY0A 3QVMA 3QOYA 4DDKA 1AV7A 4EJFA 4XWKA 1EVZA 4AY2A 1CQIB 5E0KB 1TPZA 4P32A 4A2PA 2R6FA 4DJ5X 4C14A 4E30A 1E5LA 2I3ZA 3L8DA 3NDRA 4EPWA 3WA7A 1PWHA 1QIHA 4BECA 3G5AA 3ZV7A 1T1JA 1YASA 3FPEA 2HYDA 4HEJA 1W46A 4O08A 1BEEA 3A1TA 2YRFA 1Q7TA 2ZUDA 2CUZA 3LOQA 3PGKA 4B76A 4YIHA 5JJLA 1Z17A 2X3UA 3TSCA 1OYVA 2VHEA 4YQZA 1XRSB 1Z68A 2J5XA 4CIWA 1KEKA 3KK0A 2PUFA 3QA9A 2OHJA 3FE2A 3OPVA 3X2FA 1PS0A 5F64A 4ZA2A 2FPUA 3MLEA 5JISA 4P3OA 3QYAA 4XASA 3Q6IA 3QPUA 2QX8A 1PJCA 3JARB 3NQ41 5F12A 3DJFA 4M86A 4X1OA 5CDSA 1SKYE 2Z5VA 4TUYB 3C16C 4GX5A 2ORVA 2X5KO 2D2EA 4PINA 4QM6A 1MIOB 2AW5A 3AR6A 4OL0A 5LLDA 4ZOQI 2G07A 4PHFA 5BSVA 3CCFA 1ENZA 2GHIA 4LZAA 3R5SA 3KYBA 2YZMA 1HWYA 1KJIA 3S28A 3GA7A 1E1NA 5DSTA 4JC4A 2C31A 5BUCA 2ERXA 3L0IB 4KACA 2PA3A 4HEQA 3C97A 4HDNA 5HGXA 4RABA 1YBHA 3CPJB 3LTNC 3TSOA 3GJ4A 5E1OA 3HB7A 4BKOA 3TPCA 1C41A 4PSKA 5I9MA 4FHEA 4YRRA 1N6HA 2ZWMA 5IBRA 2VDKB 3F2VA 5BSMA 3ED5A 3BUSA 1HYEA 4D8WA 2B1GA 1ULZA 1A95A 4R2LA 4U5QA 4DVGA 5EZYB 3SKVA 1XMSA 1YR2A 4F91B 1P4AA 3M6IA 1SD2A 2VJPA 2O6HA 4JYBA 3QKRB 1Z36A 1XMJA 2A88A 5BWBA 2YY6A 3L07A 1QWSA 2F9LA 2VDPB 4YCJA 3VU8A 2ZIGA 2GH1A 4BX0A 1R37A 1SVLA 3W7BA 2AMFA 3RS8A 1QPZA 4X41A 2YFYA 4BRWA 5CD9A 1U63A 5CVVA 3CUYA 1A5SB 4XWYA 1LLDA 3MGCA 4PC7A 1SUIA 4H15A 1AUQA 3NTXA 2DBQA 2PKRA 3LFUA 2EFYA 1EP3B 3KEGA 3KZ1E 5B1HA 2OHIA 3A25A 3VU9A 1Z5ZA 1LX6A 4AKIA 1B8VA 1XKTA 8ATCA 2P40A 1ACLA 3P32A 1QRAA 4E3WA 2QL6A 2GA8A 3PWKA 3ETEA 3MGKA 4XD7D 5A0TA 4N5MA 5TE9A 1NLFA 1P60A 1SH7A 1WCWA 4PYQA 2AXPA 5ENZA 1XX6A 4BJ3A 4ZYVA 3H1FA 3QI7A 4LOAA 3GJRA 1AKTA 1GZSA 2CLMB 3TZHA 2P9TA 3TX2A 3GRZA 4A36A 4JB8A 2O2XA 4KQIA 3PTZA 3WL6A 3N39C 2C7QA 2FRXA 5AK6A 3SVLA 1W36D 4TRRA 2FW0A 2JFBA 3OEHD 1BVUA 3BK7A 3I1FA 4P83A 5K3SA 3MN1A 3QKSB 4KFTA 3J81k 1XQVA 1PEYA 4F5EA 1IOWA 1N9GA 2H6EA 4WBSA 3AEZA 3BPSA 2ZJBA 3P20A 4M4SA 4IX9A 4NE9A 3TSAA 5DHPA 5HKKD 1V9SA 3BERA 1LLCA 2YWGA 3BIXA 1GXSB 3UKDA 1RBZA 2KBFA 3NC4A 2F6RA 5TX7A 2CHGA 1R18A 2DQSA 4IH4A 3FUWA 4GRAA 5LDGA 4XVRA 1AURA 2G83A 3L41A 3OZRA 4D81A 6REQB 1FDSA 2P6PA 2GRJA 3OX1A 3B1KA 1K6MA 4IIJF 1SVWA 5B37A 4GFDA 4C78A 1YI8A 7ADHA 3AOEC 5F52A 3B6ZA 2RI1A 1DAFA 1PJZA 1VLVA 1BDBA 3FYTA 3H5WA 4F3CA 1N2IA 2TMYA 4CKCA 3A4MA 3CG4A 2YWDA 4UEOA 1NMQA 1B26A 5IF3A 2YN2A 3INYA 5CTAA 2ZRMA 2GZ3A 5I7EA 5JMWA 2GAAA 1FB5A 4FK8A 1IJEA 1X7XB 4YGYA 5K3AA 4Q9JA 1D2GA 1Z34A 3SBEA 4NXNB 1UOQA 3DXYA 2XGSA 3BZWA 3QENA 4AZVA 3I1YA 4MUJA 3IVGA 2HJRA 4YRAA 1KC1A 4ENUA 4A15A 4YYEA 4PO1A 1EIWA 1THTA 4AM8A 4KIUA 1U9JA 3NGXA 2WSYB 1JR3A 1N5RA 3HUUA 1Z29A 4C4AA 4TSKA 1X1AA 4G0VA 1R9NA 3C2QA 3JVDA 4DSNA 4K86A 1Q21A 3QPDA 2AF3C 3RT9A 1MB4A 2JHAA 4JEHA 4DTCA 2RD2A 2UUBB 1L7DA 4Q7MB 1EE9A 3KJIA 4QRDA 4WK6A 3MD0A 5LU8A 1OI2A 3KQTA 1JR3E 3FGNA 4I55A 3VDQA 2F1HA 3COJA 3NVKI 1PU2A 2A9PA 4NK5A 4F71A 1M1YE 3HWX1 5DIFA 5GONA 3WGKA 3KOXA 1N1DA 3DE2X 1WOMA 3PZBA 4ID3A 4BJ6A 3LLSA 2V4ZA 5K0FA 4BMCA 4FCWA 5IFLA 1Z45A 4BPRA 2N0SA 4YC7A 2ZPUA 1YSCA 3WGJA 3C7CB 2QW0X 4YIKA 2C2OA 1RMQA 3QFCA 2YWHA 1QOZA 2NSDA 2XAUA 4OMDA 4WBNF 2PZ8A 4HKTA 3HFRA 3CISA 2J9FA 4CIAA 2X9QA 4F60A 1HMPA 3MG9A 3FH0A 4E03A 3KQNA 5L3SB 3X1YA 1IBSA 2WW8A 1QFXA 1ODKA 3MCWA 1M9NA 4FSHA 2ZSJA 3UYKA 1T26A 2O2GA 5FWYB 5BOSA 1I24A 3DMHA 2O4UX 3FM9A 1QLHA 3D2LA 4A91A 1NUQA 1UOOA 2A0UA 4WKNA 1V9CA 3WLEA 3QBVA 3MTAA 1WZEA 7MHTA 4NYMR 1FX1A 1X7YA 1NM5C 1MAHA 1N6RA 4OI4A 3ILSA 1EX1A 3SNKA 3W6PA 4H7KA 3BXGA 1TJ3A 4X60A 3RNLA 3IXMA 2AEFA 1A4IA 4XQ0A 2GPNA 1PNRA 1FFEA 3KVRA 4S3MA 1KKUA 2D3TA 2I5PO 2HFKA 5EWLA 3U4DA 4C88A 1HG0A 1E4EB 3UJ8A 3D4OA 1IHPA 3DYVA 3OZCA 4IIDA 2FEAA 1IYZA 3BGWA 4MR9B 3U7EB 3AM3A 4KO1S 4O4IA 5JCJA 3LRTA 4D8YA 5CGZA 2B36A 3NNDA 4Y2RA 2FEPA 3ZNPA 4B85A 3TQOA 2YXPX 3BX1A 1G1AA 4B6GA 3KIPA 1NXQA 1OW3B 1RAIA 4N0DA 4R3WA 4WOKA 3HEBA 1TKCA 2GA9A 2JDID 2V03A 3KT8A 2FEKA 2ZCUA 2VAWA 1RWMA 5EFOA 3H17A 3ADPA 2GWRA 2P67A 1LKZA 1RPAA 4F3NA 3UCFA 1PFVA 2QUAA 5HF5A 3VKWA 1F6BA 1TF2A 4OSOA 4E1VA 4PSUA 3CW9A 3X2SA 1TIKA 3IAM1 3C1UA 1N6IA 3EFHA 2DMRA 5E6SA 4KOEC 1TTPB 1YZQA 2B2NA 5C5DA 1RXEA 3JXEA 4N5NA 3MCVA 3TXAA 1E6UA 5EXDA 3GCGA 2WR8A 3GZTB 1PEKE 4JOSA 4F4IA 1YCGA 3DMTA 4GE0A 2Q6OA 1DINA 5A3JA 4IFEA 1YQGA 5FWDA 4I9FA 2IPAB 1XQXA 5TGDA 3LQ4A 1A4UA 4TLEA 3ROMA 4EGSA 4HSGA 3HM2A 3BICA 1FP4B 4QBIA 5CIQA 5CPBA 4XIGS 3N3AC 2OB1A 4R01A 4EFDA 1YTUA 1CS0A 3QWFA 2WYOA 5M3BA 1XCPA 1ORRA 2F4NA 3MYYA 1QYDA 3C3CA 1GFIA 5ETJA 1RYHA 2FLVA 2J3MA 3ZNQA 5TNXA 4HUQA 4AXBA 3NXSA 4QJ5A 4QNRA 4MW7A 5HRAA 3TB6A 8AT1A 4NBTA 3WGGA 3C7KA 1BVRA 4BLPA 4IFBA 5LB2A 1F0PA 2YOGA 3DLBA 5AVYA 1U11A 3DEKA 1V26A 1QNLA 3JWHA 2VHWA 5EZYF 3VPXA 5F7OA 2O8FA 3A2LA 3WNQA 3HJBA 3IJRA 5KOYA