4U2BA

Crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas knackmussii
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 80
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2bA00
1EDEA 4DNQA 1FFAA 3V1KA 5JADA 1KEZA 2YYSA 2PSEA 1YB7A 4JNCA 1JFRA 3H18A 4FNMA 3WK7A 4DLNA 4GBGA 1ETHA 3QPDA 1H2YA 3FNBA 1ZICA 2XB6A 4BBZA 3U0VA 1QIHA 1WHTA 2VJDA 1S8OA 4AN0A 5DTIA 1CV2A 1QLWA 2BGNA 5FP0A 2B4KA 2R8BA 4A23A 3N0TA 2WG0A 1N5MA 4DM7A 2XDWA 4PSDA 1EX9A 5C8VA 3IUQA 4C01A 3O9MA 5K3AA 4O08A 3WIBA 2LIPA 2HHAA 4B9EA 2CZQA 1THGA 1MN6A 4KAAA 5CH5A 1CUUA 4LIPD 4OU5A 2ZVDA 4OB7A 4G9EA 4H7IA 4HRYA 5ALQA 2C5FA 5K3FA 1MX9A 5AKHA 2Z3ZA 1X2EA 5ALMA 2GBIA 1EHYA 3ZLTA 1W52X 1XZKA 4GDMA 3ZI7A 5DWDA 3MGAA 5A7FA 5AIAA 1LNSA 5AI9A 1QO9A 4MQLA 3B12A 5EI5A 1LPSA 3WQHA 1BN7A 1YB6A 1JMKC 2ROQA 5FUMA 3K2IA 2WJ6A 3CCBA 4E14A 3IUMA 1K8QA 4WDQA 5LZ8A 4YK7A 4QDTA 5ISMA 3R3ZA 1SCIA 1N1MA 3DYIA 3FOBA 1K5PA 5AKZA 3TRDA 3C70A 3C8DA 2BFNA 5A62A 4EZIA 1LPBB 1ORWA 1GKKA 5LYYA 1CRLA 4DGQA 2C58A 1HPLA 3WK9A 3ZWQA 1FFCA 2RAUA 2ZYIA 3O0DA 3OURA 3WL5A 1QFSA 3QITA 2OGZA 1ZIXA 4HVTA 3HSSA 4JYMA 4JYPA 3QMWA 3H17A 2Z3WA 4K5QA 1UK6A 3DLTA 5FKJA 1P0MA 4BRSA 3VVLA 3WKAA 1QONA 5I7UA 2QKYA 1W75A 4BC1A 1Q0RA 5H3HA 2WKWA 3FBWA 4DIUA 5AO9A 3G0BA 4FNGA 3AILA 3H04A 2JBWA 3N2ZB 4AO8A 1XQXA 4ZI5A 3BDIA 4BE9A 4BE4A 4I19A 1XZHA 3AIOA 1E5TA 3SX4A 1MPXA 4U2FA 1H2WA 3O4HA 1WM1A 1DT5A 5C8XA 4BCBA 3S2ZA 1Q84A 4Q05A 4BCDA 4FWBA 4WJLA 4UBOA 1A88A 3EIOA 2WJ3A 1UZAA 4LXIA 2YXPX 2BUAA 1BRTA 2XUGA 4NMWA 3I1IA 5ALHA 4ZV9A 1E3QA 1QIFA 4M0FA 5JASA 3OG9A 4KR0A 1WB6A 1VXRA 3PDCA 5LZ7A 1VLQA 2FJ0A 3RARA 3BE8A 4IO0A 1DX4A 3DL7A 5AIBA 2QM0A 1JJFA 2D5LA 4BC0A 1CUZA 4QDUA 4X95A 5AHXA 3LP5A 1SFRA 2V96A 4H7HA 2VJAA 4OYYA 1MO2A 2ECFA 2XUPA 1TIBA 4QDXA 2JGLA 3WK4A 1D07A 4J0DA 2YASA 4DMHA 3Q0TA 4UFOA 2XUFA 3DS8A 5EGNA 3G02A 1GZ7A 2ACEA 5AH0A 4DSAA 1TAHA 1XRPA 3CCCA 1CUSA 4MYDA 4QLAA 2HA2A 4B0OA 3HEAA 3QMMA 1CUHA 1DT3A 2OAGA 3C8HA 1JKMA 4PSUA 2VAVA 1CUJA 2AJLI 2DHDA 2PKYX 4X94A 3F96A 5ALDA 1QGED 2BGRA 5ALPA 2WTMA 1CQWA 2RHTA 1ZOIA 1HKHA 5AICA 2H7XA 3IUJA 3PE6A 2XUJA 4BZWA 5JD5A 1NX9A 4UFPA 2HA4A 2WIJA 2OXEA 3KOOA 4GECA 4HXFB 4X3CA 3IBTA 4UPDA 4XVCA 4WFIA 3ZPXA 5CT8A 2Z8XA 4F0JA 4BDSA 1QIEA 1KU0A 1LZKA 2BCEA 1MNAA 3ICVA 1CQZA 2IIVA 3QVMA 1QIIA 5AM2A 4CI9A 5DNVA 3YASA 4QWWA 5E4YA 5CURA 2WU4A 3MUOA 4BAZA 4X91A 3BIXA 4EHBA 3G9TA 4J0KA 3DKRA 4A16A 1W4LA 3UUEA 3F97A 1GPNA 3WA7A 5JD6A 2WIFA 4BVJA 2XI4A 3F9CA 4N8EA 2ZYHA 4Y7DA 2XMRA 1XLVA 3L1JA 5AOBA 4CG2A 5D3ZA 1F8UA 4CIAA 2GZRA 3F98A 2PVSA 5D7BA 5EFZA 5DLPA 4UBIA 5AOCA 3A2NA 3FWHA 4LXHA 4UBNA 1H2ZA 4Y2JA 2JIDA 5IVDA 4FBLA 5AKGA 5CXXA 3AINA 3NOXA 5ALWA 4ARAA 1CPYA 1WB5A 1WOMA 2B9VA 2QR5A 1E8NA 2PU7A 4UHEA 2XUKA 2OPHA 5AP9A 3ANTA 2VT7A 5DJ5A 1M33A 3H2HA 5EHNA 1HDEA 4L72A 3AIKA 2HDWA 2OG1A 5HQ3B 2BUBA 3M82A 4HAIA 3EQ8A 4WFJA 1JI3A 3P2MA 4MJ3A 5EIEA 4AB1A 1UKAA 2XLCA 3OC0A 1ODCA 4QA9A 2DSNA 1WHSA 5BOVA 2ZJFA 1VJ5A 2QOEA 5AKIA 2OGSA 4XJVA 5E4JA 4V2IA 2G63A 5A2GA 4MWTA 3I6MA 3WZMA 3A2LA 2WFLB 1XLWA 1IMJA 5HFNA 1VZ2A 4C4XA 5A71A 4DYHA 2OCKA 2HM7A 1PFQA 5LKAA 3QH4A 2PSFA 1ODSA 2C7BA 3D2BA 2XQFA 2RONA 2XT0A 3HJUA 3SWWA 2H7YA 4P08A 5ALKA 3IDAA 2PSDA 1UT6A 2X8BA 4HTAA 4BDTA 1CUBA 1U2EA 4QNNA 4UHHA 3STTA 4JUIA 2OGTA 4BTLA 1FFEA 5FV4A 4DMCA 3H1BA 1XRQA 3FSGA 2HFJA 3B3QA 4FOLA 4MYSA 4LYDA 3RK4A 4AZ3A 1EA5A 1WPRA 5FPPA 3L1HA 1DTEA 4EY8A 2ONCA 3VKFA 3EQ7A 2XUQA 3GZJA 4Y2PA 3G9ZA 3WL6A 1EVEA 1H2XA 4C88A 1USWA 4UFNA 3LS2A 1X70A 1ZD5A 1VE6A 2V98A 1QIKA 3FLAA 2Z5GA 1XZCA 3JW8A 4W63A 4KACA 3D0KA 1P0PA 5AKLA 1EB8A 3GUUA 1UK8A 2WG2A 3FYUA 1CEXA 4B81A 3O4IA 1XZFA 4EY7A 1QFMA 4H7DA 4B83A 3L1IA 4OPMA 5E4TA 1OCEA 5J3JA 3HABA 1AKNA 3E1GA 4L9AA 3PFBA 4J03A 4WY8A 4ZWNA 2XMGA 5LZ9A 1XZLA 4X00A 3WL7A 2XQIA 1XRLA 2C0QA 3QM1A 4Q3KA 5JYCA 3D4LA 3CXUA 5ALTA 1AQLA 1U65A 3C6BA 3FSGD 1CUCA 5FLKA 1O6FA 2HA0A 3KDAA 3D5EA 3Q8WA 4FLMA 3CN9A 2HADA 2QVBA 2ZYSA 1VOTA 2OCGA 4H18A 5LIPA 3GELA 1W76A 5JARA 1EVQA 4DNFA 5C81A 4OUKX 5IKXA 4LXGA 1K6EA 3TEJA 4AO6A 1AURA 2P8SA 2VJCA 3IVMA 4QWMA 2VATA 3NUZA 4AN1A 4C4ZA 2JEYA 1R3DA 3D2AA 5ALZA 3HYSA 3I2GA 1CUXA 3KD2A 4X6YA 4F5ZA 3JWEA 4BAUA 1H22A 5ALGA 1IVYA 1Y37A 2ZYRA 2JGEA 3QMVA 4PW0A 5FDFA 4X97A 3IUNA 1CVLA 4HRXA 5I8PA 4U2GA 1K4YA 2OCLA 1QJ4A 4L3WA 4QDZA 3WYDA 1AUOA 1J06A 1XQVA 2BJHA 4GXNA 3S8YA 5KREA 1VXOA 4LYEA 4X71A 2X76A 4AMYA 5FPQA 1LLFA 1XQYA 1YR2A 4B0PA 4Q3OA 4EY4A 5IVHA 1EK2A 3C6XA 5D3KA 5JAPA 2WJ4A 5EHZA 2IITA 2ZJ7A 1YA8A 1YS1X 1ZD2P 4EA6A 4LHEA 4Y2QA 3V1MA 1W1IA 1UFOA 4Q1VA 5HFAA 4Y9SA 4D9JA 1C7JA 4INZA 3DOHA 1EB9A 5CRIA 5EHQA 1XRNA 4BAGA 4KYVA 1TK3A 3IURA 3H19A 4CIBA 4AZ0A 4EUSA 1LGYA 1XZAA 1EXWA 4W1RA 2WG1A 1CUIA 1VA4A 3DEAA 3ESCA 3O95A 2Y6VA 3WZLA 4W1SA 4LKOA 4QEKA 1NU6A 4ARBA 5LZ4A 2WHPA 5T4BA 4UBKA 4G4GA 5DTJA 4Z49A 5JZBA 4P93A 4H77A 1TKRA 1L7QA 3FAKA 2PM8A 1UXOA 6YASA 5JAOA 1VA5A 3ZLVA 3M3DA 2ZSHA 1MX5A 1XZGA 1A7UA 4H7EA 1ZD3A 1WPXA 1CR6A 2WSLA 4Y2TA 3OOSA 1R1DA 2XMSA 3HZOA 1ORVA 5SYNA 4F21A 3QPCA 3F8SA 5DNWA 3WJ1A 4J7AA 1QE3A 1XKLA 4JH0A 1A8QA 1W6RA 5AKJA 2I03A 4OU4A 2FJPA 3EF3A 2WFZA 1JJIA 5AK6A 2DQZA 4Q3LA 2GYUA 1UK7A 3I2KA 2AJCA 5HK8A 3BXPA 5EIHA 1GT6A 3NGMA 2XUOA 5ALNA 1ZI9A 2OLEA 3QYJA 2X5XA 1X2BA 2WQZA 5E2IA 1XROA 4J0JA 4IH1A 3GBSA 1ZJ4A 2BKLA 4KAFA 5LKRA 1RYYA 2C4HA 1F0PA 1MJ5A 3BIWA 5CTAA 3WWPA 2WIGA 2B61A 1CUYA 1CUVA 3WK5A 3DYVA 4GWLA 4GHWA 2HU5A 4U2CA 4NZZA 3WK6A 1C7IA 3A6ZA 3DCNA 2CUTA 5ALSA 3KXPA 1MTZA 4F60A 4EY5A 4XWGA 1E8MA 2Y6UA 1EDBA 4W1QA 3IULA 1G4HA 4DMFA 3AJAA 2NW6A 1OXMA 1E66A 2ACKA 5ALVA 4TPKA 5JAUA 4Q34A 1IZ8A 1SCKA 4J0CA 4Y2RA 3WKBA 2HU7A 2OCIA 4A5SA 3O4JA 1QIGA 1DWQA 5DNUA 4GW3A 4IQ4A 5JANA 5KWJA 1BEZA 3JYHA 3I2HA 2JGIA 4KRYA 4KE7A 1BEEA 3R3WA 3FCYA 2FX5A 4RNCA 1JMYA 4TGLA 2ZSIA 1JJBA 4CFSA 3A70A 4UHCA 4DNOA 5HKBA 1HLGA 4EBBA 3PF8A 4J0HA 5LLSA 4Y2SA 4MEBA 2RGUA 3M81A 4N5IX 4ZXFA 4UHFA 1WB4A 2HA3A 2GBCA 2DQYA 1BS9A 3G0CA 1R9MA 4C4YA 1XRMA 1XZJA 4QLOA 2GZSA 1SOMA 5BWCA 1PV1A 3D3NA 5DYWA 4QZVA 3LCRA 2VAXA 4BB0A 3AFIA 3GROA 4UHDA 3I2JA 5HF5A 3BWXA 5A7GA 4YASA 1N8SA 3GFFA 3C43A 1ZI8A 4E46A 4NVRA 2CB9A 1LPOA 3WKEA 1HQDA 4G8CA 3GA7A 2XMZA 1BE0A 1DWOA 3D7RA 3QZUA 4N5HX 4U2EA 3RM3A 1DWPA 3VJLA 5C8ZA 4H7KA 3FVRA 5EIAA 2O2HA 2J4CA 4UHBA 1XFDA 4E15A 1ZJ5A 3F67A 3R3UA 4B82A 2YH2A 5IVIA 4P9NA 3SK0A 1QIJA 4KRXA 1R88A 1EK1A 4J3JA 2HA7A 1QO7A 1J07A 4ZREA 3R3YA 1AC5A 5JALA 4G4JA 3FLEA 1T2NA 5ALUA 1A8SA 4OB6A 3G7NA 1RWQA 1YASA 4KJXA 2Y2VA 1XZDA 5JIBA 2WFMA 3HLKA 1IZ7A 4YX9A 5C7YA 2QJWA 2W22A 1DX6A 4ZRDA 7YASA 5KWIA 3W9BA 1FJ2A 3R0VA 5JZSA 4W9RA 2PX6A 3STUA 1ZGBA 4Y2XA 4FHZA 4I4CA 1ZGCA 1UK9A 1CUAA 3O9VA 1E89A 4B9AA 1BCSA 1GXSA 2OAEA 4FTWA 1AZWA 1ISPA 1MAHA 4PO3X 3I28A 2WFLA 1YSCA 1AX9A 5AKYA 1XZMA 2VT6A 1DQZA 4W1PA 4J0IA 1B6GA 3U1TA 2CKMA 5JAHA 3G0DA 3SC2A 4PNZA 3H2JA 1B41A 3C45A 4ZV7A 2OQVA 4J0GA 4BYMA 2DCMA 5ALOA 1Y7IA 2I3DA 3WMRA 4U2BA 2DHCA 2I78A 3D2CA 2GBFA 1BCRA 1UOQA 1DQYA 1EINA 4KE6A 2PUJA 2PU5A 5AI4A 3A2MA 4UBMA 2HU8A 3H1AA 1HL7A 3NWOA 5K3BA 1MNQA 3STWA 5AM4A 3WWOA 3I2IA 3BJRA 5FOQA 3ESAA 5DYYA 3OTQA 1TCCA 4KE8A 2ORYA 4B80A 4NS4A 4QDOA 5IH7A 5CT4A 3W2TA 5AM3A 3BDVA 3HC7A 3D59A 5HK9A 1ACJA 3EQ9A 5EHXA 2WLSA 4ITVA 3E4DA 3C6ZA 4AX4A 4EY6A 2O2IA 1ZD4A 3WL8A 3I6YA 4IH4A 2WHRA 1CLEA 4X92A 1IUNA 3RKSA 2J3QA 4G8BA 4MEAA 1E8DA 1H23A 2PSJA 3BF8A 5AM5A 3DOIA 2K2QB 2B20A 4BCCA 1GQSA 3I6ZA 4PV7A 1GGVA 2JGMA 5HF6A 1XZBA 1TCBA 2G4LA 4IH9A 5AK3A 3FYUB 3KSRA 1P0QA 5CT9A 3BL8A 3DNMA 4TVKA 3VJKA 2H9YA 4DSZA 3T52A 2D0DA 3T4UA 3QBJA 2O2GA 3UUFA 4Y2YA 4FLFA 3VJMA 1QIMA 4AMZA 3WYNA 5AKKA 1VE7A 2HA5A 4FFVA 3DJYA 1CIJA 3G9XA 1LZLA 2BUCA 4CCYA 4K6GA 1GQRA 2EEPA 1XZIA 3ANSA 1FFDA 1XLUA 5T4FA 2O7RA 1L7AA 1YCDA 1KU6A 2EDCA 3AZOA 4MWSA 3AZPA 1TQHA 3VXKA 3WKDA 5AM1A 2WU3A 2XUIA 2H1IA 2PUHA 2QUBA 2I3ZA 1BN6A 1QTRA 5K3CA 5ALLA 2RHWA 1NU8A 3E3AA 4HXGA 3BJMA 5CW2A 4DNPA 2XMBA 2AJDA 5AI8A 2H7CA 5CMLA 2UZ0A 4XIIA 4IHAA 1EDDA 1PJAA 3HACA 5AK5A 5K3FB 4H0CA 2XUHA 3KWJA 4QE3A 4U2DA 1UOPA 2HRRA 4X7BA 5JATA 1GKLA 1I6WA 3ESBA 2GYVA 1G66A 1FSSA 2XUDA 2WUEA 2JF0A 4BVKA 4GEGA 1DINA 3STXA 4G4IA 3WIOA 4Y2UA 5T4HA 2XQKA 1UOOA 3V1LA 5ALIA 3LLCA 5HKAA 1AMNA 5F4ZA 3ILSA 1N5RA 3R41A 3AIMA 1QTIA 3RLIA 5ALRA 3VISA 2PSHA 1Y7HA 2VA9A 1C4XA 4BRZA 4DTCA 2QXUA 2GBGA 4AO7A 1MT3A 2WM2A 2RIPA 2WIKA 2QZPA 5BWBA 4OD0A 5A6VA 4PSCA 3IA2A 3C5VA 3W05A 1J1IA 2G5TA 3FYUC 1U8EA 4ROTA 1OILA 2VEOA 4GI1A 1LPAB 3PUIA 1MX1A 3WWDA 2XQGA 5HF8A 5D6OA 4BP8A 4G8DA 2HFKA 2QJRA 1CFJA 2CEKA 2Y1KA 5T4EA 1CUEA 2QT9A 3PFCA 1UKBA 5K3EA 5LZ2A 4WCVA 2W6CX 3DD5A 3WWCA 5CBKA 3FVTA 4UUQA 3H2IA 3X3HA 2WHQA 2G5PA 5BV7A 3TGLA 3R3XA 2Y2UA 1RP1A 5HQ3A 1G42A 4K6HA 3WJ2A 1O6GA 1CUDA 5A7HA 4B85A 3EBLA 4KEAA 2HL6A 3PUHA 3PF9A 3MUNA 4C6HA 3WWEA 2XMCA 2QXTA 2HIHA 3E0XA 1ZI6A 2CMFA 2PBLA 1XQWA 3PI6A 4EB0A 1CUWA 3AZQA 1IUPA 4XX1A 3PICA 4WFKA 4OYLA 5IVKA 4OSEA 2J3DA 1JT2A 3STYA 1U4NA 4G1FA 2XUAA 3HXKA 2AXEA 4X93A 1ODTC 1ACLA 2XQJA 2DFPA 4M0EA 4HXEB 2AJ8A 3HRHA 4L0CA 2WHPB 1QIDA 1YA4A 1F0NA 5YASA 4X6UA 3WLAA 2CJPA 2FUKA 2VSQA 2ES4A 4AXBA 4BVLA 3VVMA 2WIDA 2OQIA 4Q82A 1ZIYA 4KE9A 4OB8A 3QPAA 4FLEA 4UBLA 3W9UA 2E3JA 4CCWA 1Q83A 4WY5A 4Y2VA 5I9IA 1CUGA 2C5GA 1XKTA 1VZ3A 3C6YA 2AJBA 3UMJA 4BTVA 4UBJA 4FBMA 2C0PA 5AK4A 2QS9A 4BP9A 5AI6A 2VQ6A 1F6WA 4JEIA 2VTVA 3R3VA 1LBSA 4DMKA 5CH3A 3G0IA 2Z8ZA 2JGJA 1QOZA 5ALJA 1K63A 3M83A 4CG3A 2DHEA 4RGYA 1XZEA 4ZGBA 4ETWA 2O7VA 1YAHA 1LPNA 5FXMA 1UWCA 3VDXA 3R40A 5LP1A 3KWFA 1IUOA 4N8DA 4N8SA 1Q0ZA 1L7RA 1Z68A 1TCAA 2V9ZA 3AUKA 4E11A 3G9UA 2XMDA 4CCYB 1R50A 3C87A 3ICWA 4BZZA 3IIIA 3H2GA 4MXDA 3WA6A 2IX9A 5K5EA 3ED1A 5ESRA 4BATA 3B5EA 2RI6A 2VJBA 2QMQA 5ALFA 2XE4A 2PL5A 4B84A 3STVA 1THTA 1G5FA 5CH8A 2EDAA 5CT6A 2JGKA 5ALYA 2CBGA 2BAGA 2R11A 1XRRA 2WTNA 3TJMA 2QRUA 3K9BA 3C5WP 1SC9A 4H7FA 3MVEA 1BU8A 4KAJA 4AQDA 1GPKA 4H7JA 3BF7A 2GYWA 1MAAA 4X90A 1JU4A 1LPMA 1R4ZA 2ZJ6A 3IB3A 4RPCA 1P0IA 4WDRA 1GPLA 4S0XA 5CT5A 5KBYA 4HZGA 1R9NA 2HRQA 2WUGA 3CN7A 4OCZA 4FDMA 4FKBA 3ESDA 3DDUA 5AJHA 3V48A 2QUAA 4G5XA 4M0MA 2Q0XA 1VKHA 4GLBA 2XLBA 5K3DA 3LIIA 3OM8A 3V1NA 5HCUA 2JEZA 3W04A 3HI4A 4K6KA 3LIPA 1TRHA 3DL4A 4MQMA 3I1YA 4FFWA 3O4GA 1AGYA 1BROA 1QZ3A 4I3FA 2XMQA 3I2FA 2WUFA 1HBJA 3ZLUA 3FCXA 1JU3A 3G8YA 1A8UA 1YS2X 1CUFA 4P92A 2HA6A 1MU0A 5ALEA 1EH5A 1LPPA 3FLBA 5AI0A 5AOAA 5AI5A 2PPLA 2QTBA 5FRDA 5HZGA 4K2AA 3DKKA 1WCYA 5DYTA 3DQZA 3W06A 4CG1A 1UKCA 1T4MA 5AM0A 4X85A 5LZ5A 2J4FA 2WILA 3ZV7A 5SYMA 4C87A 4G9GA 3WKCA 2VF2A 2V97A 1YAJA 5AKXA 4H35A 1SCQA 4PF1A 3WK8A 3H0CA 4C89A 3OPMA 2DR0A 1EI9A 2JGFA 4YPVA 4B6GA 5HF9A 3G0GA 4FMPA 5AKEA 5JD4A 4HS9A 4B7ZA 3WI7A 3K6KA 1DU4A 5JZ9A 3V9AA 1LBTA 4X6XA 1J2EA 5CXUA 4RE5A 3FYTA 2WUDA 4PQEA 5ALXA 4RE6A 1FFBA 3H2KA
chains in the Genus database with same CATH superfamily
4C9BA 4QU0A 3HWSA 4DNQA 1T3HA 3HS3A 4J1NA 1VL1A 1KH3A 1CU1A 1SUAA 4A0FA 4GSLA 5ULLA 1KEZA 2ATEA 1DCMA 4ZDJA 3CYFA 3IAAA 3MGGA 2YYSA 3QY0A 1VMDA 2PSEA 2DUMA 2ZRQA 4JNCA 4BQEA 3WK7A 1WXFA 3BMNA 1MJGA 4DLNA 1LC0A 4CIXA 3D1LA 1MRZA 2WWFA 3WE7A 3ETEA 4PPYA 4DPLA 4GG1A 3FNBA 1R10A 1ND6A 4I8XA 1ZICA 1E1KA 2HMAA 3TR0A 4BU0A 4F2PA 4MP8A 4M1YA 1ENZA 4WZ6A 4BBZA 3J7TA 5SYAA 3U0VA 4I46A 4LGCA 1XMVA 2JIRA 3NNDA 4MPTA 4AN0A 1NOIA 3HDHA 3HDQA 4UPVA 2IHBA 4KLCA 2O8BB 5DTIA 2PWBA 2RGEA 4FEGA 3LECA 4P5PA 3BFXA 5DKFA 2NYRA 3NIBA 3A1UA 4XD2A 3BZWA 4A1FA 2DEUA 2WG0A 2R7NA 2YC2C 1N5MA 3GJXC 3HP7A 1AO3A 2B92A 4EQ6A 1EX9A 1W0KA 4KPGA 3U3KA 4R0MA 5C8VA 3OX4A 1JAZA 1NRIA 5I7VA 1Q17A 1GGJA 2FPLA 3C7KA 5DBHX 3UJ6A 4C01A 1ZWLA 2G70A 5EG5A 3IQGX 3PKZA 4ES6A 5IPFA 3GDOA 1DEXA 1TRKA 3QYAA 4WBNA 1Y8CA 4BIMA 5SY4A 1BMDA 2ZIAA 4TLDA 5THKA 2RGDA 1MZVA 4ZI7B 3HUTA 2CZQA 3RVLA 3ZE9A 4DLPA 1W85A 5GVSA 1GEEA 4LV8B 4PYLA 1XVAA 2NN3C 1THGA 1W35A 4KAAA 2JJ1A 1O96B 3HLYA 1U31A 3GZTB 4R4JA 4IXMA 4UHBA 5FI3A 1E2MA 3BZUA 1LB1B 4OU5A 1NT2A 1WJGA 4JGBA 3ZG6A 1L2TA 2ZVDA 3W5CA 4RC9A 4X64B 1KAMA 4OB7A 5FPHA 2RGYA 5BWNA 5JZOA 1EEXB 4RQUA 2LVBA 3IP6A 1V9LA 1YRHA 5K3FA 3G5MA 5ITZB 1MX9A 1TJ3A 3GGOA 5EIBD 3UAXA 4ER5A 3OHPA 2YRFA 3LWBA 3R8FA 1PL0A 2ODAA 5IHPA 5FUYA 4L6IA 1QOQB 1EHYA 1GUBA 5DT9A 3DTNA 4GDMA 3F4LA 2LKCA 4MVJI 2C42A 1YHNA 5LQUA 4ZAGA 3DMTA 1U2ZA 2PSSA 2F3QA 4A73A 1GCGA 4UTVA 1K8ZB 1U8YA 1VIMA 4O59O 4NEGA 4HQNA 2NZJA 1IN4A 2VAMA 2VDOB 3B12A 2YZGA 5EZQA 1JIXA 5A3SA 1SXQA 4B6QA 1BN7A 4RH3A 5LQAA 3EHDA 3P9CA 1YUMA 2W6PA 3CWZA 5K4AA 2R00A 2Z2JA 3LBYA 5FUMA 1D2CA 3CCBA 4ASUA 2H4FA 3GJ8A 3V2HA 4FOOA 1Q1BA 1OGYA 2Z4TA 3BJZA 2VT3A 3L49A 4WDQA 3ML1A 3L7DA 5BMOA 4F1JA 2JLVA 3I5XA 1BOFA 4QJ5A 1LJUA 2PXHA 3T38A 3QBTA 3HXPA 3OQBA 3E8MA 1TEZA 4BEBA 2ZUUA 3QEMB 2CKDA 3NLLA 1U8TA 2IKQA 3BB3A 2FSIA 1MO5A 3DYIA 3PRJA 4H2DA 4MS3B 1K5PA 3VR1A 4H17A 1JR3A 5K0TA 2FG5A 2VJQA 3CFYA 3C70A 4Z8XA 4LRWA 1KS9A 1DUIA 4FYPA 4B3BA 5A4KA 4JOQA 2QRHA 4PFQA 1WUIS 4HRAA 4RK7A 1ZGAA 4F2WA 4DUYB 1QYRA 2YX1A 2C58A 1BE8A 1ZK2A 1G7TA 4OHOA 3L0CA 3RRFA 3QELB 4BVEA 1C30B 4O1HA 4QUJA 1EFKA 3VZQA 2OFPA 3T54A 2F4VB 1N0WA 2NZYA 2PKCA 4O4LA 2PJRA 1XEXB 4MGHA 4DNXA 1BMFA 3RJMA 4KH1A 3ETGA 4TLCA 1P1RA 1N1DA 3W2FA 3HSSA 3HWX1 4DZRA 3C7AA 2WWGA 4ND5A 4XTCS 2PLRA 4C5AA 2CNLA 2O3RA 4ZANA 5FEUA 4BU1A 1BDIA 1I80A 2Z3WA 2M98A 2Y0BA 3Q2IA 3ID6C 4K5QA 5JNSA 4ND4A 1RE0A 1A7JA 1SUBA 1CEYA 2B6NA 4PO8A 3U4DA 3TNLA 4D57A 5KVAA 3WKAA 4CF4A 4CEHB 1O6BA 3PX3A 3TVYA 1P4HA 1RIIA 5EUMA 3AVUA 3BD7A 1W75A 2FQWA 2XNJA 3OX3A 4RPGA 4WD3A 3DE3X 4HH1A 1ZK0A 3IAUA 3TQQA 2W8BB 4JJFA 3TD2A 2B4QA 1Q0SA 4EG8A 4MW2A 3FRIA 4FNGA 3ZU6A 1KIMA 1HE3A 4PG6A 2JLUA 3H04A 3N1UA 4YJ3B 2X41A 1BEUB 3RAPR 1PUJA 1KJ8A 1IL0A 3B9PA 1NBWB 3T3HA 3LUKA 5T3YA 3FDXA 4ZI5A 2ZRCA 2FEMA 1G16A 1CR2A 2QRMA 4QIHA 4Z3KA 5TVKA 2J3HA 2BFFA 4PSAA 4BE9A 1EK0A 1L1QA 2WWIA 3TOCA 3RV4A 4X8OA 3ZVNA 1QCDA 2V7BA 1E2PA 4F6CA 1XZHA 3S2YA 5EMHA 3PC6A 4YLGA 3SC4A 1VG9B 2C97A 5AXAA 4GU5A 2NXJA 1D2EA 4TL8A 3UXMA 4BVHA 4U2FA 2I4IA 1ADBA 1XK7A 1H8HA 1LI7A 2P9YA 2QRZA 2YZ7A 4MA5A 5FPYA 2A0YA 3RDPA 1E58A 4D5EA 1CJCA 4LF7B 1W1UA 1L8LA 3VBEA 1YUBA 1EP9A 4UNNA 5CPFA 5BRNA 2DB3A 4CGZA 3F7MA 1G3QA 3HU1A 4YNBA 4FWBA 4JUDX 4WW0A 1I7LA 2ODWA 4UQLA 5LFAA 2VRNA 2C5SA 1A88A 3AF2A 4UBOA 2WJ3A 4DR3B 5U4XA 2OCYC 1OHHA 1NQ5A 2ZI4A 3HUDA 1R0WA 1J7JA 2XUGA 3AHGA 4QOIA 2TRSB 5ALHA 4ZV9A 1E3QA 4OGLA 1EBUA 5IWCA 2J0SA 2NO0A 1U7TA 1SM4A 2YOHA 1B26A 1XG5A 5FOWA 3EG9A 2O57A 3BH6A 2QGNA 3P96A 5P21A 5IZ4A 3RODA 5IX8A 2W93A 2B83A 3LP6A 3OZEA 1I7NA 1FRFS 4R31A 3D81A 3U09A 2GVNA 3RARA 4AICA 1EE1A 3VPSA 4JYZA 4QT0A 1MJNA 4HTFA 4IO0A 2PRJA 4LE0A 4BY9E 1G6HA 4IP0A 4N3CA 1J1ZA 2C4VA 3V4ZA 1KXJA 1MD9A 3RH0A 2IIQA 3B52X 4YJ3F 4QJBA 2JBAB 4BC0A 1Z5VA 5JSQA 4B3TB 3IE2A 4F9FA 1JDBB 3NBQA 2PUFA 4NHOA 2HTEA 2D06A 1XDZA 1HDCA 1JHQA 1MO2A 4FM9A 1X7GA 4HD8A 4HDMB 4N3BA 4RK4A 5DBOA 4D3SA 1TIBA 4QDXA 4HQFA 1VDZA 4BN0A 3HM2A 4I1IA 1NJ6A 3SX2A 1TCVA 2BH2A 3KKNA 3LF2A 3O3NB 1A72A 2IUFA 2FZVA 3A05A 3PKJA 1FYFA 3LPAA 4BQRA 5IK2D 4UFOA 3T7AA 4ZCTA 1V6AA 2BMJA 2WW8A 3PPWA 4XVRA 2O2SA 3LPNA 2P65A 4PAGA 4ZT2A 4CUKA 1TAGA 1A9RA 1GDTA 2UUAB 4CMCA 4IXDA 1T5IA 1CR0A 1WS6A 2HYDA 1FNMA 1HL3A 3JAKB 1ZMXA 1VGRA 3DFFA 2F2TA 1LRLA 5A9SB 1U0HC 3R7AA 4EUFA 5CFQA 3TGPA 2A94A 2HA2A 1UJMA 1MX3A 1G2OA 1D6SA 4XR9A 2QD2A 4TZTA 3C3PA 5KNDD 1PT6A 4QBIA 2ACVA 1V4NA 1E0DA 2FPRA 2Q5HA 3ECAA 2ZJZA 1VHQA 2PMEA 1R4NA 1HSZA 2V6BA 2X5NA 4YP1A 1UZMA 5JVDA 1JKXA 1EFHA 3CLTD 2QRVA 3JZAA 1BWRA 4RV9A 4EHIA 4DJDC 1JKMA 4KXUA 4D3ZA 4AUMA 1Y9AA 2AOXA 2VAVA 1T3TA 3ROZA 1T9BA 2DVMA 1F7UA 1CUJA 4JJ7A 2G1AA 4FINA 1OBOA 1R64A 4FUQA 4TTVA 1QLHA 3DEIA 4N0DA 4X94A 2PL9A 4QVGA 3UBTA 3N8GA 3R77A 4IIUA 5ALPA 1AB6A 2P9ZA 3DR5A 3KSDO 3A1NA 1IYZA 2QNRA 4XB1A 2QNIA 3ZY5A 3PC2A 5B1EA 4EKNB 4BFUA 1ZOIA 2RG7A 1O1YA 2ZJ0A 1KPGA 3RFXA 1MVLA 4C3OB 5C5CA 4QGSA 2HT1A 3DBRB 4Z9BA 1D2GA 3SP1A 1O08A 3WSTA 2VF7A 4BZWA 4W99A 4MI3A 3ZQUA 3KZXA 2WIJA 4H0FA 2IYLD 1W85B 3BRCA 4RXUA 3ZN2A 5TQ0B 1KVTA 4UTPA 4URVR 5KAMA 2BZ0A 2JCGA 4C7KA 1BG6A 4OI0A 1IEXA 1HY3A 3GGJA 1N6PA 5ILGA 4XVCA 3IOYA 1O5TA 2G4VA 2O6LA 4QECA 3SXJA 4WFIA 5IAEA 2ZREA 4HAXA 2BEUA 1I2ZA 2DUNA 2X23A 1IY0A 3MQFA 2FSVA 4ZOLA 3ZPXA 4DDKA 3CIOA 4F0JA 2ISCA 1TZ2A 3H05A 1QIEA 2R4UA 1A2BA 2OYSA 3M6IA 2H2WA 2QTTA 1FNSA 3H65A 1NN5A 1WQ3A 4G56A 1XTTA 2YVQA 4YRIA 4WCFB 4EX7A 1E0AA 5IC4A 2ZCUA 1PUXA 3E8SA 1U5CA 2YFQA 4FMBB 3SAJA 4EECA 1RZRA 2VNJA 4MCHA 1I4OA 2B69A 1BQ3A 2PAFA 2XB9A 4ICIA 3H1EA 4JJEA 4QWWA 3QVGB 3RROA 2C2OA 4Y7CA 3ZWNA 3HB9A 3S8EA 4R98A 1Z2DA 4QGBA 2PGNA 5GM1A 3FBGA 4MUMA 4Z1OA 5K8VA 1MCZA 1U3GA 3DEKA 3BM5A 3N6RA 3WB1A 5I5EA 1W44A 2Z09A 4CLXA 1SXPA 4K7JA 2C9BA 2KHZA 5HDBB 1LD3A 3UQZA 5L3QB 2ZQZA 3TOZA 4C5CA 1R5JA 2P0EA 1F7VA 2FWNA 3T0FA 1GZ4A 5EYPB 3UUEA 2V55B 5KOJB 1NR7A 2ZUDA 4DV0B 4JGIA 4CLDA 2D6FA 2GRJA 5JD6A 2YL2A 2BGMA 2LUOA 4D0LB 4IMPA 2CHQA 1KEPA 1HDIA 2P30A 3BJEA 4P6VF 4Y7DA 3KPVA 4FOPA 4ARIA 4HATA 4XGQA 3DVSX 1Z0UA 3JWHA 4AG3A 2OCXA 1A9TA 3RC3A 4MVJF 4UE3S 2OFFA 1F2DA 2C7RA 3PZRA 1REQA 1L4MA 2R86A 3PD1A 1JZQA 3LC2O 4L3OA 4LW8A 5AHOA 5AOBA 5D3ZA 1O94C 1JLLA 2FR1A 2GZ1A 2QG9A 3AUSA 1V43A 3MOSA 1YQEA 3OX2A 2V7WA 1HMPA 2PTGA 2MIIA 1FJHA 1FU8A 2PXAA 2QMHA 4L85A 4Y6PA 4BO9A 3NM5A 1VMAA 2XEDA 1F6BA 2YVUA 1FTQA 4FX2A 4U63A 3VR2A 5EJ9A 5DLPA 2VP6A 5FBQB 2IUUA 2ZSAA 4OK6A 2HPAA 5C80A 1Y5NA 3B9BA 2N75A 2YIMA 3BK2A 4LJRA 4PLZA 3E9YA 4AC9A 1W0CA 1ZM9A 2IDKA 3A2NA 2CCJA 1R00A 4B4UA 1HETA 1I2CA 4UCXA 3CVVA 3FWHA 1Z7BA 3ILYA 1YL7A 4FC6A 3UB4A 4N48A 2IH2A 3SZLA 3MS2A 2MSEB 4GF5A 4LBYA 2ZIGA 1YB1A 3AVXA 1Q50A 5JVDF 4R51A 2I4TA 4NC9A 5DX0A 5EFOA 2W42A 2V58A 1H2ZA 1Y34E 4R2KA 4P34A 4H1UA 2W6MA 4P38A 3HXQA 3U4QB 4F2DA 3NCHA 1NY5A 3MUEA 5LDDC 5AKGA 1PQYA 4GLJA 4GM0A 2HPHA 1L4KA 3BXOA 3PNOA 2EX1A 4QUIA 1EGQA 5ALWA 3FPFA 3I64A 1CPYA 3D6HA 3Q2OA 5K1ZA 1FDVA 3W9YA 1GTRA 1WB5A 2YCLA 2I71A 3R7WB 1MRNA 2AMFA 5KYYB 1JPVA 3H99A 4YJFA 1WOMA 3PQDA 1GT91 4GYJA 4PHFA 4F72A 3BXEA 3QEMA 1IQUA 2OPHA 1WCWA 4EW6A 4CVNA 3T5GA 1HE1C 5J40A 1U3WA 2NADA 1YR9A 1UODA 2VT7A 1M33A 2J9ZB 4IF4A 4WAUA 3TSYA 2I4LA 2GD0A 1G1MA 4HBGA 4OHKA 3E81A 5EHNA 3PFFA 2QPOA 1I9GA 4A5OA 3NPAA 3WLHA 4WXMA 1BMTA 3DPIA 2P7HA 3AKDA 1PQ4A 2QQ5A 2O4UX 3JALB 1EGAA 2ZWIA 2X1VA 1MDBA 2QM8A 3UYKA 1XXLA 1SCDA 2UXCB 1JSXA 2FZKA 1UFQA 5FCDA 2IPMA 1FBNA 5EA2A 5LUAA 2DWOA 2G5CA 4MJ3A 3GLIE 1Z5UA 3F5FA 4E5UA 3OPYA 4FWTA 2UXBB 2D3WA 2OESA 5JRJA 1JLKA 3AY0A 1TTPB 5D51S 3HTXA 3PGXA 3DZIA 2XZTA 1DKMA 4MCIA 4FKZA 4CKEA 5CFPA 1TOAA 4EK9A 4KLNA 4MWOA 2DSNA 3NJ4A 4OBXA 4GI3A 4OBWA 1VJ5A 4KOAA 3ISJA 4P4SA 5AKIA 1GQOA 4XJVA 1YFKA 4RZSA 3UW1A 4QULA 1KQGA 4V0RA 2UV8A 4UM7A 4C1NA 4Y6RA 1PJQA 1LLCA 3HP4A 3FOWA 5I9TA 3VR5A 5IKEA 4RLFA 1O3YA 3GRPA 1EP1B 1H1LB 3I6MA 3OA0A 2IWRA 2PMFA 4JMPA 2H1WA 4Q00A 1BWSA 2WFLB 4BQIA 3BSYA 1UXHA 4UUNA 4DA6A 4LF8B 5DXAA 2Q5CA 4XUEA 3T5TA 5CA0B 3WTBA 4AKGA 5EVCA 1O97C 2XRFA 1DAMA 3TTVA 3LDHA 3D0OA 3QJ5A 4D9KA 1D0VA 1DUVG 1FMLA 2HBZA 2DWCA 3VZSA 2QDXA 2GFQA 5TT1A 3ZWAA 4QOHA 3UQYS 3OMLA 1TT5A 3A1FA 3HCOA 4DYHA 2NYUA 1W8DA 2A5LA 4X66B 2I99A 3OQNA 3OJEA 2C4MA 3NHBA 3A11A 4PR3A 1PR3A 2NO5A 4S35A 3T7DA 8AT1A 5HQTA 1GLGA 3QLVA 3D2BA 3PE4A 3ZDYB 4N9WA 5IXSA 1X8XA 5IXYA 4RTPA 2AN3A 1EEHA 3DMDA 3ZOZA 2W58A 4OHRA 5E95A 4JVLA 2EBUA 1QS0A 3ZE6A 2J3EA 3VQTA 3GUYA 1HGXA 3HUUA 4W4TA 3ZGNA 5LMCA 1U0FA 1YC5A 2QLJA 3K20A 3TN7A 4Q16A 3L7AA 5HBGA 3GFPA 4BNGA 2GPNA 2X8BA 3V7YA 2WB2A 1H05A 2QRKA 4LMRA 1CUBA 3C6QA 1U2EA 2R5FA 2ZS7A 3QFTA 3UUGA 1LDEA 1PGQA 5ECDA 1KSFX 2XIJA 5CLFA 3IQXA 2OTCA 4I5FA 4Q4AA 3WO0A 2PS0A 2D5CA 2EERA 3K9CA 3OH8A 5K8JB 1E9EA 2GVDC 4BMZA 2Z8YA 2NPFA 3HJAA 3U19A 5CITA 2QN7A 3UMRA 3AO0B 5J2TF 4BTLA 3ZTTA 5AQEA 1FFEA 2MOKA 1Z3CA 1ZVMA 2OWEA 3G79A 3RVOA 1LK0A 2REOA 3DV2A 3VV2A 4E88A 4EMUA 4G5QA 4G1UC 3TRHA 1ELOA 3EARA 1SU6A 3DDCA 4PN7A 6GPBA 3MSCA 2ZAIA 2HSDA 1BHSA 3KJIA 3N0VA 4PM4A 3WMEA 4ZZ2A 1Z4KA 4CF5A 1UT8A 1F2TA 3IC5A 2HRDA 1WPRA 3GPBA 1DC4A 1DTEA 3M1AA 4MYCA 3JQFC 3SHTA 3NYWA 4BQNA 1IH8A 3G6KA 2HNAA 3NGLA 5IZCA 1QP7A 4EG1A 4AF6A 3EZ7A 1LDNA 3ORHA 2BKAA 2ONCA 1KIAA 3PENA 3VKFA 1MR3F 3H0EA 1RQPA 2VXCA 3RPEA 2QTMA 4J9VA 1K6IA 1K06A 1XQ1A 3IVRA 3GW8A 1OASA 3NBMA 4X7MA 2VF8A 3F1LA 3WB0A 4ZJPA 1XMQB 5FHQA 4Z7QB 3Q8KA 2WD9A 4D3YA 3ICOA 2VAWA 1SN7A 2XKAA 3BMNB 3BBLA 2WC1A 3J81k 4W5QA 3M6WA 3UKJA 5AVYA 4DV5B 3E8XA 4TUYB 2PX0A 2BCJQ 4J6FA 1VE6A 3NC1C 3ZR4B 1ZJWA 1XZPA 3ZCUA 2QX8A 1VHDA 4CIWA 4G0UA 1RT9A 2IPXA 2GESA 1XU7A 1ZIPA 4KHZA 1U1GA 4KACA 3WLPA 3D0KA 1QO0A 2ZJ3A 4NJEB 5F2KA 3V8BA 1VB3A 3B82A 5AKLA 3VI4B 4S1TA 3X2EA 2BGTA 5I9SA 3ZHZA 3A4IA 3WADA 1J8DA 1U6JA 3N58A 2IHJA 3JATB 3C16C 5JCOA 4AD8A 3HDJA 4MI1A 5AD1A 1K4MA 2BFDA 2C4UA 2O1SA 3CVJA 3TBFA 4B81A 2PT9A 3MHPA 5K8TA 4EZBA 2HN9A 4PLGA 3GJ5A 4EY7A 1QYIA 1CK4A 1TVKA 3LVBA 1XNHA 2BMFA 4H7DA 5CX1A 4ZODA 5HKKD 3BYZA 3MCAA 4NICA 4OPMA 5E4TA 5J3JA 4TZ0A 1Z37A 3CKLA 4MMZB 4A6EA 5P8WA 1UC8A 4R2WA 2J8ZA 5SZKB 4DLBA 4E33A 2IY8A 2PL1A 3GRCA 1KYVA 4J03A 4WY8A 3HFSA 1KI9A 5DHTA 3NWJA 4ZWNA 2R97A 4DOMA 5LZ9A 1JEEA 3E84A 3D5QA 4OH1A 5E9AA 3CNBA 1R8XA 3MWDA 2FDCA 3TLAA 2AHOA 2PBRA 4HPJB 5EJIA 5TSDA 1YRQA 2YJNA 4IVQA 2AZDA 1PZGA 4RAQA 3OOJA 3U60B 4M1KA 1WF6A 4GGPA 2P1RA 4LY6A 1II8A 1DCKA 5DULA 3FSGD 3FMIA 5KINB 3H2ZA 3TL6A 5FLKA 1Z5NA 2EX0A 4BNJA 4CKWA 4LMAA 5ARBA 4AWAA 3L1KA 2HA0A 1JIIA 4ZQHA 2OVBA 3VC1A 3D5EA 1Z5ZA 3G8AA 1HQYE 4BVGA 1MIOA 2QTVA 4R2MA 1SC1A 4JBHA 4PXSA 1TJ5A 3UK7A 5AVZA 2DUWA 3Q5GA 2HADA 3OEWA 2QVBA 2YFKA 5GGXA 621PA 4YJDA 2J0QA 2OCGA 5J1TB 4BP1A 3GV0A 1YZUA 2I80A 2J3LA 1X6VA 1G38A 2Z6AA 1PGNA 3FOCA 4YJFB 1E3IA 1SCAA 3GELA 2CLIB 2J4DA 2GGSA 1KRHA 4IQFA 3CH7A 1AIPA 4P32A 2QRQA 5JARA 2CEAA 3I92A 3GARA 2EHDA 4MKGA 4DNFA 3MYYA 3FH0A 5IKXA 2NZUG 2PQ2A 2WJIA 4Q4LA 1K6EA 1KK1A 4AO6A 3P4YA 5DK4A 2WQ6A 2AOUB 2W4MA 1RHKA 3BWEA 3NHZA 1RJ9A 2VJCA 2PH7A 2A1UB 3IAXA 3UHJA 3HLTA 4E31A 1II9A 1HO3A 4MULA 1CNFA 1Y1QA 3ROEA 2VJYA 4OMCA 4MKXA 1JFLA 5EJGA 3IHKA 3KQQA 4GE3A 4OY3A 4AN1A 4C4ZA 4EA8A 4WZBE 4IY1A 4LV5B 1SHJA 4J1TC 2ECKA 1E9BA 1KSHA 4L8VA 5GZ3A 5EKTA 1KO8A 3A7EA 4Q0MA 4M9RA 2HLHA 4P81A 1CDOA 4OM7A 3JAWA 3OZFA 1L5RA 4DMMA 4RO0A 4H59A 1PJZA 1DELA 2B8TA 4OXQA 3AP2A 4RKQA 4OX9Y 4D9CA 4B3IA 1IG0A 1ST3A 1RCFA 4BE7B 3U7FB 8ATCA 5L95A 5LM3A 4WOBA 4AJKA 3T9FA 1XDGA 1DEOA 1HYHA 1QH8A 1WW2A 2OLKA 3C98A 2H2HA 3WHPA 5A9TA 1T8PA 2XAAA 4BZPA 3TL3A 1ZXXA 4G89A 4D43A 1RWOA 1I13A 1B4DA 1OUMA 2F3SA 3PKIA 4MOWA 1PL6A 5KDOA 1PFWA 1PKXA 4JA0A 2I9KA 1P1KA 4MWCA 5HM6A 1JYFA 1T6BY 3W5BA 2JIZD 3A3PA 2CNOA 4PHGA 1ZS9A 1TTTA 2JJ1D 4QUHA 4HRXA 4AJNA 3SM9A 2ZR7A 4GZ5A 1C3EA 2OZEA 1EG2A 2CXUA 1BTOA 2VIIA 3CVXA 1T13A 4FHGA 4LK2A 4QGFA 2GETA 3PRYA 3L40A 4V0NA 2CNBA 2J07A 4ONEA 1IN6A 2V7QD 1AUOA 4RQBA 1J06A 5REQA 1XQVA 3L8ZA 1UJBA 4CL3A 4DT1B 1BE6A 5F2NA 3GLGB 1XTIA 4ZPJA 5G0WA 2D3TA 4LMPA 4JCCA 2WAXA 2XGGA 1X42A 2WHYA 3O2QB 3F6BX 2X2OA 3S8YA 5IJ9A 4AZTA 1JDVA 3OY2A 2TMDA 2IL1A 3F8WA 2P2NA 5FPQA 3K9QO 3VNQA 1A04A 4ZQEA 4ZHQA 1YR2A 4B0PA 2ZRLA 5DGCA 5IVHA 3AFGA 3WL3A 2XB2A 3EEBA 1QGUB 1EK2A 5BURA 3KTAB 4GH5A 4JOCA 2OD9A 5D3KA 2AWOA 5JAPA 2WJ4A 3S1AA 2R4QA 4CV1A 4WBSA 3TLYA 5EHZA 3KO8A 3OLQA 2IITA 2W37A 2IE8A 1H4VB 3L7IA 1F3OA 1EPUA 1NQXA 1Y3IA 1J33A 3RSZA 4HEA1 4ATNA 4LHEA 2ZJ4A 4HY3A 4KO8A 1KNQA 3CLVA 2PWPA 4X65B 1NBIA 2QW8A 4LXYA 1J25A 1ZIDA 4DDUA 3DOHA 1HE2A 2JIPA 5EHQA 5F5LA 1XRNA 4A8PA 4QODA 4A0GA 3DDSA 4JBGA 4J16A 1DLJA 1LBEA 2R8XA 3CWQA 3CRVA 2HWUA 4AZ0B 1W88A 2EG5A 1T9GS 4B3HA 1RXYA 4KYVA 4DSTA 5JO0A 5B3KA 3T3EA 3PDWA 4R69A 4F45A 4CKZA 1I6MA 4P2BA 3QMPA 4EM6A 1RCTE 2IYTA 1WLYA 3EVBA 3ON5A 3PFWO 3E5RA 1N2CA 3UW3A 4CIBA 2W2LA 2P11A 3EFOA 1LGYA 2CF5A 4QEZA 3DKPA 3G5LA 4JU9A 1NYQA 1B42A 1NNUA 2WG1A 3COWA 3R0QA 4L15A 1OLSB 5JI3E 4DS3A 4KITB 2ZS8A 2AG5A 2I66A 4EB8A 4QEKA 3I37X 4ITRC 1BMFD 1HQKA 1LBIA 4X44A 2KM1A 3L4KA 3RHZA 2ZI9A 1UPUA 3B70A 3JQAA 5FWXA 4BUCA 4CMGA 2NYVA 4PLFA 1RQLA 1D6MA 2B36A 2EP8A 2YN0A 4G4GA 4OUDA 3UKOA 4Z49A 4G07A 3BA6A 4ETMA 4P93A 4BV8A 1VGVA 3MFQA 3A1DA 1C3OA 1Z7YA 2WJVA 4Z51A 1Y3HA 3KG2A 3ZCTA 1X38A 3U4HA 1JR2A 1QRUA 3CQ9A 3CRRA 2RI0A 5GZ1A 1Y1RA 4CMEC 2I6TA 2A4KA 3EIXA 2WEKA 3ROPA 4MKRA 5DN6D 4IYJA 3HJCA 1CBUA 1K6XA 3LXUX 4O8CA 2CE2X 2DFDA 4F4DA 1UM8A 2R6R1 1U1CA 2O48X 1XZGA 3SYKA 3RT9A 3CS3A 1QF9A 3AG5A 1D5WA 2OHJA 4H7EA 1GGMA 1RXCA 3QUBA 4NMLA 1V4BA 3AM4A 3OP4A 4HNGA 4K05A 3UAGA 4BIIA 4EEKA 1S1CA 4TMWA 2BHNA 3M5PA 1CR6A 2NVBA 2UUCB 1RE1A 3RK1A 4BX9A 2WSLA 1JRLA 3I9OA 4EB6B 3GL9A 5CDSA 3OOSA 1QPBA 2FOXA 4QBGB 4A03A 5IABA 2D00A 4UZEA 5AXDA 3IKLA 1G5TA 1KORA 3ZQ6A 3JD4A 1W34A 2B7CA 1X7WB 3DLHA 1AJEA 1I1HA 2Q45A 3HYRA 3ZZ0A 4JU8A 1YUNA 1MHPA 1QX4A 4ILKA 3QPCA 2Q46A 4TWJA 3NBZC 3LHDA 2A84A 3P45A 5DNWA 2KQUA 5KTOA 1VRWA 2BTQA 2H2DA 1YDHA 3SZMA 3PDHA 3ILHA 3R09A 4TLAA 1JEYB 4WACA 5AKJA 1OLUA 1H69A 3UJ8A 1L6IA 3EF3A 2WFZA 1JHUA 3E3LA 4JWTA 4UE6A 2JL1A 2B30A 4LMBA 1SKMA 2ZRIA 3CUYA 3E7DA 5JNWA 1O94D 1RMQA 3ACBA 1YH3A 3OU6A 2P9TA 4PWZA 5A1TA 5HK8A 3QKSB 3BXPA 5AVKA 5EIHA 2FAXA 5FR1A 2CK3A 1MXFA 2XUOA 4PFKA 2IZ5A 2OLEA 3I53A 5ALNA 1YJ8A 1BWPA 1M0TA 1P45A 2G08A 5G40A 2ZQ5A 3WIEA 2X5XA 3T3DA 1V1RB 1TPYA 1A9QA 4LHSA 2VDKB 3WGOA 5JJCA 5KOIA 2WQZA 2O8EB 1RP7A 2GHQA 3BE5A 4Y0AA 5U1PA 5E2IA 2JLWA 1XROA 4NZYA 1JIQA 4R81A 3RG2A 4YMGA 1JEQB 2QUJA 3Q3JB 1HTTA 1WKCA 2A86A 3C3MA 3GBSA 4RJIA 3JRWA 4KAFA 2G0TA 3GEHA 1SB8A 2GD6A 3NWPA 1S1MA 2ZYTX 3TX2A 3VH2A 5JRZA 3FFTA 4KWTA 1Z4IA 2JK1A 1FFSA 1HEYA 1T2FA 5CM9C 2C1EA 1OVGA 4RK1A 3RIMA 3VSCA 3UT6A 1S4MA 1MJ5A 2OECA 4INPA 4D97A 4Q24A 4DEVA 2VTKA 4CL2A 2PUAA 2B9EA 3WWPA 1P1FA 2JRCA 2VHTA 4YT5A 5SY6A 3T1YB 1EYZA 2FTKE 2CL6X 1GIAA 1CUYA 4PYKA 3WK5A 1PVOA 2GF9A 4I55B 5TJ9A 3EOAI 4AUNA 3RYTC 1FNBA 4FXPA 2O2JA 4Y1RA 2AN4A 1HLFA 2YV1A 3VZPA 4Q4AB 2AF3C 2HU5A 2O7SA 3CURA 4NZZA 2ZBUA 4U2CA 4D8VA 4X3PA 4GOJA 3VGJA 5KQMA 3PQEA 1IE3A 3ELUA 3LA8A 5IF9A 3GFOA 4DA4A 2DLNA 2HCBA 2X9GA 4ANFA 3Q9UA 4RXMA 5AVOA 4ZD6A 2HV9A 3UAYA 3ZGVA 4EY5A 2P3OA 5DTQA 4YCBA 2ETXA 4W1QA 1U28C 3DMPA 3DOFA 4JB3A 4J2TA 3PTLA 3OICA 1DZIA 3L8FA 3R74A 4O2BF 1EJ0A 3RYIA 4DV7B 4DL9A 3VSEA 5F64A 5EIWA 2HRBA 1P6UA 2QYOA 4IEFB 4Q9HA 3M7IA 2NW6A 1BVHA 1SUCA 4JNKA 2JS7A 4OGWA 2BHLA 3CPJB 2KBFA 1JVSA 3PRKE 3PEFA 2ATVA 4GXRA 4TPKA 3X44A 4FYHA 1VJGA 1PV2A 2ZZKA 1LDMA 3H5LA 3HB0A 4MDYA 1SWWA 1ZM7A 4Q6WA 3STHA 5JAUA 1A77A 4MUKA 3J80A 3MM4A 1YVDA 1CJUC 4J0CA 4JI4B 3K32A 3D02A 1SG6A 3LPLA 1DWQA 1JW9B 1UZUA 3DPUA 3OKAA 5JANA 121PA 4N6NA 3UMSA 2XB8A 4O1IA 5F3DA 1ESMA 4MRMA 3UPTA 4YP0A 5A5FA 3JVVA 3LBIA 5CHYA 4G5RA 3QKRB 2FLWA 2XKJE 5HTKA 1Z0KA 1BEZA 3OOWA 4TMFA 5J2UA 2P4HX 4KRYA 2G0NA 4KE7A 3ZLBA 2Q4OA 2PJUA 4C0QC 2C77A 3EAQA 1R8YA 2Q4BA 4YRAA 3WYGA 1KIFA 2Y71A 4OUDB 1V0JA 1Z15A 2BJWA 1E4OA 2EW2A 2QVZX 5DLQC 1KMIY 3BWYA 4YP9A 3WFJA 1X1EA 1XKQA 3HJFA 1QOPB 2JK0A 1WDKA 2VNKA 4DNOA 5HKBA 5K4HA 1HLGA 2BSAA 2EKBA 3C1AA 4XSGA 4NU5A 4EBBA 1S9HA 4QPJC 2ZSBA 1V7CA 4J0HA 2EWWA 2OORC 2PMCA 4CV3A 4E08A 3HO1A 4ZKDA 4BV2A 4J0EA 2VSNA 4Q48A 3ZS9A 1KO5A 1TC1A 4DBLE 2XSZD 1K08A 3KWMA 4LCJA 3O47A 4L9WA 4AYXA 4F97A 1L5HA 1J6UA 2Z2ZA 1Q1EA 2CT8A 1ZGHA 1RRKA 3TWOA 2HPZA 4C4RA 1PJSA 1R6VA 2ZIXA 4DTIA 5CFOA 3G0CA 5JYBA 5J23A 1R9MA 1DKQA 4E6PA 5CM2Z 1CRWG 3HE3A 4U6QA 5F33A 3I04A 3UG6A 3MGKA 2OO3A 3CBGA 2JGDB 1SOMA 3A37A 1E9DA 1RPNA 3IEKA 2PKRA 2R62A 2A9PA 4FDLA 4HNAB 1YQTA 2VXYA 3D3NA 4OF4A 3KQNA 5DYWA 1K7XB 3IODA 2DY1A 4DDHA 2EBWA 3U4GA 5IAOA 4JI0B 2VAXA 1C50A 1EFTA 2OVFA 4LXUA 4D9HA 5CB0A 1XXHA 3MIZA 2HW8A 2X3YA 1CVRA 2ZJAA 4LZAA 3N6XA 2GZ2A 4ZVLA 1R0SA 2FN4A 3FDIA 2OSBA 2HKIA 5EHIA 1VE3A 3CEJA 1H9AA 4PN3A 4ENWA 1W46A 2WFAA 4HLUA 5M5BA 4G0OA 3TUJC 3UH0A 1WU8A 3JATA 3BTOA 3GFFA 5JO9A 3CUEF 3EQ6A 4KLAA 3F9RA 3KUCA 2W8ZA 3PGJA 1TF7A 1YWGO 3C43A 5H83A 2C1ZA 3LCJA 1ZI8A 4GZ6A 4E46A 1A9XA 3GYBA 2QLTA 3I9V1 3ZDDA 4CBVA 1JG3A 2X5JO 4IFEA 3TOSA 2EFHB 2X0NA 5B1IA 2HCJB 3EIWA 4RKWA 2WNHA 3GA7A 1PG0A 5CW1A 5DF1A 2XMZA 1N2SA 1DWOA 2VBCA 3ND7A 2P4EA 3K0EA 3QZUA 1QZTA 4N5HX 1UJ4A 3CNHA 2ODTX 4OFWA 3RM3A 1C81A 3UJAA 1TEHA 1TLTA 4QKQA 2B4TO 2FUG1 3VJLA 1AV7A 3GLFB 3AVTA 4UXIA 1QVZA 4H16A 1TEXA 3FVRA 1JAYA 3IGFA 3GD5A 1PX0A 4L8YA 5EINA 4IS2A 5EIAA 4U7PB 1LTKA 4JP5A 1T0HB 1XVVA 1XYGA 4MQ6A 1CEQA 1DAIA 3DLAA 4MVJG 2WKQA 2NSJA 5IVIA 1VI2A 2BFEB 1JHZA 2G6BA 2ADMA 1PHPA 2A7QA 3CUUA 3SR4A 1HOXA 2XODA 2GYYA 2Z57A 3M9LA 2PGIA 1QIJA 3T3MB 4J3JA 3DE2X 4PS1A 5E6RA 2HA7A 1T35A 2OFWA 1KRWA 1DAKA 2R84A 2FH5B 3R3YA 2YJ4A 1T4DA 1YR6A 1FY2A 1Q0LA 1XD8A 3IMCA 1AC5A 4ZGGA 5CXSA 5IT0A 3ZDAA 1T2NA 2X4DA 3HXLA 3TZLA 3KSZO 3TCNA 1VMKA 3JYPA 4JJGA 4B74A 4C78A 2ODEA 3I2YX 1UCFA 2C9OA 1N7IA 2IEGA 4OB6A 4CR6A 5JV5A 1YZNA 2GN9A 1WXHA 3HKEA 1U0LA 4MV6A 4WN3A 2GB4A 3FPAA 5FYQA 2SBTA 1P9NA 4YUZA 2P4QA 1FNDA 1SCJA 3FI9A 3WX0A 3BFJA 2IW1A 2P9QA 2YOFA 4G4SO 5L40A 2VHZA 2Y2VA 2F67A 4O2BA 1XZDA 2WFMA 5JTTA 1NASA 3OZRA 3LTNC 3HSKA 3H13A 1KFBB 2QJWA 1NP7A 2TYSB 3EH1A 1SO8A 2C98A 2H2GA 1G3IA 3KU1A 2NAPA 3EC2A 1DX6A 4L5IA 3LBNA 2Q8NA 4KXFB 4RV4A 1R4MA 1NQUA 5K45A 1PWZA 2HNKA 2JIZA 4NCKA 5C5DA 1JR6A 3LPMA 3R3JA 4QO7A 3FJOA 2PX6A 3HBFA 1TDJA 4MS1B 4RYDA 3K35A 3LI2A 4FHZA 1V2GA 5J4LA 2CLFB 1UK9A 1ISSA 1CUAA 1R6BX 3EEFA 3G8CA 4RIIA 1ZM3A 2DPGA 2PQ0A 1BCSA 3MJSA 3AUTA 1WMFA 2FMKA 1P31A 3CU5A 3PRHA 4MP3A 3KV1A 5FNVA 1G7RA 2HH9A 4R16A 4BB9A 4A2QA 1FPQA 5BNIA 3TJZA 3PLRA 1M8PA 4FTWA 4OYRA 3ZJTA 1AZWA 1DBSA 3W8EA 1PT9A 5BSHA 3H75A 2O20A 2RGNA 3I28A 5L53A 3JZMA 1I30A 3IEMA 3QX3A 1ULSA 1ZH2A 2PRKA 5AKYA 5K6AC 4U8HA 1AGRA 1OFHA 1DQZA 1KEEB 3L46A 1T2VA 4LBZA 3VHXB 2WTUA 4G41A 3ZGLA 4KTTE 1XLTA 1Z0DA 3OM0A 4KB5A 2C7OA 4PCVA 4AY3A 1L5GB 4BO2A 2CKMA 4FYYA 3HCAA 1X7HA 5BSMA 4MPJA 2WSYB 3G0DA 4E2XA 2EJTA 4ALLA 2E55A 4RTNA 3C45A 2RHMA 1RWVA 2RIRA 2ZKIA 2OQVA 1NE2A 2BKXA 4EBFA 5CFMA 1Z6XA 3LVQE 1IMOA 2W2KB 2ZANA 3MINB 1YS9A 5KTYA 3M9XA 2B1IA 2CXQA 3A4TA 3RYCB 3IPLA 1AS2A 5D6NA 2FEOA 4FN5A 4DA7A 1GFSA 2B4YA 1AKVA 1LRKA 3P2IA 3ZVMA 3D6FA 4C03A 2ZUTA 2I78A 2RDMA 3IXMA 3NOQA 2BWJA 3OY7A 5SICE 1TKBA 3KLBA 1G8KA 5DBFA 4JXXA 1R9JA 4WHMA 4ZARA 4WEOA 4N6GA 1O9GA 1DC7A 1T8RA 4D96A 3IIEA 1T91A 1DQYA 1Y8QB 1BOOA 4LSGA 5K3SA 1D1QA 5I6DA 5EIFA 4RJJA 4BMPB 2AOUA 5T6MA 3IPRA 5AJVB 5AI4A 5TMEA 4UBMA 5MF6A 4LHXA 4IJMA 5JYDA 2FP4A 2X42A 5TPWA 5KTRA 4JOBA 2GXAA 3MPUA 2G17A 1YBVA 4QHTA 3DBLB 5DLEA 5K0CA 3EXIA 3I30X 2MSWA 3UWPA 3LOPA 4DHEA 1IHYA 3D2LA 1WSBA 2X19A 3C3JA 3KZ1E 4MYHA 3UCXA 2O2XA 2CVPA 1T9KA 3L6OO 4GDFA 4EI2A 1J0AA 1PYDA 2O8CA 2DFNA 3OMWA 3MTBA 4BECA 4YMLA 4XDHA 1AOXA 4J2HA 4MCJA 4AIIA 3PBKA 4OHPA 2ORYA 2I8AA 2W2XA 2YJTD 2E5FA 3EGOA 4AJPA 2D5IA 3W6ZA 3W2TA 3W8DA 4V0LA 4D92A 1PK7A 4MW5A 1CQIA 1GPBA 1NUTA 2XE6A 4YR7A 1KKMA 3ZZTA 4OLAA 3HC7A 4KJZA 3O4VA 3HGQA 1DXHA 3LT2A 3OM1A 1WZNA 1GTG1 4YCCA 4E70A 1ACJA 1ORDA 4BO5A 4LF5B 3EQ9A 1C29B 1DRVA 3E35A 3PHJA 3PNLA 3DE0X 4KP7A 1E1QA 4MR9B 4KWEA 5KQRA 1E3MA 3C8ZA 1ZZGA 1VLLA 1YU6A 3V32A 1J5PA 3L6EA 3V4RA 4BYGA 1YJQA 4NBUA 5KEIA 3JV7A 4EY6A 2O2IA 2BFAA 2ZRKA 4P86A 2ILVA 4QREA 2X9NA 1AXEA 1K7SN 3OCCA 5K0SA 2UYQA 2AKAB 4CMIB 4D9BA 1ZD4A 1BW9A 3EXHC 3KHUA 3QSGA 1CHNA 4M1EA 4CLOA 5MFZA 1JLSA 3WL8A 3MRXA 1LX7A 3KAKA 3FAZA 2WHRA 4RHEA 4ESOA 1ZAKA 3P7MA 4QTUB 3H7AA 4OGKA 3GRZA 4MEAA 4A8JA 3GMDA 1HMYA 3NJRA 4FW9A 4HB4A 4EI9A 5JCZA 5D1NA 3PEYA 2PSJA 3TXYA 3OE1A 1OI2A 3OT1B 4F3KA 3GMTA 4JSRA 4CPDA 4NU8X 4WXRA 5AM5A 4X7PA 2FN3A 1U0EA 1L1FA 4W5OA 1EK6A 2K2QB 1W5SA 1XA4A 3N75A 1UQRA 2MU1A 3BL6A 2RJ3A 4G65A 3KALA 3SNKA 5GADl 3FGOA 1ZIOA 5H3CA 1C1DB 4MS4A 3GLSA 3TEFA 3KPWA 1KJWA 3WDMA 3EE6A 4C14A 1QV9A 5INTA 1DAFA 2ZUCA 3PGKA 1GQSA 1OKKA 3I6ZA 3OU7A 4J49A 1OZ0A 1Z35A 2E89A 4LX8A 4NCXA 3V80A 4FI3C 1X15A 4F6RA 2JFXA 3IA7A 4IZIA 4KR2A 2BP7B 1J2RA 1TCBA 4CMHA 3WS7A 2O8FB 3QF4A 4ARZA 2BI4A 5DMHA 3QVJA 2ZYWX 2DR2A 4UEOA 3GG9A 3FYUB 4MTCA 4RK5A 1N2XA 4CM7A 3RF6A 4IJ6A 1RQGA 1DBRA 4JBWA 2GI4A 1IQ0A 4DSZA 1DKNA 4BX3A 1RJ9B 3ROGA 1QWSA 4HMPA 2C04A 2GNPA 3VH1A 4L0DA 3BFKA 6CHYA 3T4UA 4XIGS 3T5AA 2ONYA 1YI8A 1X1BA 1QMPA 5EXSA 5J5AA 2YNMD 4FLFA 4JC8A 4R54A 2BDTA 3CO5A 3R0JA 3CZCA 4WKCA 5CVUA 2AZMA 4YUVA 3WYNA 4A6DA 2Q5JA 1KJ9A 2E4XA 2BT4A 7GPBA 1XTSA 3BRWD 3INTA 1FYXA 3ODPA 1P4JA 4FB5A 1A5TA 1NW5A 5BQXA 4QATA 3DJYA 4MUEA 2AMJA 3RNOA 2JGNA 4ZIRA 1N2EA 3QLJA 3KSUA 3LUGA 3M5DA 1H65A 2GO7A 2I3GA 2ID8A 2Z4RA 3EGIA 4DLAA 5FAKA 3EVDA 1LZLA 2FQQA 4YDSA 1VCOA 3PGVA 1CQJA 5IKPA 3VAZA 4CCYA 5DM4A 2I54A 1K9SA 3PXGA 3OAAD 3RVJA 1WUYA 3ANSA 4YAWA 3EAGA 3KXIA 1FYWA 5C0OE 4DC1A 3L8GA 2R7AA 5TMPA 1E2FA 4NH0A 3I0MA 5DM60 5HR5A 3TEMA 4FGKA 5T4FA 1KR2A 1WUHS 4LBVA 4AMGA 2YY7A 1Z2OX 1I6LA 3FUTA 1YCDA 3QEKA 4L51A 4LRTB 4TSRA 3VZRA 1E69A 5J4VA 5DK6A 5DWVA 3FCUB 5MGNA 3GLFA 5L3RA 3L7CA 4HEA6 3QY9A 4GQBA 4CHGA 1LKZA 2EGGA 2R8PA 3RF7A 1H4QA 1TQHA 4P5DA 3JX9A 3FCSB 4UEKA 4BO4A 4ZI3A 1S2OA 3IKVA 3WKDA 3TS1A 4KQFA 1E6WA 1X9IA 1EFRD 3WRXC 1LTHR 1W4ZA 1ISJA 2WU3A 2W6ID 2GVZC 1PK8A 1QQAA 3FLMA 2I3ZA 3AEQB 4JBYA 1RWNA 1U8FO 1AS3A 1QTRA 3ZHXA 1YZQA 5K3CA 4EYGA 1H5UA 3SOPA 3NCTA 3X1YA 1JDUA 1FVOA 2O2YA 3D8TA 2GZHA 3G68A 1KC1A 1RI2A 1UXGA 3ROFA 3CGWA 3PCTA 5ICCA 3RU9A 3ONFA 2J6CA 1H4TA 2VSOA 2Y1GA 4GT1A 4OQMA 1KK2A 3X1JA 4WNIA 2IKSA 1JG1A 4JJZA 3GDFA 4LHVA 3RC9A 3PWTA 2DBRA 5CW2A 1XBTA 3LOQA 4OLHA 3BMCA 3PQ3A 3SZGA 4WA7A 1ZRHA 4BGVA 1PT7A 1YDEA 2AD1A 4L2IB 2BGWA 4GRDA 2FCAA 1U2GC 4ISCA 1L7OA 4CEJB 3AL0C 2O8DA 4Q3BA 3R9IA 1L4GA 3JCZA 4OBBA 3DDZX 5CMLA 2UZ0A 4OJTA 1L5QA 3WDLA 1EDZA 2GBLC 4N12A 1PJAA 2WF5A 4R3UC 2ZRGA 4B2LA 4UC0A 3A6HA 4FYVA 3K2QA 6PFKA 3HACA 1NHWA 5K3FB 5BOSA 4RANA 1V5GA 2QYSA 4TQGA 4C0WA 4MRNA 4OQXA 4BFYA 4Q01A 3UZUA 3VU9B 4U2DA 4EAAA 5BO5A 4YRBA 3O7MA 4TSFA 5DRTA 5JATA 1GKLA 1JH9A 2GYVA 3MF4A 4OQYA 4EFMA 3QELA 2XUDA 5B2ZA 3FA2A 2IOYA 1NSYA 3FHJA 3O8RA 2D5BA 5CDFE 4NAVA 4BNDA 1U9YA 2G82A 3BZBA 2FMTA 3M4XA 1TFUA 3IJ5A 1OZFA 4YCSA 3F6RA 2YKGA 1OR8A 3KQOA 5FTLA 1PYGA 5DZSA 4BNHA 1WDMA 2JI8A 2Q6IA 3LJKA 4D2IA 3PPXA 5T4HA 4IEIA 2NQ8A 2DBQA 3IR7A 4O2AA 3PD0A 4ZQBA 2AEJA 2FXIA 3LLCA 3OZDA 1XP5A 3U9SA 3GOHA 1GU7A 1AMNA 3W3AD 5BW8A 1F1BA 2JJ2A 5CVDA 2ONKA 1VRCA 1UPBA 2IYRA 2VK8A 4JDUA 4MWDA 2YHUA 4NFSA 2GCGA 3AIMA 3NTUA 3PQ8A 3VM6A 2E7ZA 5EL0A 2OGWA 4CMEA 2MINA 4KFSA 4X5OA 3VR2D 4CM5A 3SXPA 2WRZA 4TMKA 2VP4A 3R7DA 4H3KB 4ZP1A 3E3OA 1F4LA 4MZXA 1Y7HA 2R65A 2XE7A 4BRZA 1Q3TA 2F43A 3BREA 3LUDA 1NLUA 3NATA 4Y8VA 1OTYA 3KYIB 2K5UA 3GFTA 1M2FA 3OWOA 1MT3A 2WM2A 3P9QA 3VHLB 1GN8A 3LWDA 2X14A 2CY0A 1YCGA 3UJBA 5M04A 2V7UA 4I3HA 2IELA 4G5GA 2V3CC 2QZPA 1VL5A 2W70A 2CVHA 3MMXA 2P69A 3NIDB 4HEQA 3AIIA 3CE6A 4YAKA 1J1IA 2JAWA 2XGMA 3UPUA 1YB4A 1PD0A 2KE5A 4EF4A 2WABA 3FYUC 4ETIA 4A10A 3WGHA 3V3TA 4GX5A 2C8LA 4CM9A 4ROTA 5LPNA 3WQRA 4GI1A 2YMPA 4KQ6A 1O0BA 2BFBA 1LPAB 3PUIA 1RU3A 3LCVB 4FQ7A 1B14A 4H1HA 1XCLA 4KQJA 3FFAA 3DV0B 1ZNYA 2IEZA 4NYMQ 3PDIA 5D6OA 3VSBA 4H08A 4WOKA 4BRWA 3BTSA 4PYJA 3MWGA 4EA9A 2QJRA 3LZCA 4YLYA 4LA4A 1CFJA 2EFCB 1RWPA 4UNPA 5TE9A 4ERNA 1CY2A 1SUEA 5LD2C 1I10A 5TY0A 3QE9Y 4GWGA 5DP1A 4PZEA 3BH7A 5ETJA 1Q0UA 5JCOC 1X8JA 1IWOA 5T4EA 4CEHA 1UKBA 4BQPA 4EHAA 3A6LA 4DR6B 4N5MA 1H3EA 1VIAA 4FKMA 4JIMA 2HLDA 2E0IA 3GH1A 4I50B 4OHCA 2W6CX 4R1LA 4UXJA 5DI9A 5HRCA 1JHMA 1TO6A 1XNQB 2Q1SA 1I5EA 1X7XA 2H8GA 3ZBTA 1M6VB 1VE1A 1QKIA 1VE5A 1VHJA 3VYTB 4JJKA 2WHQA 1CXZA 1GD1O 1TJNA 3FZEA 3KE9A 3TBHA 5IDYA 3SBXA 5KPJA 1N25A 2AE1A 3OFSA 3R3XA 3TGLA 4YRGA 3W4JA 4DJAA 1RP1A 1PKEA 3WLEA 1ADYA 4EHKA 2IHTA 2Q49A 4IIEA 3QX9A 3NHRA 3O8OB 3OZUA 1ZCBA 3KXDA 2WQ7A 4LFBB 3SC6A 4UQOA 4L4ZA 4WNYA 4DQLA 3VVBA 1LSSA 1Q7CA 1CUDA 3H5TA 4FR2A 3A36A 1N3BA 1I3MA 1SBCA 2L69A 4JEHA 3O4FA 3T9BA 2PZAA 2XAUA 4B85A 1G6OA 3MUNA 3PF9A 4DLWA 3KKMA 3QVOA 1ISIA 1UJ5A 2VLIA 2YY5A 2ZWOA 3KJXA 3L0ZA 2OCPA 2QXTA 3OLXA 4P8RA 4HDRB 1STOA 2EJUA 5DTMA 4CCAA 3ZJ5A 1IK6A 3P9IA 1RAFA 4W8GA 4M87A 3LQQA 4H60A 4EB0A 5G1NA 1N3IA 2P27A 1SKAA 2FOIA 1OH7A 2Q07A 2FNAA 3CB2A 1IWPB 2DJIA 2EKQA 4I4TB 1OTHA 1V8BA 2R60A 4L5AA 4LDJA 3RC7A 4EG0A 2SNIE 3P0JA 1U2GA 3NOOA 4W6ZA 2M6LA 3ZHOA 1XDUA 1A1SA 3WMWA 4C22A 4U7DA 4JSYA 2V4ZA 4IUCS 3CRMA 5DNCA 3QKIA 5I48A 3ASYA 4WFQA 4OYLA 1I0LA 2Z04A 1O5IA 2J0VA 1FTGA 3STYA 1W2WB 1J97A 1SXJA 1PJ2A 4WK0B 2FK7A 2LRHA 2A57A 2KX7A 2A9VA 3SMVA 1N92A 4FSXA 1I01A 3AUYA 5FLYA 4KOEC 4TOIA 4DGQA 3IH5A 3VNBA 3D6UA 3AU9A 4I50F 1KGDA 2AI3A 1WHSB 2XQJA 3EQZA 1KP9A 1M54A 3TVTA 3OQJA 2DFPA 2YZKA 4LZLA 3M89A 5EHGA 2FLKA 2WHPB 1QIDA 2VYQA 2IBSA 2WKSA 3T7RA 5BQOA 3FPBA 5YASA 1Z63A 1RXWA 3AERB 3KOZA 3UM9A 2P6MA 1JYSA 2G9UA 2VSQA 2NU6A 4KQIA 2UU9B 4IG9A 2AZTA 2VNHA 3F0TA 2WWRA 1E18A 1MOZA 2BFPA 2ES4A 1B8PA 3FVVA 3L1UA 1R4NB 3QV1A 4QTXA 4AXBA 2Z43A 2QJTA 1R6TA 2HJHA 1IY9A 1RXIA 1J0BA 4Q82A 3RIEA 4ZYUA 1HQCA 1Z74A 3H11B 1A5BB 2E4ZA 1Y4AE 2VYVD 1B6SA 3F73A 4LNUA 1GPH1 4LWOA 1NJ2A 3MMPA 4N3AA 4Q4DA 4X1YB 3EPHA 3JWGA 1GJRA 3SIWA 4WY5A 1MPTA 3IUEA 2HRZA 3GX1A 2LNDA 1TYBE 1AKYA 4Y2VA 1BKYA 4IWYA 5A4JA 1JQDA 1KDPA 1DCFA 2B3TA 4EJ6A 3TOXA 4OSPA 7MDHA 2IS1A 4CTJA 3N2YA 1YRWA 2C5GA 3ABOB 3BILA 3C6YA 5CLHA 2ZUVA 3UMJA 1KGSA 1QBKC 1RQXA 1TM2A 2EFGA 3TLKA 1GDDA 4KODA 4B4DA 2HDNB 4MIKA 3JVEA 3RHSA 2W6OA 3RYFB 3U2QA 2RB4A 3DW1X 2Z95A 2AEFA 3IDOA 3JR3A 4OHFA 1N36B 4PQGA 2XRZA 1TUGA 3NWEA 2ZWPA 3A06A 2QS9A 3IDFA 3FYCA 3WQQA 4BP9A 4E32A 1BC5A 1TQ4A 3IBFA 5KDLA 5C9ZA 1HRKA 1Z38A 4LNUB 4RY9A 2YWEA 5H82A 1BDMA 1MAUA 1P7CA 3GJ4A 4V1CB 1CRPA 4B5LA 4K0KB 4IUDS 5CH3A 1KDOA 3G0IA 3LGXA 5FL7D 3WNQA 2F62A 4CM6A 4Z0PA 3R0XA 4M3NA 5BSRA 3GAMA 4TYNA 3BX1A 2HMSA 2ET6A 1S01A 4TL6A 3M83A 3EMVA 4HGPA 2H1SA 3G5AA 4J7UA 3GRUA 4AN4A 4YAUA 3CO0S 4KNWA 4R1TA 3CEMA 1EQ2A 2YHBA 3HDYA 4WL0A 1WCXA 3CX7A 4DDMA 2WWWA 3I34X 1UP6A 2WIAA 2O7VA 5BNZA 5G0VA 2IYUA 3SQOA 1YAHA 5FXMA 5IMBA 1A5SB 3R40A 1UXKA 4TT3A 2FX2A 5HIMA 1MIHA 1DBVO 3KLNA 1OD6A 2OR3A 3R3SA 2OM2A 3DTVB 2P3QA 1L7RA 1QVWA 1X74A 4F5YA 3BORA 2XT6A 3OM9A 3MCWA 1P1IA 2GPBA 1YK1A 2V9PA 3A31A 3OJWA 4I6JA 4E2WA 2AOVA 4BZZA 3EPPA 4B79A 1TQDA 2BF4A 2EFEB 4MXDA 4UHJA 5TJHA 3C3CA 2QL5A 3VDQA 1K7EB 4EB6A 2UYYA 3QBDA 4TS1A 5IU6A 2NPIA 2Y92A 5ALFA 2XE4A 1ILEA 1Z82A 2REBA 3R5KA 3MCVA 1Y9DA 3NNSA 3THOA 3UAVA 4IIGA 1EDOA 4ZCMA 3SE0A 3ENNA 3KQHA 1OZGA 3SDZA 5HSGA 1PN3A 3F71A 3BQMB 1QG4A 4XRGA 3AR5A 2QE6A 1ECJA 4NV1A 5DNAA 1BDHA 3N0RA 3B38A 5M2QA 2WAMA 4RMJA 2OXTA 1C4WA 5JZMA 1FNCA 1P5FA 1WV0A 5CK4A 5DLDA 5HP4A 3KD3A 1JKFA 1XRRA 1Q7EA 2WTNA 5A5VA 3LC0A 1CQPA 3CUVA 3R9XB 1JQ3A 5DM70 4XFDA 1UDRA 3EXFB 10MHA 2NO1A 4KAJA 3DH0A 3DJFA 3DMGA 4AQDA 4MVXA 4POAA 1JDNA 2GYWA 1GTVA 4X90A 2Q6LA 3GFQA 5AJWA 3CKKA 1R0LA 4UJ5A 5HJ5A 1LPMA 2Q6KA 3LK7A 1QG2A 3UXHA 3D3WB 3UWMA 4NWIA 4ENUA 4QBHA 3FKQA 2FFBA 4EWLA 4EG6A 2NSLA 3IB3A 1FU4A 2COUA 3JD2A 2ECPA 1PFKA 2B99A 4TRRA 3OWXA 4WMLA 4IDHA 5CIWA 3RQSA 1C8LA 3WLMA 2D4AA 3RWBA 1GPLA 4GX2A 4OQPA 1GR0A 2BEWA 3VOSA 2XWPA 4FS8A 4JLKA 4S0XA 2IIBA 4HZGA 1R9NA 2ZBPA 1BE1A 2G36A 1NZFA 2VS1A 2DPXA 3CNQS 4PIPA 4QRDA 4TKLA 5CEFA 2XXAA 2GNOA 1XYYA 2QORA 3CN7A 1VYTA 3M8KA 1MBZA 1N2CB 2WJGA 1BQ4A 4OCZA 4U3JA 4X20B 1KEEA 1ISHA 1BDJA 3ESDA 4KI7A 1JF8A 3DDUA 1F38A 5EJ4A 3VPHA 5AJHA 1L4FA 1Y42X 3V48A 3ZCVA 1SU8A 4IDAA 4N0QA 1AHHA 2Q0XA 2VWGA 4GLBA 2ATCA 3TQRA 5HWSA 4NH4A 2VYCA 5A0VA 4QPPA 1ECGA 1V3VA 2XLBA 1Z8DA 8LDHA 1M2NA 1LDBA 2ZP1A 5AUNB 3OM8A 1UPAA 4FT2A 2NU8B 1N9ZA 4KGXA 3AUUA 5HCUA 1E1LA 3KYBA 3OQIA 1GVHA 2JEZA 1KE2A 1XA0A 3AK4A 3HCPA 3VR6A 3TLMA 3GBPA 5IP5A 4ZU3A 5HMMA 2QRJA 3HI4A 3LIPA 3LDGA 4K6KA 4WZAA 2Z5FA 3VVCA 2IBTA 1KJJA 2OMEA 4L4SA 4NYJR 3RS2A 4FFWA 2AT1A 2AUTA 3HJTA 3O4GA 1AGYA 4DBLC 1QH1B 4HWKA 5IYZA 3NBYC 2HQOA 4BMXA 1XJ0A 3L5KA 3VO9A 1VJ1A 2QN3A 4NDZA 1GNRA 3GLIA 4RSMA 4C4PA 2G71A 3FCXA 4NARA 4TKUA 1HR0B 2O5CA 1M8FA 4RVSA 4BKRA 1VSBA 1XX6A 1SPBS 2J5QA 1NQOA 1FDTA 3O92A 3WGLA 821PA 4OYHA 4P84A 1F5SA 3KTFA 4WN9A 3LBAA 1EMDA 4FIDA 3AVQA 5LU8A 4M22A 5CCDA 1SH7A 2QN8A 3MRVA 1AKUA 4QT4A 1JTEA 5LB4A 4Q7LA 1LPPA 3FLBA 2AG8A 2X0RA 4HYTA 4OP1A 4QYSA 5FUBA 1Z39A 3R2JA 2Y1FA 4BLOA 2GMWA 3LRXA 4OAOA 2NYAA 1ZZEA 1W581 3LHSA 1Q1GA 4IGIA 5TS2A 3BXXA 4QO8A 4E51A 4F38A 5HZGA 3HYTA 1ODJA 4KPUA 3P0RA 2Y1WA 2NZ2A 3RBXA 4DCOA 2DP4E 3HA3A 3I58A 4ZT6A 1OZAA 4HZUB 4LG1A 4NESA 4J90A 4RFSA 3FGPA 1XNGA 4RL6A 1ZQ1A 2D1QA 2NV0A 1DPGA 1SRRA 2V0CA 3BN3A 5GJVC 3TE7A 5HPYB 4YQZA 2QF7A 4FS3A 4MDHA 4CG1A 4UMVA 2XNHA 2P7IA 1UKCA 3WNCA 4AKEA 4EAQA 2WT9A 3Q40A 1JAHA 1RHQA 3SKVA 4IDOA 1PQPA 1GPMA 4TVOA 5DP2A 5KX5B 3CRW1 2R5NA 5T64A 1ULZA 1FRQA 1X7XB 5SYMA 3IR6A 4ZMRA 2D2FA 4EYQA 4TTAA 3WKCA 1PNVA 2Q4DA 4C05A 3A9RA 5AWFC 2VF2A 2C7QA 3REFA 4DR4B 1Z0IA 4NEHB 2WZQA 4DA8A 3CIFA 5AKXA 4PSKA 2X2EA 4YAFA 2VA8A 2VJLA 4QFCA 3FUWA 3ZGZA 2VP0A 2H11A 4HB2A 3I1FA 3H0CA 3KOWA 3VU0A 4KGDA 1RAHA 4MLDA 1FOEB 1FYEA 1T36B 3BMOB