4U2GA

Crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAHEILGVNAFMRETVSWLVDQGYAAVCPDLHARQAPGTALDPLDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHLPYSNGKVGLVGYSLGGALAFLVAAKGCVDRVVGYCGVGLEKQLDKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEGAGHSFARTGSSDYVASAAALANERTLDFLAPLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas knackmussii
molecule tags Hydrolase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2gA00
3ZLUA 3KWFA 2IIVA 2HDWA 1E3QA 5EFZA 4DM7A 1EB9A 1QIJA 5EIEA 1FFAA 1G4HA 1D07A 5HZGA 5A2GA 4Y2XA 1WCYA 3VKFA 2D5LA 1LPAB 2HFJA 4G8BA 3TEJA 5JATA 2QMQA 4BC1A 4NZZA 4N5HX 2VT7A 3LP5A 3S2ZA 2VJDA 3A2MA 1J1IA 4JNCA 4FLFA 5EHZA 3G0GA 1KU6A 2R11A 3C5WP 4E11A 3QH4A 1CUUA 5JD6A 4WY8A 4U2BA 3JWEA 4RGYA 3BDVA 3G8YA 3RM3A 2QXTA 1QIMA 3IIIA 3FNBA 5CT5A 4RE5A 2PUJA 5JAOA 5AI5A 4AN1A 1EA5A 5ALHA 3BDIA 2VJCA 4IH4A 4QWMA 5DJ5A 1XROA 1H22A 4C4ZA 4WCVA 3GZJA 3BIWA 1XZAA 3DLTA 4GI1A 4BDSA 2XT0A 4ITVA 3QMWA 2OCLA 4DNFA 1U65A 2XB6A 2JEYA 2YH2A 3EQ9A 4PSUA 3VVLA 1J07A 4KE8A 3SWWA 3MVEA 3WK8A 2GBGA 4BB0A 2I3DA 1QTRA 1CVLA 4GWLA 4Q1VA 4OU5A 3M81A 4WDRA 1VXRA 1IUNA 2JGIA 1CUYA 4JH0A 5CRIA 1CUXA 2IX9A 5EGNA 1Y37A 1XZJA 1CUIA 5KREA 3D2CA 3K2IA 3G0CA 1SCKA 2GZRA 5DTJA 3C6YA 1XRLA 2XUFA 3LIIA 4BAZA 2Z3WA 2XQKA 1A8UA 1WOMA 1P0PA 1XRRA 2JIDA 3BWXA 2WHPA 2VA9A 3F9CA 4B9AA 3AJAA 1MU0A 1B41A 2YASA 3SK0A 2PSEA 4FKBA 1CUDA 4FFWA 3PFBA 3WK5A 4F0JA 3B3QA 1F0NA 1VZ3A 1GXSA 3HABA 2CKMA 1JU4A 5E2IA 5K3FA 1ODTC 2QM0A 4HXEB 4JYPA 2XQGA 4AZ0A 1AURA 3CCBA 5JASA 3WZLA 2O2IA 1QO7A 2JGFA 4I3FA 5AI6A 4DSAA 5I8PA 3WZMA 5EHXA 3H2JA 1BCRA 3E1GA 1EINA 4UHEA 3FLAA 4GLBA 3WA6A 3W05A 3NGMA 2QS9A 5ALQA 4W63A 2J4CA 4YPVA 1DTEA 4DNOA 4E15A 1A8QA 3C87A 2IITA 3VVMA 4ETWA 1ETHA 4BAGA 1KEZA 2XUIA 2QKYA 1OILA 4OPMA 1ACJA 4X85A 4KAJA 2JGEA 3ANSA 4E14A 4Q3LA 5HF6A 2HADA 1ORWA 3LCRA 3HRHA 3R3UA 3NOXA 2XLCA 3ESDA 2Y2UA 5HQ3B 4QA9A 3WJ1A 5HF9A 4LHEA 1CPYA 2VEOA 4G8CA 3M3DA 2JF0A 1YA8A 4AO7A 1LPOA 4KR0A 1NX9A 2LIPA 2WTMA 3FLEA 2OXEA 1IUPA 4MQLA 1E5TA 2GYVA 3DD5A 2AJ8A 1HPLA 3WIBA 4JEIA 4TVKA 2WQZA 2RHWA 5JYCA 4UHHA 3FCXA 2XI4A 4L9AA 3LIPA 1EK2A 2PPLA 5FV4A 2I03A 4XVCA 2VQ6A 3O4HA 5ISMA 2XMSA 1EHYA 3DL4A 3BJRA 4IH9A 5AK6A 5EHQA 2WM2A 3I28A 4KAAA 5D6OA 2Y6VA 5EI5A 1P0IA 5AM2A 1DINA 4C01A 1BN6A 2QJRA 3PUHA 4CG1A 2XMBA 3QPDA 4GXNA 2V98A 3CXUA 1LLFA 3C6ZA 5T4FA 1NU8A 4RE6A 3R3VA 3H2HA 1U2EA 2XQJA 3DEAA 5ALLA 2OG1A 2GBIA 3N0TA 3S8YA 4INZA 1JJFA 2XQFA 2XMDA 3V48A 1YAHA 4BBZA 1X70A 3ZWQA 2RONA 1H23A 4FDMA 3AILA 4UFOA 3VDXA 4KE6A 5KWJA 1EVEA 1XZIA 4B0OA 4BC0A 1AQLA 1JJBA 2C5FA 3WI7A 1TCBA 1FFCA 4AMZA 5AH0A 5CMLA 2WJ6A 3C6XA 1BN7A 2QTBA 4Q82A 4YASA 5K5EA 3DOHA 1G42A 3V1NA 1K5PA 1QLWA 3IUJA 2JGJA 3ICVA 4PQEA 1WB4A 4MQMA 3H18A 2PM8A 3H2GA 1VE6A 1E66A 2XUAA 4B84A 3O9VA 1FSSA 3CCCA 1GPNA 1ZD4A 3W06A 4EY4A 1WHSA 1TQHA 5ALOA 4DIUA 1QIHA 4CCWA 2WFLB 1DWQA 1I6WA 3KWJA 4EY5A 5I7UA 3F67A 2VAVA 4J0DA 2OPHA 5LZ5A 2VSQA 5DYYA 1DQYA 5CH5A 3H17A 2O7VA 1WPXA 3STYA 4KEAA 5FOQA 1MN6A 1VE7A 2B4KA 5DLPA 2C7BA 1EVQA 1LBTA 4W1SA 5C8VA 3ANTA 5ALJA 2Q0XA 1QGED 2XUGA 5LIPA 1L7QA 1TIBA 1AC5A 3FYUB 2WIGA 2DFPA 1EB8A 3B5EA 3M82A 5ALRA 5FPQA 4OU4A 4I19A 1PV1A 1QE3A 5A71A 4F21A 4LXHA 2J3QA 4Y2YA 3AIOA 4W1QA 4F60A 4OB7A 4WFIA 1X2BA 2V96A 4LXGA 4QDXA 4CIAA 1W75A 4GW3A 4UFPA 4AB1A 3IB3A 4BYMA 1ZIYA 5AK4A 2QJWA 1GT6A 4IO0A 3A6ZA 4PSCA 1XZCA 2R8BA 1QIIA 2VJBA 2BGNA 1YAJA 2YXPX 4J0JA 5FUMA 1CUVA 3I2GA 4H7DA 5ALEA 3RLIA 2DHEA 2QUAA 4AX4A 3E3AA 1XZMA 5DWDA 4GECA 3R3YA 3RARA 4FHZA 5K3DA 3HACA 3D5EA 1ZGBA 4XWGA 3FYUC 5KBYA 1XLUA 4DNPA 2H9YA 1LPNA 3IUQA 2G63A 1MNQA 4HRXA 3DL7A 1XZKA 4B6GA 1TKRA 2PU5A 2QRUA 4X6XA 3WYNA 5SYMA 5FRDA 3WK6A 3STXA 3H1AA 4J0CA 3QPCA 3WWOA 4JUIA 1GPKA 4X95A 3D2BA 3ESBA 5T4BA 2HU8A 3WQHA 4Y2JA 5JADA 5D7BA 3AINA 1YCDA 4Q3KA 5AJHA 2HM7A 4OB8A 1GQRA 1MAAA 1Z68A 5LZ4A 5K3BA 1EX9A 3FCYA 1EK1A 2WUEA 3H1BA 5AKYA 3GFFA 1E8NA 1ACLA 4BP8A 1CUCA 5ALFA 5J3JA 2ROQA 3FSGD 1XZLA 4RNCA 2B20A 5AM1A 1IUOA 1QTIA 5ALYA 1XKLA 1CUHA 1QO9A 3AZOA 3L1JA 5C8ZA 4OSEA 2DCMA 4HRYA 3BXPA 3SX4A 4KACA 3KD2A 4BVJA 3DQZA 3L1HA 2OCKA 1QIGA 3QPAA 4QLOA 2OGSA 1AZWA 4P9NA 4UBMA 1JU3A 3PF9A 4MXDA 4NS4A 3ZLVA 5A62A 4OD0A 2C0QA 4LYDA 4Y2SA 1OCEA 1CUSA 4BVLA 2RAUA 4HZGA 1HDEA 1MX1A 1L7RA 2XMRA 4CI9A 2WHPB 1JT2A 3T4UA 1J2EA 2FJPA 2CUTA 3C8HA 4KJXA 2AJLI 2WJ4A 1XZEA 3PI6A 4X6YA 3PFCA 2HA0A 5CTAA 1XQXA 1LPMA 1R3DA 4K5QA 3U1TA 5K3AA 3IA2A 2BFNA 3VJKA 2E3JA 1XZHA 4B80A 1UK6A 5K3FB 4K2AA 5JARA 4Y2VA 1ZIXA 2CZQA 4K6HA 4X3CA 4GDMA 4DTCA 2ONCA 3STWA 1N8SA 2Z5GA 3FSGA 4G4IA 3KSRA 4P08A 1RP1A 1JFRA 4AO6A 1UFOA 4BCBA 3WL7A 1W76A 5CURA 3PF8A 2JGKA 3ICWA 5JAHA 4A16A 1EXWA 2ZYIA 2HFKA 1FFBA 2X8BA 4KYVA 4EZIA 3WK4A 2UZ0A 1ZJ5A 4GBGA 1A7UA 4N8EA 4Y2UA 3C8DA 3CN9A 3I2JA 5E4TA 3P2MA 2RHTA 2DR0A 4B82A 1YSCA 2WG1A 1H2ZA 1XQYA 5AKIA 2EDAA 3G0DA 4WY5A 5ESRA 4J0HA 1CUBA 4H7EA 3BL8A 3AZPA 4J7AA 3UUFA 3LLCA 5CT8A 5A7FA 3V9AA 1DU4A 1VLQA 1DWPA 3H2IA 3X3HA 1EI9A 5JANA 1ZD3A 1QOZA 4UHFA 1XQWA 2JGMA 4MEBA 2HL6A 1ZD5A 5BWCA 5AI9A 3HXKA 4H18A 4L0CA 3TJMA 3WYDA 3QVMA 4F5ZA 4FWBA 3STUA 4CG2A 3DYVA 4X90A 1E8MA 3AIMA 4K6GA 3OG9A 3AIKA 2ORYA 2ACEA 3IURA 2JGLA 4N8SA 2PVSA 5DTIA 4CCYA 1UK7A 7YASA 4MWSA 1VJ5A 2OAGA 1QFMA 1W52X 4O08A 1QONA 4AO8A 5JALA 3V1KA 1C7IA 4J0IA 3ZLTA 2ZSHA 5HK9A 1XLWA 2C0PA 3VXKA 1S8OA 1QFSA 2HIHA 1CQZA 2QZPA 3HJUA 3BJMA 2OGTA 4ZXFA 1RYYA 1W6RA 3WL5A 1DT3A 1XFDA 5LZ9A 1A88A 4M0MA 4PO3X 4ZI5A 2RGUA 2PSFA 3PDCA 1SOMA 2CJPA 2CBGA 2C5GA 1IZ8A 3AUKA 5AO9A 5AM0A 1MX5A 4BATA 3HI4A 1XLVA 4K6KA 2VT6A 3IBTA 2CB9A 1K8QA 1C7JA 3GELA 5AKJA 1N1MA 2J3DA 3ILSA 5CH3A 1YA4A 4AQDA 1XZBA 2QT9A 2XMZA 3OOSA 4C87A 1QZ3A 5AKLA 5AI0A 3WKAA 2GYUA 4U2CA 1ISPA 3ZI7A 2OCIA 2ZYRA 1MTZA 4EB0A 3H2KA 5AKXA 4BE4A 1LZLA 3R3XA 2WU4A 2GYWA 4P92A 3D2AA 3RK4A 1UK8A 5HFAA 5AICA 5T4EA 4NMWA 3WL6A 4DMKA 4X92A 2OLEA 3DYIA 5LKRA 3MUOA 3JW8A 3R3WA 4HTAA 4ZV7A 2PSHA 2AJBA 3D59A 2P8SA 4H77A 3V1LA 3WWCA 1P0MA 2WIFA 1OXMA 3K6KA 3C70A 2ECFA 1CUEA 3R40A 3KXPA 3HEAA 3WMRA 4C88A 1XRMA 5HK8A 2Y6UA 3T52A 4QDUA 1F8UA 2WHRA 1DQZA 4QNNA 3DJYA 2Z8XA 1EDDA 4AN0A 5ALZA 5CT9A 4FLMA 5FDFA 4HS9A 3LS2A 2AJCA 2BJHA 3R0VA 2GBCA 2WIDA 5AKZA 1WB5A 3W04A 3G9TA 2V97A 1IZ7A 5ALGA 4EY7A 2ZSIA 1MJ5A 2XDWA 5FPPA 4A23A 2CMFA 4DGQA 5CT6A 3F96A 3M83A 1K4YA 3VISA 6YASA 4DMHA 1ZI6A 3I2IA 5HFNA 5LZ7A 1F6WA 2WJ3A 2H7YA 3I6ZA 4J03A 4G5XA 1IVYA 3AZQA 1CQWA 4XJVA 4E46A 5D3KA 2NW6A 5AM5A 4X00A 3DOIA 4W1PA 5AM4A 4FNGA 3G0BA 3L1IA 3RKSA 5BV7A 3KDAA 4QE3A 1YS2X 1GZ7A 1XKTA 4Y2QA 4S0XA 2DQYA 2EEPA 1ZJ4A 2PBLA 1BU8A 2HRRA 2QUBA 5FP0A 4Y2TA 2HA2A 3D4LA 1TCCA 4AZ3A 3G0IA 2BKLA 1UKAA 3SC2A 1TCAA 3MGAA 3QM1A 3HLKA 1UOPA 4CG3A 2WKWA 5FXMA 1AGYA 1WM1A 4X91A 4ROTA 2X5XA 4B81A 3WWEA 2D0DA 2PL5A 2WSLA 4ARBA 2ACKA 4AXBA 3D0KA 1XZGA 2ZJFA 2VAXA 5JZSA 2XLBA 3E0XA 1HBJA 1JMYA 3W9BA 3OPMA 2G5TA 4IHAA 1A8SA 3GROA 1YS1X 3IDAA 5LZ8A 3HC7A 4BAUA 5SYNA 4FTWA 5BOVA 2GBFA 4DMFA 3DDUA 4HAIA 4V2IA 4PW0A 1UWCA 5JZ9A 2XUPA 2QVBA 4MWTA 3F98A 4QDZA 4X97A 2VJAA 4OYYA 2OGZA 4Y7DA 3E4DA 3FLBA 4GHWA 5HF8A 3UUEA 4BZWA 5ALNA 4G9GA 4EY8A 2BGRA 2H7XA 1DT5A 3U0VA 5C7YA 3QYJA 4WJLA 3I2KA 2ZYHA 1U4NA 1XZDA 1Q84A 4FOLA 3BF7A 4UBKA 1UT6A 1SC9A 1TRHA 2O2GA 3I6MA 1XRQA 1LNSA 4BP9A 3WK9A 4LKOA 3STVA 5AIBA 4W1RA 3OM8A 1JKMA 2QXUA 3HSSA 1W1IA 1RWQA 1ZI8A 5ALSA 1PJAA 2FX5A 4ZGBA 1E8DA 5YASA 3EF3A 2XUDA 3OTQA 2Z3ZA 5AKKA 3WKEA 4QDTA 3GUUA 4Y9SA 1AMNA 3H0CA 1SFRA 2WFMA 2Y1KA 2RIPA 4B83A 4UUQA 5K3EA 3DKKA 2WUFA 1YASA 1H2YA 2JBWA 3JYHA 2H1IA 5JAUA 2W22A 4FNMA 3ESAA 3W2TA 1R50A 1QJ4A 4H35A 4OCZA 1MAHA 2OCGA 5KWIA 4RPCA 3NWOA 1AKNA 4BDTA 5EHNA 3O4JA 4G4JA 4X93A 2PX6A 5H3HA 3UMJA 3EQ8A 1IMJA 3IVMA 4C89A 3QMVA 4N5IX 4U2FA 3PICA 2DHDA 2AJDA 1QIFA 4AMYA 1AUOA 4KAFA 2WFZA 1BEZA 4P93A 1BCSA 2PU7A 3R3ZA 2RI6A 2WG0A 2XMQA 4H7KA 2C4HA 2DHCA 1KU0A 4C6HA 4FLEA 1X2EA 5AI8A 4QDOA 4J0KA 1ZICA 2I78A 1LZKA 2DQZA 3O4IA 5ALXA 4YK7A 4FBMA 1CFJA 4G4GA 1K63A 4FFVA 3FBWA 3H04A 3O9MA 3WWPA 1MO2A 5T4HA 5AKHA 1JJIA 5C8XA 4BE9A 1QIDA 1THTA 4B0PA 1G66A 3V1MA 4EBBA 4Y2RA 2WG2A 3WKBA 4PF1A 3FVRA 2O7RA 1YB6A 4QLAA 4WDQA 3FVTA 4DMCA 1C4XA 1ZD2P 5IVHA 1CUGA 1GGVA 5K3CA 5LLSA 2J4FA 1UK9A 3BE8A 2BUBA 5LP1A 5JAPA 5ALIA 1K6EA 5HKAA 1USWA 1DWOA 5DNVA 1QIEA 3B12A 2ZVDA 3H19A 1VKHA 5DYTA 1MPXA 4PV7A 5AIAA 5LYYA 1CEXA 5AM3A 1AX9A 4LXIA 1O6FA 1YB7A 5E4JA 4Q05A 2BCEA 4EUSA 1ZI9A 5BWBA 1SCQA 1MT3A 4PSDA 3O0DA 4ZWNA 4FMPA 2PSDA 1UOQA 2BUAA 1FFEA 5CW2A 1P0QA 3K9BA 1UKCA 3G9XA 2V9ZA 2WILA 2XE4A 3FOBA 1VZ2A 4BVKA 1CIJA 5CBKA 3STTA 5CXXA 3KOOA 1W4LA 2HHAA 4UHDA 5HF5A 3DCNA 1G5FA 5ALWA 5AK3A 3F8SA 4U2GA 5IVDA 1VA5A 4EY6A 5FKJA 4OB6A 4H7IA 4CCYB 1ODSA 4OUKX 1HLGA 4IH1A 3GA7A 4DNQA 1R9MA 2G4LA 3QMMA 5IVKA 4UBOA 1CV2A 5A6VA 1JI3A 2XUQA 2EDCA 5F4ZA 3DS8A 3OURA 4XIIA 2C58A 1BS9A 4BCDA 5IH7A 5FLKA 2JEZA 3W9UA 2ZYSA 1EDEA 2XQIA 5ALUA 3C45A 3G7NA 3OC0A 1O6GA 1FJ2A 1N5MA 5EIHA 5ALMA 1H2XA 4IQ4A 3IUNA 4QWWA 3Q0TA 1SCIA 4B85A 5CT4A 1HQDA 1Y7HA 2OAEA 3EBLA 2FJ0A 2PSJA 2VATA 1T2NA 1T4MA 1F0PA 3QZUA 4X6UA 5JD4A 4ZREA 4BRZA 4X94A 2FUKA 4H7HA 4UHCA 4TPKA 5D3ZA 5HKBA 4G9EA 4H7JA 1YR2A 4Y2PA 4D9JA 3I2HA 3WKDA 5EIAA 2OQIA 1ZGCA 3MUNA 4FBLA 2H7CA 2PUHA 2BUCA 5A7HA 4YX9A 3D7RA 3G9ZA 5HQ3A 2QR5A 3VJLA 2VF2A 4J3JA 4UFNA 1BRTA 1FFDA 4B9EA 2Y2VA 2WUDA 5E4YA 1LGYA 5IVIA 2XMGA 3GBSA 3QBJA 1GKKA 1CUWA 3QITA 4U2DA 3IUMA 4UBJA 5ALKA 3G9UA 2HA7A 1LPPA 1Q0ZA 1GKLA 1XRNA 1Q0RA 5A7GA 4BTVA 4B7ZA 5AKGA 3A2NA 3BF8A 1CLEA 4MYSA 3WK7A 3FYTA 1DX4A 3D3NA 3I1IA 3DNMA 1E89A 5AI4A 1GPLA 4I4CA 4M0FA 5AOAA 4NVRA 4UBLA 5DYWA 4LIPD 4MJ3A 2XUHA 2GZSA 3I2FA 1J06A 2ES4A 4UBNA 1UOOA 1HL7A 2XUJA 1Y7IA 4J0GA 2WIKA 3N2ZB 3VJMA 2CEKA 3WLAA 5ALPA 5ALTA 2HRQA 2ZJ7A 3PE6A 4BTLA 1CUJA 4H7FA 4N8DA 1B6GA 4DSZA 5JD5A 2WLSA 1GQSA 1UXOA 1R4ZA 4QZVA 1U8EA 3FAKA 2I3ZA 3IULA 4OYLA 4G8DA 3I1YA 2OQVA 3AFIA 3WA7A 1UZAA 3HZOA 1THGA 1WHTA 2W6CX 3WWDA 5ALVA 1H2WA 4C4XA 4H0CA 4X71A 4HXFB 5AOBA 1N5RA 1VOTA 4Q3OA 3WJ2A 2O2HA 3O95A 4UHBA 3HYSA 4UBIA 4L3WA 3Q8WA 4ZV9A 3C6BA 2WIJA 1CRLA 1R88A 1XZFA 4JYMA 3ESCA 2PKYX 5ALDA 1UKBA 3ZPXA 5DNUA 3WL8A 1MNAA 1ZOIA 3DKRA 1TK3A 4KE7A 2WHQA 1EH5A 2XMCA 1MX9A 1XRPA 2B61A 3BIXA 4BRSA 1NU6A 4DLNA 2XUOA 3EIOA 4C4YA 4WFJA 1R1DA 2HA6A 4M0EA 3A2LA 4A5SA 4U2EA 2B9VA 5AOCA 1VXOA 1JMKC 1CUFA 4XX1A 2Z8ZA 2HA4A 1L7AA 1R9NA 3O4GA 1CUZA 2WFLA 4LYEA 1LBSA 2YYSA 4TGLA 3C43A 3ZV7A 2G5PA 1XQVA 2WTNA 2WU3A 1WPRA 1LPBB 1WB6A 2VTVA 5AK5A 2QOEA 1EDBA 4PNZA 5CXUA 2WUGA 3I6YA 2BAGA 2DSNA 4KE9A 4Q34A 4CFSA 3NUZA 4ARAA 3TRDA 4GEGA 4KRYA 3R41A 2X76A 5DNWA 3TGLA 1BE0A 1DX6A 1Q83A 4MYDA 4HVTA 2ZJ6A 3WKCA 1BEEA 2HA5A 3ED1A 4UPDA 5LZ2A 4BZZA 3F97A 1LPSA 1PFQA 3CN7A 4QEKA 5HCUA 5AKEA 3FYUA 1CUAA 5IKXA 4HXGA 1BROA 1VA4A 5I9IA 1M33A 4W9RA 5LKAA 3PUIA 4MEAA 4G1FA 5JIBA 4ZRDA 1ODCA 5CH8A 2HU5A 4WFKA 1CR6A 2HA3A 3A70A 5C81A 4CIBA 3EQ7A 2AXEA 3WIOA 4X7BA 4L72A 5AHXA 5AP9A 4BCCA 1ORVA 2HU7A 4DYHA 2XUKA 4EHBA 4Z49A 2K2QB 4EA6A 1QIKA 1HKHA 5JZBA 3G02A 1TAHA 3YASA 3FWHA 3C5VA 4KRXA
chains in the Genus database with same CATH superfamily
3ZLUA 1V43A 3WTBA 3AKDA 3EZ9A 1NMXA 3AB3A 4DOMA 5DW3A 3S99A 1Y8ZA 5J4YA 2HDWA 2QM7A 5JPIA 2JKVA 2Z08A 3KRTA 5DM1A 1USKA 4Y98A 1EB9A 3RLFA 2VHUA 4ARVA 4QICA 3MJRA 4TL8A 5EIEA 4CXMA 2ZAOA 5B64A 5JC1A 1FFAA 1MENA 4Z4IA 2PL1A 2G72A 3EVTA 3LOPA 4GX5A 4XB2A 2PKCA 4L16A 3Q8LA 1SZJG 3K1ZA 1LSOA 4OI2A 1GDTA 2C9CA 4IJVA 3QY9A 3CE6A 4PLGA 1RZRD 1SCUB 3H5VA 1LPAB 3BJZA 3IO5A 2UYGA 3KQWA 3A6JA 4LUCA 3VC3A 2JLBA 4AP6A 3HXPA 1UDCA 2XBUA 1IBMB 2C59A 4W7IA 5LQUA 2BPOA 2W0MA 2FZEA 2ZPUA 2DRIA 4MIOA 4F9FA 2B5VA 3W6PA 4UDXX 3MAGA 4ZYUA 4N5HX 2J6BA 2JAHA 2AEEA 4EGFA 1E18A 4MVJP 4OREX 2RGCA 3KV1A 2BJWA 3OCWA 4PQRA 2FQWA 4E30A 2Y66A 1J1IA 4HPJB 5H83A 2DVMA 1NN5A 5CFRA 5EHZA 1PK9A 4L07A 4R6WA 3G0GA 3PFIA 3FMPB 2G9VA 2R11A 3C5WP 5JD3A 3SR3A 4E11A 4DMMA 4IG4A 4KWHA 2AEFA 3GPBA 3MMNA 3NUQA 3PC6A 4EATA 4D02A 3N5CA 5ARDA 5JD6A 4LC9A 3QLJA 2VT2A 4HQFA 5BRJA 2OBLA 1Z7EA 3NJ4A 2ZR0A 1H5QA 1XT6A 4MAFA 2ZJ0A 4B47A 5LM3A 2MSCB 2V7GA 1E0JA 4RGYA 4FW8A 2JLRA 3RM3A 2HCBA 2ZBVA 5JEEA 3ZZUA 3EG9A 3KCNA 1T9ZA 1E2IA 4FZ5A 1XDZA 3NBUA 1GG2A 1UOEA 1XFAA 2UYQA 4PZYA 4O4LB 5HVNA 1Q15A 3WRXA 2QRMA 1Q7TA 4AMBA 1ODIA 2NXCA 1FL9A 1I2DA 1MOZA 1PGOA 2PTGA 4XR4A 2VAMA 1ATZA 1FJHA 4CEHB 2ENUA 2WAOA 2JPDA 2YHSA 3BDIA 2VJCA 4E4TA 1QB7A 1T13A 1GGNA 3ZBQA 4ZDIA 4X45A 4YQEA 1P1BA 2UAGA 4C4ZA 3R5KA 4HSEA 1XZAA 3DLTA 4HUQB 4QPNA 2C9ZA 2O8FB 4ITVA 2GUWA 4XAQA 2ZT7A 2XUZA 3K73O 4Z0PA 1RAFA 2BGMA 1MW9X 3AL3A 1U65A 3MF4A 1X7DA 3EQ9A 3VR6A 1KGDA 1SQFA 1XK6A 2Z09A 4MS4B 1J07A 1JQAA 4KMMA 5IFLA 1YZGA 4P98A 2NU9B 3SWWA 5CA1A 4MV5A 2XT9A 2XJ9A 2ZIWB 3UK1A 4Z8YA 1IN6A 1IHUA 2GBGA 3G1TA 3B51X 2AT1A 2F3UA 4A15A 2B34A 4DKXA 3C48A 5CM9C 3W8DA 4YRGA 1CVLA 4ZYTA 4GWLA 1GAWA 5FV4A 1A9PA 1AS2A 1VMDA 4OBEA 3GLSA 1JFSA 3QVKA 4C3UA 2C95A 1YR9A 1QMGA 2H2HA 2SNIE 3TW4A 1XNRB 1Y9AA 2AR7A 3NETA 4CM4A 2A0WA 4NABA 4H17A 2JGIA 3UC5A 1TLTA 2WB2A 1MB3A 4FGUA 1G20E 2BFCA 2C8JA 2IX9A 3FUUA 4NYMQ 1ARZA 1LBIA 2WHYA 3OA0A 2JLWA 1XZJA 4G81A 5AXDA 3F6SA 1CBUA 1CUIA 1P17A 3M89A 1DS6A 2DM6A 4FIDA 2VYQA 3WNZA 1WVGA 4C30A 4NOLA 2H4WA 2I4IA 3TNFA 5HM8A 3D54D 4INOA 3HVJA 5PNTA 3VPGA 1L5OA 4JEMA 2XKKA 5DTJA 4TYPA 3NVDA 5GONF 1GG5A 3C6YA 1VG1A 1YL6A 4KV7A 3QUBA 3V6MA 1NP3A 1WW2A 3LIIA 5L7WA 4PX5A 4CU2A 3DE0X 4LW8A 5H3CA 4MUYA 3ERCA 1C4OA 3FPHA 3QELB 4B6SA 1WOMA 1M6WA 2J0EA 4JYBA 4WZAB 3GARA 5FBZA 1FX0A 1JHXA 1X38A 4HLQB 1LA2A 4IUCS 1W5AA 1SU4A 3VZCA 4O4IA 3EGEA 3Q9NA 3E9CA 4HFJA 2OM6A 3OKPA 4V0NA 1PFYA 2V8OA 1NP7A 3VPBA 3HS3A 2X23A 3HTXA 5IDWA 3CEJA 3FAZA 3IBYA 1DAEA 4M36A 3RT9A 2C29D 4A4DA 1BKDR 4D8YA 3WADA 4ARIA 1PEYA 3HZHA 2QRVB 2FJUA 2G09A 2A86A 2GWHA 2VJNA 1WKBA 4FFWA 1CRWG 4B09A 1TKBA 1TDJA 4PIMA 2YN4A 1E1MA 5B37A 2JCVA 3B3QA 4F0JA 1JILA 2I7DA 1CRZA 5IEBA 2EZ9A 3Q72A 1GXSA 2NO5A 4WOKA 3S6JA 4BGVA 1V16A 1DI0A 1M6VA 4HT3B 3I53A 5CCXA 5TMPA 4IAOA 3DVAB 4EYQA 2BFDA 1RAGA 1SZDA 2WUVA 1ODTC 2NVUA 1J7KA 1HC7A 2QM0A 3GQBB 1YZUA 4JYPA 5E38A 4YQFA 3HKCB 3P2OA 2CF5A 3HBMA 2DPLA 2VRCD 3CG0A 1AURA 4GSLA 4ME6A 4HWRA 1IEQA 1Z5NA 3ETGA 4Y9DA 3DDHA 1P9OA 4I7EA 1XP8A 3FY4A 1MFPA 4OP1A 4NZPA 1R4NA 5GTDA 1NF3A 5DO9A 1MO4A 4M0LA 4IZ6A 5C1IA 4RA9B 4BFLA 4DQVA 3B8EA 5BXQC 4KFCA 1WZNA 2PH7A 4DRXA 5KYNA 2AG8A 2O2IA 1IWPB 4JI8B 4YP9A 2R7AA 1QO7A 3OECA 1JH9A 1U0NA 2PCJA 4FMBB 4ACAA 4EX6A 2OCDA 3TINA 1O57A 4PPFA 4GH5A 1AV6A 3NH6A 3E1GA 1Z3IX 2ZJ5A 2O2SA 3I83A 4JP1A 3JQQA 5GV7A 3QNUA 1BDHA 3P5SA 2EG5A 3GRFA 4ODIA 2B8WA 4MP6A 3FLAA 1VHTA 3W05A 1Q1GA 2ZBPA 2J41A 3NGMA 3BXOA 4QXPA 3JAMA 2NN3C 5ALQA 4MJ7A 3IPYA 5ELMA 4RIIA 1HG0A 4YPVA 4ZGGA 1CZNA 3CZAA 4X1YA 4NARA 3CNNA 4YDRA 5LWHA 3FFTA 3A11A 2D74A 3AP3A 3RWMB 4YI3A 3H1PA 3ABIA 4JAVC 1GHTA 2FPGA 3THXA 2ZYUX 1U1DA 5ITZB 1I7SB 1ZNWA 3E61A 4R69A 3U7RA 3IRUA 2CCGA 3A37A 2XVXA 3JD2A 4M1EA 3PUYA 3QWIA 4X20B 3TUJC 3MTAA 5JROA 1X86B 5LWQA 2ZRFA 1XDDA 2WHXA 4ZVRA 2YIDA 4OPMA 2XTMA 4PX2A 2OOSA 2OGWA 4ZT5A 4B3SB 1XCMA 1JQKA 3JYOA 3TGPA 4QBHA 4LMAA 1X1EA 4Z3KA 5HF6A 2YOHA 1HSZA 4FXOA 4NU5A 1R37A 4XQ9A 2BEVB 3ER6A 4NBWA 4HQNA 3NIDB 2O0MA 1NJGA 1G3IA 2Y71A 4A0HA 5JMWA 4WBSA 1VPWA 3T61A 5DLDA 5HOEA 1XHLA 5JFTA 2W37A 3ICOA 3KPWA 3K8ZA 2QTVA 3EWNA 5IDQA 1TZCA 4L8VA 5J5CA 3U5TA 1XCBA 1NNSA 1FRFS 1Q0LA 1DKPA 3EOBI 2CLHB 4JB2A 1EVZA 5K8IA 2PBZA 4IUDS 1DMRA 1FUIA 3M3DA 2OO7A 3IDOA 3R9IA 1H9CA 3ANMA 3I9JA 1YA8A 4MUAA 3IAEA 4MUGA 4M1ZA 3L1KA 3KSDO 3L7KA 3OJWA 4LVNA 1O08A 4WA7A 4ZC1A 1KWGA 1OFUX 2R751 2GH1A 1XJ5A 3GMDA 3G5TA 1QRAA 2H0RA 4UEWA 3NVMB 4OK6A 3NRCA 4IDCA 2OXEA 1H3EA 1LD3A 1XXHE 2REXB 4LDJA 4ZFNA 1Q7RA 3D8HA 4YCLA 4GPIB 1JHYA 4IKPA 3ER8A 1ND6A 2GPNA 4WBXC 3A4VA 3O3CA 1HPLA 3DMGA 3CO0S 2CT8A 5AHKA 3HWX1 4KBYA 4J16C 3DEHA 4CN9A 4ITRC 3OFVA 5IFKA 1WY5A 3VPAA 4JBLA 1E2LA 3HKDB 5HIMA 1EA7A 2PZKA 2VLIA 4KI7A 4XVCA 5BRAA 1WMDA 4I9GA 3O4VA 4M0CA 2QTRA 3WJAA 1AU9A 3L6DA 3GEDA 3RFXA 3SIWA 3A58B 1BFDA 1C5KA 1QGAA 2OD9A 2YYAA 3DC2A 4Q21A 5CLLA 1QP7A 3DNFA 3D5TA 5ARBA 5FB3A 1EHYA 1NW4A 3TOCA 5IARA 4Z3OA 1NUQA 4Y3UA 1J0AA 1LDMA 3DEFA 1VRWA 1U0BB 3DL4A 5J4KA 1J0DA 3BJRA 3RHTA 1PQYA 3HCOA 3MZ0A 5AK6A 1UWVA 3M34A 3N8NA 4RJIA 4BMPB 1UXHA 3FI9A 4XFKA 5BYAA 1X7XB 1GSAA 1CULC 2WM2A 5G0TA 3DR5A 4MTCA 1RC0A 5TNXA 3VGPA 4DMRA 1XIVA 1KSJA 2AG6A 4W99A 3EGDB 1P0IA 5AM2A 5FFNA 1I1OA 2WD7B 1XE3A 1XYGA 4K8RB 1QQAA 2PJRA 3T4XA 4BO0A 4RBNA 1S3FA 2HAEA 1LW6E 3PUHA 3A3PA 3PPXA 2J6HA 4PGFA 1E5DA 3QPDA 1Z4QA 3VO2A 2O1XA 4CG1A 8AT1A 4CN8A 2KSQA 4R41A 3M33A 1O0BA 4YLEA 2V98A 3RAJA 5JNWA 1TO1E 8ADHA 3IOMA 5DN6A 3VU1A 1NY6A 3C6ZA 5KZMB 2GAFA 2DFKB 3NOQA 3WC4A 3L8GA 4EF5A 1N7JA 3A6GA 1V8OA 4TQUS 3IR6A 5LPNA 1QG0A 3LVBA 3ICCA 5EWMA 2P67A 3DMPA 1QM5A 1ZH0A 5T8KA 2R47A 4Z51A 1Y3CE 2XQJA 3LX8A 2DE0X 5E6RA 1T26A 2LKDA 2GBIA 3RBVA 1GPBA 3VDNB 3VH2A 1IB0A 2I6SA 4CPDA 3S8YA 1I9CA 2EKLA 2QMYA 2Q5CA 3PXAA 1OBHA 4EQ6A 1N6LA 5F5LA 3O84A 3UG7A 4OEHA 4DM7A 4UVGA 1MO3A 2IW1A 3UMMA 3ZE2B 5CA1F 1V2GA 1NDHA 2PZAA 2QMEA 4RF3A 5TGZA 1NUPA 4JLJA 3V48A 2GASA 2V9CA 4US0R 4I66A 4BBZA 2VDNB 2NIPA 3ZWQA 4BGUA 2V1XA 7GPBA 3QE0A 1VIAA 5EZYA 4I14A 3UW1A 3L18A 3RU2A 2DLDA 2WJHA 4REMA 3B7WA 2ZWOA 3QKRA 4PLFA 4YROA 3BREA 1FDWA 5DDIP 5A5FA 3ZWOA 4YAFA 2BFFB 1FX1A 5KWJA 3CUTA 1JLHA 1XZIA 4LYFA 4NBUA 2ZLBA 4YMHA 4RTMA 1U0RA 2IS1A 4B0OA 3R4CA 1YCFA 3OOWA 3BMQB 4TL9A 1LB1B 1M2NA 3MTQA 3TL6A 3WV4A 1PFKA 2JJQA 1NW5A 2BTQB 2C9BA 2ZSBA 3GAAA 5FNVF 3BK1A 3IKLA 1KSGA 3ZI4A 4LHWA 3BFPA 5KTMA 4E70A 3MIZA 4YMTA 3D6UA 4I5FA 2O8DA 5LQKA 2IPMA 3C6XA 2BMWA 1GWNA 4R8RA 3AX6A 1PJ4A 2PKXA 4RJ2A 4A9AA 1NQWA 3PP8A 4DV1B 3W9BA 5H81A 5CUQA 3PUWA 4Q82A 2ORWA 2I2DA 1KOJA 2R6R1 4MRMB 4BFXA 3DOHA 3IV6A 3R7AA 1TGVA 2ID7A 1EFRA 3SYRA 1XEFA 2PUBA 2ZZMA 2VUHB 5J23A 3FIJA 3DP7A 2XXAA 2ZAIA 1TL7C 1PEAA 1FXUA 1FQKA 3N6VA 2JGJA 4KWEA 1QK5A 4UCXA 3IV7A 2GESA 4PQEA 1QAQA 2J0UB 1CG6A 4QHTA 4EYSA 2JGRA 3GP3A 1MJGM 2WJJA 4O4IF 2YW2A 4MQMA 4TQAA 1RCTE 2P77A 3D7KA 1P7YA 2QRKA 3O2QB 4KFUA 4TXNA 3U3KA 2O5EA 2O5RA 3AHDA 2QTCA 1E0AA 1SXJD 3L8YA 3LOUA 1Q91A 4RMIA 5DV9A 2QVCA 2PJDA 3DEZA 5FA8A 3NYWA 2A9QA 3IMEA 4B3JA 3OEHD 3O9VA 1X8LA 2M1ZA 1KBZA 5CJPA 2Q4OA 1GPNA 4R2IA 4DNXA 1GLVA 4LISA 4DPMA 1C30B 3I4CA 5T3YA 4WW0A 1QGOA 4ZOEA 2DEUA 1MH1A 2H06A 2HYDA 2G0NA 4IHKA 2I71A 4DIUA 8MHTA 4MVJE 3UYKA 1SVLA 4KSYA 1VLMA 1QIHA 1QP8A 1WDTA 1G18A 1JQBA 2CE7A 1Z33A 1Q19A 2VP2A 2Z5VA 2WM9B 3M6XA 5FTNA 1T2AA 2A58A 1D4AA 3MXOA 3OT1A 1N2CA 3L84A 3JS5A 1BG6A 2A92A 2PZJA 4IFIA 3RANA 3L9WA 3ZHVA 1D5CA 1K0UA 3NBKA 3GLHA 3P2JA 2AQIA 2Q5IA 2ZUFA 1SUPA 1ZN9A 1D9XA 1XMQB 5DVZA 3GEBA 3SSAA 3M1YA 4TLBA 2YKGA 1WPXA 3RWBA 3STYA 4PLYA 4N0PA 3DULA 4ABYA 2P9BA 2PLNA 1AO0A 3WGIA 3GG9A 2C3OA 1TYDE 1VE7A 1SD1A 2WKQA 3JZDA 4UUPA 4EH1A 4DCTA 4UNPA 2JGNA 3JRXA 4LOHA 5AXCA 3QEMB 3SHFA 4ESEA 2B4TO 2Q3EA 2JJ2D 1EFUA 1KRXA 1VKOA 4RVFA 4CMAA 1QGZA 3GRKA 3GJRA 4I55B 3CC8A 1E79D 5FADA 4QECA 5ITWA 2H6EA 3DMDA 3KHKA 5ESDA 2ZBGA 1YJXA 1J20A 5K05A 3N75A 4RWZA 4EUNA 4CL3A 4FMDF 5EIOA 5LDGA 4KX3A 2D13A 4EHHA 2QG9A 3M82A 3BGWA 1J9ZA 2RD2A 3TZKA 4N12A 3OIVA 1T8TA 2GBLA 3WIEA 2QVXX 5BORA 2NP6A 3ABRB 2ZE5A 3MBOA 3W5HA 4DFDA 3D31A 3FH0A 3KQKA 1LW7A 3CX4A 2CBXA 4H1UA 1R2QA 3PUKA 3T0GA 2QU8A 4C6TA 1YOVB 3BICA 4WFIA 3DMYA 4AUNA 4PRLA 3JARB 1A5AB 5BN3B 1UBTS 3DEIA 4F7DA 2A5LA 3DT8A 1QYXA 5ED0A 3KZNA 3FSEA 3K53A 4QBGB 2C7VA 3AO0B 4LXGA 3O1LA 3QXGA 1YI0A 1NRIA 4NAHA 1CJKC 1U3CA 2P7HA 2POQX 4PLTA 4UFPA 4QPJC 4DR5B 1ZIYA 1LWNA 4RKEA 3MWDB 2GM5A 1GR0A 2GJ4A 1QHIA 5I9TA 3VHQA 1DV1A 2BY4A 1S89A 3IODA 4XARA 1X77A 3R1IA 2NPFA 3RJTA 5AUOB 3V8BA 3CF4A 1H8HD 4WIAA 1SKMA 1PGJA 2AN4A 1I0ZA 4P0PB 1EP9A 3B1FA 2E4ZA 4AL4A 3ZDCA 1FFXB 3HUTA 1ULAA 2H07A 3DA8A 4L5BA 1B42A 3HLYA 1X1SA 2AKYA 5GJWC 3LKZA 5FUMA 4KUHA 5JQWA 1IWOA 5ALEA 2VFAA 3RLIA 1B15A 5C1BA 2J0QA 2W2KA 1PJTA 3I5YA 3HA7A 4FJ1A 5EVCA 3DCYA 5LKAA 5LMUB 3M6UA 4HNSA 3ESRA 1JFFA 1Q7GA 2FWPA 3GFOA 2OHJA 3B5IA 2PY6A 1CWUA 2P41A 5A3QA 3R3YA 1QYDA 3LPAA 2G9UA 4PLWA 2M98A 5K3DA 4MWBA 3U62A 5CB8A 1RMTA 1QH8A 5F51A 5EKDA 3PXDA 3RT1A 4D0GA 5C8YB 1FW8A 1T9AA 3LE8A 5ER6A 3RG8A 5EKXA 4UTRA 5AJVB 1NVXQ 1XLUA 3MTJA 1H2FA 2X6TA 3F5DA 3L8HA 4UUNA 4BFYA 1BYIA 1SKYE 3LGAA 3FTNA 3FKJA 2GR9A 4CT5A 5KMGA 2HD4A 1WY7A 2Y05A 4OIFA 5GMOA 1OXBB 5LYJB 4KAXA 2G63A 2W7TA 3BGOS 1R6UA 4L57A 3P20A 4XDYA 4D0NA 2NM0A 4A8JA 1G3UA 4RVUA 3MHPA 4IVNA 2IYYA 4HOYA 4KNYA 3QVSA 2FSFA 4RLHA 1QG2A 2JFFA 3ZWCA 4DDHA 3G23A 2XHEA 4O4JB 3ZDRA 1TKRA 1JZQA 3OCXA 2G67A 5DEIA 4QQRA 4E5VA 5MGBA 1SU7A 1T91A 3BVPA 5CFLA 3VSCA 4B3TB 2IS6A 5SYMA 4N48A 3WK6A 1V5FA 2ZE8A 4OHUA 3EVCA 2Q46A 4DLTA 3MPUA 4JBNA 4O29A 4YN3A 4JJAA 2P9CA 5FEMA 4D4IA 4PXYA 5B7QA 1QZZA 2NX2A 2ZYGA 2O1EA 3ORQA 3QI7A 3THWA 1PS9A 3EGVA 4R9NA 2FF7A 3ODPA 4ZA2A 1PJSA 3ELUA 3RPEA 3D2BA 3ESBA 3ZXXA 3VKHA 1II8A 1CZKA 4DCVA 1INLA 3H8SA 5LXTB 2B35A 4QD3A 4CM9D 3GRZA 3S4YA 3UK7A 1Z5ZA 5IJ0B 1K86A 3KXLA 3V6LA 1UBUS 1JVNA 1FK8A 3N53A 5DGDA 4NYJR 1L4UA 5KPJA 2XCQA 2FMKA 5F3WB 3VHRA 4D74A 2PMDA 1VE5A 1DPFA 4O2RA 4NYIR 3W2HA 4D7AA 4YQYA 1ELOA 4MVJM 3SXUA 2VTBB 4Y9RA 1SIWA 4OB8A 2FZKA 1LBHA 1MA3A 3FPJA 4JODA 4KVZA 3R9KA 3IAHA 4KXFB 1SKQA 3NAGA 3SVZA 1D04A 3GMTA 4FOTA 1YBVA 2IOFA 2J67A 1MC1A 4P3KA 1I1HA 3RB8A 4BZQA 1N2HA 4ETIA 5KYXB 3AB7A 4LNUA 4B7CA 1QGYA 3BX1A 2IDKA 3Q5DA 1HDRA 3BWCA 4JP3A 4DREA 1WKVA 2WAMA 3GFFA 1E8NA 1OLUA 3AEYA 3FOAA 3LT0A 3P45A 5EZYF 2ZITA 4L8FA 2RGNA 2BBWA 3RFTA 1EBUA 1CUCA 1WXFA 2CXTA 2DPXA 2MYUA 4QEZA 4S24A 2ROQA 4H6WA 4KXQA 1DC7A 2C4MA 1TM7E 4MS1B 2CWWA 3I3OA 2VPXA 3KJQA 2HNKA 4ITUA 5AM1A 4D97A 1BVYF 4UU7A 2X0IA 1U3WA 3AR3A 3IVCA 2XVZA 4F12A 5LMNB 1SXGA 4IYJA 4P33A 4HDMA 4ZDJA 2PMBA 3FZGA 4TVBA 2QLNA 1A69A 1XKLA 4ZXPA 1HEYA 3RIYA 3ZH2A 4YH1A 5F1YA 1XV5A 1QO9A 3L4SO 3OEEA 2GJKA 2GRAA 3AZOA 2G1PA 2BMEA 5EMLA 2FHPA 1L5GB 4AWAA 1V48A 1NG1A 5CM2Z 4ZO4A 1D09A 2YQ5A 1RHQA 2BONA 4JUCA 2IPLA 3LH5A 3DE3X 4GUAA 1UPUA 4LS3A 4J3NA 4RZSA 2VJPA 4KACA 2IYXA 1O58A 3A4NA 1TTHA 3KKQA 4BVJA 2MSLA 3ASUA 2O5CA 3T9AA 5HPYB 4GIBA 3L1HA 1G55A 2VF4X 4I50B 1SVIA 1QIGA 5D1NA 1K8ZB 4NF2A 2H2AA 1AZWA 4UBMA 1R7RA 4ZEXA 3W6NA 4F4CA 3GJ5A 3GLFE 3LF2A 3COPA 3SHOA 1X7YB 4MXDA 1Q22A 2KYRA 2NZWA 3GJSA 5EEGA 2GM3A 2EJUA 2I4MA 1PZNA 2C0QA 4MRPA 4OD0A 4Y2SA 1KHHA 1CUSA 1P3Y1 1H6CA 1EBBA 3VYVA 4L73A 3KFXA 2RAUA 4D9MA 1EX6A 4JT2A 3ZUGA 1TFUA 1XZ8A 3LKVA 3IPLA 3L9XA 2YCLA 4M8SA 5TGTA 1CCWA 4MLPA 1JDSA 5IYZB 2B3DA 4JSTA 3D6VA 4BJ1A 3X2EA 1RVV1 4ER7A 2X41A 3DEJA 2GXAA 2P79A 3QKSB 3VPFA 1YRHA 1ULHA 2VEDA 2HJWA 3H5LA 1I51A 4CIDA 3C8HA 3TLGB 1GGHA 2RGAA 5FBQB 1J2JA 2AJLI 4X6YA 1KMHA 3VSDA 5FH9A 4A10A 3CH4B 4I5DA 4FFMA 1Q0UA 3H0EA 5CTAA 4HGOA 5CIQA 3CJQA 4MWEA 5BUQA 4R2WA 5BSMA 2DPMA 5CNIA 2HU2A 3U1TA 3BPSA 4TYWA 5K3AA 1BDMA 1V26A 2QRJA 4IO1A 2WZCA 2CMKA 4C4OA 1TLLA 1JX6A 3AT1A 1M2OA 4M2LA 4M76B 3SQDA 5A6SB 3W3ZB 4JDUA 4Y2VA 2AWNA 1QFJA 3G17A 3JQ7B 4LKRA 3VH1A 2W2NA 4X3CA 3OCUA 4YXWD 5ICSA 4BBAA 1UC5B 3SJ7A 2NYRA 4QYSA 1YQEA 4OQQA 1DIOB 4BEBA 4CQMB 2CVOA 2P5UA 4DTCA 5KHOC 3OOJA 3STWA 1N8SA 1R74A 2NO4A 3EVBA 5FEUA 3H2ZA 4JSRA 4DJJA 1WXWA 2Z5GA 3UZUA 1RRPA 3FSGA 4G4IA 3UBMA 3GA0A 1TTPB 1HRDA 1JFRA 2DTDA 3FVVA 2MJLA 1YMQA 2AS0A 3ROEA 1RWOA 2FWRA 1I1QB 4OA8A 1LDGA 4JI6B 2OCAA 3JXEA 1V47A 1BCRB 4R8VA 3WDLA 3LCJA 1V1RA 3PYLA 4TMYA 3OMLA 1UEIA 2G82A 4UNQA 2XZTA 4WXPA 5J58A 1FU7A 3D0RA 4OJTA 1S2OA 4C4PA 3K2EA 4ZT7A 4OA5A 4KRFA 1N2IA 3IP7A 4E88A 5JUWA 3AY0A 3JYLA 5CDTA 3HU3A 5TR9A 1JDUA 1SU8A 2ZXFA 3USZA 2IYZA 1CVIA 2ZYIA 3I8XA 4IHJB 4NH0A 2PGXA 4JFAA 4LRTB 1GSOA 4X1IA 4G5RA 3R9XA 4KYVA 3P27A 3PWSA 5DYIA 4QBTA 1SU6A 2HJ9A 3FTEA 1NVDA 3WK4A 1J8DA 1RBQA 3JWJA 4TWZA 3KKEA 4OBBA 1BO6A 5JDCC 1RQ7A 2PX2A 3CMMA 3QF4B 4D92A 4ZU1X 3TLAA 4C22A 1I94B 3DHYA 3HXLA 4NOJA 2LTAA 1H05A 4QTZA 5JCZA 2NUBA 3L1VA 4UDNA 2GEJA 4RETA 5FTLA 2DR0A 1QVZA 3EY4A 1JV2B 4JGBA 2WG1A 2AW3A 5HBRA 2C7RA 1OYOA 2NAFA 4DV5B 1R5OA 1UDXA 4JL6A 4L5AA 2HQRA 4WY5A 1PZFA 1JBQA 3JYPA 2ATCA 2FUG6 3NCHA 2XNHA 2A0YA 4MV0A 5T6BA 2CLEB 2WYWA 3L8MA 1NP6A 3U1VA 1D0SA 5T5QA 3AOGA 3B89A 1Z29A 3G3EA 4G3XA 2ECKA 2XVAA 4Q7JB 3HB5X 1R00A 4FYMA 5HUJA 1V7CA 3GHYA 2VF5X 3OZWA 1LBQA 3PGA1 4H3HB 4Q4CA 3OE1A 2P27A 5FUBA 4ZJPA 3F90A 2IWHA 4RJLA 3ORSA 5CT8A 3DKPA 3R0IA 3R5HA 4N0EA 1W8DA 3KLOA 3ZBUA 2DECA 2BMJA 3PXEA 5T3UA 1NF2A 1DU4A 1VLQA 1OXSC 1DWPA 2Y1GA 3G6KA 5G4KB 4C06A 2P2GA 5H9WA 3M3PA 2PRKA 5I9NA 4MRAA 1OXUA 4JZKA 3K94A 1MJNA 2PMKA 4HG2A 4F92B 1XQWA 2JGMA 2QUHA 2WF5A 3T1VA 4K9RA 4O4HA 1U1EA 2Q1TA 4PX3A 1N77A 1OHHD 1M67A 5AXBA 3JQAB 3P4UA 5C7IO 2FN3A 3HXKA 4DDUA 1JEOA 4GYJA 2W83A 3C5HA 2FMHA 4AUKA 4XDZA 1P33A 2VWQA 4L0CA 3EVAA 5F76A 1PVOA 5AMXA 1BFKA 4WACA 3T7DA 3QVMA 5A9TA 1PRYA 1TU4A 2M6RA 3GWZA 4DLLA 4FWBA 3JVUA 1U6KA 3O0TA 1U2SA 2A5JA 2Q29A 4M86A 4B3GA 2Q1UA 4HV4A 1E8MA 1WSAA 2CXXA 2OCYC 1M7BA 4DARA 4EA9A 4ER3A 2ZPTX 4X41A 4BWYA 2JGLA 2VAWA 3DD1A 3INNA 2AVDA 3LQYA 3O1JC 1GG9A 4P7FA 3FSRA 4QAQA 4RHXA 3QWBA 3EPRA 1GN8A 2VJKA 1R64A 2IS2A 4KPUA 1I7PA 4W6ZA 4KXLA 7YASA 4MWSA 4QXOA 4CI0B 2ZUDA 4EMSA 3TAUA 3K3PA 1LTHR 1GU0A 3PSAA 1Z25A 3TB6A 3ZHYA 3SC3A 4EEZA 5IC5A 4AO8A 4ENTA 3KSUA 1PWYE 3NPMA 4OK5A 4EJ2A 4K3UA 3C1UA 4RPKA 2EZ4A 3K0FA 2GO1A 3NAZA 2IU0A 2QG6A 3BJEA 2ZSHA 5HK9A 1SBZA 4FGSA 5T64A 3ZDAA 1BWPA 2F1RA 1HX7A 2FZVA 1BRMA 3EXIA 3F46A 4GZ6A 2ZU0C 5AHOA 3OCCA 3OT4A 5G53C 3HJUA 3ESXA 4GMDA 2FLVA 3BC1A 4CQLA 3ZHCA 4LYHA 4M88A 5K09A 3U17A 4D44A 4NBLA 1XNGA 3BXZA 3LUFA 3RUHA 5EE3A 1GKYA 1X1DA 2JI9A 5DX1A 2WJWA 2R8EA 2FFQA 3WL5A 5JRDS 3KQMA 1PFWA 5CLHA 1LRKA 3MS7A 4J7UA 2SCUB 3UMFA 5LZ9A 4M1TA 3IMKA 3WAJA 1JG6A 1BAPA 1W7AA 3H6KA 1YJQA 3I9NA 4J9VA 3PDCA 4KC0A 3CVUA 3QUSA 2LP4Y 2KW5A 3EB9A 1XU7A 1WZUA 3DHNA 2JCBA 4OV6B 3LQKA 4OH7A 2PBFA 3AKEA 4JOCA 2RJOA 3M4JA 2IUUA 1HLFA 2JAUA 3L8DA 1GY8A 3JZAA 4Y1RA 3DG9A 5DCLA 4NZNA 5DI9A 4BMNA 5L3QB 1E62A 2B69A 3B2NA 3JATB 3DAYA 2VT6A 3FOEC 2R6ZA 1UXGA 2RJNA 1C7JA 3GRVA 3KEGA 4M6WB 3JPWA 2DU8A 2F9MA 3E9QA 3I9MA 3ILSA 4IWYA 4KKVA 4CIWA 2R2GA 4RD3A 1ORRA 3JCZA 4YS6A 1H66A 1XZBA 3LW8A 1NNI1 1N0UA 1GQFA 3QPUA 1G5RA 3OOSA 4RENA 3WKAA 5AJUA 5AI0A 5AVUA 4XWKA 2IL1A 4P7BA 2XITA 2GYUA 4AG3A 1N5OX 3HDVA 2RHGB 1LC0A 2IYOA 4CKBA 3R7WB 2DT5A 1VLVA 4DUGA 3M2TA 1J33A 3B70A 4KXNA 1NW7A 4I6GA 1NVTA 1C9DB 1RI3A 2DUMA 2W2PA 3TXXA 4V1CA 1XSEA 2ZTSA 3PQ6A 3G2QA 2XMPA 1REQB 3P8ZA 3S0JA 3A9CA 2WWFA 1CYDA 1KORA 4QYXA 3X1XA 1X9IA 8OHMA 3D2AA 4Q4DA 1NV9A 4RSGA 3SC4A 1BMDA 3TLMA 3VU9B 2BGUA 3QPBA 4OM8A 1Y4UA 3E22A 4PZUA 2O8BB 3FJOA 1TYCA 3WS7A 1TMKA 2DJ5A 5F2OA 3BKWA 3MYRA 1AUQA 3C4QA 1DFIA 1GZSA 4IBOA 2V58A 3IP6A 2DJIA 4HQ0A 1JPNA 4DMKA 2WV9A 4NS1A 2Y1XA 1E5QA 5HWSA 2IBTA 3IHKA 4AUMA 1PZGA 3MUOA 4BGIA 1Z22A 2C07A 4KPGA 3O03A 2G9QA 4KREA 1OYWA 3CZ9A 5K4GA 2P8SA 3VHXA 4PYOA 4ZOAA 3V1LA 1IM8A 3T1YB 1IAQA 1QUEA 2GXQA 2OBNA 4XYLA 2A0FA 3A3YA 4I1YA 4MQFA 3U09A 5HJ2A 3CLRD 1J8VA 1Z73A 1W59A 1N9ZA 1RHJA 2JFUA 2WIFA 1A50B 3BD7A 2WSSA 3IPRA 3KNZA 4OGKA 2A9KA 4BV3A 3CVYA 3RHZA 1DTWB 2C0CA 3KZXA 3PUVA 2GEUA 5K8LA 2ZKLA 2VYVD 3BFVA 3G2MA 1BHJA 3EZNA 5FUQA 1XRMA 2FVYA 2NO6A 2Y6UA 1XCGB 2PQ2A 1AQ6A 3G8CA 5HK8A 1L4YA 1T8UA 5L53A 1F8UA 3PE3A 3DLHA 1UPCA 2IYVA 3K32A 1ZFNA 4NBVA 4RTQA 1DJQA 3KYCB 4BNZA 4FMCF 3T6KA 2I76A 2RKBA 3ZIAA 3ORYA 2WU0A 3DJYA 1VLJA 3LI2A 4OHPA 3CUWA 1EDDA 1C14A 1XI2A 2Z6AA 3ZBPA 4D56A 4TMTA 4YRNA 3GJZA 4NZYA 5ALZA 2YWHA 4AC9A 2ZI9A 1G5TA 3DHWC 1Y4DE 2JAQA 1PBTA 1ZUIA 2X7XA 4BQQA 2UYOA 3LS2A 1B23P 1WEKA 2BJHA 4K2HA 2D1TA 3ZWMA 1BGWA 3DMRA 4TLMB 4A0RA 4ZOQI 1H6AA 1DCTA 1XXLA 4HYEA 1XTIA 3KHTA 1JI0A 2GBCA 4XGQA 3LAWA 4EYKA 2KPOA 3QW2A 4OJKA 2R87A 4PWYA 1HRKA 3ZCSA 1U3GA 4OJMX 3U3ZA 4WCDA 1FSFA 2W6ZA 2XGGA 4OHRA 4H1WA 2YMPA 4E31A 2FW9A 2QGFA 3M83A 1U28C 4GOXA 2JW5A 3VPSA 4BV8A 4NATA 1VL8A 4RV5A 1T3HA 3BZUA 1IJBA 1AQIA 3DOUA 1BFUA 2YZ7A 3Q0EA 4R1QA 1HOTA 3LL4A 3GFBA 5B30A 1N8NA 1XD2B 2ZRDA 3NWJA 3NATA 2AG1A 3U7HB 2MR5A 4G5XA 1QRUA 2X8WA 1Y9DA 2J9GA 4AJIA 1CQWA 2C9MA 2CBZA 1XDSA 2EFDB 2OQRA 1ZCZA 1LI4A 2C00A 4L50A 1ESNA 4RH0A 5T57A 2Y1LA 1OFIA 5AM5A 4X00A 5A4JA 1ZRHA 2QZJA 2RGGA 3DOIA 2ZROA 1WDLA 4W1PA 3N76A 1IXRC 3CISA 1JSLA 2RHJA 3PGKA 4HK4A 1C3VA 3IHWA 3QU2A 4IOJA 4MQBA 1TAGA 1GQQA 2HLHA 2O9JA 3LMKA 2C5EA 2EZ8A 3O83A 3TW0A 4AJ1A 4JS0A 1I2ZA 4HVAA 4F5WA 5DHFA 3MMZA 3NWEA 5LB2A 3RKSA 3SI7A 1WXGA 3V4FA 1ZHOA 2IHYA 3PJDA 3QNMA 4UPVA 3FR7A 2MCFA 3HXQA 2DQYA 5CXQA 3AI3A 3G5MA 3HN6A 2PBLA 4K28A 5EJ6A 2HH9A 4ZTUB 5JRZA 2L42A 1SCJA 3H2SA 4XQCA 4JC8A 4G26A 4MGEA 1E1QD 4MKXA 1DAGA 2AFIA 1YBFA 2CNOA 1CJTC 2WZBA 3IAM1 4Y6GB 5DBGA 4XPIB 3KQLA 4Q9NA 1PP4A 4P0TA 2J32A 4CMEA 3FUWA 4CCAA 3H5RA 1SC1A 5ED4A 1YJAA 3IEMA 3GUCA 1JR6A 5G1NA 4Y2HA 3TZQA 3WMFA 2DUUA 5G0WA 1JLKA 1PL8A 4QUIA 3MMSA 4DA7A 1OVGA 4X0EA 4B44A 3WWEA 5CG1A 5DT2A 4IDOA 3L4JA 1Z4IA 2PL5A 3N8GA 3PQ4A 3LVFO 4GYWA 1R6XA 4MB0A 2J6IA 3K6JA 4BE7B 2CVPA 2DR3A 3D0KA 3KQQA 2J9FB 4D8TA 1I8TA 2ZJFA 4EMUA 2P9YA 5T67A 1WSBA 2WYOA 3MCAA 2CFSA 5BVHA 4Z4GA 1MC4A 3F3MA 4LMPA 1N9KA 5EERA 1V1MA 4IQ0A 4H3VA 4TTTS 4KJZA 4A6EA 1L7EA 1C3XA 3GA5A 5FOUA 2D1YA 1CJCA 2G5TA 1UBSB 2VXBA 2JFQA 1ZINA 4H6XA 2XNJA 4QO7A 1YS1X 3EMDA 3A0RB 3IDAA 4P5DA 2ATXA 3DDNA 4FDVA 5LZ8A 4FTWA 3LY5A 3MA0A 2C2GA 3W5DA 1SUDA 3DBIA 2IIPA 1APBA 3B85A 3P9ZA 1U8TA 1UWCA 4FE4A 4EDHA 4RUKA 1P4JA 3KYIB 2XUPA 4MWTA 3HRIA 1N2OA 2J6CA 4QTXA 1V8PA 1ZCFA 2KHZA 1OT3A 3F8WA 2QLJA 4UMEA 2VJAA 3SBEA 2NZ2A 1OIVA 3L06A 5FR2A 4BWFB 4D5GA 3GLIB 1YFLA 2O8CA 1ZG3A 4HNAA 1T3ZA 4DLRA 1QBGA 1UEXC 1XVAA 2OGZA 4I9NA 4EI8A 4Y7DA 3E4DA 5K0JA 2OXFA 3VSBA 4JJEA 4URXR 1GUYA 3UKDA 3LM8A 3U6BA 3I0ZA 1NUSA 4MB2A 4QVGA 4DMLA 5LQDA 3TBFA 2V1UA 3WV5A 5BQ3A 1QO0D 1PJCA 1T8YA 4LDAA 4ZAYA 4EY8A 1AE1A 4YR7A 2D2FA 3N9IA 4B3HA 3K16A 4MPTA 3GYBA 1DOZA 2OKGA 4XUDA 4CR7A 2H2GA 3ZE1B 4FQ5A 1OBOA 3O93A 3L7OA 4H3KB 1GPDG 4O2BA 4X60A 2ZYHA 5EQTA 1X8KA 1FQJA 4UU8A 1SMKA 3E03A 3W5UA 4BKQA 4BLUA 1V96A 3SX2A 3BF7A 4UBKA 1ZH4A 1JVSA 3ECAA 4EGCB 3D8RA 2JFVA 4L0DA 4D4KA 1M8JA 3T1QA 4MZDA 5E3IA 1Y0BA 5J5VA 2K7FA 1WTAA 2EAUA 5L3SA 1SHKA 3TOZA 2Q6KA 3GN2A 1T5SA 3M0EA 5AUQA 2N1BA 4PM4A 2ZUTA 4G41A 3CIFA 1SIOA 5IUJC 2P1DA 3RRMA 2QXUA 1RLTA 2X0FA 3V3TA 2HDHA 2WC1A 4U63A 3SC6A 4MCAA 4P8RA 4WK0B 3KZMA 1AT1A 3GOHA 1K4MA 4LE1A 5YASA 1YBAA 4YTEA 2HV9A 1TUGA 4A0GA 1BH6A 3MWGA 4LBZA 1A98A 4WKCA 2CFCA 3OQBA 5DM60 1O0CA 1QNLA 1N0VC 1C7FA 3FN4A 2WF6A 5DBOA 1PQWA 3OIYA 1BDJA 3PTAA 1YOBA 4FNAA 1JIXA 4K6CA 3R6WA 3RT7A 3CONA 3T7IA 1JRLA 4Y0AA 1VECA 3NWPA 2IYSA 1M72A 4GZLA 3D7NA 3R3SA 4GE0A 1E3EA 4NJEB 5KB3A 3EH1A 2BFPA 4EW1A 1DV2A 1Z7BA 4KO3S 4GF5A 4PHFA 1P1HA 4BN5A 2RIPA 3SMQA 1NJ5A 3FRHA 3AF1A 3K9WA 2P69A 4CIYA 1LI5A 2RH4A 3DKKA 2IDZA 2GAAA 3BMNA 4XSGA 2YXEA 4KGXA 4Y67A 2R1VB 4ND8A 2A35A 1SIBE 1THMA 3ESZA 3W4IA 2R85A 4N82A 1P5FA 4QG3A 4LTMA 3K71B 1TMOA 1O96A 1C9EA 3ESAA 1N3YA 3M5WA 4FFPA 4H35A 2GD0A 3CWCA 4CTJA 2CXOA 1FLNA 3EC7A 3NKVA 2WR8A 2JDID 2OCGA 3K09C 4QT0A 3QLUA 3ONWA 1G21A 3EZFA 1E9SA 3LPNA 2VTBA 1Q1AA 2VYND 3FA2A 4GSYA 3IP8A 4XCVA 3BRCA 4GM1A 3TXAA 4RV9A 2CLIB 2Y1FA 1AIPA 4UE6A 3QU7A 2FKNA 4O6VA 1XAGA 3OPYA 4GMHA 1M0WA 3O4JA 5CDUA 3OP1A 4RGVA 4MHOA 4J2OA 1D1QA 4PTLA 2J9YB 1OFHA 3EQ8A 4I1IA 4F3CA 4LX0A 2ZIEA 1IMJA 3ZCRA 2C1XA 5ITVA 4ENWA 4DCCA 1SB9A 3OAAD 4OBXA 3MINA 1HMYA 2DY0A 2QX4A 4JROA 3I6QA 1J99A 1J8MF 5AJTA 2M2IA 2DHDA 3EGWA 4MUHA 4G5FA 1VBKA 4PPNA 9ABPA 4AMYA 3EXFB 2CV2A 1U2DC 4HEA6 3MS4A 1S2IA 2OCBA 3OM1A 1T9CA 3EGOA 1L4BA 4AF6A 5LMZA 1GA4A 2JHGA 3L41A 4DT1B 3B6IA 5JSFA 2QE6A 3E8XA 3IELA 3VOAA 2WE8A 4DQLA 5HW0A 4GNKA 4WKBA 1B4DA 3IQGX 1B7GO 1LSJA 2P8JA 3AFHA 4EJ6A 1N32B 2R25B 3GPCA 3GLHE 1QYCA 3IOCA 3RTBA 4JHXA 1WCIB 3NQ41 4BQSA 1X0VA 3D9QX 2IK8A 1PJRA 2QQFA 2C4HA 1WMAA 2DHCA 4XWTA 4XCQA 3U44B 2RB5A 2UUOA 3MSCA 4FLEA 5CFOA 3D4OA 2IZ5A 4AICA 3V8PA 2MSEB 3JVVA 3EA5A 5EA2A 3G82C 3JQ8A 1OOEA 1A7AA 1SKBA 4KO4S 5FAKA 3QWHA 4H27A 2HMVA 2VJLA 1LZKA 3AIIA 3S2FA 3ETCA 1ZONA 1VIDA 5AVTA 2H00A 2YXLA 4WE3A 3O4IA 4HLDA 3TQSA 4L2IA 4F4HA 3CUSA 2FEKA 3I45A 5ALXA 3TEFA 4R3NA 4XWWA 2BFOA 1VYVA 1NQOA 3VKWA 1G8GA 3H04A 2EFHB 5GOZA 1PN3A 2BRUC 3L77A 1E2JA 5KINB 5CU7A 3TLXA 2GZAA 1DADA 1RM0A 2Z2JA 1XZPA 2QIOA 1ENPA 2CXNA 4RVDA 5CEJA 1Y3IA 1X80A 1UCFA 4F2HA 1C81A 1JJIA 3D6AA 2FPIB 1JHDA 3A04A 4MA4A 3KHSA 1GILA 1RRGA 3E1SA 1JHAA 3C1AA 1DC4A 4NCIA 1DJOA 2O0JA 2ID4A 1QIDA 5WRFA 1GAEO 4GNRA 3TLJA 1VCIA 1JIVA 4CMIB 1QVWA 3QOFA 4NMHA 4CTKA 3SKYA 3ZKAA 1U2GC 2WG2A 1GCUA 4N5MA 3WKBA 1BX1A 1COWA 2IHKA 4XLZA 5KTOA 1JIJA 3FG9A 3HFGA 3DWGA 2ODPA 2BVNA 4ARUA 1YZLA 4JGGA 2QW8A 5EXXA 4Y9UA 4GGPA 2W6PA 5D01A 1XVUA 3FUTA 1MOQA 5IAAA 1NNEA 3FNQA 3V1TC 2HV8A 1KDOA 2IYUA 1Z6PA 4HN4B 3CZ5A 1O1YA 2IXTA 2J4FA 3N7UA 2YJZA 3H9CA 4ECAA 4PC1A 1X1AA 5HHTA 1KF0A 3AR9A 5L6LB 1IXZA 5FBLB 3EQ2A 3ON5A 1ORDA 3DDWA 1W85A 1UJ4A 1QDEA 5LOVB 1K6EA 3CNBA 2VP0A 1YRQA 3R3HA 1IDOA 3IE0A 1UDRA 1QIEA 3LVQE 2EFJA 3BD6A 4CUKA 1DAOA 4DYVA 5KSYA 3L05A 3VZDA 4WZBB 1I3MA 5DYTA 2A1UB 3LHIA 2FPKA 1BXRA 3R3JA 4OGGA 4R2HA 1EXDA 1SM4A 3HNRA 4LZJA 3INGA 5AIAA 1TJ4A 2WVJA 5KTKA 4KZPA 3K70D 1U7XA 3BOSA 1JG2A 5D5PA 5FCDA 2WLTA 3RC1A 4KV9A 1R16A 2AB0A 1G6Q1 4KK4A 5I48A 2AFHA 3SP1A 5F9HA 1L4GA 3R2JA 5K2OA 5A1TA 3FYSA 1V8DA 1ZI9A 3GLKA 3TZ6A 4DADA 1ZVKA 1SCQA 3JD3A 4OKSA 4XJTA 4ZWNA 2Q6IA 4KOAA 4Q3EA 3VFDA 2JGDB 1QMPA 2QU7A 3P9NA 2I62A 1NQTA 1B00A 4OY3A 2YV5A 2ZZKA 4OSOA 1P0QA 5CW2A 3RAGA 2UZ1A 1CLUA 1I13A 4FYYA 2V9ZA 2WILA 2O06A 3I12A 1SBTA 2VSFA 1ZN8A 5B55A 3AU9A 3RO7A 1XNHA 1RLIA 1XPRA 4Q1EA 4U02A 1JSRA 1OLOA 4UTPA 4E2FA 1CR0A 1U7OA 1LJUA 3QUTA 4CQJA 2VPWA 4O63O 4YUZA 3SVTA 1KI3A 5K45A 3ZGXA 2F2TA 1RJEA 4F4DA 3CLTC 2OHOA 2WYHA 3RS0A 4OFZA 2HCFA 3AVTA 3K0EA 1EFCA 2JKYA 3CH5A 4UC0A 3DCNA 3MC1A 3T9CA 3WGLA 2CZGA 3DC7A 1SH7A 4NAVA 4BMOB 5PGMA 2CLMB 4UPEA 4ZJZA 5AK3A 1D2MA 4IXTA 4N7JA 2E2WA 3BRWA 5JXIA 4EY6A 2X5NA 2UV8A 4QODA 4O2BF 5EUBA 4CCYB 5DZSA 3KT8A 2LE0A 3IT1A 4L6AA 1UFRA 2HWWA 1Z2OX 3ENZA 4OUKX 1GO2A 4RTKA 1RJ9B 2R6HA 3KEOA 4ZVSA 2OMKA 4PPGA 4G0VA 1U94A 2ZRPA 5LVAA 4KX5A 2SHKA 1L5HB 4DSOA 4B2YA 2V5AA 5C18A 5JNUA 3FPGA 1PBNA 4UBOA 5B57C 4TV9A 3R74A 3HXMA 1AUPA 4J75A 4XVHA 3I72A 1NURA 4KH1A 4MRVA 1MMFB 2EHDA 5F2NA 1KO8A 1JEAA 2C58A 3MW8A 3V7FA 1N9GA 4CM5A 2EX1A 1AD2A 2QGZA 2P62A 4ZT3A 4HZUA 3KVYA 2PUWA 5CHYA 1QGDA 4CNBA 1TVMA 7REQA 1FP4B 2J31A 3NEPX 1U3TA 3EEFA 3IUPA 4ICIA 3W9UA 3CIOA 1F6BA 2Y3IA 5ESXA 4Z2AA 1BTOA 1EDEA 3OPNA 1URPA 4Q1BA 3A1FA 3C3XA 4XDHA 4UE2A 3UMSA 1OTHA 3BD9A 3S8EA 1DBVO 4B3DA 3NGLA 3K9NA 4IIUA 2XA1A 3MLEA 1P4RA 4KQCA 5KNDH 1SUIA 1IEVA 3RTAA 3TFQA 3V8VA 5BXYA 3RCBA 3V2GA 1JECA 5EIHA 4YUYA 3NM6B 1EGQA 1OD6A 1I3NA 3KBBA 7ADHA 1B0PA 1YK0A 1JNYA 3PQCA 1Q7BA 2PX5A 1JR3A 2O8EA 2A9PA 3O8OA 4MR9B 1NPDA 4JJZA 4U3JA 4XXHA 3AVVA 2J3HA 1Q2XA 4K9LA 5KQRA 5JI2E 2ANBA 2WDPA 2QJOA 5BNWA 1L5MA 1OXXK 1CXZA 3HN2A 5TQ2B 1H3FA 3T7EA 3CB2A 2OSBA 3LG2A 1ZCJA 3HSYA 4J16A 4O2AA 4RLSA 1A7JA 1DG3A 3NNDA 1DUSA 2PH5A 3EBLA 3NTRA 3Q9SA 5EWLB 5ECDA 1P7PA 2C88A 3G8AA 4MNTA 3H75A 1JEQB 1RWMA 2WY2D 2F43A 5C0OE 1TM5E 5JJIA 1FNMA 3AWIA 5HE9A 3GUVA 2GZ1A 1XLTC 3QZUA 1HFWA 3H7IA 1ZNQO 2FOLA 3BMOA 4ZREA 2HBZA 1O9GA 3RH0A 1RTTA 4ZZ3A 2OHVA 2XADA 2FEXA 3HKEB 1GU1A 3GGCA 4CKWB 1E6CA 1TJ3A 1X15A 2EU8A 1XWWA 4ZPJA 3TO5A 1P8AA 1BVHA 2AOVA 4H7JA 3AUFA 3RVJA 4J1SA 2E6UX 3UJPA 2WU8A 1YR2A 4Q15A 4Y2PA 1PWXA 2VUUA 1GVHA 2RKWA 3G8BA 3H6GA 2HSDA 5HRUA 3CPJB 3L43A 2FZ4A 3OJLA 1RT9A 2GCEA 4JK3A 3C2QA 4OF4A 3DHEA 4AS2A 4EI7A 1ZGCA 5JJ5A 2B36A 5D3QA 3NHLA 3EVEA 3EXHA 5DSZA 2DQKA 3WNDA 3IBGA 4KQHA 4AJPA 3GC6A 3KS9A 1N6PA 4MR7B 3RSCA 4MS3B 2OVBA 1EWQA 4W5JA 4QSHA 1CDEA 1YACA 2BUCA 1NI4B 3EAGA 2O8VA 1FRVA 3JAWA 4BY9E 3VJRA 3A9WA 3LKBA 5HJEA 1KI6B 1VE3A 1UKVY 3ZHTA 3TLCA 3B48A 1DJNA 3DBLB 5HQ3A 3O4FA 3VJLA 3OLCX 1YT5A 4NZMA 3NVKI 2R8ZA 1XA4A 2VF2A 1BRTA 2BP7A 4UXIA 1C1XB 1SEVA 4NBTA 3TI7A 3AU8A 4NDNE 2WVGA 4KZKA 4RK7A 1ADCA 1QKIA 1XN1A 3L49A 5E4YA 3V2IA 1CERA 1KQPA 2WF7A 1U0OC 3AFGA 2XCTB 2XMGA 3QOXA 3ZTWA 3LNTA 4ENSA 2QBYA 3OPXA 3E5NA 4R2JA 3CUYA 4GRDA 1HDGO 1RWBA 3EVDA 5BNZA 3GFQA 1U9IC 2P6UA 2CV0A 3FTQA 3AMVA 3QITA 4BVFA 2GAOA 3X1YA 5G0UA 4JJFA 1VPTA 3P0FA 3Q6IA 3GH1A 1E2MA 2GNPA 4J0QA 3WDSA 2C5SA 3G9UA 2HA7A 3JY6A 1A82A 4S0ZA 1WXXA 1AH2A 1W1UA 3JTMA 1XRNA 1Q0RA 4BTVA 4HFMA 4HLCA 3ZQ4A 3LWDA 3MWJA 1N75A 1WCXA 2VBIA 2CF6A 4P4SA 4B40A 4YAIA 1YFKA 5AKGA 1TUBB 1L7MA 4OG2A 1ADYA 1RABA 3A2NA 4QJ4A 2AI2A 2NTEA 5GJVC 3TD2A 2CLFB 2GT1A 3C15C 3LUGA 1KDVA 4S04A 1NQVA 4JR1A 4PGAA 3WMGA 4YY3B 1UBKS 1IE3A 4X6LA 2CL0X 4WCFA 4CLEA 4ZMBA 4R6XA 4LVUA 1AHPA 1U8ZA 3K20A 1MAWA 3P9RA 5EE5B 4ACBA 2I29A 1TVKA 4ZJYA 3VM6A 5CA0B 4PG4A 5EN4A 4OXRA 1QV7A 2I99A 3LUDA 4UBLA 3RVNA 4CMBA 3A6EA 3CX6A 4IEIA 4LIPD 4LOIA 3EPJA 4BMCA 3O82A 1Z6XA 4G1UC 4PYRA 4YJFA 1IBLB 2O07A 1N3BA 1KIMA 1IY9A 2ES4A 1DZIA 4MUFA 2W00A 1F4VA 4FP9A 3LU1A 3L4KA 2D5IA 2Q3CA 1Y7IA 2I0FA 1ZC4A 5KSZA 3N2ZB 3BIOA 1OIXA 3RC9A 3THSA 3VJMA 5HR5A 2REQA 1KARA 1OPXA 1TXGA 2C5BA 4IR7A 4TRRA 1TEZA 4UVIA 4QASA 3OT5A 5AXAA 4RFSB 3VA7A 2VQ3A 4Y1GA 2HRQA 3PE6A 4I50F 4Q18A 3E81A 1KK3A 4JU9A 4GE3A 1WBDA 4MMYB 1Z7WA 1DEKA 3L7AA 4L76A 1EE1A 1CIVA 4L5YA 4EUFA 2VJMB 5KI6A 4EKDA 1JZSA 3CZ4A 3KHUA 4EVIA 2NU7B 3EXG2 3JQDA 3B6MA 4I1SA 1P6QA 1QH1B 1U8EA 5ECYA 2YQ4A 5DX8A 4G8DA 3IDFA 4JR0A 5HIAA 5MN5A 3AFIA 1TD1A 4UNNA 2RGYA 4EUHA 1JYFA 4LNAA 3PDIA 3RSSA 4WBNB 4OQMA 2SKCA 2GOYA 3R5TA 1THGA 3CJRA 4ZK6A 3OESA 1PDWA 4YRLA 4MLZA 4JJGA 3WWDA 2ZUEA 3GEMA 4QOFA 2PRZA 3F5QA 1H2WA 4Y7CA 3F4LA 4G4SO 4DA4A 1H42A 3IMCA 3P26A 4GBMA 4XFJA 1RBMA 1O97C 5AOBA 5KHAA 3DV2A 3S8MA 4Q3OA 4QAJA 5IN4A 4LHXA 2EQBA 1P44A 3C1OA 4A5OA 2W90A 4RABA 3LBHA 2I2XB 4DV0B 4RHTA 4ZIRA 3WTCA 3O95A 4BLPA 2H0QA 4V38A 1W0KD 3HYSA 4OUDA 2XRMA 5FNZA 4G67A 2JAPA 4DUYB 2R86A 5IAOA 4ZV9A 2B78A 1YWGO 3O8RA 2W9XA 3HY6A 3NYQA 4PVCA 1YZYA 2BH2A 1YR8A 5CLJA 1C3EA 2AZ4A 2WIJA 1PYDA 1XZFA 4KITB 5KDOA 5B6IA 1DAKA 3E7DA 1MB2A 1ML4A 1NVGA 2NVBA 2E0IA 3KLPX 2IY9A 3NH9A 4IJKA 4K46A 2PAAA 2PKYX 3ZWYA 4S1WA 5ALDA 2VAPA 4F4JA 1UKBA 1VJGA 3KVRA 1IN1A 4EUKA 1RDFA 3FB1A 3VPXA 5BP7A 1DC5A 4M1SA 1KVUA 1C4WA 1E2EA 1TK3A 2V6IA 1Z8DA 2WHQA 4II2A 1EH5A 3HB0A 4EEXA 1MX9A 3VU0A 3HCEA 3DZKA 5AW7A 3FOCA 4XPZA 1NBAA 3HBNA 1E2KA 4JBYA 4RFVA 5EHIA 1G20B 3KR9A 1QR6A 3RYFA 1M2JA 2IYNA 4JI5B 3SF0A 3VR0A 4DLNA 1FFHA 1UODA 1AGRA 2I6XA 3K5WA 3NHKA 2HA6A 5KCMA 4B43A 4M0EA 2IV7A 3MJDA 4EENA 3UUWA 1ND5A 3X2FA 2UXCB 1CZUA 3WGKA 4II7A 3F5FA 3PGXA 5IASA 2J5KA 1SOAA 4UARA 5BV8A 5I4KA 1L1QA 4TV9F 5EPEA 1Q92A 2QEQA 5J47A 2FLKA 1SCNE 1HYBA 2H1CA 3LX6A 1JMKC 3UV6A 1ADFA 4RZQA 1U8UA 3LXRA 4EX7A 2CXSA 5CYGA 1DXYA 1TF5A 4JI7B 3GMSA 5H59A 1O0SA 2YZKA 1PK8A 4MKHA 4JXXA 1CP2A 1FNSA 2HA4A 2Z8ZA 5B1HA 4EW6A 5KYYA 2I6TA 3UKOA 3C7TA 3L8ZA 3A6HA 3SHWA 3E9EA 1KPGA 1CUZA 1M1NA 2A7QA 1Y9EA 2NXEA 2WRZA 2OZEA 1TMYA 3KK0A 4Q1FA 4LQCA 3ZV7A 4A2WA 4F11A 3RAFC 2I22A 1EAYA 1IN7A 2Q9UA 5DMHA 3WGUA 5EUCA 3RVLA 4HAOA 2X4DA 3CS3A 4MQEA 4QDKA 4U8HA 3PWZA 1R8SA 1WPRA 2WU3A 5J2UB 4HDOB 1YVUA 1WB6A 2VTVA 3V1YA 4ETNA 3HKBA 2L2QA 2Q9BA 3E48A 2QOEA 4RZHA 4BRWA 4XYGA 5JY1A 3WDKA 4I4LA 1S6YA 1R0XA 5CXUA 1P1RA 2CJXA 1GNTA 3N8DA 4OX9Y 3QUCA 2RH8A 3HEMA 3L7MA 4KG7A 2RHLA 3FNIA 4KE9A 2RHDA 3U9SA 3NUZA 4CFSA 1A8IA 2QSUA 1Z37A 1R8YA 4RM3A 5E9WA 1IOZA 2GCOB 4ZO9A 1IDN1 5EPOA 2A3NA 1NPYA 1LUAA 1PFGA 4AM8A 3AEUB 1VSQA 1W2HA 1S1CA 1TTQB 1R0KA 4LJ5A 4TV8A 4GBJA 1BE0A 5DNWA 3VX3A 1DX6A 2GHIA 1JQJC 2EX0A 3RC7A 4RKWA 1W36D 3PDHA 4KPFC 3ICPA 4O2AF 1WP9A 1RXYA 3KVVA 5H02A 3DBHA 4WN9A 1D4ZA 1Z75A 1KVSA 1T4CB 2BL4A 3KXIA 1X7WB 3BSYA 2UYYA 1N1EA 3DTVB 1ZZGA 4HDCA 3C3BA 1LPSA 1UBLS 4PZZA 1ZRNA 2YHIB 4NQZA 3O2SB 4RPGA 1N25A 3SEFA 4QG7A 1Q1EA 2H65A 4BX3A 1QV9A 4HXGA 1UIRA 1YCGA 3F71A 3IIKA 2FZGA 2QSJA 3OKAA 4IDBA 4LJRA 3PVZA 1TC1A 1M33A 2QLBA 1H0RA 5EUMA 4B71A 1OUMA 1YL7A 2W6QA 2WOJA 4JJ6A 4UQLA 3PUIA 1SEPA 2GTIA 4R7TA 4F72A 2DWUA 2VDWB 3DGFC 2C4WA 2ZTMA 2F1IA 5FWXA 3EAFA 4ZRDA 1ODCA 3TNYA 4DYDA 5CH8A 4E13A 4N6NA 2HU5A 4F4UA 3TEMA 5CB4B 1EK0A 2Z30A 2CHUA 2ZIGA 3GZ4A 4DEYA 1RKBA 5C4GB 4EPXA 2HA3A 1IJKA 4CWAA 3S1SA 2O2CA 3PEUA 5C81A 1MAVA 2HXSA 1CR2A 4PIPA 5GWXA 3ELDA 1UMCA 1B1AA 1G5HA 2W2QA 1C7QA 4C0WA 2QQ5A 2H18A 5I7OA 4QYTA 4D3YA 2JB9A 4LRUA 2IEZA 3F6YA 3WIOA 3KUKA 3I6IA 5I8ZA 2QB5A 4X7BA 4XUEA 4EITA 3UPTA 3HR7A 4WNYA 2CYCA 4M83A 4BCCA 5KQGA 1CR1A 1EGAA 2H1OA 3I73A 4HUJA 4A3SA 2V6FA 4N3CA 4DYHA 1ONNA 1WCV1 3BMCA 3KYDB 5E6SB 4EHBA 4Z49A 2V4UA 1OGJA 4MCHA 4C4TA 3S81A 5JU6A 1VSUA 3GCXA 2BFEB 3EZ2A 4JLVA 2BEWA 2OC9A 4LJLA 3GFPA 1T2VA 4JOBA 3ZCPA 4MCIA 1KO7A 1SQ0A 1W36B 4DY4A 1QRRA 3FPEA 3QHQA 1DFHA 3FCUB 5BR4A 3DDCA 3KLMX 4MV6A 1M66A 5EL0A 1LVGA 3EF1A 3FWHA 2C4VA 1AK9A 3SN6A 1RFLA 4D9GA 1E2QA 1PJQA 1NRJB 2BHNA 1VSTA 1JKJB 5DGTA 5THXA 1UJBA 3GAFA 5THKA 1RJDA 4CKCB 4D6XA 3H99A 2R68A 5EFZA 2TRSB 1UFVA 3GLQA 2G9ZA 2WIBA 3GJ3A 2Q5QA 4GP9A 4KQEA 4NV1A 1E6WA 3HBAA 1S3GA 1FNBA