4U2GA

Crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAHEILGVNAFMRETVSWLVDQGYAAVCPDLHARQAPGTALDPLDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHLPYSNGKVGLVGYSLGGALAFLVAAKGCVDRVVGYCGVGLEKQLDKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEGAGHSFARTGSSDYVASAAALANERTLDFLAPLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas knackmussii
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2gA00
1MAAA 2VJAA 3AZPA 1XKLA 1ZJ4A 3UMJA 1GQRA 4EBBA 1TK3A 4B9EA 3IUJA 4YPVA 3DKKA 1FFAA 2VAVA 3R3XA 1DT3A 5JALA 3WK5A 2WU4A 1ORWA 3SX4A 4WCVA 5CT4A 5IVDA 3AIMA 3PDCA 3T52A 1X70A 2XMBA 5K5EA 2QXTA 5JARA 4H7DA 3O95A 1U2EA 1YASA 3GELA 3BF7A 1W52X 2GYVA 2BKLA 1D07A 5AI9A 4HXFB 3WQHA 2CUTA 4P93A 5BV7A 4J0JA 1XLVA 2HA5A 2XQFA 4K6GA 4W1SA 3R41A 2PKYX 3H2JA 4OYLA 2VAXA 1F6WA 3V1KA 4QDUA 1WCYA 5JZBA 1Q0ZA 2XT0A 2QZPA 2HDWA 1DX6A 1A88A 3HSSA 4W63A 1MO2A 3HRHA 4EY5A 1E8MA 2JGKA 4UBMA 1CUDA 3ESCA 2BFNA 3NUZA 4G8CA 1HQDA 2PX6A 2WUDA 3VKFA 4MEAA 3STYA 4HXGA 1XRLA 2HFJA 1QIJA 1FFBA 2H9YA 5IH7A 1UFOA 2JEYA 5LLSA 1MX1A 1IZ7A 2XDWA 2JGEA 2PBLA 1LZLA 5K3FA 4FHZA 2ROQA 3QMVA 3SK0A 3F8SA 3WYNA 4N8EA 1BCSA 4OU4A 2JGMA 1VA5A 2XMCA 5JD4A 2HIHA 3L1JA 2G5TA 5CT5A 3BJRA 4LHEA 2WHPA 5ALHA 1R4ZA 3D2BA 5A71A 4CG2A 4BAZA 3FCYA 1QIFA 2IIVA 2R11A 1QFMA 5ALLA 3WKCA 5JZSA 1TCCA 2WUFA 3ESDA 3WK7A 3I1IA 4H7FA 5DNVA 5CBKA 3VJMA 2FJ0A 2WHRA 4QDTA 2DSNA 5E2IA 2I03A 4AB1A 2VTVA 4Z49A 1PFQA 4KACA 3FCXA 5AK5A 1ZD5A 3NWOA 2VQ6A 2PSFA 4UBNA 3F97A 1XRNA 2Z3WA 1R9MA 1GGVA 3NOXA 5AI4A 4IH4A 4X7BA 5H3HA 1J07A 3H2HA 1NU6A 2BUBA 3F67A 4DTCA 1UK6A 4QLOA 3H17A 1MN6A 3I2FA 1J06A 3C6ZA 1VZ3A 4BVLA 3AIKA 2Z5GA 3DL7A 1TRHA 4IHAA 4QDZA 1YA8A 1YA4A 5E4TA 1CUFA 4J0IA 3QYJA 1O6FA 3D7RA 4G5XA 2WKWA 5FPPA 3W2TA 2J4CA 4GXNA 4FOLA 2BJHA 1UOPA 4C88A 4CI9A 3R40A 3CN7A 2H1IA 2WUGA 2XQGA 4WDRA 4KRYA 3F9CA 4ZGBA 4Q3KA 1EHYA 5BOVA 2RONA 1CUJA 3ED1A 4PW0A 5AKEA 4B81A 1AURA 3STTA 3M81A 1JU3A 5BWCA 2PUHA 3PFBA 3D4LA 1HDEA 4C4YA 4BZZA 4AXBA 4K5QA 2HA6A 4BYMA 3KXPA 3UUFA 4PO3X 5K3FB 5LIPA 5CW2A 1YAHA 1TQHA 3WKAA 1G66A 1JJFA 3ZLUA 3PE6A 2XQJA 1MPXA 5FPQA 1OXMA 5JYCA 3HEAA 5FRDA 2XMQA 4NZZA 1X2EA 4BVJA 1P0PA 1MNAA 4UBOA 2HU7A 3B12A 3V48A 3HC7A 2XQKA 5AOCA 4CIAA 3WL6A 3E4DA 4G8DA 4Q05A 4OYYA 5KBYA 1I6WA 1GQSA 1QIGA 4KR0A 5AKHA 3O9VA 2Y2UA 1P0MA 3WKBA 3WJ1A 2XUDA 2ZSIA 1MX9A 1RWQA 2IITA 4OPMA 4UHEA 3U1TA 3G0IA 4X90A 5AO9A 4XIIA 2O2HA 4E11A 4GBGA 1QFSA 4QWMA 3Q8WA 3F98A 3BDVA 1MTZA 3DOIA 3C6BA 4IQ4A 5HKBA 3HJUA 1RP1A 2C7BA 4G1FA 2QT9A 4DNFA 5ESRA 3WK9A 4MQLA 3K2IA 2CB9A 1B6GA 4AN0A 1E8NA 4P92A 4Q3LA 3KDAA 3QMMA 3S8YA 4FLMA 1QJ4A 4MWTA 4FMPA 2ZYHA 2WHQA 4KE8A 4Q34A 4OSEA 2OCLA 3NGMA 4KE6A 4Y2QA 3ICWA 3O4HA 5T4BA 2WIGA 4Y2SA 3BIXA 3EIOA 4OD0A 5AK6A 1ACLA 1R3DA 1CUBA 1EINA 1K6EA 2XUKA 5CH8A 3I6YA 2CJPA 2V98A 1AC5A 2JIDA 2JEZA 1LPBB 1UT6A 3T4UA 2Y2VA 3D0KA 5CXXA 2AXEA 1ZIXA 4Y9SA 1S8OA 1DWOA 2WIFA 3FSGD 1IZ8A 2O2IA 4BDSA 4EY4A 2RIPA 3MUOA 4G9EA 3GFFA 1YB7A 5ALTA 2EDCA 3O0DA 3WK4A 2WTMA 1EDDA 3HACA 5ALGA 4BATA 2QKYA 4BCCA 5CTAA 5CMLA 5I9IA 3G0BA 4AO8A 2Y6VA 3CXUA 3U0VA 1ZI6A 4L9AA 3IUQA 4A16A 5HQ3B 1L7AA 5AHXA 2ORYA 4NVRA 4HRXA 3BJMA 5ALIA 4X93A 4F5ZA 1LPNA 4S0XA 1OCEA 2JGIA 3JWEA 4EHBA 3OTQA 4FLEA 3G9XA 4UPDA 2RHTA 4ZXFA 4X94A 2HU5A 3B5EA 4WFKA 2C0PA 2K2QB 3WKDA 1P0QA 3H04A 5EHZA 1NX9A 3IDAA 4X91A 1ISPA 1XZGA 3E1GA 1ZD4A 2YH2A 3CN9A 1MJ5A 1K4YA 1LBTA 3WWCA 3VJKA 1XZJA 1UZAA 1GKKA 5AM3A 1DQYA 2PSJA 3JW8A 3FVRA 4UBLA 4GECA 1L7QA 1XLUA 3A2MA 3VXKA 3WYDA 3ILSA 1HLGA 5LZ2A 2HRRA 1H2WA 5DWDA 2ZJ6A 1W75A 2DR0A 3KOOA 3WWPA 2XI4A 3YASA 4XVCA 2WG0A 3FLBA 1Q0RA 1XZHA 4AMZA 4GWLA 4M0EA 4ZRDA 1VOTA 3IUMA 4NMWA 3RK4A 4DYHA 5ALEA 3JYHA 1JJBA 3WK6A 1T2NA 1XZCA 1H2ZA 2FJPA 5EHXA 1JJIA 4UHFA 2Y6UA 3F96A 1THTA 4QE3A 1EVQA 2HU8A 3R0VA 1UK7A 5AM2A 5ALOA 4PF1A 2I78A 5CRIA 4J0GA 3C45A 2W6CX 3FBWA 3WL5A 2GBCA 4N5IX 3WL8A 4H0CA 4KAAA 5AJHA 1E89A 1A8SA 4D9JA 1THGA 4N5HX 4Y2TA 4B84A 1VLQA 4PSUA 4FNMA 4ARBA 1GPNA 1YS1X 5EIHA 5C8XA 2QMQA 2W22A 1HBJA 5LZ5A 4CIBA 4KAFA 4C4XA 4X00A 3Q0TA 2XUGA 5A7HA 4Q82A 1JT2A 5HQ3A 5T4EA 3G02A 4DMHA 3UUEA 5ALUA 2XMRA 1ODSA 4H35A 5KWJA 4J03A 1MU0A 1EVEA 3RARA 5CH3A 5LZ9A 1AMNA 3WIOA 5DNWA 2XLCA 3G9ZA 4MQMA 3STUA 3W06A 2NW6A 3DYVA 2B61A 4UHCA 4FFVA 4BTVA 4CG1A 3K9BA 1IUNA 2OLEA 4QNNA 4BAGA 1WPXA 1TIBA 5LKRA 4QEKA 1CUWA 5FUMA 4HS9A 4UFPA 3ZV7A 3ZPXA 5BWBA 3VVLA 5LYYA 5I7UA 5ALKA 2O7VA 5AKXA 5A6VA 1AZWA 1QTIA 1CV2A 4GDMA 5C8VA 3TJMA 3LLCA 1KEZA 1W4LA 4JNCA 4X3CA 2XMGA 3L1HA 5YASA 1JKMA 4AO7A 2PVSA 1EA5A 1X2BA 2BGRA 2QS9A 1J1IA 3C70A 1BN7A 4EY8A 4B6GA 5LKAA 3H0CA 3AUKA 3WA6A 4QDXA 1CUIA 1EH5A 2VJCA 5JAHA 5IKXA 4N8SA 1XLWA 1XZFA 3HI4A 1UWCA 3V1MA 5AIBA 2IX9A 2YASA 4KE7A 3PFCA 2LIPA 4UHHA 1E8DA 5JAPA 5AOAA 4FLFA 5AKIA 3G8YA 3O4IA 1WB6A 3OC0A 1JI3A 1O6GA 2PUJA 1AGYA 1JFRA 3WI7A 4U2FA 3FVTA 4BTLA 1AX9A 1N5RA 5CH5A 5ALNA 3I1YA 1ZI9A 5SYNA 1W1IA 5AKJA 2H7CA 2HL6A 2UZ0A 5A7GA 3STXA 4H7EA 3CCCA 4AMYA 1QTRA 4G4GA 5LZ8A 6YASA 2XUOA 3DYIA 3CCBA 1EDBA 3QZUA 4X6UA 1CIJA 4OB7A 2VT7A 4J3JA 5AM0A 1QONA 2PSDA 5AIAA 2ONCA 1SCKA 3GROA 3G9UA 2WIJA 1XZDA 2BUCA 4CCYB 2HA0A 2XMZA 5E4YA 3HYSA 3HXKA 3IUNA 1DT5A 4BC1A 4QZVA 5AKZA 1W76A 5JIBA 2OAGA 1XRPA 2PL5A 4X6YA 2OXEA 3FNBA 5DJ5A 3EBLA 5C7YA 4PV7A 5CXUA 3OURA 3BIWA 3M83A 1UOOA 4U2BA 2XUFA 1ODTC 2DFPA 5A62A 1LNSA 2QVBA 3C6XA 4MWSA 1YR2A 3C8HA 2DHEA 3P2MA 1R88A 2PU5A 4AZ3A 4X6XA 4EY6A 1Q84A 4RE5A 4E15A 4HRYA 5K3CA 2WILA 4TPKA 2VATA 2HHAA 2RHWA 3KWJA 1TAHA 4MXDA 5AP9A 1GZ7A 5EIAA 4J0HA 2VEOA 3KD2A 1QLWA 3VVMA 1CUHA 2CKMA 4G8BA 5FKJA 5FXMA 2Z8XA 4C6HA 2GZRA 4DGQA 4LYDA 4INZA 3ANTA 2XMDA 1H23A 5DNUA 2AJDA 3W05A 4BRSA 4ROTA 3ICVA 2I3DA 2X8BA 3IVMA 3DEAA 3D5EA 2H7XA 1A8UA 5AH0A 4BRZA 1W6RA 2YXPX 1VJ5A 1NU8A 5ALQA 2JBWA 4HZGA 1SC9A 5AICA 1UKCA 3H2GA 1H2XA 4X95A 4BC0A 1EK2A 4L0CA 2JF0A 5HF5A 3TEJA 1YCDA 3WZLA 2WJ3A 1DTEA 1DU4A 1BROA 2AJCA 2X76A 1HPLA 3PI6A 4MYSA 1CRLA 2Z8ZA 3ZLTA 1QIMA 2G5PA 4BDTA 4E46A 4DIUA 2OAEA 1LZKA 4UBKA 4JH0A 3ZI7A 3K6KA 1QGED 2YYSA 2VT6A 5AI0A 4KEAA 4AZ0A 5FP0A 3DJYA 5AM5A 4CFSA 4ETWA 4A23A 1C7JA 2RGUA 4OCZA 4FKBA 4CCYA 2OPHA 4O08A 4UFNA 4UBJA 5HCUA 3IBTA 2CEKA 3I2KA 4RPCA 1CQZA 3BXPA 3C87A 4C4ZA 3STVA 3W04A 5HFAA 2PSHA 4EY7A 3QPAA 4I19A 4MEBA 3HZOA 3I6ZA 1ZIYA 1LBSA 4L72A 1R50A 4QA9A 1XQYA 1UK9A 5D3KA 4NS4A 2BUAA 2XUHA 1M33A 1ZI8A 5EGNA 1QIHA 1TCBA 1LPPA 4PQEA 3TRDA 2AJLI 4J7AA 1WHSA 1GKLA 1QOZA 3DKRA 3WZMA 4ZI5A 4E14A 3VJLA 5AOBA 4H7HA 4B82A 4ARAA 2VA9A 3H19A 4HAIA 3H18A 1EB8A 3AFIA 1DWPA 3PF8A 1N5MA 3H1AA 2XMSA 1BE0A 4YASA 1DWQA 3WWDA 1XFDA 3DD5A 2QM0A 1XZMA 3ESBA 4TGLA 3AIOA 3QITA 4MYDA 1DX4A 1AUOA 3E3AA 4LXHA 4BBZA 5K3AA 2WG2A 1XRQA 4GW3A 3G0CA 2ACEA 2QOEA 3MUNA 3C5VA 4OU5A 2GYUA 4EA6A 1AKNA 2AJBA 2GBIA 3BDIA 4WY5A 2WIDA 1E3QA 4Y2XA 2PU7A 3OPMA 4BP9A 3QPCA 2R8BA 5EFZA 1HKHA 4OB8A 4EZIA 1CUGA 3R3WA 2WTNA 4PSDA 2ES4A 2PPLA 2C58A 5J3JA 4U2CA 4BE9A 1VXRA 4LXIA 3FYUB 1K5PA 3O4JA 3BF8A 5ALXA 2Z3ZA 2RI6A 2WLSA 7YASA 3PF9A 3V1LA 5CURA 1LPAB 2H7YA 2QXUA 4BB0A 5FOQA 3R3VA 1WB4A 2WUEA 1MT3A 4UUQA 2XUPA 5IVKA 1Q83A 2X5XA 5A2GA 1JMKC 3EQ7A 2BAGA 2ZSHA 4C87A 1CUEA 4H7JA 1U65A 1QIIA 5D3ZA 5ALJA 4BCDA 1VXOA 3A2LA 2ZJ7A 1CEXA 2B4KA 2CZQA 4Y2YA 3IULA 4MJ3A 5AKYA 3EF3A 3SC2A 5A7FA 4FNGA 4DMKA 3M82A 5AI8A 3W9UA 1FFCA 4YK7A 2OGTA 2J3DA 2J4FA 3DCNA 1TCAA 4WFIA 4DSAA 2HA7A 5ALDA 1A7UA 1VE6A 1QIKA 3IIIA 4RNCA 4XX1A 3ZLVA 2B9VA 1JU4A 3QBJA 3N0TA 2QTBA 5C8ZA 3D3NA 2G63A 1XZBA 4J0CA 1GPKA 1BRTA 4B7ZA 4GEGA 3AZOA 3RKSA 3M3DA 3PUIA 3RM3A 3C5WP 2WM2A 4TVKA 1U4NA 4BZWA 1CUYA 1EX9A 5HZGA 1H2YA 5DYYA 5I8PA 1XQWA 3WMRA 3W9BA 3B3QA 1WM1A 2WIKA 2XE4A 2O7RA 4X71A 5JANA 2QJWA 4RE6A 4Y2VA 5HK9A 2VJBA 3TGLA 1HL7A 2OQVA 4AO6A 3AZQA 4BCBA 2PSEA 4OUKX 4WDQA 1CUAA 5D6OA 1ODCA 1BU8A 4CG3A 4Q3OA 2WJ6A 4JEIA 2FUKA 4AX4A 5ALSA 5ALZA 1F8UA 2Q0XA 4FFWA 5AI5A 1DQZA 2OCKA 3FYUA 3OOSA 3KSRA 4EB0A 1MAHA 4KE9A 1Y7HA 3LCRA 1WHTA 2WFZA 1L7RA 4UHBA 1G42A 2DQZA 2OG1A 1EI9A 1SFRA 4OB6A 5EHNA 4G4JA 5LP1A 3FYUC 5EI5A 3O4GA 1J2EA 2ZYSA 4RGYA 1XZAA 2V97A 2WSLA 3GA7A 3I2HA 5JAOA 3GBSA 4HTAA 1XRRA 5T4FA 2BGNA 4KYVA 3QVMA 1SOMA 4IO0A 4CCWA 1EB9A 1N1MA 5AI6A 4DM7A 5KREA 5CT6A 5HF6A 3C43A 2WFLB 2C5FA 5IVIA 2ECFA 1ETHA 4UFOA 3I28A 5ALRA 2OCIA 1ACJA 4UBIA 2QR5A 4BE4A 1XZEA 4QDOA 4K6HA 1RYYA 4DNOA 3ANSA 2DCMA 5SYMA 1BEEA 5ALWA 3MGAA 3WIBA 2DQYA 3C8DA 4KAJA 3RLIA 3O9MA 5HKAA 4P08A 5JD5A 2QUAA 1WOMA 1GT6A 2HFKA 3AINA 1ZICA 5CT9A 4DSZA 1CPYA 3FOBA 2O2GA 4K6KA 5DYTA 2FX5A 4YX9A 4GLBA 2I3ZA 1XRMA 1IMJA 4FDMA 3DDUA 3H1BA 5AKKA 1JMYA 5IVHA 4WFJA 3LS2A 3PICA 4C89A 3A2NA 3BWXA 1FSSA 3R3UA 1PV1A 1QO7A 1Y7IA 3D59A 1CUVA 3FLAA 4W9RA 5CT8A 4GHWA 2V96A 1BCRA 1P0IA 5K3DA 5JZ9A 4Y2RA 3GUUA 2HA3A 1CVLA 1LPMA 1GXSA 3C6YA 2WQZA 3FYTA 3D2CA 3LIPA 1XZIA 1Z68A 1QIEA 2EEPA 1WB5A 3IA2A 2XUIA 4QLAA 2GBFA 2ZYIA 3FWHA 1DINA 1R1DA 3N2ZB 2GYWA 4A5SA 1KU0A 3OM8A 2XB6A 4H77A 4LIPD 3OG9A 4PSCA 5AKGA 3D2AA 1IUOA 1FJ2A 1WPRA 1N8SA 2XUAA 5FV4A 4DNQA 1CUCA 2EDAA 4I3FA 4AN1A 2CBGA 3ESAA 1BS9A 5EIEA 3EQ8A 4N8DA 4U2EA 4W1RA 3A70A 4B9AA 2GZSA 1IVYA 3BL8A 3WLAA 1ZOIA 5D7BA 1CUUA 5EHQA 5HF9A 3WWEA 4LKOA 3ZWQA 2CMFA 3LP5A 1LPSA 1LGYA 2ZVDA 2OGZA 5JATA 2HA4A 4ZV9A 1T4MA 3S2ZA 1EXWA 1K63A 2C0QA 2WFLA 2ACKA 2QJRA 1XQVA 4QWWA 4ZREA 4B0OA 4LYEA 5JAUA 3AILA 4Y2JA 1LLFA 3WL7A 4IH1A 4X92A 4F0JA 3GZJA 2OGSA 3PUHA 1ZD3A 1FFEA 5HF8A 1EDEA 3A6ZA 1YSCA 4F21A 4L3WA 2E3JA 2AJ8A 3DNMA 5FLKA 1UKBA 4I4CA 1A8QA 3QH4A 4JUIA 5JADA 4KRXA 1G5FA 2WG1A 5HK8A 1B41A 4EUSA 2G4LA 1R9NA 3DL4A 4DMFA 3KWFA 4Q1VA 4H18A 1XZLA 1CR6A 5K3BA 1G4HA 1VZ2A 1VA4A 5AK3A 4FTWA 1TKRA 4Y2UA 2HADA 2JGJA 2JGFA 4ITVA 2J3QA 1QE3A 2HRQA 2P8SA 5DYWA 4LXGA 4DMCA 3X3HA 4U2DA 3QPDA 2OQIA 1ZGBA 5DTIA 4PNZA 1CUSA 4B83A 1BEZA 1VKHA 1IUPA 3E0XA 1XROA 1YS2X 2XLBA 3WJ2A 1UXOA 4WY8A 1Y37A 2BCEA 1USWA 3R3YA 4Y2PA 3HLKA 2HA2A 4JYMA 4XWGA 5AK4A 3L1IA 4K2AA 4X85A 5KWIA 3I2GA 2WJ4A 4G4IA 5ALVA 5ISMA 2DHCA 5ALYA 2XQIA 3G0DA 4BVKA 1FFDA 5JD6A 1MX5A 1QO9A 5DLPA 4H7IA 2PM8A 5C81A 2QRUA 2VSQA 5F4ZA 4DNPA 3I2JA 5ALPA 2WU3A 4HVTA 2XUJA 2XUQA 4XJVA 3LIIA 4IH9A 5K3EA 5ALMA 3WA7A 3G9TA 5AM4A 2DHDA 3HABA 2RAUA 3DOHA 2V9ZA 4KJXA 1XQXA 4B85A 4WJLA 1QZ3A 4C01A 5JASA 4W1PA 1SCIA 3FSGA 3VISA 2JGLA 1E66A 4J0KA 1C7IA 1F0PA 2D5LA 4V2IA 3DS8A 5T4HA 1BN6A 1OILA 3DLTA 2OCGA 5LZ7A 4M0MA 4AQDA 4FWBA 2WFMA 2Y1KA 3I6MA 1C4XA 1ZJ5A 4B80A 2VF2A 3EQ9A 1MNQA 3WKEA 3IB3A 3R3ZA 1ORVA 1VE7A 3I2IA 2HM7A 1UK8A 4X97A 2GBGA 2C5GA 4W1QA 1XZKA 2ZJFA 1CLEA 1SCQA 4UHDA 4FBMA 5ALFA 1ZGCA 3H2IA 1XKTA 4HXEB 4ZV7A 2VJDA 1K8QA 4B0PA 3STWA 3IURA 2C4HA 1CQWA 4M0FA 4BAUA 3G7NA 3VDXA 4ZWNA 1H22A 1CUZA 4U2GA 1U8EA 4BP8A 3G0GA 1CUXA 1EK1A 1CFJA 1QIDA 4G9GA 4Y7DA 1KU6A 5FDFA 1YAJA 1E5TA 3BE8A 3H2KA 2D0DA 5E4JA 3DQZA 3V1NA 2B20A 1YB6A 4P9NA 3MVEA 5DTJA 1UOQA 3QMWA 1AQLA 3FAKA 2WHPB 5HFNA 3WWOA 1PJAA 1F0NA 5AM1A 5LZ4A 3QM1A 5AKLA 4DLNA 3FLEA 3WK8A 3AJAA 1GPLA 2ZYRA 1LPOA 3SWWA 1UKAA 2QUBA 4FBLA 4H7KA 4J0DA 4F60A 4JYPA 1ZD2P 4GI1A 3V9AA
chains in the Genus database with same CATH superfamily
4CMEC 1WMSA 2GHQA 2V4MA 5F98A 3KT0A 3TL6A 3AZPA 1D7AA 4Q21A 1XKLA 1G1MA 3G1WA 1ZJ4A 3BM5A 3C1OA 4YN3A 3OFND 3ZK8A 2YINC 3C4QA 5BYJA 2PX2A 4YYEA 5EMJA 4DSOA 3LKZA 1JNYA 3TCNA 3WGZA 3TVDA 4Q9LA 3DBVO 3R4CA 3CUSA 2R4TA 2VAVA 3LECA 3NHUA 3MK31 3IESA 3K31A 3MT9A 4KN6A 1PFUA 1NNI1 5JALA 4H4CA 2F55A 3DGFC 3X43A 4A5OA 4AUMA 1K1EA 3RC1A 2Q2OA 4EPXA 3EIWA 2JVIA 3BIFA 4QYXA 5BN3B 1KJNA 3MWDB 2GNPA 3K0SA 3W0LB 3ICPA 4CNBA 1Z3IX 1C5KA 5G4LA 3U48A 5IVDA 3LOUA 2W6JD 1C4KA 1YHZA 2O1XA 3AIMA 4JBIA 2P2LA 1RJWA 2O23A 3DULA 1YJ8A 1ZPDA 4YJHB 3TTVA 3VZSA 4POOA 8LDHA 3UPDA 1CR1A 1B0PA 1F8GA 2PLWA 1IG3A 2AFHB 1PR9A 4MW0A 3JQAB 2Z83A 2O5VA 4H7DA 5HOQA 2WJZB 1RRVA 3O95A 3SS9X 3GELA 1ZL2A 3BF7A 1USGA 2OPBA 4CF5A 5T6BA 3A3KA 1M6EX 3RYIA 1NXXA 2BFBA 4KDRA 4S1PA 2VK8A 3AUXA 3CVXA 4B3RB 1TA4A 1W52X 3UG7A 3PEEA 4XUCA 1LDMA 2DG2A 4BV2A 3QWIA 5AI9A 4BLOA 3ME5A 4HXFB 1WL8A 1XMPA 4TVOA 1JDSA 1K9SA 3OWOA 3GPCA 1MW8X 1I6LA 3GD7A 1PFGA 4YRSA 2I65A 2R00A 4LVUA 1W0KD 4P93A 5BV7A 3JD1A 3RVQA 5F3RA 4ER0A 3HVKA 2OL4A 4MKGA 1B6RA 2I87A 2B99A 1YDMA 3HJAA 3NXKA 4XVRA 5CA0A 4ZJPA 4IIVA 2XQFA 3ACCA 1M6VA 4WVFA 5CVJA 5K8VA 2Y8EA 4IQ8A 1BGXT 4MQ6A 2W8BA 3W6ZA 1GV0A 2PKYX 2O14A 3QI7A 1JEYB 5FTKA 1KZ4A 1CHDA 3JAWB 4RULA 2X22A 2CVZA 1Z6YA 4YUAA 2BMDA 3TW0A 3QVWA 4OHWA 1T3ZA 2XT0A 4NNPA 3T35A 1F60A 1DX6A 4HYTA 3QXXA 3A2KA 1WRBA 2IYVA 2ZWPA 2MTBA 3LYLA 4XB6B 3U7HB 1KI1A 4REQB 2ZPTX 3UGJA 3VDMA 3PENA 2EKPA 1IXZA 3TDKA 5FBRB 3DEIA 4DZZA 1K6IA 4QG3A 4E2YA 1O97C 1IBLB 2PX6A 4ZK2A 4EL0A 4PAMA 6GPBA 3QU7A 3F1KA 3STYA 2NU8B 1F38A 3WBFA 4RK4A 1QH1B 3UAZA 3O4VA 4YUYA 3W5BA 1OXUA 3WYGA 1FP1D 4UOEA 1Z29A 1USVA 3PTZA 1YRHA 5LWQA 3KTOA 2HFJA 1CULC 1M2NA 4JHLA 2LE0A 4EYOA 1SXHA 3SF8B 1MW9X 3KB2A 1HORA 2XTAA 4J43A 4RVNA 3ITKA 1N0IA 1Q6ZA 4TUYB 4NRDA 3EJWA 3E8XA 3EUAA 3TNDA 5JNSA 3KHSA 4FHZA 4BFZA 5JPDA 1XNQB 1YR3A 1KDTA 3QMVA 1OAAA 2A4KA 2A78A 1XQ6A 3NJ8A 4RVGA 3SK0A 5JY1A 2O8CA 5DRTA 1BCSA 3AW9A 4M8IA 3KJIA 1KZHA 4D9EA 5BPFA 4NV1A 4EVIA 5TLSA 1P91A 4B7UA 3CUEF 2Q4OA 5K4AA 5F78A 3W6OA 3SEQA 3DZKA 1XDUA 3I92A 5A2QA 4I55F 2OXRA 4JUCA 2BY4A 5IDYA 1FDRA 1QDEA 4YALA 3GNSA 3IAAA 1FUUA 1KRXA 4GMHA 1YMVA 1W581 3H2BA 3OECA 5KQRA 3K7EA 4KLRA 6PFKA 1Q1EA 1ZL0A 2AYZA 2DF8A 4HLNA 4X62B 2NVWA 2WRZA 2ZXUA 1QG2A 3RU2A 2F8SA 3WIUA 1FMLA 2QX8A 3KFXA 1RWWA 3PA8A 4PGHA 3K1JA 4URFA 3EZ6A 2DFVA 3SIRA 4C7MA 2CJYA 5C52B 1EM8B 3COVA 4LWQA 2A14A 4L74A 3TAHA 4AFNA 2IIVA 3H05A 1GDTA 3AFGA 4DPKA 4K03A 1V8PA 1V9LA 2ATXA 3KETA 4Y0VA 3VPBA 3WK7A 3ESDA 1NRIA 1RAEA 3BMNA 4MV7A 1NXQA 3DMPA 3VH3A 1ISIA 1XHFA 2FWBA 5CBKA 3HB7A 1F4VA 2FJ0A 2WHRA 4KNYA 5LXTB 5E2IA 2I03A 2VC2B 5FJIA 3EG9A 2BC9A 1S3SA 3OQ1A 3AUTA 2KBFA 3Q41A 1L5HA 1Z5PA 4OQPA 3S55A 3VR6A 1N2JA 2EW2A 3L49A 1P2TA 3LPLA 4L22A 3RGGA 1Y3FE 1PFQA 3ZU5A 5B6JA 2FZ5A 2X0IA 1Z7GA 2JS7A 4CIXA 4C9BA 4RJ2A 1ND6A 4HXYA 5AK5A 1G21A 1ZD5A 1JKXA 3HFRA 2PRZA 4E5KA 5LQRA 2J5BA 2VQ6A 4UBNA 4Q4AB 2PX5A 3ZWXA 2I9KA 3NETA 3H0KA 3QW2A 4JYBA 5T3YA 2PGXA 3L1UA 5F9FA 2HT1A 3T4EA 3OEED 3KLPX 4F3NA 4ZCSA 3CUKA 3NOXA 1ZYUA 1ND5A 1RMTA 2AF4C 5I9BA 4IH4A 4DIBA 3TBKA 1U6JA 4FOOA 4WA8A 1CE8A 2R2GA 3H2HA 3P2YA 4K9PA 3TGPA 4R9UC 4G1VA 3LHIA 4HAYA 2D3TA 3R7NA 1ZVJA 2OC9A 1NU6A 1WS6A 3FE2A 1Y1SA 3N8IA 3NTLA 3F67A 4UMDA 4W5TA 2YWJA 4P4SB 4DTCA 4IF4A 4LHWA 4QLOA 3H17A 4Y8VA 4AKIA 5JJCA 2GTIA 3NTRA 4KQ6A 4FCTA 1QRUA 4QDJA 1NUPA 3QVJA 5TARA 7ABPA 1OA1A 3VKGA 3WGGA 1R27A 2TSYB 4HAZA 4P5DA 3QLUC 2OK7A 1HMPA 5DLQC 2R66A 4XDYA 3MJFA 1RHMA 2FPPB 3EDQA 5LDGA 3V1UA 4IHAA 1YA8A 4RPKA 3S1AA 1AUQA 4O2LA 5DYIA 2H4YA 4MP8A 4ZT7A 2QGFA 2CDBA 1YQXA 3FPFA 1O6FA 2QJOA 1YR7A 5DSTA 3ZIUA 4G5XA 4ZGWA 4J3NA 1X6VA 4DBLE 2V7QD 2Q2VA 1GQ2A 2GEKA 1N7JA 1Y6RA 2HY7A 5FPPA 1MLDA 3OE7D 3I6BA 1YMQA 4LYYA 2J4CA 4K87A 2Q0SA 3EVAA 3FPAA 4RY0A 3UN1A 3BQ9A 1LV7A 4P4LA 1JG4A 2Z95A 1KAQA 4F4JA 1AH2A 3FHTA 1L2TA 1QANA 1GQYA 2IQ5A 2YRWA 3AB7A 4IHJF 3DVAA 2Q4DA 2X42A 3FJOA 4X0EA 2XQGA 4HGZA 4KRYA 4Q7EA 3A9CA 3EPHA 3VSBA 5DGHA 1W1WA 1NVFA 5KU7A 1FUKA 1IB0A 2B8WA 4JP3A 5DWQA 3OQMA 1CUJA 5IH3A 1EAYA 3P5BA 4AS1A 4PW0A 4B81A 1H3EA 2QY9A 1FUEA 3WTCA 4RMJA 2VP2A 3M81A 2JIZD 5BWCA 3JR3A 3QJGA 1Z6PA 2PUHA 1Y5RA 1ESCA 1MB0A 2VPWA 4R41A 2NVUB 4W5NA 3D4LA 2HTFA 5CCDA 4EG1A 1E3EA 1S2OA 3CC8A 3B6ZA 1A9ZA 3A3OA 1MVOA 4OSOA 4C4YA 2WU8A 2O57A 4OLAA 4WOJA 3JRWA 1A96A 4KFUA 2AL7A 4IZOA 4TSFA 2MDTA 3I6QA 1YCHA 2FKNA 3L9WA 3M9WA 1V6AA 1CZKA 2HA6A 3HXMA 1Z16A 3UUGA 1VIAA 4M54A 4N7RA 5K3FB 5LIPA 2CXXA 3OZDA 3PEUA 4FQ8A 4RS3A 4ETNA 4I4IA 1L1EA 1YAHA 1TQHA 3PXXA 3DFMA 3GUVA 4ZC1A 3WKAA 2ZQYA 3ZBQA 2IZ0A 3KZVA 4D8YA 3D6HA 2C7VA 3CLTD 3OZWA 3SZOA 1JJFA 2AFHE 2C42A 3ZLUA 2XKBA 1XLTA 3QP9A 2X7HA 4O4IF 3RTDA 1AKWA 1N1DA 3L82B 1V96A 2IYOA 1D03A 5NULA 1S9HA 1NVTA 4BO6A 2RJOA 2Z2KA 1TU4A 4NZYA 4I5FA 4OI4A 3H86A 4HB0A 4FJ2A 1OXSC 5JCPA 3HEAA 3NC4A 3LTNC 1WZEA 3EDRA 4V3CA 4BNDA 1QM5A 3ISJA 3QVUA 4G5GA 4ENPA 5F1PA 4NZZA 1ABFA 2PWZA 4GLOA 1X2EA 3SZUA 5CD1A 2RJ3A 1MNAA 4YDRA 1K88A 1UUFA 4ITRC 3TF5A 2JJ2A 4YAOA 4PPGA 1HOTA 3EEYA 1MOQA 1N3IA 4GDFA 1QX4A 4F7WA 5C5EA 3NYWA 4NCNA 4RF3A 3KYBA 3UT5A 3UOGA 1J0AA 4D79A 1A72A 4Y9DA 4AW9A 5KYWB 3ESRA 3QEOA 1R4NB 3BXXA 5I9SA 1F1BA 2PUWA 4KQEA 1M2VB 4E7PA 5B64A 5I48A 3MSXA 2I4RA 4LV6A 2XT9A 4BLUA 1NFRA 3JWPA 3F71A 2C5BA 1GQSA 2WWXA 4OJKA 4HWPA 2A94A 2J46A 4JC0A 3ZYZA 2ZAOA 1NMXA 3OA0A 2NU7A 4OOFA 4U5QA 3H5OA 1P5HA 3IAS1 3O9VA 2IGBA 1PFYA 2VWPA 3SZLA 2O4CA 3VU9B 1V5FA 3UM9A 2EL9A 1YE5A 4KG7A 1S8NA 4Y6PA 2IITA 1NI4B 2FSGA 3OESA 1EBUA 4F45A 5AO9A 4DBLC 1LC0A 4Q7MB 3HZHA 3Q2OA 4MVJE 2NSLA 2CXQA 5FV7A 4H0FA 5GONB 3DOEA 4EKEA 4GBGA 1QFSA 4FQ7A 4Q1DA 4QWMA 3Q8WA 1IWOA 2VDQB 2FRDA 3F98A 2RARA 2CNOA 3TD2A 3ZGYA 1K7CA 2DWQA 2IYEA 1LDBA 3CPJB 2QD1A 3LY8A 1FXUA 3MTIA 1D4OA 4IVPA 3U09A 3WLTA 2YXEA 1SZCA 3AOEC 2XZTA 4DUPA 3M3PA 4YV0A 5HKBA 1P9NA 3RVLA 3E48A 3GXBA 4LBZA 3CGWA 2C7BA 2YVQA 1DI0A 2IHJA 1PKXA 1Q0LA 1VJ1A 1UBTS 1WMEA 1K8XB 4ND7A 3HB4X 3OE5A 2NQTA 1KI6B 1BXRA 4DNFA 5ESRA 1H4VB 3TJZA 3D3WB 4EG7A 5A4JA 2JJYA 3DZJA 4MQLA 3W7BA 4OJNA 4MS4A 4BNHA 3U3OA 1U1GA 4IGKA 4OIFA 1B6GA 4IRXA 3TUIC 4E33A 2HRDA 1E8NA 4GOMD 5HA5A 5BUSA 2B4RO 1TO2E 3PHLA 1Y4UA 4P34A 2FVXA 1U7PA 3AR7A 2AEEA 4M76B 4QYIB 1E0JA 1JFTA 5DZSA 2B25A 2PYZA 2Y1XA 3ETGA 3NHLA 4IJWA 4A26A 2Z2ZA 3MIIA 4AROA 2ODNA 1G2PA 1RYBA 1Z6GA 4TMYA 2QY6A 4HAWA 4FMPA 3T9BA 3NHMA 3ZDZB 2P9HA 3AXSA 4XM0A 1KQPA 1T13A 1A7KA 1VCNA 1R7RA 2ZYHA 1AMUA 2XXJA 2OCLA 4FFLA 2AFRA 4RD0A 4Y2QA 1XP8A 4YP9A 1M0SA 1HG0A 2FPXA 3NZEA 4CODB 2CY0A 2OC4A 3BIXA 3TKYA 2AVDA 4MYHA 2C00A 3AO0B 1UAAA 2P3OA 4LGYA 5K8IA 3EXHC 4AQYB 3GVPA 3I2YX 3KXDA 1Z75A 4I4TF 1LLQA 3WLOA 4TTVA 3UCEA 3M49A 4EHNA 1K6EA 4S05A 3SBEA 1PLLA 4BV3A 2CJPA 3WVNA 1AC5A 5L53A 2OD2A 3AVTA 3ICCA 1LPBB 3JATA 4DQLA 3F5FA 1UT6A 4JQOA 2J3EA 2X0FA 5A5DA 1AGRA 2YOHA 1CJBA 3LZCA 5HILA 4ZVQA 2QIPA 5CXXA 3GEDA 4J7CA 2ZJ4A 1HT2E 2D06A 2VAMA 2C54A 3AHGA 4UEWA 2HLPA 1UCFA 1D3AA 1BA3A 4XJTA 2NPIA 1R2QA 2FW6A 2IELA 2ZU6A 3W5CA 3CNHA 1Z28A 1C41A 1UC4B 3PV0A 1IZ8A 4IIXA 2J6IA 1A9XA 2HJGA 5AW8A 3KC2A 2CHEA 4FHGA 1P2FA 2RIPA 4JLOA 4EY4A 1NR7A 3KR2A 4RDIA 4ZT4A 1RQGA 1ZISA 4WBNA 2QDXA 5FPYA 4KREA 5ALTA 4PAWA 4V0QA 1FX0B 4E6PA 2RB4A 2EDCA 4FIZA 1J56A 3O0DA 3WK4A 3X2SA 2YY7A 1XNHA 2QPLA 3OCZA 3HY6A 4QUHA 221PA 4YUZA 2B5VA 4G5YA 2FSSA 4OGWA 1QE5A 2JFBA 5CTAA 2AOXA 1J1UA 2JFZA 1ZRSA 3GC6A 5L3QB 4DV7B 3KPUA 1C8LA 2HJRA 5I9IA 1U04A 3G0BA 2MWMA 3JAKB 4JEUA 3THOA 2DJ5A 3SSNA 3TZEA 5C4MA 1W4ZA 1B00A 3NHYA 5T64A 3VC7A 2PS0A 1OWMA 1BSVA 1RRGA 3KZXA 3PRYA 4GYYA 3R9KA 4F6RA 4B46A 3FTDA 3AP2A 3NYIA 4KDCA 4KODA 5KNCA 1SVLA 5JLJA 3ABSB 1P81A 1E1DA 4TMXA 1IY0A 2ZG6A 3LSTA 3EUFA 1CY7A 3A27A 5KX5B 1RVV1 2HDNB 3IUQA 4RV9A 2ZIEA 5J40A 3CX8A 2R1TB 3C5HA 2G80A 3EA5A 2ISCA 4NVRA 4A1FA 1UPTA 4JI6B 3L4KA 2GK6A 3FNEA 3U37A 1T2FA 4RHYA 1K0FA 3PVCA 1YZFA 1G20A 1GCAA 1WMAA 3M6IA 4EPYA 1GZSA 1N25A 2VHEA 4WXEA 3IQDB 1ULTA 2YUTA 2WWTA 1QQ6A 1XP5A 3GJXC 1GG5A 2I22A 2XRZA 4GM0A 1AUXA 2OLJA 4POAA 3ZBUA 3OH8A 1TFRA 3FJ1A 3K1AA 4IWYA 5KTOA 5LMUB 5KWEA 4URYR 5DWVA 1K75A 3FXAA 4BKQA 1FMFA 2HU5A 4MHOA 4WFKA 1E7QA 3N5KA 4ND8A 2AD1A 4D4MA 3O8NA 3QUAA 2NU9A 3VUEA 5A4FS 5JD5A 4I99A 1NX9A 2PS1A 1KH1A 3WL4A 1ISPA 1T9DA 1YB5A 2ZUUA 4KQWA 1G8KA 2XW6A 4GI7A 1ZD4A 1VMIA 3E9CA 4WLUA 3VNBA 4BNLA 1RQ2A 2WV7A 1SZDA 2JDIA 5EE5B 2Y66A 5HKOA 5J4KA 3D8SA 2ETVA 4I66A 1I4WA 1AKTA 5JWHA 2QE7A 4B3XA 4Z6KA 5KYXB 3IBFA 1L4NA 3WWCA 2MINA 4JCCA 4CU5A 3U3RA 5FBVB 1HC7A 3E5MA 4DWWA 2ZJZA 4ZYLA 2VPZA 4XDGA 1JHRA 3DO6A 1OH8A 1OFGA 2J1LA 1Y4DE 2VDWA 1S2LA 3FMPB 4OHUA 3IP5A 5J43A 4Y6QA 1GKKA 1Z2AA 5AM3A 4KIGA 1QCDA 1P7YA 2PSJA 3CMMA 1RXUA 1L7QA 2Z1DA 3GLHB 4GECA 5ILOA 1E2HA 4YIKA 2E48A 5DEIA 1IQUA 3NOQA 3VXKA 3M89A 1G3QA 3CB2A 2RHJA 4LOAA 4JI4B 3H75A 4RF2A 3KQTA 2B1GA 1HLGA 4E07A 3DTVB 4IHJA 1TC1A 1Y5IA 4GKJB 1H2WA 5LBTA 1FP4A 3PC8A 4N01A 4TSKA 1Z36A 4K86A 3SS7X 4ZC8A 3U7QA 4XVCA 1IWBB 1WBBA 1HYHA 4HDSA 1FNMA 1E79D 4M0EA 2Y0EA 2WY2D 5K3OA 4MPPA 1QO0A 5GADl 3V97A 1VOTA 3IBSA 3NJ4A 1UM9A 3RK4A 3OZCA 2C0CA 1CCWA 4Q0MA 4UXHA 4UATA 2E82A 3OX2A 3JYHA 2J9ZB 3BZUA 1JJBA 3KVYA 1AKMA 1ZX1A 2WVHA 3EFHA 3GCZA 1EM6A 1XZCA 4L57A 4NJMA 4IJ6A 1BFUA 2VSYA 4R01A 2I8LA 2OFXA 1XDBA 2FJPA 2H2WA 3CIFA 4OTZA 2J48A 3N8HA 1KEEA 3UPTA 3F8TA 3MWYW 1JJIA 4PYNA 1XV5A 1KARA 4LV8B 4QBKA 4KTTE 4ZQCB 4R3WA 1EU1A 4QE3A 5L3RA 1EVQA 1TVMA 2G9QA 4JJZA 1PEYA 1WMDA 4B6EA 3EX7C 4MGZR 1EIWA 4NBKA 3SVTA 3Q3VA 1DX9A 4GL4A 1B8PA 2Z08A 1C14A 1JHZA 5C51B 4EI9A 1UK7A 5AM2A 2DU8A 4GX5A 4PAQA 5CB6A 4PF1A 4O4HA 2D2VA 4YWHA 4EAAA 5CRIA 3NFYA 5IKMA 2RH9B 3O73A 1IM2A 4AKGA 4HDRB 2BE9A 2CL0X 3FBWA 1P72A 2F43A 3A11A 3H5WA 3WGYA 5J47A 2JL1A 3DV0A 5H16A 3O21A 4ECAA 4L5BA 5E38A 3WL5A 3EVCA 4B33A 2FMFA 4BMXA 2DC1A 3WGLA 2NYUA 5E7JA 5K45A 5AJHA 1A8SA 3ENVA 4D9JA 4KMSA 4N5HX 4OK5A 4QARA 3MERA 2VHCA 1D5CA 4L9SA 1KFBB 3D0QA 2AZ4A 1VLQA 1RACA 4D9HA 2BWJA 4M60A 3UPUA 3B1XA 1NRJB 2YZ7A 3NBUA 4PLGA 4MVJH 1C1XB 3THXA 1K2VN 5HIAA 2DTDA 1UBRS 4RS4A 4BJ6A 2JG3A 4PSUA 2VQFB 4YBZA 3C7AA 1CDDA 4A27A 4YFVA 4JDPA 4X65B 4YRLA 1DKRA 3Q9LA 4MQFA 4PLFA 1CJKC 1OX4B 2H1VA 1TADA 1SIWA 2A1UA 5DHQA 3RYCA 2PS9A 2C3UA 3CE9A 4XEHA 3VR5D 4GC9A 5TJHA 4C4SA 4XWKA 4P1ZA 5JBQA 5CJ2A 1UDXA 1RQ7A 3FTCA 3IE0A 3QVSA 2R44A 4QXMA 3AKZA 3PNQA 3SKYA 4LCBA 1V41E 2PT6A 4FMCB 1ILWA 1M2GA 1BDJA 1QPBA 1ZOSA 2QI9F 4W8OA 3SLKA 4CLOA 2Q3DA 4NATA 2BGGA 4TRMA 2IPAB 4CIBA 1P4JA 3UOWA 3VPXA 1ZCBA 1U3CA 2F1OA 1Z4LA 2HXSA 1BVUA 3WNCA 5D1HA 5T4EA 3M34A 3MIZA 3RS8A 3G02A 4EPWA 1NBOA 2ZTLA 3TIFA 1NOIA 4HFJA 5K9ZA 3P9XA 2DKFA 4YP6A 4AUNA 3PYMA 1TJ4A 4PSAA 4YMWA 5CB4F 1J8DA 1ODSA 1L7EA 3SBDA 1NZDA 5FFFA 3V4VB 1DRVA 3OQHA 4HJRA 4QHYA 2C77A 4GZ5A 2IHKA 1GFWA 1MGOA 2HUPA 1X7XA 2FPUA 1XU7A 3DR3A 4MRSA 2JI6A 1J42A 2VP6A 1U9ZA 4IUDS 1L5KA 4AY3A 4BS9A 2XLCA 3EDMA 4MMYB 3LL4A 3VX3A 3RYHA 3G9ZA 3HSYA 3HPRA 4PRKA 1J8FA 5JAMA 1QHEA 4FFVA 1J90A 4WZBA 2GD2A 2OEPA 2PS3A 3MLEA 4ZI3A 2QGNA 3EAQA 1DADA 4KV7A 4BAGA 5KMGB 4B3GA 1KJ9A 3UF0A 5EJ9A 1IM5A 1P9RA 1U5BA 4P6VF 3HG7A 5LKRA 2YHAA 3RVOA 1XPRA 3C48A 3C7DB 2AS0A 1YRBA 3DL2A 1G3IA 3QY0A 4RCVA 4XGQA 4UJ5A 3ZV7A 5HM6A 1DUIA 2CVFA 2GRJA 4JJFA 1H2HA 4UHKA 5J2UB 3IJRA 1N6LA 3FNFA 2P2DA 5AXBA 5KCZA 2GM4A 3NHBA 1UBLS 1RWKA 4RKEA 3C39A 3KX2A 3ESZA 5ALKA 3JQBA 2FFQA 1FLNA 4IQFA 4KQGA 1Z7EA 4YO7A 3R7SA 4F86A 1A27A 1DKQA 3MFYA 4IGIA 1IN5A 4BQNA 1GLNA 4EUNA 1DKMA 2IEGA 4FI3F 5ERGB 2GILA 3RYFB 5C8VA 2XDQA 4L2IB 1LRLA 4MUFA 4WAUA 3MLBA 4RH3A 1U9YA 2AG6A 4ZO6A 4Z99A 4EHJA 3KBOA 2XMGA 3PS9A 2J9FB 3L1HA 4X1YB 4XR9A 4JLJA 1E6MA 1JKMA 4U5XA 3V8BA 4QU0A 3MS4A 2UAGA 1E2DA 1EA5A 1JGTA 2CMDA 2VHQA 3AETB 3KUUA 5ECWA 1X2BA 2G09A 5F2EA 1DWUA 1E6EA 1O03A 4WCDA 2BGRA 1UBUS 2QS9A 3LVBA 5BURA 2IBTA 1J1IA 2CNKA 2YN2A 2D1QA 5DSZA 4BFVA 2PE5A 2FZWA 5HW0A 2ZRKA 4D8TA 5I4IA 4KTVE 4M9QA 4IEFB 3C15C 1CUIA 2IL1A 5LMCA 3VJRA 4TYWA 3ETJA 1EH5A 5TMDA 3WLKX 4H1UA 1RLJA 5F3WB 4WXMA 4O4LA 5CVCA 4EFLA 1LA2A 4L8YA 2H63A 4F91B 1GNQA 2Q5CA 1XZFA 3EC2A 3GX1A 4LHZA 1LTQA 2WWYA 4NOMA 3OCVA 5A9TA 2ASVA 2YWDA 1DBSA 1IATA 4UNQA 5F7XA 1M0WA 3OMLA 4KE7A 3E7DA 5GV8A 2LIPA 3PQ8A 3NWJA 3OCXA 2IUUA 5JXGA 2CNDA 2EARA 3SD7A 1IHDA 5JAPA 3T3IA 3RJZA 4PHHA 3B9PA 1IJKA 4Q7LA 1P4HA 3OAAD 1MOZA 1RMYA 1W44A 1ZGZA 1WDTA 3TOSA 4TTQA 2CFSA 1UH5A 1WB6A 1CDEA 1QFZA 4EZBA 3WC4A 1KERA 3E3LA 5ITZA 1MGPA 4F9GA 1U3DA 1JFFA 1KAHA 3A1EA 1QRAA 1KZ1A 3OZBA 1YULA 2IEDA 4HTFA 1GRNA 3D4BA 3WI7A 1GFIA 2TRSB 4M7OA 1PP4A 1OHHD 2JFNA 1UMCB 4BTLA 4F12A 4Z53A 1AGPA 2FMUA 2W83A 5CH5A 5ALNA 2PQMA 1XMIA 5EMKA 1PWEA 3VR4H 1NT2A 2R84A 3I1YA 4FYYA 3UK0A 4A2CA 4EO7A 1NNEA 2CEAA 2PJZA 1JZTA 1IK6A 3MPOA 3RWOA 1I4LD 5E1DA 3Q87B 4YGYA 3UBMA 2OVBA 1GPH1 3CCCA 4MGEA 2P9QA 1TMKA 6YASA 3FDJA 1NP3A 4D0GA 1OVMA 3GRKA 1YOVB 1H3FA 1EDBA 3INRA 5ERXA 3ES9A 2AQKA 4XX0B 3RU3A 1SWWA 4F4IA 3HU5A 4US0R 3HJNA 2WT8A 4OB7A 2VS1A 1DFHA 4QOSA 4AJ9A 4D02A 4PR3A 2VPQA 3TG8A 2YWFA 2UVPA 2NG1A 5I9NA 1QONA 4IJQA 4XD7D 1NSYA 4DJDC 1JEQB 2PSDA 2ZCUA 2A3NA 4OOEA 5CUQA 4ER7A 3DB2A 2H51A 4IVRA 1ZDMA 4LWZA 1SCKA 2RHOA 4GWGA 4AMUA 4G0NA 3MNFA 2ZUFA 4LJ6A 5AFSA 1C4WA 4ALLA 1PGPA 3K0KA 4DV0B 4DR1B 2DWCA 4DL9A 2C9DA 1J2UA 5LBIA 2ENUA 2WWVD 3QKRA 1PJBA 1VHQA 3CPSA 3MJEA 2XMZA 4M0LA 2JIQA 3MCTA 3I04A 4Q9JA 2PPVA 4CZ2A 1XVAA 1XB2A 2G9NA 2JC3A 2P40A 3R0XA 4BWFB 2HYIC 4BQSA 4LY3A 1T6BY 2X5JO 3WP1B 4CIYA 2I6SA 5JT1A 5K09A 3BBLA 1HFKA 4GOJA 3TW8A 3TB6A 1VE1A 2P4EA 4ZDWA 2I2XB 2OAGA 2PGDA 4TXMA 3Q0IA 3VZQA 4LF5B 3NT4A 5DJ5A 1O6CA 3E7FA 3JWJA 3H8SA 4YAKA 1KF0A 2XBUA 1DLIA 2W6ZA 3OFSA 4H08A 1LBIA 4LSGA 2PXAA 4G01B 4R2MA 3EW7A 1JKJB 4G5QA 5KVQA 3AM1A 3PTAA 3KM0A 4N1AA 4QUGA 2QAGB 1ODTC 1I14A 2Q2WA 3KQWA 3L7KA 1MF7A 3TFWA 4BNZA 1LNSA 2QVBA 3BXFA 4P22A 1V11A 2NUBA 2IUYA 1ZK3A 3IQZA 3TIXB 3U16A 3T15A 3PSAA 4QFMA 3C8HA 2C97A 1U0BB 3LL7A 4C7BA 5LL6P 5EJEA 1T6YA 5E1BA 5C1OA 1SPXA 2FSUA 3K70D 2PD6A 2HYDA 4PG5A 1G6KA 4RE5A 4MNTA 2ZCJA 3GO4A 5DVZA 3R6TA 5K3CA 1R12A 2MSEB 4UAJA 4TPKA 2VATA 3D6UA 3G7UA 1H9BA 2HHAA 3R44A 1JQLB 1NXPA 2QL5A 3KWJA 3Q5DA 3QXGA 5AP9A 3DE6X 2FVYA 1QVVA 5FNVF 1Z0ZA 1GZ7A 2XNCA 3WLPA 1AUPA 4AXXA 1HT1E 4MRVA 5EIAA 3SE0A 4EA7A 3SP1A 3PC3A 4NLLA 4KW7A 2XE6A 4LXTA 4YAEA 2XB2A 1TVKA 2VEOA 5EZYB 4GZ6A 1D1SA 1PL6A 2DE0X 1PX0A 3KYIB 4OA8A 1NLMA 3EPLA 1ZFNA 2C2GA 3FPGA 3I9V6 4G5FA 5FXMA 4AJJA 3JQDA 3R9IA 2NZ2A 3SR0A 1UR5A 3PR1A 4RFLA 4KMMA 1J00A 3K8QA 4RUKA 4TV9F 4LYDA 3NP9A 1RYZA 5JZOA 3MG9A 1FU4A 5F5LA 3A10A 3K0HA 1CY2A 4NTZA 4GVPA 4Q5IA 4XVUA 3MCVA 5FB3A 4LNUB 1RCTE 4BMSA 5LIRA 4D9CA 2XMDA 2INGX 3HN6A 2GRAA 4RPIA 2OUKA 4C04A 1MXFA 1DKPA 2IXDA 4BRWA 4AG6A 2IUEA 3DAGA 4ZMBA 4BRSA 1WETA 4EGQA 4XDHA 5K8TA 1MA0A 1OFUX 1GSIA 4BUZA 3ICVA 1JN0A 2Z43A 1JJAA 3TTYA 4B44A 4RKWA 5T3UA 4BTEA 1G19A 5IM4F 4J16A 4HKTA 3PEWA 1U9IA 1PO7A 2D4HA 4FT2A 4JASB 4CQJA 4C2UA 1BHSA 3ENWA 3UMSA 3MRVA 3KQMA 3DDZX 1W7AA 3RW9A 2RGBA 1A8UA 1OFIA 3B48A 4ER3A 4BRZA 2PRJA 5DIZA 2C99A 5HS6A 3OEEA 5TGZA 4WGFA 3X44A 1VJ5A 1NU8A 3DOFA 5ALQA 5DTEA 3PZRA 2PH5A 4D8WA 4CMJA 1SPBS 2RGNC 5A06A 1WVMA 3FM9A 3J81k 2NO4A 3AESB 2H92A 2ZRAA 4OK3A 3T4XA 1D4ZA 3BCRA 2MOKA 5P21A 3PPYA 2PH7A 5DLDA 2JJMA 3NQ41 5REQA 1H2XA 3L0IB 1F8FA 3AV0B 4L0CA 4BO5A 4EVRA 3HXPA 4E2ZA 3T3DA 1YS7A 4HOYA 2FMHA 3WO1A 2O06A 2RD2A 1DU4A 4XUDA 3CSUA 4Q3EA 3I53A 1YK0A 3N8GA 2HR1A 3SR4A 4AJNA 1E6LA 1S2IA 2OQ2A 4YAWA 2Z8ZA 1OW3B 4HUTA 2CLIB 4PPFA 1QWOA 4ZXPA 3IP7A 3NTQA 1Y9ZA 2G5PA 1U5AA 5AVWA 2KI5A 2VXOA 1P39A 4OI2A 3OCCA 1Y6GA 1J2JA 2Z2YA 3BXEA 2JLXA 2ZUVA 1NE7A 5GP1A 3FYCA 3K6KA 1NQOA 4QGFA 4BKRA 4UTNA 3A36A 1OGYA 4LF4B 2IHZA 5GGYA 3UJ3X 1QBGA 2APJA 4KEAA 1VSUA 1YUBA 4LQ4A 5FP0A 4AZ0A 4W7SA 3DJYA 3CZCA 5AM5A 1NSTA 3OOWA 5JU6A 4EX7A 4Z86A 4LBYA 3ZHVA 4EEXA 1Z0DA 3MQFA 3SYNA 1RQPA 5E1OA 1RRFA 1T8WA 5KYGA 1EX1A 1P6XA 1Q12A 3K0FA 2FPIB 3RSCA 2F1KA 3EOBI 3ITNA 3KFLA 4L8WB 4Z7QB 1K2WA 4GLLA 4UUBA 3EPRA 4YQZA 4NKRA 4BYGA 3WIVA 5GV7A 3EYWA 4HEJA 4Q1AA 2HSZA 2VBIA 1GGJA 4UBJA 4F4HA 3PYLA 3Q9NA 3K30A 2JGNA 1H5QA 2FN3A 2KWIA 4JKOA 4N03A 5HCUA 4CE6A 2V3WA 2I9PA 3IBTA 1G5QA 1U1IA 5F51A 4QSMA 2BHSA 2CEKA 4RMIA 5LOVF 2P67A 2P27A 4K1XA 2AFIB 4RPCA 4RA9B 1I9CA 2AE2A 3B1YA 4NCXA 3ASZA 1QF6A 2XA1A 4C4ZA 2C92A 1JAIA 3PUJA 5HFAA 1FSFA 1KNXA 1YGPA 2CXPA 4D3ZA 3LF1A 1SJ9A 5ESDA 2FEOA 4MEBA 2VF8A 3I6ZA 1ZIYA 4D4IA 2FMKA 3V8QA 5GZ1A 4JGGA 4KNVA 3SQMA 3GVCA 3KJZA 4D92A 1SCJA 3E22B 2OO5C 1T43A 3I9NA 4BJ5A 5M29A 1YCGA 3I76A 3N0RA 4PYQA 4BCCA 3IE1A 3GPLA 5KTNA 1MB4A 4UVHA 5D3KA 4NS4A 4CL2A 3O8OB 4G25A 4X63A 5ELXA 2ZB8A 2NAFA 3VO8A 1Y7TA 1IOZA 4KX5A 1M33A 4IOJA 1ISSA 1BOOA 5GWXA 1DBPA 1T1EA 2PUTA 4CMCA 3FPEA 2AQ8A 2DT8A 3N2EA 1WVGA 2VDRB 4ZVSA 1P19A 4MV6A 2C57A 3FUTA 4RZXA 4GP9A 1TCBA 4AZ3B 4HLQB 1LPPA 1NDHA 2OD7A 2Y0PA 3GGCA 3PB3A 4NDZA 4R81A 3SDZA 1MO3A 3EWSA 3KQYA 3L7JA 3TRDA 5BWMA 1CJSA 4OQYA 4WINA 2V45A 2GN9A 4YDQA 3ZVNA 1UMBB 3FUWA 4Z4FA 1T6XA 4DPLA 1E5XA 1EVZA 3BKXA 3GG2A 4QICA 5WRFA 3WAKA 3DDWA 4W9MC 3PIRA 4BVGA 2JFXA 3IKJA 2VNHA 5AOBA 1E32A 1E2MA 1E7MA 1R6DA 2JLBA 2ECPA 4RKRA 4XIGS 4ARAA 4ESHA 1FYXA 5CXQA 1JDVA 4MDFA 3LGAA 4HAIA 2MMCA 1SOUA 1YS6A 1V1MA 2TMGA 3T41A 2VP3A 1M9NA 3H0EA 1NG1A 1E61A 1EEHA 5A04A 1WF6A 2X4LA 5EIOA 4ZOQI 4L3VA 2QRGA 1DWPA 2IX3A 3GDGA 4PNEA 1N5MA 3OCYA 3SICE 1Q95A 4AJEA 4LTNA 1E1MA 3H1AA 1E96A 1DLJA 1YJQA 2XMSA 1NATA 2OFWA 4CFYA 1JHAA 3ZN2A 2H2FA 1XDZA 4RZ2A 3D4OA 5B30A 3PHGA 1DWQA 3VHXA 3DZFA 4MV5A 1W2GA 3S70A 3RARA 3DD5A 3USCS 4GUAA 4A73A 4AICA 1GLVA 1M1YB 1XZMA 2EBFX 2Y1EA 3CE6A 4HDMB 1OBHA 3V4OA 4A8HA 5CEFA 4N0QA 3MZ0A 1JQDA 3WMFA 4TMKA 1Z37A 5FL3A 1NVVQ 1XTTA 2RGGA 4FFMA 5J1TB 1TF7A 2Q1UA 3O2NA 5EKDA 3NR2A 3QITA 1E6CA 3PHJA 1DX4A 3C3CA 4DQ0A 1II8A 1T2VA 2D74A 5DV9A 3ROEA 3UB4A 4D3YA 4TRJA 3G8AA 4V24A 2EYQA 2OBMA 3RIXA 5LN1A 3RYTC 3BMQB 5BV8A 5HE9A 4HI0E 121PA 3IB6A 2ACEA 4C08A 1MC4A 4NFLA 3CLTC 3CQ9A 3NKLA 2J59A 1LLDA 1AKNA 2GBIA 2V7VA 1D0IA 3IKMB 1SZPA 3TOXA 4QJIA 3PD1A 1QRRA 4I6GA 4RELA 2G77B 1SBTA 1VHWA 1RR6A 3CU5A 2J07A 3FOCA 1AT1A 2B30A 2ZUCA 4BVFA 2KMLA 2FDRA 3O2SB 3L6OO 1RLOA 2PU7A 3TRIA 2J33A 5B57C 3EIUA 2XJ4A 3OPMA 1WSBA 3VYVA 3ZC3A 1R0LA 1DQSA 3CB4A 2Z4SA 3I8OA 4CTNA 1NYTA 3A05A 4C0XA 1OIVA 4EZIA 4DSTA 4KVAA 4RETA 1SG9A 5CD9A 1C9JA 1XI2A 2XGOA 1UWLA 4JYAB 1Z12A 4MCAA 2FQWA 1N1GA 1XAJA 2P0YA 1VXRA 1T3TA 2F1IA 2L82A 4B2LA 3GLKA 5JTTA 1K5PA 4C7KA 3AEQB 5DISB 1VJCA 4MV0A 3KNZA 4JU8A 4P35A 1UZNA 4BHTA 4EH1A 4R69A 5KTMA 1IUKA 3M0EA 4DEXA 1NBMA 2OORC 3QE4A 5ALXA 1BH2A 4WBSA 2RI6A 1EXMA 1JUDA 2OV8A 4D82A 2WLSA 1G5IA 5F2NA 3PQ7A 4NSNA 4TTTS 4NYMR 2NO1A 1P2GA 2NM0A 1OWPA 5J5CA 1LPAB 2IIPA 1H8HD 3AY6A 3HJGA 3O0TA 4UZEA 3UICA 5JZSA 2PO5A 5KZMB 5CEEA 2NSDA 2OBFA 3AKEA 3PUKA 4CTJA 4DMMA 5I9LA 4R98A 1XCOA 1FLAA 1GT91 1ESMA 1T36A 3EISA 4FW8A 4G5RA 4QVIA 2B8JA 2PFGA 4OM7A 2J85A 2XTMA 3N74A 4P4TA 5IS2A 1B1CA 1DOHA 1Y81A 1P9WA 1I2DA 3B89A 5A2GA 1XA3A 4KO2S 3F6EX 5EWMB 5SZKB 4AT1A 2I3AA 4R1NA 1DRKA 2PT9A 4R84A 1XTBA 4ZO9A 1Z2OX 4BO0A 1NJGA 1QIIA 2H59A 2VBFA 3EXIA 3TTSA 4EHDA 2IXAA 4ZPJA 1U1DA 2YFQA 1SVWA 4K9MA 3ZHRA 4ZFNA 1VXOA 1UJ2A 1W47A 4DMGA 2Q27A 3QVOA 2BZ1A 2IEIA 3RVMA 2W4QA 4JEMA 3TEMA 4LYGA 5AXAA 1TUBB 1NQXA 1QYCA 2HK8A 3ILYA 5CVTA 2NZWA 2CZQA 1N7HA 1YE3A 2J45A 2A5YB 3DV9A 4MRMA 3R0JA 3UA3A 1STOA 3KJQA 1JQEA 2ZYGA 3EF3A 3SC2A 4DJTA 2X77A 1MB3A 1YIAA 3DUFA 3VR0A 3WGMA 2RGYA 2Y1CA 4G0OA 4ZDKA 1EJ0A 4DMKA 1C30B 2IHUA 1SC3A 3ORQA 4RZHA 3NBQA 1YR6A 2GNAA 5FTJA 1KMHB 5JTUA 1GAQA 1NTOA 4ZI7B 4PYKA 1XEWY 5EZSA 3FNIA 3RJTA 3RRJA 1XT6A 3QHAA 1EZ1A 5C53B 4U7HA 1JVNA 1E5DA 1BMTA 3CEMA 3HUEA 3L8ZA 3OA2A 3PXCX 4RENA 2OKCA 1MC5A 2AI1A 5HCNA 1E9CA 5HGJA 5EIBC 5A3SA 2I1VB 2WI8A 1L5FA 3OZAA 4Q01A 4DTIA 2JD1A 4YAUA 1YDGA 2GJ8A 2HA7A 2XRFA 4Y7CA 1WZNA 1MAWA 1QX3A 1U2RA 2I7DA 1RBYA 1VE6A 1IEXA 4IDQA 3RRYA 2W2OA 3D7KA 4ZCMA 3AK4A 3TTWA 2Z6QA 2QSYA 2IEAA 4Q66C 2HRBA 3AM3A 3BGSA 3I61A 1RYHA 3ROKA 1J6UA 2CHFA 5CBPA 2GPNA 3ONWA 2NU6A 3UQYS 4GPIB 4NBTA 5HUQA 3GNLA 4TKZA 4DCNA 5BT8A 4J4HA 4YP1A 5C8ZA 2XCLA 4YY3B 4ANFA 2QVGA 2ZYVX 1E3SA 2I3BA 2QTWB 4IFEA 1W87A 4LI3X 5TQ2A 2K7FA 2NUAB 2ZUDA 2VQ3A 3TFOA 1J1ZA 2Q5EA 2J7PD 2HSDA 1VIYA 1U63A 1MB2A 5GQSA 4WLVA 5EYPA 1MABB 4CF4A 4JI8B 1XNGA 4JKIA 2YVUA 721PA 1VHDA 1KBZA 3AZOA 2MMGA 2EL7A 4PRYA 4LISA 4C0QC 4ENSA 5LDHA 4XLZA 1GCGA 3K9GA 3N0WA 4I5GA 2RE8A 2WJWA 1V3TA 1U8TA 2XB4A 2QG6A 3AT1A 3NAQA 4LJ8A 5D6NA 5DCWA 2R87A 3VH1A 3H1EA 3BZWA 1DXHA 3M5WA 4LK3A 3QSGA 4J07A 1F4LA 1DZIA 2VBGA 3K16A 4MS3B 4RW0A 4XQEA 2XZLA 5FA6A 2OO3A 3AR5A 2QN8A 2AF3C 3H11B 1PNRA 3CIOA 2GN1A 1H2YA 5DYYA 1M34E 4DDKA 2GWRA 4D0RA 1XQWA 3WMRA 1Y8CA 4URVR 2EX0A 2OZVA 5FWAA 4V1CA 2P6MA 2YY5A 4D25A 2Q62A 3EPPA 4QQ8A 1ONSA 3VHQA 2C2KA 1KOGA 4BGUA 1Z6TA 2WB4A 1T25A 1NVDA 2WWRA 4L6CA 5GZ6A 3SQDA 4DG8A 2A5DA 3ZDQA 5DEOA 3Q3JB 4RE6A 5EPOA 5TGTA 1PJ2A 4LF8B 3AJ9A 3B85A 3I3OA 4WESA 2OHVA 2X1VA 4YJDA 5DO9A 5HK9A 5JV5A 2X15A 4M83A 5EXDA 1I3NA 3KKQA 3WISA 1IFXA 4J94A 5KJ6A 4BIIA 1HL7A 5KVAA 3DKVA 4GMXA 2OFOA 4DMLA 3G5MA 3S29A 2RFLA 4OUKX 1Z6XA 4MB2A 4DCVA 1DQNA 5D6OA 4B45A 2R8XA 4CF3A 3TFQA 3O3OB 4QYWA 3W1EA 3TOCA 4CHGA 4XIYA 4IGAA 3AEYA 5SY9A 4DIOA 4L0MA 3BYZA 2HF2A 4JEIA 1TB4A 4F3RA 1NPDA 3HN7A 2N1MA 3FGPA 2WABA 4MRRA 3MUFA 1WSWA 3DF7A 1I0IA 4Y1FA 4CMHA 1F8UA 5EJ5A 3VKUA 3GEIA 3OLZA 3UW1A 1DQZA 3D7LA 1C9MA 4WTOA 2QD4A 3FZQA 4EJSC 3FHJA 4L5JA 3EVBA 3IJEB 3KHTA 1O87A 4IW3B 1HNNA 3ENZA 1NRWA 4COKA 2NX2A 5I7HA 5B2ZA 3TQOA 4DB4A 1Y7HA 3V55A 1OB5A 3CPHA 3ETCA 3I12A 4W5JA 3LCRA 3LF2A 3LDHA 3WBBA 1WHTA 5EINA 1S8FA 2J9RA 4MW4A 3GFBA 3O2JA 3W2EA 2PZEA 4QDKA 2GPSA 5KSOA 2JKZA 1F9AA 4QBTA 2R86A 4ND1A 1ABBA 1IIRA 3FYUC 3JYOA 4PCAA 3CNNA 1VBMA 4HPXB 3TLAA 4AYTA 4Q37A 4FBGA 1Z4OA 3GZ4A 2VUTA 1TTHA 1BOFA 1UWKA 4F5WA 4I6JA 1VKNA 3I2HA 1TIPA 4CN9A 1H8EA 1PX2A 4KPFC 5BRAA 1QNFA 5JXHA 1B0UA 1YH3A 3LQFA 5T4FA 2HXYA 2TECE 2I2BA 3CUYA 2RGNA 4BMOB 1YRYE 2BFMA 4MOWA 3DXXA 5HIJA 4G0WA 1SOMA 4E08A 4FXPA 1MEEA 1BHJA 1O97D 3B51X 3L8GA 4IO0A 3ZKWB 4MUXA 3V7UA 2A4MA 1N1MA 2JFFA 2R7NA 1FBTA 4YHBA 5AI6A 4YTEA 4DM7A 1ZW1A 3TCKA 3R4VA 3U6BA 4BN4A 4YHHB 4CCSA 5CT6A 2C8LA 2WTUA 2ILVA 1JALA 3E70C 2OZLA 2R97A 3R3JA 1GSAA 3P9ZA 4DLKA 3HA7A 3WZ2A 4F7DA 5JH7F 4YT2A 3RVJA 5I3CA 2N42A 2ZRJA 5G3YA 1FS4A 2EW1A 1GQFA 3BMOA 4B6QA 5BMVB 1OGIA 4YR9A 4QHSA 1N9KA 2C07A 1N5DA 1PG5A 2PGNA 4D5EA 3JQ7B 1J70A 1RADA 4NP6A 5JXJA 4ALIA 1EDOA 3NNNA 3OPXA 4HX2A 1CYEA 2QR5A 3GCXA 1E4EB 821PA 2Y05A 1WV0A 1C1DA 1SG6A 3GT7A 4LJKA 5DK6A 3O38A 3L1KA 4E0BA 1VYHA 1P6UA 3GRVA 1OPRA 4DCUA 2FA9A 1N0VC 3L05A 4Z2AA 4PN3A 5KHLB 1AVTA 2TMDA 4D26A 3O90A 1ZCJA 3K09A 1DXYA 5EE9A 1LWOA 4E3ZA 2EZ9A 4I46A 1NBHA 2H08A 3RS4A 4MUEA 2Y1LA 3F0TA 4Q02A 1N75A 2IY8A 4L8GA 1W5AA 4DR2B 2QWXA 3WLQA 1BKDR 4RTLA 2REOA 1CZUA 4A8TA 3RSFA 2D5AA 1IRIA 5FBLB 1WNTA 3P94A 5KVCA 3BL6A 3HVRA 3FWZA 4FMCF 3PDIA 4G85A 2W2LD 1OZGA 1EUDB 2OCAA 4DSZA 3R76A 1OH6A 4PQRA 1HDIA 2FR8A 3AHIA 3MTQA 4D57A 2H0RA 3OCJA 1CETA 2Q41A 2IDKA 2C20A 4NABA 1RKQA 1YU9A 1PV2A 3G2NA 5H81A 1BS1A 2FFRA 2H0AA 4K6KA 1C3OB 3V7FA 1T6NA 4Y1RA 3ORSA 5CIWA 5J63A 4C4AA 5AW7A 3AFHA 2QN6A 4MGKR 3DV2A 4P7GA 4AKSA 1C3JA 4AIIA 1FZTA 1R6AA 1T35A 5FPSA 4C22A 3DDUA 3HCCA 1X1BA 1P45A 3HBNA 1IXRC 2O8FA 1KZGB 1JMYA 1KFJB 2A0YA 3QQPA 3W9YA 4S12A 5IVHA 3MGBA 3WV4A 4PPYA 4P7FA 1QRSA 1VRCA 3LVFO 4F4FA 4C89A 4ZKDA 1TYEB 1YZNA 1RIFA 1UBOS 2GCOB 2BSXA 3BWXA 3EHDA 3GGPA 4KH0A 2OD9A 4ZAVA 4ZTBA 3DCYA 2FEMA 2X8WA 5IP5A 5DM70 1UFRA 1XKXA 4K9LA 1Y7IA 3FCEA 1Z7BA 4FHFA 4J91A 3RG2A 3IHKA 4DQXA 1ISGA 3VNUA 3FLAA 1YHYA 1ZU4A 1X39A 3IPYA 3KJNA 4OO3A 5ESWA 1XD2B 5CT8A 4BFLA 4BUJA 4OQZA 4ME6A 2V96A 1UPXA 4KPUA 2Y0BA 1A50B 3QVGB 1LW7A 4AZVA 3K9NA 2ZRQA 2FPSA 4MJXA 1YVEI 4YROA 1KJZA 1Z82A 4BFYA 3GUUA 1YI1A 2C5SA 4MWEA 4NBVA 2GD0A 1GPAA 1U8ZA 1U2GA 1CVLA 1UJNA 3B38A 3OTIA 4QOGA 4IYJA 4Y6OA 3PWTA 3C6YA 1GXSA 4WW0A 1CZOA 4AZSA 3KS9A 2C2YA 1GG8A 3ZVMA 5FAXA 1WBDA 3Q1LA 1M7GA 3PUXA 3VR3D 5INTA 2I2CA 1XZIA 4ZTZB 1Z68A 3IIMA 3IQGX 3MCUA 3AR2A 1YU6A 5A3RA 1Z8HA 4DWVA 1QIEA 3V8EA 1WUYA 1XTQA 3MB8A 4M9SA 5DLEA 3AVUA 5FYQA 4F4DA 5JO9A 2ZYIA 3CPEA 5H1YA 1Y6ZA 1OLSA 1PJ3A 4RCZA 2H18A 4U6SA 4ZVVA 3EPJA 4C0SA 1PSWA 1SQSA 4G0PA 1KU0A 4OHYA 1GZUA 4MUAA 1KFCB 1KH3A 1TT5A 4D8UA 2OLKA 3GFVA 1YF3A 1S3FA 1NW5A 5BUZA 3PIDA 1D6SA 4DIKA 2FW7A 2CFIA 4X7RA 1IUOA 4IIEA 1PQYA 1KO7A 1TYCA 3ZK7A 2IYPA 2FK8A 1TTPB 4M9ZA 4MRAA 4ZO7A 2NWQA 1AXEA 3F2VA 5FL7A 5BQFA 3QKUA 2GZ2A 1TJ5A 5KNBD 3F1LA 1E0SA 1L5RA 4KN5A 2PL9A 3JQGA 2QGZA 1CY6A 2G72A 2OILA 2CBGA 3ELBA 2PUCA 1AOXA 3EF0A 5G4KB 4ZYZA 1D0VA 5EIEA 3KR0A 1UZUA 6ADHA 2GZSA 1FF9A 4AAYA 4EMSA 2XUZA 4KUHA 1QH8B 4YNBA 3WLAA 1A98A 2H1WA 3LSYA 1J23A 3CRVA 4BFXA 4DEVA 4MVJG 4B7CA 3EASA 5D7BA 3INGA 3BGOS 3FZGA 3QRWA 4P5EA 3TZ6A 3FR7A 4DV2B 3H3FA 5HF9A 1J25A 1G21E 1XYVA 4EPTA 1OJLA 1PZFA 1NUHA 4J3FA 4QSHA 4MUHA 1MVLA 4M38A 5EMHA 4YRJA 2GKOA 2XCTB 1YFLA 2C7QA 1LPSA 2C29D 4LNAA 3ZDDA 1LGYA 1AO3A 1TJNA 1TYBE 1XD9A 1XGKA 2OGZA 2HA4A 3BZBA 1LF0A 4LCEA 4IFTA 3M6AA 4R9NA 4DSNA 4FX5A 1A7JA 3A4TA 5IJ9A 4P84A 4KBYA 1GAXA 3MBIA 4LRQA 3EXFA 3M33A 2ZM5A 1OAOA 4U7JA 2F9FA 2JIZA 2QE7D 3GLTA 4NJEA 5ARDA 5B3JA 2ZETA 2K5UA 3BRCA 4CM8A 5K51A 1WZUA 2IS2A 2C2WA 4KGDA 4CT5A 3RVKA 2GD1O 1ZJ6A 2X1LA 2QJRA 2TMKA 3BG5A 2IBSA 2Q6LA 1XQVA 3PC2A 4QWWA 4XW2A 3NI2A 1HSOA 3AU9A 3OP4A 5EP4A 4ZZ3A 1NONA 1EFVA 2VUSA 4J90A 3IAXA 1ANKA 2NOAA 5ECDA 3WIDA 4LOJA 4TSFD 2V7UA 4MGYR 4KXFB 3OJLA 4W4TA 5JAUA 1WZ2A 4A2PA 2E4VA 2EW8A 4Y2JA 1H4SA 1PWXA 5G0UA 4W5QA 4E21A 2HWUA 4G89A 2B1IA 1H69A 1H0HA 5BVGB 1FDVA 2D59A 1VPWA 4IH1A 2G06A 3T1NA 3UJ8A 4M37A 3JPYA 4X92A 1L9KA 4BBAA 1FBNA 1ZD3A 4FZVA 2RJNA 2OFPA 1EDEA 4H31A 1YSCA 1L5GB 4WGGA 5HRUA 5B55A 1HM5A 1O5OA 4D3SA 5H02A 4M87A 2VSXA 2ZBVA 3DNMA 1LWNA 4V2UA 1OIWA 4KWEA 3JQFC 3QELB 3AF3A 4R05A 1O94C 3OSUA 1PJ8A 2MSDB 1UKBA 1Z6QA 2B8NA 3F6CA 4M8SA 2BFDA 4EJSB 4IMRA 1QYVA 5CYPA 4KR3A 1J0CA 3WQQA 4K46A 3I72A 2A0WA 4CL0A 1JILA 3DLIA 4R0MA 1PWZA 2OG2A 1XF9A 2QD5A 2ZRHA 5HK8A 4EW3A 1Z25A 1FRZA 3GMDA 1KKLA 1GTVA 1LBEA 3GFTA 3OZVA 4L75A 3PNSA 4HPWA 4N4AA 3NAZA 4OJQA 3WQSB 3HXQA 4UEOA 5J4LA 4J0QA 4PZCA 4R83A 1RXIA 5ICEA 3CS3A 5KTSA 3KWFA 1T4CA 3HUFA 5B3AA 3LZDA 4Q1VA 1T1GA 1E9RA 2Y9MB 4KIFA 4PNHA 1HG1A 3OFNA 4CQMB 3K2EA 1RHRA 3O8LA 1LJ8A 1CR6A 2Q2QA 5AW0A 5L3SA 3EZYA 2M1XA 2PUVA 2HF7A 3ONFA 2FUEA 3U49A 1K3TA 1Q50A 1ONNA 3N86A 4Y2UA 3NBXX 4KSYA 3GJ0A 2H9AA 2JGJA 4M3NA 1TC2A 1BHQ1 3GJSA 2V5VA 3HVUA 2Q50A 2OXCA 4TVBA 1Z5NA 1LVGA 5TB5A 2VJYA 2D0PB 5FI3A 1T9GS 3G0HA 2Y76A 1CG6A 5DYWA 3P2OA 4UHJA 1HI9A 3GYBA 3VYRB 1G3UA 4PZUA 2VDVE 4E4YA 3S1SA 1EWVA 2JHAA 4M6WA 4X7MA 4YT5A 2HUNA 4NMMA 4U6QA 1LNQA 3DQQA 4U2DA 3ZNQA 4ED9A 4DRXB 1G291 1U7DA 2YHSA 3IMFA 4K1LA 5D86A 1IBMB 2OQIA 4P31A 3H83A 2GRUA 3AHHA 5CGZA 3V7YA 4R7GA 3RU9A 2R7KA 1ULSA 2DETA 3OLQA 1G0NA 1B8OA 1TQDA 3LPMA 1V2GA 1VKHA 2YFYA 2ZJ2A 4P0PB 3K1TA 2AC2A 4ZP1A 2RG1A 2VLBA 2EBUA 4P80A 4CTMA 1P74A 4CGZA 1IBRA 1CJCA 3JALB 3HJRA 4UNRA 3R74A 2X8JA 2ZBQA 1YBHA 3R3YA 4EO9A 4EUKA 4FFSA 4HDKB 3AU8A 4Y2PA 3HLKA 4UEQA 4JYMA 3T54A 2HBZA 2OBNA 4KC0A 3FDZB 4C1BA 3DZGA 2GF0A 4L0DA 1D7OA 2ZBPA 3WB0A 4OREX 4X85A 4Z0PA 2RK3A 3IQXA 3Q5EA 2Y99A 4N0EA 3LT4A 2FFAA 4P98A 4G4IA 2BKUA 3T7SA 4YRRA 3X1KA 2HCFA 2VBCA 2GK3A 2FR0A 4QOHA 4RPJA 4X1KB 3C7KA 2XQIA 5ALYA 4DMRA 1E1RD 1NY5A 1DMSA 5JD6A 1NW4A 4KDFA 3GRFA 2IPNA 1JH8A 1AGNA 2RKWA 2ZLBA 2ZJ3A 3ODGA 1N6IA 4Y2HA 4H7IA 3TSWA 3WRXC 4B3JA 2PM8A 1OFHA 2XYHA 3KEGA 3IFSA 1JDBB 1KYIA 1BG6A 3OD5A 4NOKA 3R6WA 2PRIA 3AJDA 4RD1A 4DJFC 1AQ6A 2VSQA 2YC4C 3PBKA 3CNOA 4HGPA 5CFOA 4NV0A 2V6IA 4R0NA 5AUQA 3RKRA 4C2AA 1E3DA 1R6UA 2HNKA 2QU7A 1QZUA 2A5GA 1YL5A 1O4VA 4U8GA 2DFLA 2H2GA 3LWDA 3GWGA 3K4PA 3K2BA 1DVRA 3KTAA 2QV7A 3HKDB 3ONEA 4QQKA 1XRSB 4HMQA 4WLEA 2G07A 1MV8A 1Q14A 4LBWA 3TD6A 2VUUA 3KQPA 1NYQA 1X9GA 1OKKA 5BN3A 1KDRA 2QTLA 3A4YA 3N2IA 1BS2A 3D6FA 3QXSA 4Q7KA 2P5SA 5KOJA 2LRHA 2YMMA 4PHCA 3S44A 3QUTA 2OV6A 2WYOA 4EY3A 3DOHA 4MWGA 2ID4A 1Z07A 2V9ZA 1TM1E 3C3YA 4RPLA 2II6A 2HCJB 3EVFA 2RCNA 1J2TA 4QOFA 2GJ9A 4YYZA 2WF8A 3T3EA 3QU9A 2XSZD 2AFHA 1WKVA 3CT4A 1YQWA 3PDJA 3TEFA 1O96A 1L4GA 1FDIA 3GVHA 2JGLA 4ZRMA 4DV3B 2OOSA 3LFTA 4WADA 3CVUA 4R1LA 2O7NA 3RYCB 2D5LA 3KZ1E 2JH9A 4P2GA 4R16A 3ZHXA 3EZ7A 3LW7A 3S81A 4JJ7A 1APBA 2FOIA 4BNWA 3OM1A 2VN8A 3ZXXA 5AUNB 3PKIA 2EBHX 4AD8A 1N77A 1UMKA 4MITA 2JIRA 1A9SA 3OPVA 1R18A 4FWBA 1MHTA 2O50A 3LHFA 4II3A 3VKVA 1P5JA 5EP1A 3TVYA 1XN4A 1U4SA 1UINA 2Q1TA 4WRRA 1LC3A 2C3OA 2X2FA 1KI8A 1E7YA 1SRRA 1M1UA 1HFEL 5CA0B 3COSA 3EQ9A 3HMQA 5KO2A 4TWZA 1A7AA 3W8DA 3CRW1 2F6RA 3IB3A 2FK7A 4MSUA 1XAIA 2W8BB 2XVZA 1L4YA 4Y6GB 4DCCA 3DKIA 5DNAA 5JXIA 1UK8A 2FGJA 1JEYA 1AMOA 1JHYA 4RANA 2GBGA 3JAWA 3MJ4A 2C5GA 2DKNA 4YBRA 4PYOA 2ERXA 4XAQA 1J2YA 1SCAA 2GCNA 2JLQA 2I0FA 1W30A 2PH3A 4RVFA 3DDOA 1A5BB 5IC6A 3BGIA 1CFZA 3ET4A 1KDYA 4ZMRA 4QM7A 3DA8A 4P3YA 1SCQA 1YTLA 2EQAA 2WMYA 3U7IA 2P30A 2P0AA 3VX4A 2GKSA 3ZD8A 1ZGCA 1DL5A 1ZH4A 2BMJA 1RSZA 2COEA 5KHOC 1TJ3A 4YRDA 2FB9A 1LI4A 4DLRA 5DGDA 3MCWA 1E3IA 2MSLA 4LDJA 2IEBA 3UT0A 3ZW8A 4WE3A 4P3NA 2BFFA 2VI5A 1NW8A 5DGTA 4A0HA 3BICA 5JPCA 4WMLA 3L07A 1X7GA 2OB1A 2SICE 4FZ5A 1ZQ9A 4RYDA 4UD2A 2NU8A 2Y0CA 1QH1A 3CO5A 1KPHA 5THQA 4YCCA 1MV5A 2C4HA 2W6QA 2ZKLA 3A32A 3NB0A 1P9OA 4M0FA 4ZCTA 1GPBA 2O2CA 3RFCA 4AWAA 3RODA 5ITVA 1LD3A 2NZJA 1FDWA 2HMYB 2YMLA 3O84A 3W9SA 3VR6H 4ZWNA 3IAEA 1AKYA 3BC1A 4U2GA 1QK5A 2AB0A 2Z1NA 5EXXA 4F2WA 2GO7A 3PXUA 5J4YA 2ZYWX 4U7FA 8AT1A 5M04A 1I0ZA 4TUYA 4TYNA 2ZJ1A 2AW5A 1CUXA 4TWIA 1AF4A 3RUDA 4XSGA 1XZQA 1XZ8A 1HA3A 2X4DA 2H1RA 3KE9A 3HBAA 2DEUA 2DXIA 5CLFA 3WDKA 2Z9CA 4DREA 3JYPA 1YAJA 1OYOA 3BWEA 4NBSA 1EGVB 5LP6C 4LFBB 2Q3CA 4UZSA 2O8CB 1ZHFA 4WXRA 5GJVC 1TDJA 3ZDYB 1ZRMA 4G41A 4S1NA 1QCYA 3EIXA 5K6RA 4C0KA 2I4LA