4U2GA

Crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAHEILGVNAFMRETVSWLVDQGYAAVCPDLHARQAPGTALDPLDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHLPYSNGKVGLVGYSLGGALAFLVAAKGCVDRVVGYCGVGLEKQLDKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEGAGHSFARTGSSDYVASAAALANERTLDFLAPLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas knackmussii
molecule tags Hydrolase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2gA00
3W9UA 3FSGD 3R0VA 1XROA 5HQ3B 2WTNA 4UBKA 5JD5A 5FPQA 4HXEB 1K6EA 2ZJ7A 4K6KA 4HXFB 3R3VA 2H7CA 2X76A 4C6HA 4CCYB 1ZGBA 3FSGA 2B9VA 4KAAA 5EI5A 2VJBA 3E0XA 3DDUA 4J0GA 3QPAA 4XJVA 4L9AA 3W2TA 5LZ5A 4CI9A 4WFIA 5F4ZA 1O6GA 5K3AA 3YASA 2G4LA 4ZV9A 2Y6VA 1QIDA 3Q0TA 5DJ5A 1XZKA 1CIJA 3C5WP 1A7UA 1WB6A 3VVLA 3KSRA 4P93A 2XQIA 1H2XA 3FCXA 1UK6A 1JMKC 2PVSA 1GQSA 3EF3A 3I2GA 1A88A 2OCLA 3N0TA 1UXOA 2PSJA 4RPCA 3KDAA 2HA3A 2XMDA 5HF9A 4GECA 2OPHA 5EGNA 2VJCA 5AM4A 4BVLA 5A6VA 4G1FA 4P92A 1GPNA 4CIBA 2XUJA 4UBJA 3DQZA 4HS9A 2XDWA 1CLEA 1G4HA 1QIIA 1MAHA 2GBIA 3GA7A 3D5EA 3HI4A 2C4HA 2JIDA 1XFDA 3AZPA 3DLTA 2NW6A 3WL5A 1YS2X 2ZYSA 2XE4A 4WDQA 2ONCA 1BN6A 4BAUA 5C7YA 2XQGA 4J03A 4B81A 3WWPA 2W22A 3FYUB 2Z3ZA 1TRHA 2GBFA 1IUPA 3FLBA 3WWOA 3F67A 4X93A 4BRSA 4X71A 4B0OA 2GBGA 3ESCA 1EK1A 5CBKA 4KE9A 1P0IA 1DWPA 1YA8A 1Q83A 2I3ZA 1IUNA 3QMVA 1XRNA 1QTRA 5FV4A 3O4IA 4W63A 3E1GA 3H2KA 5C8VA 5CW2A 1T2NA 3N2ZB 2R8BA 3ICVA 2JGIA 1J07A 3I6MA 2OG1A 1XRLA 2PPLA 1EHYA 2H1IA 5AKYA 1R50A 4Q34A 2HA5A 5E4JA 2O2GA 2ZVDA 4RGYA 3BIWA 3AFIA 2FUKA 2AJ8A 2PM8A 4UBNA 3HABA 3O9MA 3A6ZA 4X85A 5DNWA 1ORVA 3D2CA 4HZGA 1BRTA 2PSFA 1BS9A 2JEZA 3DYVA 3BJRA 1P0MA 3BL8A 1TCAA 4CG2A 4X90A 2HU8A 4L72A 3OC0A 3MUNA 4WY8A 2AJBA 1ORWA 1SCKA 4EZIA 4BBZA 1U65A 3Q8WA 1QONA 1ZICA 4ROTA 4BAZA 2FX5A 3BJMA 2OCGA 4AZ3A 1CUSA 4OB8A 1UK8A 4MJ3A 4BTVA 4BCBA 1C7IA 1SFRA 1H2YA 3IA2A 3C8DA 5IH7A 1GPKA 4HTAA 1QIJA 2WUEA 4GW3A 4PV7A 3GZJA 4EBBA 2B4KA 3K2IA 3O4HA 4LXHA 2PSDA 3PUHA 3WK4A 3O4GA 2VJDA 3QMWA 5ALPA 5CXUA 5AKLA 2C58A 4IH9A 4G4JA 5AK4A 4BP8A 1W1IA 1YCDA 4BDSA 3O4JA 1BEZA 1K63A 1XLWA 4ITVA 3LP5A 3STVA 2Y6UA 5AICA 2RHTA 2ZJ6A 4M0EA 5ALQA 1WHSA 1LBSA 3AJAA 4J0IA 1UFOA 2BUBA 2WHPB 5K5EA 5AI0A 3ZPXA 3FNBA 5DYWA 4G9GA 3KD2A 1H22A 4B9AA 3HXKA 2XMCA 3VJLA 1VLQA 2VTVA 4LYEA 3PF8A 2X5XA 3VXKA 2QJRA 3V1NA 2LIPA 2WJ4A 3DL4A 3B3QA 1MU0A 2CBGA 3BIXA 4PSDA 2C0PA 2RI6A 2XMGA 1FJ2A 3AIKA 1G42A 1SCQA 4UHDA 3ESAA 2I03A 3G0BA 4GLBA 5EFZA 3STXA 5AHXA 1WOMA 3VISA 1C7JA 3QZUA 4B83A 4EA6A 1MN6A 4BC1A 4AX4A 1DX6A 4EY7A 1DQZA 4DGQA 4TPKA 1E3QA 3ANSA 3PDCA 2W6CX 1DT5A 2EDAA 3PE6A 3BXPA 2WFZA 3HLKA 2XUKA 4OD0A 3G0CA 3EQ8A 5ALDA 5A7FA 1HL7A 1JKMA 1WPRA 1XZBA 2V96A 4PNZA 3G8YA 2GZSA 3H1BA 2XUOA 2HA2A 1LZLA 4Q3LA 3I28A 3H18A 1TCBA 1LGYA 3T4UA 4W9RA 5JADA 3M82A 5AOAA 1FFEA 2WG2A 5AK3A 2HU7A 3TRDA 3C6YA 2AJLI 1THTA 1ODCA 4BZWA 2AJDA 5EHQA 1TK3A 5A71A 2Y2VA 2GYWA 1LLFA 4UFOA 5HKBA 2VATA 2PSHA 2XQFA 3WMRA 4NMWA 1WB4A 1JJBA 3GELA 2OCKA 5EIAA 2QUAA 1GKKA 3R41A 2Z5GA 4W1QA 4PF1A 5LZ9A 4KE7A 1N5MA 3JW8A 4IH4A 3KWJA 1FSSA 3VDXA 5CT9A 5AP9A 3R3XA 4BTLA 4C4XA 3SC2A 4BVJA 1CUWA 3KWFA 4PSCA 2JF0A 4BRZA 4X6XA 5LIPA 2PSEA 3SK0A 4J0CA 2RGUA 1QO7A 4C88A 1TAHA 5DNVA 2Z8ZA 1R9NA 4FBMA 1LPNA 2G63A 1MT3A 4GXNA 4F0JA 4YASA 5DYTA 2QMQA 1X2EA 1IZ7A 1CEXA 1R88A 1M33A 4E46A 3ED1A 4W1RA 3B5EA 1CUXA 3V1MA 1QIHA 1HQDA 1ISPA 2XUGA 3B12A 1CUGA 3FOBA 5ALSA 2WQZA 3A2LA 1Y7HA 1RP1A 2BJHA 1GGVA 3HJUA 2WIGA 4NVRA 4UHBA 4U2GA 3WL8A 3WWCA 1XQXA 1L7RA 2VAXA 2HA7A 4LIPD 4H77A 2WILA 4V2IA 4B6GA 1CUFA 4B0PA 3AZOA 2HFKA 4UBLA 3W05A 3F96A 4TGLA 4WJLA 3M83A 1ODTC 2WKWA 2OGTA 4QE3A 2XLCA 1THGA 4BYMA 2FJPA 5YASA 4GWLA 5DTIA 3VJKA 1FFAA 4DNQA 4F60A 3RM3A 1F0PA 2C0QA 1QIFA 3T52A 4AO7A 3ZWQA 1N8SA 3K6KA 5ALJA 4BB0A 4BVKA 3K9BA 5CRIA 3WL7A 4JEIA 1QZ3A 4K6HA 1AMNA 1BN7A 3U0VA 5A7HA 4RE5A 3C45A 2XMQA 2JGFA 5FXMA 1VJ5A 3ESBA 5AKXA 3G02A 4WDRA 3NGMA 1SC9A 5JALA 5ALXA 4XVCA 1K8QA 1YASA 2DHCA 4ZRDA 3STTA 4QZVA 1QGED 3G0GA 5ESRA 3A70A 3DYIA 1ZD5A 1DX4A 5JD6A 4FFVA 1LPSA 2VJAA 3G9ZA 1TCCA 1B41A 3W9BA 2QRUA 1WHTA 1XZFA 4IQ4A 5HF5A 4C4ZA 3OM8A 1ZI8A 4FWBA 5T4FA 3IBTA 1EB8A 4DSZA 3NOXA 1OXMA 1QLWA 5LZ8A 3WQHA 2IITA 1VE6A 1XRPA 4S0XA 3V48A 4QNNA 3JWEA 5KWIA 5I9IA 1XZMA 3FVTA 4EY4A 2XB6A 1EK2A 1XLVA 4KEAA 1CUVA 3UUFA 1YAHA 3STYA 5K3FA 4DTCA 1JU3A 1W75A 1ZD2P 2XUAA 3WK8A 1A8SA 3O95A 5I7UA 4G8DA 4J0JA 5EIHA 3QVMA 3WIOA 4A23A 1DT3A 4YX9A 1Z68A 4I4CA 4DM7A 5EIEA 4LKOA 1TKRA 2HU5A 1CQZA 5AKZA 5FOQA 3SX4A 3CXUA 5AO9A 3RLIA 3BDIA 1ZI9A 5LKAA 5HKAA 1XZEA 5JIBA 5K3DA 3IUQA 2YYSA 4X92A 4YK7A 1VXOA 5A62A 2CKMA 4CCWA 3PICA 1XZHA 1LBTA 4OB7A 1QIGA 4FLMA 4E14A 2D0DA 1XQWA 4NS4A 3QPDA 3NUZA 1XQYA 3OOSA 3GFFA 1LPOA 1XZJA 4C89A 3PUIA 3CCCA 4Z49A 3IDAA 3FVRA 4GDMA 3QM1A 3H2IA 3C6ZA 5DNUA 4XX1A 3CN7A 4BATA 1EDEA 3STWA 4ZGBA 1CVLA 2QS9A 5AK5A 3V1LA 3E4DA 2V98A 4KE6A 4GBGA 2QTBA 5JANA 5FPPA 4ZREA 2ORYA 1HDEA 3PFBA 3R3YA 1OCEA 2WIJA 5JD4A 3CN9A 4OUKX 3UUEA 5LZ2A 4WFJA 1IVYA 3VJMA 4HRYA 4G5XA 1FFCA 4PSUA 1DINA 1XZDA 4G4GA 4JYMA 1QTIA 4JUIA 3BWXA 2DCMA 4G9EA 2QM0A 5JARA 2YASA 4P9NA 3MVEA 1AZWA 5H3HA 2PKYX 4UUQA 4KR0A 4AXBA 3H0CA 1J06A 5FRDA 1EVEA 2H7XA 3L1JA 1QFSA 5AJHA 3DD5A 5HF6A 4CG1A 3WZLA 3WZMA 5BOVA 2J4CA 4I3FA 1JJIA 3G9UA 2YH2A 4EUSA 3ZV7A 2HA6A 5K3BA 3H04A 3TEJA 4LHEA 3DEAA 2WG1A 3DNMA 4QDTA 1Q0RA 3V1KA 2DHEA 5JAHA 3QPCA 2PU5A 5AM1A 4OU4A 5HCUA 5A2GA 3ICWA 1IUOA 4B9EA 3WK5A 2XUPA 3OTQA 5ALRA 2C5FA 4Q82A 2XMRA 5CH8A 4BE9A 4INZA 2CJPA 2VQ6A 1XRRA 4C87A 5DTJA 4Y2RA 5T4BA 1EVQA 4DIUA 5ALWA 4DMKA 2HM7A 4UBMA 2OXEA 4UPDA 5HQ3A 2HFJA 4H7HA 4B82A 1ACLA 5D6OA 3EIOA 1YA4A 1D07A 3LS2A 4RNCA 4Y2SA 1CUZA 1N1MA 1WPXA 3QYJA 3DL7A 5AK6A 5HFNA 2WTMA 5DWDA 2DHDA 3R3WA 1EXWA 3OPMA 1SOMA 2Z8XA 4JNCA 4CCYA 3D7RA 4Y7DA 5K3CA 3MGAA 5DYYA 4AMYA 3GROA 1TQHA 4AN0A 1ACJA 1H2ZA 3WA7A 2VT6A 1W52X 1BCRA 2DQZA 3IULA 4I19A 3DJYA 2WJ6A 4U2EA 2ACKA 2JGMA 4BZZA 4IO0A 4QDOA 1X70A 3DOHA 5AM0A 3GUUA 3VVMA 3QH4A 2BAGA 1KU0A 3IVMA 4OYLA 4AO6A 4HRXA 2H9YA 1I6WA 1CR6A 1GT6A 4DNFA 4BCCA 2WG0A 4QLOA 3R40A 3IB3A 3WJ1A 2ES4A 4FNMA 4D9JA 2ZSHA 4KYVA 5JAOA 3L1IA 2XUQA 3R3ZA 1L7AA 1QOZA 3ILSA 1QO9A 4ARBA 5D3ZA 3ZI7A 1EDDA 2C7BA 2CUTA 1LNSA 2OGSA 2XUFA 4CFSA 4C01A 5IKXA 1RYYA 2OAEA 4QLAA 1G5FA 5AKIA 4EB0A 1GPLA 3WIBA 2JGKA 4FTWA 5C8XA 3D59A 1HBJA 1F8UA 2HRQA 4X00A 5CT8A 1GQRA 2QOEA 1DTEA 2WU3A 4Q3KA 1ODSA 1CUAA 2CB9A 2X8BA 2QVBA 4KJXA 2G5TA 3KOOA 2QT9A 1EI9A 5K3FB 3IURA 5FLKA 4HAIA 5HF8A 2B61A 5CT4A 2XLBA 4XIIA 3O0DA 4X3CA 1IZ8A 1ZJ4A 1MX5A 5JAPA 4N8DA 4BAGA 3KXPA 4ZV7A 1KU6A 2XI4A 1VXRA 2WLSA 3G9TA 3C43A 3I2KA 3PI6A 4U2BA 1EH5A 4MQMA 1GKLA 5FP0A 2O2IA 2YXPX 3F97A 2JGEA 1OILA 1BEEA 1MNQA 4U2DA 3H19A 2OQIA 4KE8A 4AO8A 1UT6A 1VA5A 1P0QA 4Y2JA 3IUMA 4FBLA 3BF7A 4QDXA 1IMJA 1MPXA 4KAFA 2Y1KA 4X97A 4IH1A 2QXTA 1TIBA 2GBCA 4Y9SA 1YAJA 4F21A 5AM3A 4Y2VA 4X6UA 1ZIYA 4OCZA 2H7YA 2GYUA 2EDCA 3FBWA 2WUGA 4J7AA 2XMZA 3OURA 4GEGA 2RONA 4U2CA 3D0KA 4W1PA 3WKCA 1QJ4A 4J0DA 2J4FA 3WLAA 2IX9A 1VZ2A 5LKRA 3EQ7A 1E8DA 4OPMA 1CUYA 4PO3X 4AB1A 2PX6A 2QJWA 2R11A 4DSAA 5AIAA 5HFAA 4M0FA 3IUNA 4UFPA 1UK9A 4RE6A 4EHBA 6YASA 2WU4A 1UOQA 2I3DA 3IUJA 5BV7A 5ALHA 2GZRA 5ALFA 1CUEA 4H35A 4KRYA 2WHRA 1HPLA 1G66A 2ECFA 2OQVA 1N5RA 1AKNA 1DWOA 4Y2UA 3ANTA 4IHAA 1UKAA 4GHWA 5AI4A 5ALEA 1UOPA 3C8HA 1YR2A 4DMHA 3WKEA 3WL6A 1CUUA 2BGNA 4OU5A 4MEBA 4H7KA 1PFQA 4ZXFA 3LIPA 1ZOIA 2OGZA 4M0MA 1JJFA 5BWCA 1AUOA 1NU8A 1BROA 3C6BA 4DMCA 1XQVA 1JMYA 1J2EA 4H7DA 1XLUA 4Y2XA 1UK7A 1L7QA 1BCSA 2P8SA 3I6ZA 2PUJA 4ETWA 4DNOA 4FOLA 3M3DA 2QZPA 4WFKA 1FFDA 2HADA 1MAAA 3JYHA 4J3JA 2DSNA 4JYPA 2PU7A 2HRRA 3H2HA 5C81A 4MWSA 3WKAA 1YSCA 4FKBA 1AURA 4Q3OA 2UZ0A 3HZOA 1U4NA 4O08A 2WM2A 2ZYHA 4QWMA 1EX9A 1LPMA 3LIIA 5KREA 5D7BA 2V9ZA 1K5PA 4TVKA 3WK7A 3CCBA 3H1AA 2C5GA 4NZZA 3ESDA 3RKSA 3LLCA 1EA5A 2RIPA 4A5SA 4YPVA 3SWWA 1AX9A 5LP1A 1ETHA 1EB9A 4DMFA 5CURA 1VA4A 1P0PA 2XT0A 2Z3WA 1F6WA 2WFLA 3C87A 1PJAA 2J3DA 5AH0A 5HZGA 1MX9A 2VEOA 3H17A 1AQLA 3S8YA 2ACEA 4ZWNA 4LXIA 2Y2UA 1R9MA 4UHHA 1LPBB 2BUAA 3RARA 1UKBA 1E5TA 3RK4A 4B85A 2HDWA 3LCRA 2WJ3A 5ALZA 1H23A 5LZ4A 2RAUA 3DKKA 2EEPA 3WK6A 1E8MA 1R1DA 4AN1A 1W76A 3W04A 2V97A 3AIOA 4FFWA 1AC5A 4U2FA 4LYDA 4B7ZA 1BE0A 5A7GA 1CPYA 4MYSA 1YS1X 1WM1A 1ZD3A 4Q05A 3WWDA 4A16A 2DFPA 3NWOA 4DNPA 4X6YA 3WI7A 5AKHA 4BC0A 4BE4A 5AKJA 3ZLUA 5ALNA 1R4ZA 4AMZA 2VA9A 4QA9A 5LLSA 5CT5A 2Q0XA 1CQWA 5KBYA 4OYYA 5JASA 1XZGA 5ALTA 3I1IA 2O2HA 4PQEA 4J0HA 3G7NA 3WYNA 5AKEA 1C4XA 3DOIA 3AZQA 5ALKA 1QIKA 1VOTA 2XMBA 3I2HA 3QMMA 4EY5A 2ZSIA 3ZLTA 4XWGA 1R3DA 4G8BA 2WSLA 5IVDA 3M81A 3BF8A 2PL5A 5EHXA 2XQJA 4ZI5A 3PF9A 4H7FA 7YASA 1DWQA 4H7IA 3U1TA 2ZYIA 5LYYA 4X95A 4AQDA 3F9CA 3WKBA 2WIDA 5CXXA 4K2AA 2GYVA 4L0CA 1ZJ5A 3C6XA 1E89A 4CG3A 4AZ0A 2O7RA 2BKLA 1Y37A 1LZKA 1YB7A 5JZSA 3WKDA 2HA0A 1WB5A 1MO2A 2JBWA 3DKRA 3ZLVA 3R3UA 1JU4A 2PUHA 3D4LA 1XZLA 4ARAA 4H7JA 4J0KA 1LPPA 2OCIA 3GBSA 5IVHA 2O7VA 1H2WA 4MYDA 5CMLA 4EY6A 1YB6A 2IIVA 5ISMA 5ALOA 5T4EA 2HHAA 3V9AA 1MNAA 2DR0A 5JYCA 3C70A 5IVIA 4KRXA 1DQYA 1XZIA 2ZJFA 4K6GA 4DLNA 3IIIA 1XKTA 5JATA 1U8EA 2VSQA 3DS8A 1XRMA 3G0DA 4DYHA 4H7EA 3P2MA 5AI8A 2HIHA 4FLFA 2HL6A 1VE7A 4H0CA 1XZAA 1GXSA 4PW0A 5CH3A 5JZBA 1MTZA 3STUA 5HK8A 1ZGCA 1X2BA 1CUJA 3AUKA 3AINA 4UBIA 4OB6A 4JH0A 4L3WA 1ZIXA 4X94A 4MQLA 4FLEA 1CFJA 1PV1A 2XQKA 4W1SA 4QWWA 5JAUA 3HYSA 1UOOA 3S2ZA 5I8PA 1NU6A 3WA6A 3DCNA 3X3HA 3FCYA 2BCEA 3EQ9A 2I78A 1B6GA 3D3NA 1CUDA 2QXUA 3HEAA 1QFMA 1XZCA 2RHWA 2J3QA 3HC7A 4MXDA 1W4LA 2WIFA 2JGJA 5AKGA 3WJ2A 1EINA 2WIKA 4WCVA 2ZYRA 2DQYA 1Q84A 1JT2A 4CIAA 3C5VA 4Y2YA 3BE8A 3I2JA 2WUFA 5ALGA 2VT7A 5SYMA 3FLEA 3AILA 5AI6A 2CZQA 4N5HX 4G4IA 4OSEA 2WUDA 3FLAA 3EBLA 2WHQA 2BGRA 3OG9A 1BU8A 1Q0ZA 3PFCA 1JI3A 4F5ZA 3FYUA 3A2MA 2D5LA 3I1YA 1KEZA 4H18A 4E15A 3HACA 1VZ3A 5DLPA 2VAVA 1E66A 1QE3A 4EY8A 3TJMA 3I6YA 1F0NA 1CUCA 3UMJA 2XMSA 5EHZA 2WFMA 3E3AA 1UKCA 2K2QB 4Y2TA 1O6FA 3H2JA 2XUHA 5AI9A 3MUOA 4QEKA 1U2EA 3O9VA 5AKKA 5FDFA 1NX9A 4BCDA 1HLGA 5CH5A 3D2AA 4P08A 5AI5A 3G9XA 2HA4A 3WWEA 1E8NA 2XUIA 5IVKA 3H2GA 2WFLB 1EDBA 5KWJA 1VKHA 3QBJA 5K3EA 3HRHA 4MEAA 2AXEA 1XKLA 2VF2A 1JFRA 4KAJA 1MJ5A 1Y7IA 4K5QA 3BDVA 3D2BA 4C4YA 4FDMA 1RWQA 1CRLA 4MWTA 4KACA 3VKFA 1QIEA 1K4YA 2QUBA 4HXGA 4N8EA 2OLEA 5ALUA 5AIBA 1MX1A 4N5IX 3QITA 1USWA 1AGYA 3WK9A 3L1HA 5EHNA 1A8QA 5BWBA 2G5PA 2PBLA 1UZAA 5LZ7A 5SYNA 2BFNA 4Q1VA 4UHEA 3A2NA 5AM5A 1CUBA 4UHCA 5ALYA 3F8SA 2B20A 1HKHA 3FYTA 4Y2PA 2BUCA 3HSSA 1ZD4A 2OAGA 4HVTA 5E4TA 5FKJA 1W6RA 5AOCA 5HK9A 4FNGA 5ALVA 4FMPA 5E4YA 2AJCA 5E2IA 4G8CA 1GZ7A 1XRQA 4B80A 1FFBA 2CEKA 5J3JA 2QKYA 1CUHA 2ROQA 2E3JA 2CMFA 4BDTA 5ALIA 4X7BA 1T4MA 1CUIA 4WY5A 4LXGA 2JGLA 2QR5A 4N8SA 3FYUC 5T4HA 1A8UA 1ZI6A 4GI1A 3I2IA 1QIMA 5JZ9A 1WCYA 5AOBA 2JEYA 3AIMA 5C8ZA 3WYDA 4QDUA 4UBOA 2FJ0A 4UFNA 3I2FA 5FUMA 5D3KA 4QDZA 1LPAB 4BP9A 1UWCA 1J1IA 2WHPA 5CT6A 1SCIA 1DU4A 3FAKA 3FWHA 5AM2A 5CTAA 4E11A 4B84A 4FHZA 5ALLA 3W06A 1CV2A 2XUDA 1S8OA 4Y2QA 3G0IA 3TGLA 3F98A 5ALMA 4X91A 4UHFA
chains in the Genus database with same CATH superfamily
4BX2A 4ND5A 1TA4A 4MWGA 3W9UA 3SAJA 2N75A 2B4AA 2RJ3A 1Z4NA 3HB5X 1P9NA 3MWDB 3PCRB 3R0VA 3ZKWB 4GQIA 1XTBA 2PGLA 4BLVA 1SU6A 2ZPUA 3WMGA 5SY6A 3TG2A 3MIZA 4TYMA 4L2IA 3MLAA 4CTMA 1RYDA 1XTRA 2G9QA 4JIMA 1E64A 1WMFA 4HDRA 1DQPA 3BK7A 4A03A 3ZH2A 3AVQA 3RCBA 3CA8A 5HJEA 1RHMA 3JQ7A 3PHHA 1G6KA 1A50B 2ORWA 3G5AA 3VR5H 3EHDA 1NAHA 4HXFB 1L3BA 1NF9A 4C6HA 2I1QA 4LFBB 4HQOA 3FSGA 4I08A 4PHHA 1ZUHA 2QB5A 5DBFA 4ZI2A 2QMHA 3DDUA 4RVCA 4URUR 1GNSA 1GR1A 4ZQEA 3ZD8A 4FSHA 2M1ZA 2Y1EA 4Z1MD 1SGWA 2UZIR 5LZ5A 4CI9A 4WFIA 5F4ZA 1TPYA 1O6GA 2C4VA 1ONNA 1TC2A 3L4BC 5K3AA 4CFYA 4L95C 1HYQA 1Q12A 3BFXA 4GSLA 5JOQA 3ROTA 4MO2A 5B55A 1GXSB 2C8LA 2G4LA 5DHFA 4I5DA 4F4UA 1KDRA 2Y6VA 1KVUA 4LXXA 4AMVA 3Q0TA 3VOAA 1BCRB 1Q20A 2E18A 2VRBA 1NF2A 1GRNA 4TM7A 1RMYA 1JXQA 1NGSA 1T1EA 1YNOA 3N2GA 2IV7A 1XNHA 5FLYA 5IJWA 2EKZA 5K99A 3P5BA 1QFXA 3O8DA 4ARZA 5BN3A 3EEOA 1IZZA 3U3DA 2B25A 2DPYA 4P93A 5HJ5A 4A36A 5KQGA 3IQFA 3I9LA 2EKLA 2ZOSA 4IIFA 2XQIA 1CJTC 4IIBA 1XMOB 5LLDA 4LDZA 1ANKA 2QRMA 3D31A 5C8YA 3NI2A 1DARA 1Y4AE 3K0FA 4PVDA 1N5IA 1JMKC 4WK0B 3LUAA 4LXUA 5GONB 5CFNA 3H4TA 3HNRA 1BGVA 3N7AA 1N2JA 3SF8B 2XOEA 2CFIA 1ZCFA 3V4ZA 5HR5A 2HK6A 2ZAYA 3DBVO 4LV6A 2AFRA 4QYMA 3JV7A 3M6WA 1ZK4A 2NYRA 4XQ0A 2PA0A 2PZKA 3N0TA 5JNLA 4RPCA 3KDAA 2BEWA 4IL5A 1P1CA 4MGYR 4XDHA 3BWDD 2BN4A 1IVNA 1FP2A 5CIWA 3NIGB 2R1VB 1A77A 3IOEA 4KGVA 2XT6A 1OI7A 5CA1F 2VJCA 4Q9AA 3NAQA 1T5BA 3HDVA 4MPTA 2B36A 2VYVA 4HNAB 5EZ6B 4BVLA 4EHHA 5H4HA 5DBGA 3EUFA 5TMEA 4G1FA 1GPNA 4U5XA 3O82A 1L5FA 2QMYA 3F5QA 3H1PA 1SUBA 1Z13A 3T12A 3UHFA 1CLEA 2A0YA 2X9GA 3IXMA 3UWSA 1KRWA 2MSLA 1G4HA 1DI0A 2BFPA 4XUGB 4DLPA 1A9SA 1SR8A 1AJEA 4GI7A 1NQUA 5AJTA 3FPBA 4B2IA 5BR1A 2AMFA 2LGJA 4UM5A 2WHXA 1HMPA 4G6ZA 3RI3A 4LFCB 4DIDA 4BX9A 1XSEA 4M9CA 2R8EA 4A2QA 1QYXA 2C83A 1M74A 1JSLA 3HI4A 4FUQA 1FYDA 4D3YA 1E9CA 4DMGA 1QU2A 4XAQA 1TUGA 2ZYTX 1RQNA 5FD8A 4I4TA 2VHUA 2EJBA 2QVZX 2PUEA 4XGIA 1WULS 1D2EA 3NWBA 2WICA 4LWOA 4JQYA 3CM0A 3HKDB 3ZNPA 3DTTA 4DZZA 2NW6A 4BWYA 1UBHS 1P77A 3PNMA 4P1ZA 2P6NA 2XE4A 4QBKA 5TMDA 3SGLA 3H3JA 2CXUA 1SBQA 2JHAA 2ONCA 5D5QA 4PE5B 3UVEA 4G1BA 5B4UA 4NONA 2Q5LA 5K3OA 2C2BA 3QX8A 6ADHA 4HBZA 3U1BA 1U9CA 1YB4A 5D5PA 1AUXA 3GT7A 1O4WA 1QNFA 3NYRA 3X1MA 3V7YA 4FE7A 4MUEA 5JMWA 5A3VA 2AKAB 4EB3A 1UPXA 2Z3ZA 2QLFA 2FAXA 2Y4NA 4O0MA 4E5YA 4EELA 4YMLA 2G9RA 3IJPA 3NEAA 2HK8A 2IEDA 3WWOA 4B73A 2RKBA 1SWVA 2Q2OA 3NYWA 5IWAB 4X71A 5IHPA 3H2SA 1RZVA 2R25B 1DC8A 2LXNA 2NXNA 2HB6A 2VOJA 2ZTHA 2GBGA 3ESCA 3LDHA 2QVCA 2V7BA 3TNYA 3ZZ0A 4HYTA 2C4NA 5DT9A 3DBHB 4EX6A 3NXSA 3VNUA 2OOKA 1A3CA 4MRAA 3NBKA 4ZEWA 2FVXA 2IUEA 4M98A 4FHDA 3AUFA 1KEEA 1Z4JA 5AXCA 4F7WA 4W5OA 2HGZA 1M83A 3HB0A 1GRQA 1HTTA 3WP1B 3UWKA 3PEYA 1Z22A 2WAXA 3G68A 2G5GX 4R3NA 4GP7A 4YJ3A 3VTFA 3MXTA 2YWGA 1EFCA 3I6QA 1L7XA 1QOQB 3MTGA 1U7UA 2I87A 5DV9A 4PAOA 1A95A 5KYKA 4BWGA 3DEKA 1P9OA 1E1QD 4LNUA 5BR4A 1QTRA 2JK1A 2R6JA 3IIKA 4AP9A 5K8TA 3FPLA 3O4IA 4W63A 2YQZA 1N0IA 5CW2A 2AUMA 2NNWB 1N9GB 2YN2A 4C4PA 4DARA 1S8NA 2RI0A 3RS3A 2RAVA 5FEMA 1RLMA 1U8FO 2IYEA 4MW1A 3C5CA 4CQMA 2IX3A 1VBKA 3I6MA 3BGIA 1EHCA 2PPLA 2O8BB 1D0IA 4KO4S 4DV2B 4BMXA 3R9KA 1FYXA 1E79D 1SIOA 1HE8B 3HG7A 3KJXA 5AKYA 5FTJA 4DJTA 2QTHA 3LP6A 4Q34A 2ZE8A 4KDFA 4WLFA 5C46F 1NF8A 3NBAA 2BFWA 2CNWD 5LQJA 1MQAA 1T0IA 2VDMB 3Q9LA 4GM4A 4HDOB 2R7MA 3CUSA 4Y7CA 2FUKA 3OJXA 4M46A 3F2VA 2X58A 1AUVA 2AJ8A 4CM9A 4KFRA 3OIWA 4REQA 4UBNA 2XCRB 3OPXA 2MMGA 4CLRB 3QVXA 2C0CA 3FDZA 5FTMA 3QWFA 3NW9A 4GPZA 4MX8A 4CIVA 2FOLA 1R6DA 3D2CA 1BRTA 1WQ3A 2WSIA 4LJ8A 5GADl 3R9XA 5F23A 4E2FA 1U3FA 3IMKA 4YVFA 3S28A 4C1BA 3N8NA 3RU7A 3LVFO 3DYVA 3QJ5A 3HA3A 4RO0A 1MC4A 3UMVA 4BN4A 4KLCA 4CM5A 3V00A 3HB7A 1K5GA 2WM9B 3VPXA 2Z95A 4X90A 1AGPA 1E1MA 3KJZA 1Z0SA 2EZTA 4V0LA 1ORWA 1PF7E 4E33A 1H0SA 1OAKA 4W6ZA 1X19A 5L6MB 3Q8WA 2JCGA 3CWQA 2IZ1A 1ZICA 4IKPA 4ROTA 2AEJA 1QV9A 4B3HA 4EB8A 1UEJA 2VJLA 4LBYA 5KVVA 5CITA 1T5IA 1DLIA 5GONF 3T95A 3BOSA 2HKIA 1SELA 1DXHA 1PQ4A 4Q7QA 2WSMA 4FFPA 1TJ3A 3FPEA 4UU1A 1LJUA 1S0UA 3GP3A 2BDTA 5B6PA 1O6ZA 1PNVA 4RV4A 1ZH6A 1KQ3A 1GZVA 3BTUA 4D8WA 1CS0B 1H2YA 1TYDE 1FDWA 2JAPA 1GTVA 1NHGA 2DJ5A 3LD9A 4AJ1A 4N76A 3GY0A 4G0XA 5KAMA 2YRFA 4HFJA 4B7AA 2G0NA 3IA2A 2QZJA 4QPJC 4R01A 3TEFA 4ENTA 4F2PA 3C8DA 4UTRA 3ZGZA 3VKWA 1N1EA 2G70A 2EBUA 3MWGA 1UMKA 4RS3A 3DULA 3HKBA 1UXIA 1OAAA 2BMDA 1II8B 3QVVA 4MIYA 3L6UA 4OL0A 1IZ9A 3RJTA 2BELA 4DBLE 5ITVA 3HNOA 3HADA 4BO6A 1W1UA 2NO7A 2C00A 4QT0A 3TLBA 1D4OA 4MLZA 1WLYA 3O4GA 4BRUA 2VLIA 2VJDA 4CGZA 2J46A 2QSYA 1F1BA 1XDZA 4LWPA 5ALPA 5AVJA 2C58A 3LQRA 2C5HA 4DTIA 1EP9A 2KSQA 4DV4B 1PS0A 2CJWB 2F48A 2VZLA 1W1IA 3CHYA 4Q4LA 3DTVB 4O6VA 3AB7A 2J3IA 3HB4X 1Z26A 4BDSA 3KYCA 1RWBA 4YIHA 1K63A 4LC0A 2HF8A 1KJ8A 5IZ4A 3UV3A 3LP5A 5CVCA 3W6PA 3K30A 3OY2A 2OENG 3EFEA 3GPIA 4OATA 2V4ZA 1H94A 2ZJ6A 4KUEA 3WTCA 3CGWA 4M0EA 5ALQA 3TXAA 3OETA 1Y9EA 3ZW7A 3B3FA 3H11A 3LL4A 2RHOA 4IDBA 1CB7A 4M1YA 1AD2A 2OG2A 3N0RA 5DGTA 3UJPA 5EJ7A 1E6MA 5DTEA 3IP6A 4P5DA 2WHPB 3W9YA 4CMEC 1P4HA 3DOEA 3TSYA 2CGEA 1E1RA 3EWNA 1M6HA 1C9NA 4UC0A 1NMSA 2HLDD 1DUSA 2M6SA 2ORVA 1HL3A 3LA8A 4J1NA 4ZCLA 4EGCB 2O1XA 4YRAA 2FR8A 3FN4A 3U3OA 4B3GA 2QQ0A 3L0PA 4TLBA 4YUZA 5MGNA 1XHFA 1S7CA 6LDHA 3VX3A 4QHSA 3RRBA 1BEUB 3IPRA 3PC8C 821PA 4RUKA 3T5CA 2JVKA 5KHOC 2B5WA 1SQGA 2Q29A 2XVAA 1XG5A 3QXGA 3PX3A 3VXKA 3VSCA 3NOOA 4UHKA 2GEVA 2LIPA 3VYWA 3LUGA 3SQWA 1KNQA 3LFUA 2NYUA 5B3JC 3E9ZA 3BL6A 3BIXA 4LYGA 4MUYA 4N0MA 4TS9A 5B4VA 2C0PA 1EFRA 2RI6A 2WJJA 1UPFA 2XMGA 2YIVX 3LDUA 2PX0A 3NM5A 1G21B 3LWNA 3OZVA 3V8BA 1QU3A 2IUUA 1GTSA 1I3LA 3ROGA 1ONPA 1F6BA 1DMSA 1XEFA 3BSSA 4NIMA 4XFKA 2ZCVA 4UTPA 1OFUA 1K97A 1TD9A 3FDFA 1TU4A 4GLBA 3A6LA 3DW3X 3FUUA 1I2CA 4YBRA 1WOMA 2WVHA 3X44A 3DZIA 1J5EB 1C7JA 3JD1A 1X9GA 3QZUA 4Z1OA 1VCOA 2P9CA 1GM5A 1UT5A 1MN6A 3BMCA 4XSHA 4AX4A 1ZH2A 3LVQE 2AXNA 1LEHA 1VCNA 4LG1A 3TTVA 2FEWB 2QHXA 3L0BA 5KTRA 2FQQA 2B8JA 4JJEA 4LFAB 1GSIA 1D6MA 1NN1A 4EA9A 1T9BA 3ZDAA 4YXFA 3FZEA 4KO1S 3B6JA 5F9MA 4FHCA 3REFA 2W6CX 4TUYB 5DULA 1T43A 1QK5A 3EDRA 1G8MA 4BPRA 2OO7A 2CVZA 4N1AA 2NMVA 1ZH8A 1RZUA 3IJ5A 1K6IA 3BXPA 4WXHA 2GPNA 2WFZA 2O3RA 3T5BA 4S1WA 2XUKA 3K73O 1WEHA 4AY4A 1D2GA 3EQ8A 3H5IA 5ALDA 1MEOA 3DONA 5AR1A 4CR7A 1L8LA 1TJ4A 4G89A 1L5LA 1JKMA 3JQ9A 5HCIA 3SS9X 4PTYA 3N8HA 2WWYA 4X8LA 1GNRA 1V95A 2R7LA 4YY3B 4ZVRA 2HA2A 3G59A 1AV7A 3PDWA 5I3ZA 3QKWA 1KO1A 1L4MA 1A2KC 1LZLA 2EFEB 2ZBVA 4YONB 2O8CB 3M33A 1NATA 1F8XA 3H18A 1YBFA 4ID3A 2EJUA 5G0VA 4C21A 5ESDA 3OQIB 3T4UA 3AY0A 4IQ8A 5GQSA 3T3NA 3M82A 2RAFA 5AOAA 1GNQA 2WG2A 2HU7A 4G1UC 1T3LA 5AK3A 3VPFA 3ZNQA 1XQ9A 2XQVA 4L1KA 4HDKA 2DETA 1W46A 5FYDA 1SKQA 2ZM6B 5A1TA 3Q7SA 5LSAA 3LT5A 1NUAA 1R6TA 3MWJA 2ZTUA 3TRDA 3C6YA 3BGVA 1PN3A 4E2XA 4FFRA 1SOUA 4JLOA 4RH1A 2Y1CA 3B6EA 3LT2A 3GNQA 2AJDA 3OHMA 3ISTA 3PKZA 1FYEA 4O5OA 3EPRA 4RD4A 3FWKA 1GZ6A 5GWXA 3DC7A 1X94A 4Z54A 5A71A 2DT5A 1HZZA 5DCLA 1G18A 1LLFA 4LYAA 4UFOA 3TM5A 5C52B 1T9GS 1DRUA 8ATCA 1JKJA 1XQ1A 3DZDA 2OK8A 3HJBA 3OEED 4DJFC 4YRNA 3R0QA 1JJBA 2N47A 2XPCA 2FPIA 3GELA 5EIAA 2WC1A 5EZYB 3GEPA 4KQHA 3ORRA 4A5OA 2REBA 1HURA 2VQSA 4W1QA 4FBGA 2OZLA 2IEGA 4N82A 4GMXA 1XTJA 5LZ9A 3N2IA 2H4XA 1E9EA 1Y89A 3DJFA 4TRRA 5IKOA 1KYIA 4AUKA 1TW3A 2DLNA 3HJNA 4J2HA 3R4CA 2OD2A 1R7RA 3W8RA 2QRJA 1O95D 1RVDA 1ULHA 3FVQA 3P9YA 5HS6A 2XA9A 3MOGA 1BDBA 2UYHA 2OUKA 1QORA 4BVJA 1CUWA 1OZGA 2NG1A 4NEQA 2P9FA 1K89A 1TO6A 4O1IA 3EW7A 4PSCA 4ZEOA 4CKEB 5KS2A 1OI2A 1RKVA 1YQWA 1C1YA 1R8SA 3IAFA 4UM9D 4EKEA 2XB2A 4J16A 2WAYA 2C9YA 4X6XA 5IK2D 1XV5A 2RFLA 3VPSA 4K40A 4UAVA 3RWMB 5LIPA 1JFFA 1FLDA 2E2WA 2PSEA 2VF7A 1JF8A 3E5HA 4PXAA 4Q02A 2ISCA 4BVFA 2J0VA 4IXTA 3OTIA 4J8PA 2RGUA 3H16A 3FNQA 1TAHA 1Z0AA 3VOSA 1CXZA 1JN0A 2LNDA 1UKZA 1OFHA 2WABA 2KPOA 2Z8ZA 5D5HA 2F43A 4L75A 2NTJA 1JEYB 1LPNA 4B6SA 1EUZA 2P9BA 4M2LA 4F72A 1FXWA 2E37A 3FBGA 1I32A 3RADC 4GMKA 1BVRA 1C80A 2HSDA 1MH1A 4K86A 2P3QA 3GDWA 3QG1A 2VL7A 2XCLA 1AXGA 1JWAB 1BO6A 1Z07A 2H1VA 3GRZA 4WZBE 2C31A 1NYQA 1JDJA 5EMJA 3KCQA 2JIMA 1JQLB 4RORA 5FBLB 3THSA 4ZYXA 2GKGA 4TTVA 4EVQA 3FNIA 1D9XA 4E1AA 3DVLA 1NYLA 5KTKA 2CMDA 5AUQA 1J39A 4LRUA 2AT1A 1RPTA 1CUGA 3FOBA 3A9SA 2JGDA 4UDNA 4BN0A 4N01A 4DCOA 1JPUA 4ZZ2A 4NAVA 4YMGA 4X0EA 4HH1A 1Q44A 1G2QA 5FAKA 2CXRA 4MCHA 2PRZA 4JVLA 1RP1A 4RD2A 4BFCA 4MRMB 4QGSA 2CMGA 1ZW6A 2PS0A 2IP1A 3UOWA 3ZHBA 4A0FA 4G23A 3KWLA 3N75A 4HB3A 1L7RA 4OXYA 2C07A 1R0WA 2X7JA 3KLPX 3LPAA 5JVDB 1O0CA 2RARA 4MQFB 1A9YA 2J6CA 1IN5A 3MJEA 2A7XA 2WILA 4V2IA 4X1YB 3WV4A 1A4XA 1N0WA 1S2LA 3W8DA 1B4DA 4KR6A 4OO3A 3WIDA 3VSEA 2VZEA 4MR8B 2NXCA 1TJ5A 2H1LA 3IDZA 5EHGA 1LBIA 5LCXA 3IELA 4UBLA 5IF3A 3PGA1 2J0QA 2ALJA 4G8JA 2Q27A 4TGLA 1E7RA 2VNKA 3DXXA 4PCUA 2HWYA 3NAMA 1DZ3A 1GPWB 1ZIPA 2XWBF 5TS2A 4ETIA 3VGPA 3MGBA 1NJ2A 4CCSA 1ILEA 3BD8A 1UAGA 4UE3S 3AF5A 2IPMA 5JPDA 3ZX4A 5CDGA 1LSOA 4TWBA 3ZEAA 2H85A 2OGTA 4E1VA 1V1MA 1TEXA 5AW1A 2PX4A 4G0YA 4JODA 4QE3A 4Y6QA 5DBHX 2XLCA 3EODA 1HDIA 5LBIA 1Q1AA 3FPKA 3GWGA 1XTTA 4FNAA 1ADFA 4C29A 1XTIA 2BDUA 2J31A 3K6RA 4JSTA 4OTZA 4R1MA 3E2MA 1JX6A 4IIJA 4MI3A 4YRBA 2ZTLA 3THXA 4LMPA 2HDOA 4G4SO 4RK0A 1UEIA 4D9NA 1P4GA 2D1YA 1EK6A 1M34E 2PZAA 3UK2A 1EK0A 1F0PA 1PZHA 2C0QA 1EIZA 2G9UA 3E1KA 3G2HA 1ORTA 3MMSA 4TUYF 2BEJA 1E2BA 3OZAA 2COUA 4US0R 3T52A 3PC3A 1VMEA 1OBHA 2OEPA 1QR2A 4UM7A 1QP8A 2CNDA 1M10A 3MJDA 3K9FC 1X38A 3ANYB 5TE9A 5JNRA 1D4AA 1H3FA 4EQZA 4OX9B 2R1TB 4KB5A 3IC5A 4LGCA 3H9QA 4FGKA 1CY6A 1X7HA 3NDJA 5EYPB 4M9UA 4RVHA 2YOGA 3K35A 1S8FA 5JMOA 4E5SA 2JARA 1H9CA 1BN7A 2YIJA 3CEHA 3NHLA 3S5UA 4ZHQA 4P4SB 5MN4A 3U0VA 2ERCA 2UYCA 3IEXA 1ZR4A 2WW8A 3HFJA 3NBFA 3OZIA 1E62A 4IEFB 4F6LA 2ZJ5A 4FOSA 2JGFA 4NFSA 4Z6KA 4AY6A 5F9FA 2CV0A 3TZ6A 5DHQA 4CUJA 2HJ9A 2NAPA 3U81A 5JCJA 3L7LA 1M73E 3NGMA 3ZDZB 2Y67A 3E0QA 3P0RA 4CM8A 2YC4C 1Q21A 5JALA 1VE5A 1DG1G 3LWDA 3ROPA 2WD7A 3STTA 3TQSA 4DJDC 1T36A 4QTTB 4D9FA 1SCNE 4ZRDA 5T5QA 3VFDA 3AJRA 5LB4A 4WNIA 4ZVVA 4BLOA 3GPDG 1ZD5A 1K8XB 5IJ0A 1PJTA 3AYZB 1ISHA 4HKTA 5JD6A 2WJYA 2YWDA 1X7WA 3PZBA 5I3CA 4M1EA 1BQ3A 4N0DA 4FFVA 5KC9A 3CPEA 4G5OA 1G2IA 3QSGA 5IT4A 2I22A 2AOUA 1GYRA 1LPSA 2P4HX 3G9ZA 4MW9A 1TCCA 3PNBA 1S9DA 4IICA 3ZWCA 4TSKA 4B43A 3HA2A 5EZYF 2QRUA 5G3ZA 3O0TA 4EPRA 4IQ4A 5HF5A 3TN7A 2FWJA 2ZM5A 4QT4A 4FWBA 2EG5A 3HSKA 5B6IA 3EAQA 1M8PA 1ZUNA 3L4EA 2R62A 1VCHA 3LUPA 3LYUA 4YDSA 1XU9A 2LCFA 3HEBA 1H2HA 4MUGA 4YRTA 5DF1A 4JI7B 3U40A 3VYVA 1VMAA 4EATA 1THZA 2J4DA 4YACA 1W87A 2F4NA 1XXLA 1UBMS 3GFQA 5LZ8A 3RVOA 5B4TA 5AVQA 1K3TA 1RYEA 4CKBB 3EVAA 1JQBA 3UGQA 3TUZC 3V48A 1AKUA 2ZYAA 2XXJA 2VCEA 3BJEA 4N48A 1NVEA 3LTEA 2F90A 1G20A 2PKCA 2FHSA 1Z37A 2QRVB 3GH3A 3Q5GA 5A4DA 4YCCA 1G6OA 1Z5PA 3ZDCA 4JIGA 1Z0FA 3HMKA 3LBFA 1EFKA 5J2UA 4AKGA 2ZCJA 2A5JA 1RTTA 3MRSA 2UZ3A 1YAHA 1RXYA 4ZYLA 1HORA 3QVKA 4XVQA 5I8ZA 1P2FA 4E5NA 1N7IA 3MF4A 3H1EA 5K3FA 4DAEA 5DOVA 4HWOA 2BFMA 4PIPA 1L9XA 4BKPA 1CR1A 1W94A 3FB4A 4KWEA 5LDGA 3M3HA 3OF3A 3FZQA 2ZB7A 2H1HA 5I7UA 2OYSA 3FOAA 1Z18A 3HYLA 1HOTA 1WZIA 2ZRCA 3BC1A 3G88A 3OQJA 4MIEA 2AYZA 2FW7A 2QLMA 4YALA 2P0AA 4X84A 5DW0A 5AWFC 2X40A 3U62A 3M70A 4OH7A 3C74A 1ZD1A 4B74A 4Y0VA 5EIHA 4QG3A 3ZZMA 3N2EA 4Y9TA 1NY5A 2EL9A 3EIWA 3Q10A 4XFJA 3RT1A 3FUTA 1GA4A 2NTNA 3BWYA 4UZEA 2Q3EA 1CY4A 3LXUX 4DM7A 4KP7A 1OTYA 2FPLA 2QUJA 3MD9A 1W88B 2UU9B 5KTOA 4YR7A 1C0KA 1CQZA 1UL1X 2O7QA 3V4LA 5BOSB 2GF0A 4AWBA 3HCBA 4QLBA 1N3LA 1JDSA 2OO5A 4LCEA 5DGDA 5E9AA 5DISB 2I2AA 2GEDA 3KEMA 4HN4B 5JS6A 4MDYA 3D8SA 2GA8A 4P4UA 4CN8A 1XCLA 3HCWA 4KPUB 5JVDF 3CVYA 4CQLA 3E7XA 4RPGA 3FHTA 5HKAA 2G67A 2IJGX 1XZEA 3RKUA 2VWGA 1W2GA 3VU9B 5TVKA 1PJSA 4H27A 3IUQA 1JLLB 2YYSA 3KT8A 1H1LB 4X92A 3A36A 4Z53A 1DKLA 2D7JA 2HSWA 2APJA 1GGFA 1LF0A 1XRSB 4DY6A 5A62A 2CKMA 4J6EA 4QVKA 5LM3A 3T7RA 1P5FA 2GFQA 1D1SA 3W3AD 2ZYGA 1LUAA 3Q7EA 4L0MA 3T7EA 2IZ7A 3NWPA 4BVEA 2W2LA 4JYCA 2ZIUB 3OF2A 4I4IA 1PFKA 1QIGA 3RIHA 1RWNA 4E14A 4JGIA 1ORHA 1LDYA 1Y3IA 1XQWA 1U9IC 3QPDA 4B2PA 1DKNA 5EHIA 3EIXA 1LPOA 4DJEC 4O4LB 1U8YA 1P9WA 4PTLA 3VR6D 3CBQA 4ZVSA 1F2VA 1W36D 1UWVA 4RIFA 4F4DA 3PHCA 5JE8A 1CQJA 4HTFB 1JQ3A 1NOIA 1U7HA 2A9VA 2W0SA 2XEXA 3H2IA 2YRXA 3NAGA 3ZGOA 3AY7A 1FFYA 2A5LA 1FLAA 1SBTA 2FPSA 4F4FA 2NX2A 1IULA 4ZZ3A 1PWYE 3STWA 2OAP1 4JXXA 4CM4A 3I9NA 4IFIA 2VXCA 2HDNB 1R4NA 2QS9A 5AK5A 2C8JA 4FC6A 1Z6XA 3OU2A 3V1LA 4X41A 1L7EA 2V59A 2WJZB 2X77A 3E4DA 3GXOA 5CPBA 5TARA 1N4AA 2V98A 5ETJA 3VPAA 2HMYB 2R68A 1CDEA 2HWXA 4PCVA 4BKQA 4GBGA 5ARBA 1A2BA 5I7WA 2ZUVA 2B7BA 2QTBA 2ZUFA 3GFGA 2VDVE 1HDCA 3RAPR 3PQ7A 5CA1A 3PFBA 1DUVG 2QU8A 3HE3A 5L7TA 2ZBQA 1OCEA 1XXHE 2I7VA 3OFSA 4D8YA 5A4JA 2LDBA 2OMKA 3TSWA 1U3DA 3PIRA 1CE8B 3T8YA 3Q6MA 5FUQA 2DPMA 4GUDA 1XMVA 1SQ0A 1L8XA 1Y3FE 5DHTA 4F91B 3AH8A 3KQYA 3LX8A 4MITA 1XC7A 4WFJA 1Y6JA 1XXHA 1FUYB 3WGGA 1ISIA 5ILGA 1GPYA 2KWIA 1JAIA 4FCWA 3K0EA 3QX7A 3L8GA 4UU8A 4HQKA 2CFTA 2LKCA 3N8DA 3Q2KA 1U0BB 5JSZB 4I6JA 1QH8A 4PSUA 2FMTA 1PR4A 2NU8A 3OWXA 4J1SA 4BFXA 4G4GA 3U7EB 3QOXA 4YRSA 4JUIA 4ZVTA 2IOHA 1OXUA 3KYDB 4N47A 3VU1A 2QM0A 4DR2B 3KUCA 1K2VN 2FX2A 5JECA 5LBTA 4P9NA 1TADA 3HYCA 5JARA 3TI7A 3WLJA 5H3HA 1ZK1A 1E98A 5KU1A 4UUQA 3ZOKA 4D5EA 1RJWA 3H0CA 4M7RA 3W4JA 3G7SA 1RW4A 3MAJA 4IG9A 1EVEA 5IWCA 5DSTA 4HX9A 1QYDA 3SC2B 2JAXA 2Q45A 3QEJA 2G72A 4MUMA 4NV0A 3WZLA 3WZMA 2J6HA 4MAFA 3S2SA 4CRWB 2QN6A 2ZWPA 2IWRA 3JAWB 4I3FA 4PZDA 3OZRA 5F1YA 1EE1A 1GEEA 5AVUA 4F4CA 2BRUA 4EYOA 2IYAA 5EESA 1UUFA 1WMBA 2HA6A 3BREA 1Z73A 1JFLA 1GO2A 4QX6A 5BV2P 3OEHA 1TVEA 1NE7A 4UATA 3DEAA 1YONA 3DNMA 1YGYA 4QDTA 2C88A 1A76A 2CFRA 3DWGA 5KJ6A 1T26A 1KBQA 2QU7A 3RANA 5A0VA 4PPNA 4IMRA 1PDOA 1IYZA 2TMDA 4LRXA 4OU4A 4N6GA 3ONEA 4FR0A 5JCPA 1W47A 1V2GA 4M7WA 4UM9B 2AKEA 2IOYA 3HA5A 1GQYA 4S12A 3U4GA 1H5NA 5C51B 4J29A 4LDPA 3MGCA 4W9MC 4IOJA 1VHWA 2DQKA 4L9RA 3W8FA 2XUPA 3OTQA 1I4TD 1JE0A 2J9GA 2RI1A 2O8FB 2QTVA 3RYFA 3QTTA 2H4HA 3R7BA 4P3PA 1MMFB 3FWZA 4YLYA 2ZU0C 4TSFA 5I8WA 1PK8A 1FVFA 1VL2A 3SC6A 3CLHA 4F9TA 3PTAA 3GP5A 4JLDA 5KOHA 4IX1A 3RU9A 3FNGA 1Z5ZA 4PC6A 4PGHA 4YHBA 1EVQA 3A25A 4UQLA 3JWIA 2V5AA 2X22A 4K87A 3N8KA 4DIUA 3JQGB 1Z88A 3CRQA 1PGNA 2I2XB 2OO3A 2RB4A 4CCAA 2H31A 4KI0A 3HLYA 4AI6A 1GVNB 3I8OA 3ZKWA 3I12A 1MR3F 4UPDA 2NSDA 1RJ9A 2VSNA 1GGEA 5HPYB 3DL0A 2Q8NA 2Q4RA 5JFGA 3KR0A 3P0IA 2O0LA 3P2KA 3P2YA 3L4KA 3EIOA 1P3Y1 2NXEA 4E09A 4NBTA 3TRKA 3LS2A 4Y2SA 1N1MA 1TT5B 1O96B 3KQUA 4JI6B 4F38A 1QK4A 1P29A 1WPXA 3DKVA 4FN4A 2C7PA 5DHRA 5AK6A 2VHJA 3C3AA 1ZJWA 2I5PO 2R5FA 5DWDA 1JECA 5DTQA 3WB1A 4ALJA 2W2QA 2H8KA 5IXSA 1RLUA 1SOMA 2Z8XA 1R12A 1S01A 2XXBA 3B3AA 3DDOA 5KHAA 4DLRA 4GIBA 1U3GA 4EVIA 3D7RA 3PNLA 3CF2A 3QLVC 3UCXA 4KWIA 4JKOA 2YZGA 2V45A 3KSZO 4U7PB 5H9VA 5A9TA 1G1MA 4YRRA 4KOEC 4UD2A 1H6AA 5CX1B 2V7UA 5JYBA 1N36B 2GT1A 1ACMA 3GEIA 3GROA 1W36C 1K9SA 1ACJA 3F1LA 3WA7A 1HFEL 1T5DX 1SO8A 2F9LA 4FC7A 4O29A 4Y6GB 5A4IS 4TMFA 1BCRA 1LDBA 1NPYA 3EF1A 4ZEMA 3V7WA 3QKRB 3DLPX 3IULA 1QB7A 1IBCA 4HYEA 1NI4A 1I5EA 2CE2X 4O4LF 4EB6B 5KYYB 1FIUA 2HT1A 4UEWA 2WJ6A 3FWNA 1CU1A 1I1QB 3PQ5A 4EJ6A 1GZUA 3N39C 3U3MA 2JGMA 1XEWY 4EJSA 4US2R 4OAQA 4TS1A 3CH7A 3O3NB 4JAVC 4PPQA 3S2FA 1CW2B 2GZMA 2QMEA 4C0LA 1VPLA 1R9JA 4TV8B 3QIAA 4PLTA 3LDFA 5D00A 3ZGVA 1KWKA 3HJAA 3SF8A 3TKYA 3KETA 1E6WA 5FNVB 3VNRA 4PR3A 2K6GA 4B87A 5B7QA 4CBVA 3UOGA 5BWNA 5G3YA 2ABWA 5FIUA 4I1YA 2A0XA 4NH0A 4OYLA 2RGGA 4YI3A 4O5AA 2ZJOA 1EFLA 4KDRA 2RD2A 1U2RA 1CR6A 4RJJA 2FSUA 4U9HS 3K09C 5JZMA 2KJQA 2R1VA 2QX4A 1GT6A 4JP1A 4MKRA 4O4HA 1KI2A 1U0RA 3PHIA 5J5AA 2IXTA 1ZIOA 2WG0A 4RF5A 2NUTB 1I6LA 2DPGA 4HNAA 4L76A 4QLOA 4Z99A 2PMEA 1DBRA 2JFNA 3SQMA 2VBGA 1X92A 3Q12A 4KTTE 2AEEA 3F5SA 3IB3A 4R7ZA 3TLYA 4BBPA 1P1FA 3EG9A 1TQ8A 2IYRA 2JFPA 4O0LA 3C3EA 3UAVA 2ES4A 2QPTA 4FNMA 5EXDA 3LZDA 4MYHA 1PZFA 2KMLA 4OLFA 4ZYVA 2ZWVA 3T5PA 2CLSA 4D9JA 3SXJA 2ZSHA 4KYVA 4R9SA 5IYZB 4C0SA 1MTOA 3L1IA 1P2VA 3V80A 2XUQA 4FUTA 2EJWA 5FWNA 4Q3AA 2GRJA 3L7AA 1NMQA 2ZRNA 5LQUA 1QC5A 4DCCA 3ZI7A 1UFVA 4PN3A 1EDDA 2CUTA 1HDZA 5NLLA 4H3KB 1NBME 1P7ZA 4HX2A 1LNSA 2FFHA 3DSRA 4YT5A 4UARA 3MERA 3F73A 4BIMA 1GJRA 5DNDA 1NX6A 1AXEA 1SVWA 1RYYA 1CZUA 3UC5A 1PGJA 4TRNA 1ZPDA 2YJNA 3CUKA 3IAXA 4GF5A 4QLAA 4Y30A 4C4SA 3GW8A 1QFYA 3LLUA 4OI4A 3HKDA 4WLEA 1L4FA 3UAYA 4Z9YA 1NBMA 3EC2A 5BSGA 5FBVB 5C5EA 5K0CA 5CM8B 4BBAA 2ZSBA 2GN6A 4U7TB 3DOFA 4FMCB 4R51A 3OX2A 1JHOA 3D59A 4LMRA 4Z0NA 3T5GA 1C5KA 1C81A 3DDNA 1NW9B 2EQAA 2GPBA 5J1TB 1R27A 4CXMA 2WWXA 1G0OA 4TWJA 5JAQA 4GQAA 4C05A 4OM7A 3UO8B 1PFUA 5REQB 4Q3KA 4DC0A 2GVNA 1MAUA 4D9HA 2A58A 1Z6TA 1VHLA 1ZCJA 1ODSA 1PX2A 2Z3VA 5JSKA 1UXGA 1LX7A 1CX9B 2NXWA 2OHVA 4M0LA 3AR2A 3LYLA 1AQYA 1R37A 2QNBA 1B2RA 4WKOA 3UMCA 1X8KA 2C2MA 2O8NA 2G5TA 1OAOA 2G7ZA 3KOOA 4XWWA 2H7VA 2QT9A 3O2QB 4Q1DA 4Q5IA 1DJQA 3U39A 4LRYA 1AKMA 1MQ8B 1Z8HA 3IURA 1NBEA 2HBYA 1VJTA 2Y71A 4GX5A 1XN4A 1DWUA 1WVMA 2WWTA 2XLBA 2YFYA 2QSJA 4XIIA 5CT4A 3O0DA 2JJ1A 3MTAA 3RLFA 3W34A 4RTPA 2BSQA 4PSVA 3D43A 4D8UA 1ZJ4A 2XW6A 3BXFA 4X60A 2X0JA 4RKWA 4URYR 1USKA 1IOLA 2QDXA 3ZTWA 2YBDA 1E3SA 3R5TA 4EKYA 5CLGA 3GZNA 1KU6A 5HIAA 1C1HA 2ONZA 4I5IA 4LNHA 2WLSA 4HCJA 5E9JA 2ONJA 1Y3AA 1YJQA 1NOJA 1PR1A 1EH5A 2RIRA 4OKSA 2WE8A 1D4ZA 1O94A 2W9XA 1NW5A 3I52A 4QQNA 3VOBA 4DRYA 3I01A 2X13A 5CUQA 2V1UA 4N03A 1A9ZA 1BD4A 1N9GA 2O2IA 3O8RA 1R5NA 4LW8A 1YR9A 2ZWIA 1A5TA 2NV6A 3U49A 3A1WA 3BILA 4II3A 2Q0SA 2YOFA 4UZSA 1ESNA 4D2IA 5AUOB 5HS4A 3H19A 2ACVA 2VTBB 2Z9DA 4P81A 3R0JA 4K1LA 4XR4A 3S44A 1MW9X 1L5KA 1QF6A 2X86A 2R4QA 3L82B 1UWKA 2RHRA 3FUXA 3QBEA 5I9TA 3VR2A 4C7MA 2D1RA 3FCSB 3R23A 3BF7A 4HGZA 4IF6A 4MVJM 1W4ZA 5CIQA 5GVRA 3DV9A 5DLDA 1H9AA 2ZIXA 5K3SA 1YZGA 4EMBA 1MJFA 2EZ8A 3WBBA 4DDVA 4F8EA 2AXPA 4IXDA 4A27A 1GPH1 1BRMA 1DEAA 2QXTA 4E3WA 3VZDA 4EG4A 4TL8A 1X7XA 3WRXC 1MJGA 4IMJB 4NEHB 3A6GA 3H8VA 1OLUA 3V42A 5K03A 3PJDA 4DUGA 1XPRA 1YAJA 1M6YA 1NHWA 1WUJS 4GPD1 3TW8B 1RM4A 2R44A 3U7IA 2F3RA 3PNYA 3V32A 3FG9A 3DM5A 2PKEA 1SHKA 1ZIYA 3LKVA 4PG8A 2H5EA 1DE0A 4BNDA 1YDMA 2H7YA 3IH5A 4HR7A 2A92A 1IPEA 2FXIA 3ZDBA 2UZ4A 4NNJA 3PQ6A 4J7AA 2W2NA 2XMZA 3EFOB 5AJZA 4PC7A 3IL2A 3WAJA 3UWOA 2FNAA 1V25A 3K31A 3ROXA 3TD2A 4KIGA 3KZ1E 4JQCA 5EMHA 4NOKA 4W1PA 3L4BA 3B7WA 1W36B 4FZJA 3OKFA 4KQIA 4E5MA 4OLAA 2J4FA 2Y66A 2B78A 3WLAA 4BPBA 5C80A 5EKUA 4PRLA 3K9QO 2GO7A 5KMGA 1NBHA 1P6QA 4H4DA 4LY3A 3AR9A 2C2OA 2FSFA 2BY4A 2QI9C 4GVXA 1IB6A 4MRVA 3B51X 5JH7B 5FNVF 3WGNA 2CYCA 3S5JA 2P3OA 2Q4OA 2WT9A 1ODFA 2Q6IA 4JLPA 1KS2A 1I01A 2AHRA 2XTNA 3BRQA 4NPCA 4PO3X 5F1KA 3DB1A 2AW5A 3RUAA 5FL3A 3GIWA 3WLHA 2BPOA 3WIUA 1RR6A 1CS0A 2WP0A 4AB1A 2WF5A 3THYB 5AW0A 1CTQA 4MVWA 4CYMA 4V1CA 1M6NA 1OT5A 1Y5LA 4OF4A 5HFAA 1R00A 4HI0E 1DAOA 1NMXA 1UK9A 2YWXA 3EISA 3I6BA 3Q3HA 4D7AA 2QBYA 4EHBA 3S8MA 4PBRA 4NXNB 4QFBA 1H0KA 4WY2A 4JQOA 6YASA 2E4YA 4IHJB 2FK7A 2IDKA 5G4LA 5IASA 2O5EA 4JDPA 2C4TA 3OEYA 5IBRA 4ASUD 2VYCA 4KKVA 3CVOA 5CEJA 2ZIGA 4FGJA 3P52A 1RWWA 4JB3A 5ER6A 2J7PA 5JO9A 3EGEA 3H42B 3TAHA 1CF4A 5ALFA 2H2AA 2VHQA 4NQZA 1QH0A 2DFKB 3MEQA 3NAZA 5ED4A 1A96A 1IHYA 1IM2A 4BIIA 3KQSA 4PHFA 3GJ8A 3JR7A 3L18A 3M6IA 4PSKA 3LQ1A 4UXJA 2JANA 5A5VA 1G66A 1I4LD 1HTBA 4Q18A 2OQVA 5JPIA 3F3SA 4Q9LA 3IP1A 3W2HA 5FOSA 4HF7A 2FE4A 4RZQA 1E3MA 3FOWA 1XVVA 3EWSA 4RYDA 3TLJA 1AKNA 1TF7A 1J0BA 4WESA 3ZQJA 4CMJA 2QIOA 1OPXA 2G36A 2W6NA 3B9QA 3PPYA 4KLZA 2Z2JA 3ANTA 2CK3D 3FHCB 2F9MA 5ALEA 5GV8A 1RQXA 3W5BA 2WD9A 1YR2A 1XU4A 2ENWA 1JDBC 4RH3A 4NOJA 3LQ2A 4FMCF 1VSTA 5TB5A 3QTLA 1RXUA 3ILYA 3HN7A 1H8EA 2DYKA 3S55A 5LA6A 1NXWA 2FMHA 4K6CA 5FOUA 5A6SB 1A2QA 4XYLA 1ZOIA 1JHYA 2IZ5A 2VUSA 3OEWA 4V03A 4IVNA 2Q62A 1FRVA 1AUOA 4IDPA 3ZWDA 3U13A 1D5CA 4GH5A 3OD1A 4QUIA 5EUMA 2CCJA 1KAQA 1RM0A 3WMXA 2O8EA 4PINA 4ZI7B 1DTWB 3ZDDA 1BKYA 1F2DA 2GZAA 3BE5A 1XPJA 4BGIA 1JMYA 4R71A 4PO1A 1F38A 1E0JA 1ML4A 1J2EA 4H7DA 4UCQA 3TZHA 3B53X 5IJ9A 2PK3A 1R18A 4MUKA 4JN6B 2X15A 2I2DA 2V7QD 3I6ZA 2CV1A 4A6PA 2GEUA 1H8HA 3L4SO 3UJ9A 3F6EX 2G80A 1SY7A 3MS7A 4DV5B 3NCHA 4NY1A 5I4BA 2BZSA 2O0JA 1FFDA 1G6HA 2XA2A 4ZQCB 4B4KA 1E60A 2PBZA 1KI3A 1D09A 1JHQA 3T99A 2J8ZA 2VJYA 5CFOA 2C9OA 3AJ9A 3KNZA 4J3JA 4NV3A 4Z7OB 4MSUA 4JGGA 1GT91 1E3EA 1MAWA 2CUKA 3TD9A 1XP5A 2ZLBA 3R4VA 4DWWA 1WO8A 4MB2A 1ECCA 3OPYB 3RNLA 2BKXA 4GKVA 2B2CA 3H2HA 1LXCA 4J9UE 1IJEA 2Y77A 4XGQA 1G17A 1UMDA 1WEKA 3PHGA 5EZ5A 3UK0A 5BURA 1TZ2A 3HS3A 4ITUA 5I9NA 3GUYA 3DLHA 2DQ4A 5BPFA 5DLEA 1E3WA 2JL1A 4IMIB 2QTNA 4HUQB 4QNMA 1U0GA 1TCUA 3CPHA 1W59A 3P9XA 5HIIA 2QZZA 3CZ4A 4Q3OA 4A0RA 1LV8A 1S3GA 2GN2A 5DLYA 4ZVOA 1HEYA 2AWOA 2Z08A 2ZUTA 3NGXA 4FYHA 4YQYA 1JNYA 3HZOA 1B6TA 2K87A 3RVJA 3EF0A 3TTXA 4ENWA 2EGGA 4LRWA 3TTSA 3AVPA 3EGDB 4ZJUA 1FA9A 1KJ9A 2YIMA 2A33A 1UC5B 1YL7A 3RB8A 1SXHA 3WMFA 2CHFA 2WM2A 2ZYHA 4QWMA 4A8JB 4UJ5A 5L45A 1LPMA 3P9ZA 2O8CA 3LIIA 4M0KA 4MYRA 1W49A 4DADA 4RULA 5KREA 1JJ7A 4QVIA 1J5PA 4BQIA 1RYBA 2V9ZA 3RKRA 4P53A 1YFLA 2IODA 4Q9HA 2AWNA 3ANLA 4TVKA 3KSBC 1C30B 2FH5B 4C2UA 4LI0A 1SU4A 1PQYA 1ZGHA 4EHKA 1OD6A 2P62A 4L27A 4RFSA 1JG7A 2Z04A 2BTQB 3QPBA 5T6BA 4GC9A 1I3NA 3RKSA 2P1DA 2CNKA 4IIVA 1F3OA 1P8AA 2HTFA 4WECA 4B3XA 2Q28A 3DVRX 3LYAA 1PG5A 3UJCA 1C9MA 5FOTA 3KQHA 4KHPB 2GPTA 5LP1A 5LUAA 3U7QB 3MAGA 2V5VA 3WRVA 3SEQA 4JI1B 3O8LA 2AOTB 3PE4A 4GICA 1F6WA 4DR6B 1RRFA 1Z7GA 3FNHA 3EWAA 5T64A 2ID7A 2DWOA 3P9NA 1OI4A 5FI3A 1ZQ9A 1PJ4A 1TKBA 4FEEA 2BIFA 3B8EA 7REQA 4HNHA 4R41A 4L4XA 3RAFC 2PJRA 3QPUA 1VCMA 2NQ8A 4IDDA 3RVLA 2ACEA 4ZWNA 3D4IA 1XN1A 3EXAA 1FZQA 2Y2UA 4C4AA 4JWTA 1KI1A 4HVCA 1DCMA 3TKLA 4TTJA 3I3OA 3EG5A 4EFKA 5JH7F 4ZT6A 2QRQA 3PLRA 5BYAA 4NZMA 1D03A 1FSZA 4B85A 1C7QA 1DDIA 1UFQA 3QLEA 1UPUA 2PKRA 1DDOA 1V39A 4M0CA 3TQFA 3BB1A 2YNMA 2JKZA 2Q4TA 3GLHB 2PGJA 221PA 4KXXA 4OP1A 4XUEA 1MRNA 2CNBA 2EEPA 1QO0D 2RAUA 2PD3A 2XBMA 3OZSA 2V7GA 4AN1A 3W04A 1OVGA 1L4GA 4GYWA 1AO0A 4OJYA 1ZUWA 1KI8A 2Q2WA 2H1FA 3AWDA 3C7CB 3FYCA 3V8RA 2WP8J 4IHJF 1VGRA 4U2FA 4XD7A 4DSTA 1BE0A 1XMSA 4IWNA 3T3HA 3DFMA 4JMPA 2V5UA 4MYUA 1Z2EA 2C2ZA 2FCRA 4WVLA 2ZUDA 2XV1A 5BYJA 4OJQA 1KFCB 3TQHA 3X0DA 2FWNA 4ZAVA 2CLOB 3AVXA 4OK6A 1EWKA 1FX0B 1S6YA 2IKSA 2V6MA 4NFLA 2BR5A 5JISA 2Q1TA 4ADSG 1VRCA 2V7TA 2ZR7A 1JKIA 1Z35A 1WZNA 3UAXA 2DFPA 1UDRA 1HYEA 2HHCA 3NWOA 3GO4A 2VPQA 3EIUA 4ARSA 1SHLA 3VPGA 4EL5A 3DLAA 4UKDA 1VIMA 2WUVA 1E0AA 3IYLW 2JAHA 3R44A 2OQRA 1MOPA 2YQ4A 4X6YA 4HNVA 3T54A 3GFTA 2WRZA 4X9XA 1GFWA 2BZ0A 4FFSA 4A4DA 5E3HA 1V26A 2HNAA 4NULA 3V5NA 3DV0B 4B17A 3GZ4A 1W2HA 4RABA 3O93A 3DUFB 1FS6A 2YHIB 1DBWA 3BE4A 1IAVA 2A14A 4O63O 5JS2A 2GLXA 1R4ZA 3I34X 1T2VA 5LR6A 1GGKA 5CTJA 5LLSA 1RADA 3TSAA 2O19A 3TIIA 4NMHA 1GGNA 9LDTA 2C94A 1V1RA 3WYGA 2JFYA 1CQWA 3EEFA 3UATA 4B6PA 4DSUA 4D41A 2Y92A 4CWAA 5KEIA 4L8YA 1E99A 4O25A 3ZTYA 4BZPA 4RXTA 2IGBA 2ZRPA 1JDBB 2D2EA 3L1UA 2FPRA 3WYNA 5TNXA 3F8TA 1BXGB 4QOFA 1PV4A 3SX2A 1C4XA 3NALA 2PS9A 2HO5A 4ZI7F 4UW9A 4BNHA 3GFRA 4A15A 2NU7A 3ENNA 3IR5A 4I1PA 1XB2A 2O3QA 2Z1MA 1K9VF 1ABFA 2H07A 2QROA 3AZQA 4ISBA 4MR8A 4UJ3A 1QIKA 1NOKA 1U7WA 2EVWX 1VOTA 2XMBA 3BORA 5LDHA 3I2HA 1MAVA 3QMMA 1TE2A 3U1VA 1X9HA 3DHNA 4UUBA 4B6OA 3L0OA 2WYVA 2GK3A 3ZIAA 4EY5A 1SBYA 3KHUA 2J07A 2VKQA 2JZCA 3MK31 3QXSA 4O2LA 1T2AA 2HMVA 2PO7A 4YREA 4XWGA 4EJ0A 2FEMA 1R3DA 1M6EX 1YJ8A 3BGDA 4WNAB 5HRAA 2VJMA 1ZBQA 3VR4D 3KHTA 1PUIA 1Z36A 2R6DA 3R5HA 1YD7A 2W90A 3JQ6A 3AMVA 4RL4A 3OT1B 5HKOA 4CM3A 3RSCA 2P9HA 2Y93A 5B3JA 1SCUA 5I4CA 5IAKA 1WXQA 1BE1A 1UIMA 4GZ6A 4ZI5A 2IW3A 4RIIA 4V02A 1HSZA 2PTGA 5K0TA 3SR3A 3QUCA 5C2JB 1LTQA 4CIDA 5FWYB 4IJUA 4AURA 1AUPA 4TMZA 2A1TR 3G6KA 2ZYIA 4ND1A 5K2MA 3BT7A 2RGRA 4ZPXA 1XA4A 1E59A 1C8BA 4IGKA 3EIFA 4M8LA 1MA3A 1PL6A 5KSZA 3A7EA 2XNCA 4DLUA 5EVJA 1KYTA 1U98A 1XAIA 2NSLA 3KLBA 4NI5A 4BUJA 2FWBA 2X4IA 3IUYA 4JLWA 4K2AA 3JATB 5HW0A 4AQYB 2GESA 2GYVA 4JUDX 3VGJA 1SD5A 3BRWD 1F60A 3GAAA 4ZAYA 1IATA 3SR4A 3TL2A 2A9OA 2ZXUA 1XTUA 2FZVA 5F76A 2REXB 1B76A 2YVQA 1LZKA 3A4VA 3IGFA 5F3DA 2Y9PB 1J8DA 1SXJE 5LU9A 1JILA 3I45A 2Q9BA 3SYMA 2JBWA 1J0AA 1B0UA 1NP7A 1HEUA 1WKBA 2CNWA 2PX8A 2QR2A 2QVGA 2XITA 4P4SA 5AHWA 1SUCA 2PUHA 5CNMA 5ADHA 1Q0HA 2CHGA 3KJIA 4PG7A 5K8LA 1KI6A 3WFZA 4PLWA 1YZYA 2Y0PA 1TX4B 1BOFA 1Q14A 2RCNA 3D4LA 4Q16A 3VJRA 4M22A 1MO4A 1SXJA 3FR8A 4KV7A 1P2DA 1Z16A 1PLKA 4YUVA 2VAPA 2C20A 1E20A 2PQMA 3DCIA 5K0GA 4UUPA 1EMDA 1G3IA 4BJ6A 4YMWA 1EFTA 3QXJA 2ZJ3A 3T7TA 1U7ZA 3O3CA 2FXVA 2OCIA 3GBSA 3OZ7A 4L08A 3VU8A 4CM6A 3T3DA 5FO1A 2DM6A 2GEBA 1TO1E 1Z82A 3DEZA 3JVIA 4Q1EA 1BX1A 3IAM6 1J2JA 1F5NA 4DR1B 3H99A 3DE1X 2G4VA 3TAUA 3E81A 1KFJB 5BXYA 5ISMA 4EEXA 4M86A 2W71A 1EFDN 2O5VA 4GX1A 5ALOA 5T4EA 3R09A 3DE0X 5T3UA 1QP0A 4I9NA 2IEZA 4J4BA 4DIBA 1KS9A 1CEEA 1PLJA 4YECA 2ZDGA 1JDTA 1R5BA 1Z4KA 2C5SA 2DR0A 2QWXA 3GLFA 2EF0A 1IG0A 3N8IA 1RAGA 3I0NA 4KRXA 3ZS8A 2ZJFA 4DABA 4FCTA 4YJHB 2JA2A 1G55A 4R54A 3RUHA 4OJKA 5A9SB 2NM0A 4HZUA 2WJWA 1I3MA 1XDUA 4AG5A 3D54D 3PI7A 1KKUA 1YE5A 1ID1A 1FYWA 1Q1ZA 3GVCA 4PYNA 4UCFA 3WLRA 2XGJA 1D2MA 1UANA 4PX9A 1QGYA 1XRMA 2A78A 3G0DA 1C1XB 1NM5A 3LOQA 4GQBA 4XX0A 1UXKA 2KI5A 1YDHA 2ZI5A 3KB8A 1DKQA 1M1NA 1S89A 2D5BA 2HL6A 1SCAA 4FLFA 1DTSA 4MUAA 1TQ2A 1XRJA 3AHHA 3FKSD 2ENUA 4EJ2A 5JAZA 2QJOA 3HLTA 1AIPA 2I66A 4XDYA 1MTZA 2RK4A 2ZWMA 4IDOA 1KL7A 5DH9A 1ISSA 1O4VA 3ULKA 2QI9F 4LPSA 1XKQA 2GFIA 4YLEA 1IQPA 5G41A 4B4UA 5K2OA 1VFPA 4D4GA 1W34A 3OU6A 3HZZA 3CEPB 3IBFA 4KMMA 1SBIA 3AINA 1G4UR 1FDVA 3KPWA 1U9ZA 4FK8A 4Y6PA 3WXMA 4OB6A 2YBEA 2VK8A 4JH0A 4Z51A 3OZEA 3D3QA 3P2OA 4MQLA 2PBRA 5D1HA 4FLEA 5HGXA 2HJVA 3VNAA 2XQKA 1Z83A 4POOA 4ODIA 4W1SA 4QWWA 5FTWA 3O8QA 3OUZA 2FI1A 4R2JA 4M0DA 2A94A 4BMOB 3HYSA 4R16A 4V0MA 4OJTA 3BEDA 2Z30A 3WNVA 1ZX1A 3D7LA 1UOOA 3F74A 5LJLA 1SM4A 2FPXA 1JFVA 2E4WA 2EJVA 2JIRA 3OQHA 4MUIA 5H59A 3UAOA 1ZITA 1P6UA 3MMZA 1ZXBA 3KT0A 1NU6A 3BWBA 3WA6A 2WZQA 2EP8A 3D1LA 3HWSA 3FCYA 5FUYA 3ONWA 1AN9A 2BCEA 3EQ9A 2I78A 3WNCA 4EQ6A 4RWEA 3FCEA 4L8WB 1KZ4A 3D3NA 3N76A 4WEOA 3UKDA 4HY3A 3OZCA 5JJLA 1DOHA 3EPPA 1YRAA 4S1OA 2FQWA 3AERA 4WW0A 3L84A 3W0LB 1SPBS 3ZZNA 4Z4EA 1QFMA 3ZIUA 1QHNA 1AKEA 1A04A 1KZYC 1XZCA 1YJXA 2VPIA 2WTBA 2QK4A 4ZAWA 2EBHX 2EEZA 2G0AA 1KORA 1CC1S 4BQRA 1DHRA 2DBVO 2VWHA 1XJ0A 4ABTA 4LE1A 1JDUA 1P1HA 5KYVA 1ADCA 1EINA 1MC5A 1KDTA 1QB8A 1BNCA 1R15A 4NR0A 1KK1A 5DFAA 2ZYRA 4ZOEA 2DQYA 2FWMX 2ZRDA 1Q84A 3OE7D 3AV0B 2NV2B 3HJHA 3PR3A 1EFUA 1JT2A 4F9EA 2R84A 3FMGA 1GV1A 1W30A 5GGYA 4LTMA 1C3EA 3DXZA 5J59A 4TWIA 3OJOA 5TXGA 1P5JA 3LPLA 5ALGA 1VB5A 1OWNA 2GXUA 3UNXA 4FGLA 3ZK8A 4RESA 1GLGA 1LBHA 2FSVA 2ZB4A 5HRUA 1K4KA 1WZCA 2OSVA 1TTHA 4WX2B 4ZVNA 4L3VA 1QDLB 4RHCA 721PA 2JLSA 3AILA 4QYIA 2PS1A 1NBOA 1Y4ZA 1V2HE 5SV2A 5AI6A 4C6RA 5ABPA 1YXMA 1PZGA 4DG5A 1NFQA 4YMTA 1GL6A 1VPDA 3G1UA 3GL9A 3L7JA 4I1OA 2WUDA 2X6QA 4IIDA 4EYKA 3KVVA 4Z7QB 3SX0A 1XYVA 1G16A 3JALA 3ADBA 3S40A 2HQRA 1H4TA 4IXMA 2H1CA 3QX3A 4O4LA 1CR2A 3GLIB 3PFCA 4R31A 1L1EA 4LC1A 1G5QA 1LWNA 2LUOA 1JI3A 4D46A 4Q24A 2WQ7A 2I9KA 1TLTA 4HTFA 3CLTD 4R8KA 2Z4RA 3A2MA 4B6EA 3IVCA 4MZDA 1Y34E 2VF4X 3BKXA 1WXHA 3HACA 1OU4A 1MIHA 2BKAA 1ECJA 2QAJA 4FI3C 3JARA 3R5SA 3GGPA 2QSZA 2GARA 5A9RA 3WGIA 1J24A 4PZCA 4M87A 2DUWA 1V6AA 2VYND 3W7BA 1KYXA 3OIVA 5I7SA 2FN3A 1MGOA 3I6YA 1F0NA 1J8FA 3CRNA 4ZVKA 3UMJA 2VHVA 1NVAA 3KC2A 1PYDA 2C54A 2GEJA 3UFXB 4AJKA 1JZSA 2RHGB 4ZTUB 4YWJA 1XVUA 2VRNA 5BWMA 1L4UA 1O6FA 1MFPA 4P86A 2GF9A 1GGMA 3I5MA 2IH5A 5JYEA 5AI9A 1DZIA 1RQGA 2X0RA 3HDYA 3TTYA 2UVPB 3D6AA 3P96A 4UNSA 5KSYA 2XA1A 2J87A 1CE8A 4R2XA 3TRIA 5FDFA 4PZEA 1YB5A 3WLPA 5FX2A 3M5WA 3IKLA 3VH4A 2HQOA 1YK1A 2IXGA 4IOLA 3ASVA 1YACA 3GDOA 3L02A 4RU1A 3CR7A 3D2AA 5IMBA 5ULLA 3I62A 1I13A 1S2GA 1L6IA 1F06A 1Z5GA 2R66A 1KSGA 2HA4A 1LI5A 1M2GA 3ETEA 2IIQA 3UBMA 1KARA 2WF8A 1EDBA 3HNPA 2GM9A 3K5PA 3O84A 4XWTA 4KR2A 1BW9A 3QBJA 5HSGA 1L7VC 1R8YA 3VSAA 4AJIA 4EHLA 4R05A 3TQTA 1S3IA 5K3EA 3HZHA 3CF6R 3HRHA 4O2AB 5FOWA 4P82A 1OTXA 4GLLA 5F73A 3ACDA 3GGJA 2BM1A 2C9BA 3MJTA 5JRZA 5L53A 2JI9A 3NX4A 1Z0UA 1V11A 1XKLA 4MH0R 5CD9A 1VM6A 1G3QA 3NG1A 4RTMA 3EEYA 3FTNA 5GP1A 2BLNA 3T3PB 1TNDA 1TXGA 4QJIA 4UZFA 3MS4A 4C43A 2RHJA 3LUDA 3OLWA 2D0OB 4TL6A 2G9ZA 2BFCB 3DAPA 1NBAA 3CT6A 3L8FA 4C4YA 4QRHA 4LF7B 3OEEA 4HQ6A 3C41J 3PUVA 3UHOA 4MWTA 4KACA 3KZNA 4EFMA 3JQPA 2GUGA 4G3XA 4DXDA 4Z5XA 9GPBA 1UOEA 1Y33E 1NMYA 3DMFA 3KU4A 3PE3A 2AHOA 1KOJA 3JAWA 4N8EA 1EZ1A 2OLEA 4B44A 1A2OA 5L3SB 13PKA 2RGWA 1T9ZA 2AC7A 4RY2A 1FDOA 1NPTO 2W6ZA 4BMZA 4EO7A 3FCAA 4MVJG 1X7DA 4ZICA 3QFCA 4H17A 5ICFA 5AQEA 5A05A 4K1XA 5CYOA 4D74A 2FWIA 4I81A 4FHFA 3OCUA 1Q16A 4FOTA 4ZZ1A 1XZQA 3O1IC 1P7WA 2G5PA 2AMVA 3UT5B 3BH6A 3KL2A 4RVOA 4G0MA 5IMSA 3EGXA 3ZI4A 1GAXA 5SYNA 2H2GA 3V8EA 4ZO9A 3C0KA 1FTWA 4IDGA 3TNJA 5IX8A 5KO2A 4UHEA 3T3MB 3B85A 2R6CA 3FIUA 5D3MA 4BOYA 1FNCA 1EFVA 1YVRA 4IDHA 5F21A 4CT0A 4JOCA 4PQFA 4UHCA 5IK2A 1OC2A 3E2IA 3U19A 2GDJA 2B20A 2AZTA 5CA0B 1QHSA 2VP3A 3D4BA 3IAHA 4DLXA 2HWKA 2IYWA 2DY1A 2BUCA 3L8ZA 2V6FA 4Z7JA 2FP4B 3O1HB 3V7UA 2O59A 2XE7A 1LD3A 1I10A 1MB9A 5DTRA 4BNLA 1N2SA 3AYXB 5IZCC 3W90A 3QPVA 4LF8B 3MNFA 3ZU2A 4GMHA 1DDGA 1B8OA 3RF7A 2GPAA 3C2QA 4YB8A 5ALVA 3RYHB 1YZKA 3SHFA 3HKEB 5GJCA 3KFVA 5JNWA 1X39A 3RRNA 3H2YA 3QNWA 2ZT6A 1IEWA 4MHSA 3H8JA 4XB2A 4NICA 3MBOA 5EQFA 1FLVA 5I7EA 1IE3A 2I8LA 5I9SA 1PJ8A 3BXXA 1PTJA 1NASA 3OP4A 3HR8A 3QKTA 1QX4A 1CUIA 2GAIA 2IHYA 4RD3A 2JGLA 3IXQA 3LNCA 4MI6A 5K1ZA 1ZBDA 4NJMB 1WXFA 4DKJA 4UQOA 4N8SA 3FYUC 1HG0A 5T4HA 2O0HA 2XDYA 2ZKLA 3C15C 4IKOA 5BR8B 1WCIA 2BGUA 3BMXA 5KWVA 1E7MA 1HZJA 5FHQA 4C7OB 5JAIA 1QIMA 2BC9A 3NPMA 4UE2A 1N8TA 4E5PA 5JZ9A 1WCYA 4YRQA 1VYUA 1II9A 5BSUA 5T67A 2OCYC 5C8ZA 3VR3A 1Z2NX 2VZ0A 4JVNA 4DMUB 4HSEA 1ZG3A 1WAMA 3G2NA 1G7SA 1KQOA 4Z3DA 2BF4A 4COOA 1GPDG 4NZOA 2BMVA 3IIMA 1W6UA 2BMFA 1JQDA 3JYLA 2P68A 5D3KA 5FI0B 1LPAB 3VZCA 3SQDA 4CMBA