4U3AA

Crystal structure of ctcel5e
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
304
structure length
292
Chain Sequence
b'AVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGYKNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYETWGTQEDMDTVVRVFDFVKSWSDRNNIPVYFGEFAVMAYADRTSRVKWYDFISDAALERGFACSVWDNGVFDMAIYNRDTRTFDTEILNALF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase H
publication title Biochemical Characterization and Structural Analysis of a Bifunctional Cellulase/Xylanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Hydrolase
total genus 119
structure length 292
sequence length 304
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4u3aA00
3FW6A 1G94A 3AS3A 1E1EA 3WNNA 2YKKA 1UR1A 3N13A 3ZOAA 3ECQA 5DMYA 4UFHA 2WNWA 1FH8A 5FL1A 2OWWA 1F4HA 1TFVA 3T0BA 2YL9A 1A47A 1E1FA 3WNOA 5A6LA 4U3CA 2DIEA 2WLZA 2XM2A 5JIPA 3A47A 4K68A 1DWHM 3SUUA 1NOUA 1JDCA 3WF3A 2E8ZA 4UQDA 2XYLA 1JNEA 3SUTA 3VGDA 1BVZA 2ZUTA 5EB8A 1E3XA 3E1F1 4PRWA 5CPTA 5FKYA 1E6XM 1KWKA 1CXFA 3NSMA 2VZTA 4P8WA 4DUVA 1L8NA 5BWFA 3TTOA 3CH9A 3ARZA 1UR4A 2D2OA 2WYSA 4RE2A 3TTSA 2BY0A 2XUCA 4GQQA 5CSYA 4UZSA 2QHAA 5LYRA 4XX6A 2VX6A 1WAWA 3AMGA 2J77A 1EOKA 3PZMA 3U57A 4KH2A 4PMRA 5A95A 1V3JA 1HVQA 1OIFA 2XM1A 1W3KA 1ZBKA 5CSUA 1HF6A 5I23A 1H5VA 2WVUA 4MAZA 3FHAA 2WC7A 2ZWZA 4XV0A 1UZ1A 1HNYA 1TE1A 4AZ7A 2CXGA 2UWFA 1B3WA 5JBEA 4FLSA 8CGTA 1UD6A 1CGXA 1VFMA 2W67A 2JFEX 2BVDA 1GCYA 4UFJA 1QHZA 3F5LA 1GNXA 5C71A 4OBSA 2ZX8A 1LG1A 2PBGA 3ZM8A 1EDQA 3VGHA 3A4XA 1VIWA 1HJXA 1ZBWA 8A3HA 1JAKA 2OWCA 3DHPA 1LG2A 1Q6DA 1ZU8A 3T0AA 2HISA 4AZBA 3TP4A 2BV9A 4AD4A 4H8UA 3OGRA 2JE8A 4UQAA 1G5AA 3ZJ7A 1JXKA 1WDPA 2XTKA 5HPOA 5GNZA 4CCCA 1VAHA 1MXGA 2G4FA 4CD5A 1DEDA 1LQ0A 3A4WA 4KRTA 5A2BA 2VUYA 1JZ4A 1G01A 4H7VA 3M7SA 1UYQA 2V3EA 4BQ3A 2QF8A 2JEQA 2VX7A 3RDKA 2V3FA 1LL7A 1PPIA 3L4YA 4V28A 3DYOA 3IJ8A 4MNKA 2OSYA 5AC5A 4UNIA 4HA1A 4WKAA 1J18A 1BYBA 1SYTA 1KXQA 2ZUSA 1KGWA 4S3KA 1K9DA 1JYNA 3EMQA 3GNOA 4W8BA 3VMOA 1CGUA 4ACYA 3DHUA 2D22A 2VC9A 4XB3A 1E6QM 5JBDA 5M5DA 1V6YA 4GIAA 2ZXQA 1WNOA 3WH7A 2WHLA 3FN9A 5A6AA 2W91A 1VENA 2PWGA 3OA5A 4NRSA 4PMUA 4QCEA 1Q4NX 4KGLA 4H8HA 1UD8A 1XD0A 4EANA 1XYZA 3GH7A 3AOFA 1OT1A 4BF7A 3WQVA 2PC8A 2UY3A 3WNLA 1GVIA 4YHEA 5BYWA 2VZVA 3IK2A 2W4XA 3VDCA 2XVGA 3THDA 4NF7A 4FMVA 1E72M 5LA0A 1E6RA 3CMGA 1RP8A 1R87A 1W3HA 1O6IA 2YOCA 3CUGA 1XCWA 2YA2A 2V5DA 5FD0A 3UERA 3ZR6A 3S6TA 5ABFB 1M01A 3GDBA 3VDAA 3APGA 2BHUA 3WDQA 1E0XA 2WW5A 1E4MM 1V6WA 5E6YA 3QHOA 4WLCA 5HOSA 4M24A 3NUKA 4M81A 1JZ7A 1WZLA 1UWUA 1SR0A 2WSPA 3CZLA 2X0YA 2X8RA 1GQKA 3SURA 3VTRA 1LWHA 2J47A 1E6NA 4CN6A 1C92A 4JAWA 4IM4A 4NSBA 2GJPA 2OSXA 3THCA 1CEOA 1E4NA 2VCBA 2GDUA 1GOMA 3PZQA 2A3BA 3DECA 4ACZB 2VI0A 1KB3A 3VILA 3WNPA 4M29A 1V6VA 1PZ2A 1MWOA 3W53A 3WNKA 5DO8A 1OGSA 2CEQA 2D3LA 4JKMA 3BAXA 2B31A 3SCTA 1NH6A 2J7FA 1HJVA 1EO7A 4AEFA 4WKFA 3WDIA 1BLIA 4ZE4A 1H49A 1A3HA 1HVXA 4HMDA 1HL9A 4CD8A 4ATWA 2DSUA 3BMVA 4TXEA 4MB3A 3OBAA 3K8KA 3J7HA 3VD3A 3AIRA 3QGVA 4J3TA 4F79A 4HPHA 3ZR5A 1BYDA 1R86A 1N82A 1EH9A 3NDZA 2VVNA 4MAVA 1KXTA 4W8AA 1US2A 4PMVA 4PTMA 4PUDA 4UFMA 1JDAA 1BVNP 2MANA 1FHLA 1UA7A 4U2ZA 3CZ8A 3AZRA 3AHZA 2C0HA 4P7RA 2D20A 1CGWA 1MYRA 5ABFA 4GQRA 5AYBA 1I1XA 4CD6A 4CVWA 4HOXA 1QPKA 1TUXA 3W0KA 3S2CA 2CHOA 1FP8A 3AHVA 1J12A 1UZ4A 1WCGA 1V3HA 1UA3A 4B9YA 1JXJA 1OGBA 4TTUA 4J3SA 3EDJA 4U5IA 3AS1A 1UKSA 1J11A 4CCDA 1JZ2A 3GYCA 2YA1A 1XHGA 1WO2A 1X1NA 4M8UA 3ZJ8A 2BNJA 4BCEA 2W5FA 2WCGA 1PIGA 2Y4SA 3II1A 3BLPX 3NIYA 1U33A 4PMZA 4HZ6A 4GO8A 2WZEA 3CZEA 3WQ6A 3W25A 2WHMA 4FLQA 1BSIA 2WVTA 2AOSA 1E6PA 1FHDA 3GBEA 3POCA 2PBOA 2PWDA 3K4DA 2E3ZA 3ZJ6A 2XIIA 2VL4A 2ZXAA 3SIMA 2VZSA 2CCRA 4ACZA 4YPJA 2ESCA 3MANA 3MUAA 1MW2A 4H8VA 1EQPA 1J0HA 3B9AA 3MUIA 2XVLA 2HVMA 5TD4A 1K9EA 2VMFA 1HKIA 3AICA 3OZPA 5A2AA 4MB1A 4LPCA 2W92A 4U31A 4TTGA 2XWDA 1CBGA 4JL2A 2NW0A 4CD7A 5E0CA 3SUVA 2DH2A 1W1YA 4PEEA 4GI6A 3AMCA 4DUWA 2E4TA 1E0VA 1MQRA 1KXVA 3GZAA 1BF2A 3K8MA 3BC9A 3VIJA 4HOZA 3MUZ1 2Y2WA 4UFKA 1JYVA 2D0GA 4ZXOA 2FGZA 3WFZA 1J0ZA 1KQYA 1OGGA 2AAAA 2F2HA 1G9HA 3I3DA 4UQEA 5E70A 1KGXA 4W7UA 3WF1A 1X6NA 5IHSA 3FAXA 2BXYA 3AMDA 2WHKA 4M80A 3BAIA 1JF5A 2WCAA 3BAWA 2XIBA 1QNRA 2EQDA 1W1TA 3VIHA 4LQ1A 4AXNA 5AC4A 3UG3A 1ZL1A 1E6ZA 1QBAA 1XC6A 4HTYA 1FH7A 4QAWA 4WF7A 1UQZA 1UWRA 4F9DA 1CGYA 3PZIA 3UCQA 2D0HA 2VURA 2TAAA 1QHPA 5CPQA 1C90A 1HKJA 4AIEA 1NARA 1PX8A 3WDRA 1NWTA 5DEZA 5I5RA 3UG5A 4D6DA 5GNXA 5AY7A 1US3A 1UR8A 3KL3A 1XD1A 4UOJA 1JNDA 2CBUA 3EDFA 5BRQA 1OIMA 1MW1A 3EMCA 4UZUA 3W38A 2DPEA 3GNRA 2F61A 1E15A 4H41A 1B3VA 4JFUA 4W88A 3OZOA 3RCNA 3K4AA 1CTNA 5JIWA 1CENA 3GH4A 3MMWA 3WIJA 1ODUA 4M1RA 4D6CA 2AMGA 3WH5A 4B15A 1KXHA 2VTFA 3CTTA 2DT2A 3RO8A 4CGTA 3WD3A 2UY5A 3CUFA 3ARTA 1JAEA 1SMAA 2D3NA 3MV11 3W81A 4HMEA 3POHA 2WMKA 4IISA 3NSNA 1MQPA 6A3HA 2G3IA 2ZXDA 1HKMA 4OOZA 1ISXA 2QV4A 2W66A 1BG4A 2DSKA 3L4XA 2WSKA 5CPSA 2BS9A 1CECA 2VQTA 5HBFA 2QMKA 3MO4A 1UD5A 2YJQA 1JD9A 4UQBA 4LGXA 4IUGA 3CO4A 4GPNA 3SCSA 2CPUA 5BXRA 1C7SA 1DWIM 2YA0A 3KWXA 5IFPA 4AYSA 2WCSA 1C93A 4JFVA 1WP6A 3EBVA 3L4VA 1EXPA 1FOBA 3VIOA 2FHBA 4AD1A 2G8ZA 1RPKA 3L2LA 1HIZA 2VOTA 1H3GA 1ZS2A 3RPMA 4X9YA 1KQZA 2EEXA 3CZJA 4AD3A 1E43A 2A3CA 3VIMA 3TA9A 3ZIZA 1HJUA 3W6LA 2VRQA 3AXIA 2IXUA 2WMIB 4AMCA 4AEEA 1OINA 1BTCA 2YL5A 3AHXA 2ZX5A 3WD0A 5GPRA 1EDGA 4P7OA 2CIPA 2O9OA 4J3VA 3TOPA 2WZHA 4MTVA 1ZJBA 1PX4A 1V03A 4OKDA 2GFTA 2ZX7A 4AD0A 5LA1A 3FNDA 1FFQA 1HKKA 1GHRA 4GI9A 3VINA 4RE4A 3PZNA 4HPGA 3WKZA 1TA3B 4B3LA 3AISA 3ARXA 2WANA 3SCUA 4QCFA 5I24A 4CKQA 4LYRA 3F4VA 3WQ8A 4IPLA 4JCMA 1QI4A 2XJ7A 4ZE5A 4TVCA 1K6AA 1Q6EA 1Y7VA 2X05A 1FFRA 4JHZA 1ZBCA 5HXMA 3VMNA 1TR1A 2CBJA 3PZUA 3JUGA 1Z32X 1HX0A 1R8LA 4PBGA 1NM9A 4Z2JA 2YBTA 2WK2A 1JZ5A 1K9TA 4DWSB 3AXHA 4XUYA 3ARYA 3M46A 4Z2IA 2WAGA 1YHTA 3VX0A 5A8QA 5AYIA 3OIHA 4B16A 1KBKA 4BQ4A 1CXKA 1OD8A 1QOXA 3VDHA 1H0IA 3WF4A 3PZGA 3BAKA 3BLKA 1V3MA 1XH0A 1QVBA 1HJSA 2J7GA 1C3FA 2QPUA 5E0FA 1GJUA 1HXJA 2CITA 4AW7A 4MADA 1B2YA 3DYMA 1WE5A 1R7OA 3GXDA 3EYPA 5E09A 4AY1A 3QR3A 3AYSA 3M07A 1QW9A 2D24A 4JFTA 2IXVA 4PMDA 2CHNA 3DC0A 3WFLA 1KR0A 2VO5A 5A8OA 1J9YA 1GJWA 5CQ1A 3W24A 4F8XA 1JYXA 2DQXA 3A3HA 1C91A 3LPPA 3W28A 4OBRA 2WMIA 4URIA 1LL6A 3AI0A 1CNVA 3WSUA 4J3WA 1GONA 1XGZA 4E2OA 1F4AA 2ZIDA 2G41A 3QHMA 1Q6CA 2VVSA 4GO9A 3W6MA 3PTMA 1TVNA 3WL1A 1JZ6A 4AD5A 1TA3A 3CUHA 2XVKA 2NT1A 3OB8A 1I75A 1VB9A 3PTKA 4MB5A 5A8NA 3T09A 3MUY1 3VVGA 2OSWA 4D72A 1H11A 5KEZA 5I3DA 2CKRA 3N12A 1QHOA 4Z2HA 4W5ZA 5A2CA 1UD2A 1MW3A 1E5JA 1EQCA 1U2YA 4DWSA 2ZX6A 4PMYA 1DWGM 2GK1B 2JF6A 2DEPA 3F5JA 1TCMA 1ISWA 5D8WA 4DWSD 4A3YA 2YL6A 3CBWA 3VMPA 4GI8A 3RM8A 3AYRA 4U33A 2CESA 3ZT5A 3W27A 4UOQA 4Z2KA 3KL0A 3CHDA 3WQWA 1WDRA 1B90A 1WZMA 2DIJA 1V0KA 3ARPA 3WDHA 1EHAA 1P6WA 2XFYA 4WIWA 1RD6A 5A6MA 1E4IA 1EOMA 2Q8XA 4E8DA 3AMLA 2BY3A 4PTXA 2WC3A 5FCZA 4ZEPA 1CWYA 4ZFMA 4DM1A 4Q22A 1XCXA 5IHRA 3AZSA 4W87A 1C8XA 1X6LA 3RM4A 3PHAA 3FHQA 3ZO9A 1OBAA 1MXDA 4P8VA 6CGTA 5A6SA 4UQCA 4DM2A 2BFGA 3VGBA 2GDVA 4D6FA 4H2CA 3TTQA 1M04A 1E4LA 9CGTA 1GORA 1ISZA 2A3HA 1BQCA 3ARRA 4BQ5A 1KR1A 2CERA 5BROA 4D6JA 3AIWA 1QW8A 5A3HA 4ML4A 1QI3A 1V3LA 4W89A 1XRVA 2VRJA 4WKHA 3NCOA 1GW1A 3UR8A 1OM0A 1V3KA 3ARUA 3AIBA 4HU0A 1EHNA 4TX8A 3NDYA 5IXEA 4ZXLA 3WN6A 3PZ9A 3VIFA 4E4PA 2VZOA 4C7FA 5EFDA 4DUXA 4W84A 4GZEA 4P7LA 1W2VA 3AQUA 4TX6A 5CXPA 1ZB5A 4HA4A 3CPUA 3VUPA 5JBFA 3WUGA 4FLRA 2XPKA 2JF7A 2OYMA 3LPOA 1DWJM 1U30A 3SCPA 4U5KA 1UKPA 3VD4A 4PN2A 4PTVA 2GK1A 1DP0A 1OB0A 2WMHA 2WC4A 4EKJA 4PMQA 1C7TA 1UH2A 4BZYA 1TVPA 3UR7A 4R5EA 4GKLA 5D9NA 3HJEA 2W63A 5ABGA 5EFFA 5A8MA 1M53A 2WM0A 3B9EA 1H09A 1BFNA 3W37A 4XZWA 5CLTA 4D6GA 2DT1A 1BHGA 2BHYA 1ISVA 5D9MA 2GUYA 3WF0A 3GBDA 4TOQA 1CXIA 1VEPA 1BAGA 3L2MA 2PWHA 2WXDM 4EAMA 2Z1SA 1W32A 3O6AA 3ZJKA 5BRPA 5I0DA 2VR5A 3SUWA 1J10A 3EDEA 7A3HA 3G6LA 1PX3A 2VZUA 4J7RA 2YL8A 2XFFA 3W26A 4L4OA 1EA9C 3SCRA 1CLVA 3AIUA 3VD7A 3WD1A 2WBGA 1H2JA 1OSEA 3SCQA 1Q6FA 4MJ2A 1IZKA 4NI3A 3N11A 3AJ7A 1EGZA 3FY1A 1PIFA 3BSGA 3GXMA 3WUEA 4CCEA 1UWSA 4TUFA 1UKTA 5IFTA 3AZTA 1JG9A 1E3ZA 2YLLA 2XFRA 3I3BA 4PMXA 1H4PA 4PCTA 3RMEA 3CMJA 3WDJA 1MFUA 2EPLX 5BXPA 1FP9A 4KRUA 1UR0A 2EO7A 2DH3A 1NWUA 2VX4A 3VNZA 1CZ1A 3VGFA 4DWSC 4JKLA 4CN4A 4JKKA 2BVYA 1UOKA 5ABHA 3ARVA 1D2KA 2J7CA 1ESWA 1G0CA 3WBEA 2Y8VA 2OYKA 5HDRA 2E9LA 3CZGA 3VGEA 3WBAA 2FH6A 3WEOA 4Q7NA 2J4GA 4PMNA 3AS2A 4JIEA 1GQLA 3HU7A 1E5NA 4UR9A 1VRXA 1KCKA 1NWRA 2OLHA 2YIHA 3WH8A 1XSIA 3K8LA 3KE0A 4AZ5A 4NZCA 2CNCA 3ZSSA 3D3AA 2NT0A 2ZUWA 1ZJAA 4X0NA 4JFSA 2D1ZA 3IJ7A 1IT0A 1C8QA 4C7GA 3RJYA 3FXYA 1OCQA 1J0YA 3BMWA 5GNYA 2O92A 4MNMA 4QP0A 1V0LA 1V6UA 1BYAA 3W82A 2WLYA 3QHNA 2VJXA 3WUBA 2X1IA 3CZKA 5EBAA 1J0IA 1XYFA 2E0PA 4WK9A 2XHYA 1EO5A 2ZUNA 2XVPA 1CXLA 1B31A 1H1NA 4P8UA 1E40A 5JUVA 2RGMA 5CG0A 5D8ZA 2VRKA 2WKGA 4D1IA 1W9PA 1VJSA 3WQ5A 3WH9A 2FHCA 5A1AA 3T08A 1GQIA 1GOKA 1GOQA 1UG6A 4U3AA 1TZ7A 3MSDA 2A3EA 5I77A 2YDSA 2ZE0A 2OYLA 2G3MA 5DF0A 1UD3A 4B9ZA 1NP0A 3UG4A 1EDTA 1B3XA 3NSXA 2WVSA 2DT0A 1VFUA 1B0IA 3ZT6A 2UY2A 1PZ3A 3CGTA 1B30A 4ATDA 4UOZA 3A6OA 1G1YA 1LL4A 5DFAA 3AHYA 3T2OA 2WB5A 3PZVA 2VQUA 2CBIA 4B3KA 1KFWA 2WWDA 2QPSA 2GJXB 2C7FA 3UEQA 1GZJA 3N9KA 3WMCA 4MDPA 2EPNA 1B3YA 4GXPA 2WMFA 3MV01 4UFLA 1CXEA 1JL8A 1M03A 4P7QA 3PZOA 3K1DA 7CGTA 1NWSA 5C8BB 2JIEA 1XV8A 1GPFA 4OJYA 2XSAA 1W9UA 2X0HA 1BPLB 1JI2A 2EPKX 2WKLA 2YLAA 4PMOA 4FLOA 3WELA 1ITXA 1GOWA 1UUQA 3D5HA 4F9JA 2WMJA 2PI6A 4CN1A 4W7VA 1NP2A 3L4ZA 2E9BA 2VR4A 3WEMA 1XSJA 1R7AA 3TTYA 4KMQA 3KEHA 2ZWYA 1FH9A 5LA2A 1JIBA 3VIIA 3GM8A 4JCLA 2X2YA 4E8CA 3GH5A 3AIVA 2CETA 1AMYA 3OLIA 4MB4A 1PBGA 4N0RA 1KCLA 1LWJA 2YBUA 1JYWA 3CLWA 2EPOA 4Z2LA 2EJ1A 2J8FA 4J28A 1MQQA 4HA3A 4D6EA 3A4AA 4MNLA 5GQBA 4AIOA 4D71A 2ZX9A 1UKOA 1EIBA 1E0WA 4AZGA 4AWEA 1OT2A 3BSHA 3L4WA 4CD4A 1UWIA 3GNPA 3IANA 1ODZA 3BXWA 1IV8A 3WENA 2JEPA 1V08A 2EPMX 5FOOA 2XGBA 3VM7A 2J7HA 4HOWA 1VBRA 1JGIA 4XZBA 2PWFA 2GJRA 3AMKA 4MPKA 2E9MA 2J75A 3VD5A 2VT0A 3ZSTA 2JALA 1CPUA 3BH4A 1UWTA 4N42A 2DGAA 4JHOA 2GJXA 3ALGA 1W91A 1JD7A 1CLXA 4V2XA 1J0JA 4PYSA 4AZHA 3LPGA 1LF1A 5A8PA 3I3EA 1V6XA 3CUIA 3QOMA 1ISYA 3OGSA 1GHSA 3N1AA 4AZ6A 1UH3A 5D9OA 1CIUA 5A6KA 3GXFA 4CU6A 2WZIA 3VKKA 1WKYA 4PSRA 4OZOA 5C70A 1BG9A 3OLGA 4AISA 4W93A 3UETA 1E56A 5I79A 1K9FA 4D6HA 5A6BA 2WWCA 3CHEA 2CBVA 3AXXA 4W5UA 5ABEA 3M6DA 3GTNA 2V38A 4FF5A 3AIEA 1DHKA 5A6BD 5I6SA 3PZTA 5M17A 1B1YA 1HN1A 4LYQA 2J7BA 2GSJA 2Y24A 4KGJA 4WSJA 1E71M 1BGGA 3SCOA 1CXHA 3PTQA 4GZIA 1BGAA 2WHJA 3FAWA 3SUSA 5BXTA 4W86A 5CGTA 1HP5A 2FHFA 1XSKA 1WB0A 1W9BM 3N18A 2DSZA 2W61A 1QNOA 3F5KA 4CVUA 4R27A 2EBNA 3WH6A 2GVYA 2ZUMA 3ARQA 3MMUA 2ZXBA 3U5UA 1YQ2A 2XG9A 2V5CA 5EMYA 4QDMA 7TAAA 3WD4A 6TAAA 1D7FA 3TONA 1QI5A 5A94A 4ZENA 1HT6A 3VIGA 4WSKA 3HMCA 4QFUA 3VX1A 2J79A 4JFWA 3ZMRA 3W29A 1Q6GA 3ARWA 4RE3A 3PN8A 5A6JA 4D1JA 4AZCB 1L0PA 4ATLA 1VBUA 4S3JA 4CU8A 2EXOA 4J27A 2PWEA 3AS0A 2UY4A 5D4YA 1VF8A 1M7XA 1UD4A 3VIPA 1HJQA 3VO0A 2WMGA 2YDQA 4AIUA 3MKKA 1PAMA 1JFXA 4MDOA 4PCSA 1W1VA 1UKQA 3HN3A 5I78A 1CGTA 4C7DA 2D23A 3B9DA 2C8NA 2ZOXA 1KBBA 5A69A 4W7WA 1WDSA 4LX4A 4NRRA 3LPFA 4U2YA 2O9RA 4CUCA 2Y5EA 5CJ5A 2WBKA 2WVVB 3IJ9A 1QNSA 5M3WA 2ZUVA 1MW0A 2PF0A 3RJXA 1HL8A 5D9PA 4YN5A 2XGIA 1BYCA 2XSBA 2QMJA 3KL5A 5HNNA 2BXZA 2E8YA 4AC1X 1UH4A 4Y7EA 3ZQ9A 2BY1A 3BCFA 1E9LA 3U7VA 2FH8A 1C8YA 4A3HA 1RP9A 2DT3A 2YDRA 4A4AA 1H0GA 3SCVA 3SCWA 1V02E 4HP5A 3WEZA 1J0KA 2VX5A 3N15A 1AQMA 3BAJA 4P8XA 4J3UA 2VNCA 1JF6A 3MMDA 3B8SA 4H04A 1J01A 2BY2A 2JIWA 1OD0A 1V02A 3VGGA 1IZJA 2XVNA 4LYPA 2DSVA 3IAPA 3RILA 3W4RA 1ZBVA 1NOWA 1E6SM 2V3DA 3VPLA 4AZCA 2D0FA 1WZAA 1GQJA 1SFSA 1ITCA 3WL0A 4P7NA 3O9NA 4D6IA 3AHTA 3L4UA 4UTFA 4IPNB 1XH1A 1QI0A 2FDMA 3RIKA 3SEPA 2BVTA 3WD2A 2F8QA 4AZIA 1QBBA 4KWUA 3WDPP 2E40A 4CU7A 4UCFA 3EDKA 1VJZA 3WY1A 1WPCA 4PSPA 2DSWA 1DWFM 3N17A 5M03A 4HMCA 3IAQA 1E73M 1LJYA 1QNPA 5HPCA 4J3XA 1TG7A 2WVVA 2IUZA 2Z1KA 3VDBA 1W9XA 4BA0A 3CIVA 4UFIA 4PTWA 4BQ2A 3SCNA 3O2LA 4YHGA 3BGAA 1SMDA 5CGMA 2QLYA 1CGVA 1QI2A 3PBGA 1B3ZA 4WJXA 4HZ7A 3OLDA 1JFHA 3OG2A 3UESA 1TMQA 4W85A 4AD2A 1NOFA 1AVAA 4OOUA 3MU7A 1VFFA 4MJ4A 4QLKA 4M82A 1JDDA 3CHFA 2OWXA 3AIQA 3WUFA 1KGUA 1UQYA 5F7UA 5IDIA 1MVYA 3WF2A 2J7EA 3RM9A 3N04A 2O9TA 3VD9A 1OWQA 3MS8A 3VOCA 4X0VA 3DYPA 3CUJA 3EDDA 1LLOA 2PB1A 2ZUUA 3T0DA 4EK7A 5FL0A 1W9VA 1UWQA 3L4TA 3VU2A 1I1WA 1O7AA 3BCDA 3VM5A 1UR2A 1W2PA 4QLLA 1JI1A 1VEMA 2J74A 2ZICA 3VNYA 1WZKA 5I2UA 1E55A 5E9AA 1GUVA 2J25A 2CYGA 3T2PA 2FGLA 3ALFA 4Z2GA 1JZ3A 1E70M 4HZ8A 5CLWA 3LMYA 1W3JA 3WNMA 5FIPA 2J62A 1DTUA 4GINA 4GZJA 1PEZA 1HJWA 2A3AA 1V0NA 1JZ8A 3OGVA 4L4PA 1W1PA 3ARSA 4HU8A 1S46A 4BS0A 1GOIA 5E6ZA 1VFOA 1QNQA 3T2QA 2O9PA 3G6MA 4MNJA 3K46A 2WPGA 3GXIA 1NQ6A 4EE9A 5DT7A 4V27A 1AQ0A 1CDGA 2W62A 2J7DA 3U7BA 5KZ6A 5CZKA 2DDXA 1D3CA 3U5YA 3QOKA 3NYDA 2V3GA 5DT5A 1R85A 1DWAM 1UR9A 5BCAA 4QLJA 5BXSA 2BHZA 3NJ3A 4UQ9A 4TVDA 1UHVA 1KWGA 2Y8KA 2J8GA 1H41A 2NSXA 3WMBA 1W9DM 2VCCA 1V3IA 3MSGA 1ECEA 2CKSA 3WMSA 1GVYA 2RGLA 2J78A 4OUEA 1AQHA 2VCAA 1XH2A 4F66A 1V0MA 1FA2A 4RL3A 3VIKA 1B9ZA 1CYGA 3EMZA 1MFVA 2X09A 4W8LA 3KZSA 1PJ9A 3AFBA 3OLEA 4M56A 1GOOA 2G3JA 4LXFA 4OIFA 1RH9A 4JZ5A 1VEOA 3CHCA 1WDQA 3ZT7A 5ECUA 4TVUA 2G3NA 2XWEA 3WQ4A 3BAYA 1W3LA 3AROA 4FK9A 1HP4A 4JL1A 4PUEA
chains in the Genus database with same CATH superfamily
2DW7A 1G94A 4Z1AA 2CC0A 4D9PA 2Q6ZA 4V1YA 3WNNA 4I8YA 4B4HA 3WLPA 1UR1A 3N13A 4L9XA 1MRQA 4KETA 2FPVA 3GNNA 3LCHA 3WK1A 1TFVA 3IUDA 2C18A 2B7PA 3WNOA 4JQAA 4U3CA 4K68A 5MF5A 1M41A 3BLEA 1XR2A 3SB0A 2E8ZA 1OFBA 4XBSA 4DXXA 3W02A 1FQ0A 3MWAA 1JNEA 4ZO8A 3SUTA 1IR2A 4GRSA 2PWUA 2ZZ1A 3O06A 1Z9AA 5D03A 3O8AA 1R6WA 1P6BA 3A3XA 4S3FA 1CXFA 3C6CA 3NSMA 3UJRA 4R9OA 1L8NA 1IIGA 4H2HA 2DZAA 1RVGA 5EA9A 3BCJA 3ARZA 2REQB 3ZWTA 2D2OA 4RE2A 3TTSA 4GQQA 5CSYA 2QHAA 4XX6A 1WAWA 3L2IA 3UZYA 1RQEA 1IWAA 4E6MA 3VOHA 3PZMA 1ITUA 1KM6A 1HVQA 1OIFA 3VA8A 2YCEA 5CSUA 1HF6A 2PGWA 5I23A 4NAFA 3QPEA 2X40A 3T55A 4MJMA 1PZ1A 4G7FA 2UWFA 1B3WA 2GQ9A 3IV3A 1UBSA 1EJ7L 1VFMA 2E5BA 4GIEA 3M6YA 3TN6A 2Q02A 4UFJA 3F7JA 3H6OA 4OBSA 3KCLA 3LUTA 2PBGA 4KWVA 3WJYA 1EDQA 1M3UA 1W1IE 5XIMA 3EWDA 3PVFA 3H12A 3ID7A 1FCQA 1ICPA 5I09A 4XO6A 4IX0A 1XIGA 4NXKA 1H60A 4DO7A 4JTDA 4RW3A 1H63A 2XTKA 3MJYA 4J1OA 3R25A 3LMZA 1W54A 2QCCA 4JN8A 3BLDA 3M7SA 4LBSA 1XIHA 3P5ZA 2JEQA 1I2PA 3RDKA 3GAYA 3MP5A 3NL2A 4IIDA 1PPIA 4IMFA 2BB0A 1XPYA 4O50A 3H53A 4HA1A 3WO8A 5HMDA 2IQTA 4YVVA 1SYTA 1TWDA 4S3KA 1K9DA 3LHWA 3EMQA 4H9XA 2YDAA 4C91A 2VUNA 4ACYA 3DHUA 3P62A 4ZGYA 5JBDA 3W1TA 5H8MA 1FWDC 2NQJA 3WQOA 2VFGA 2BOGX 4L6OA 4C6MA 1Q4NX 4KGLA 4H8HA 1HGYA 1UD8A 3L0NA 1M68A 1WBJA 5DLCA 2PDYA 3GH7A 1OT1A 4NU7A 2RJHA 3TC6A 5D02A 1BWKA 3HGSA 3WNLA 1GVIA 5T91A 1XBYA 4K1GA 2W4XA 1XIJA 3BUVA 4JN7A 2F38A 4C6FA 1LCOA 4DJDD 1UP2A 1J2BA 4JYEA 3QPZA 3W88A 2OPJA 3N2MA 1XCWA 1BXBA 3VKCA 3GDKA 4PGLA 3S6TA 3QRHA 3VDGA 2C1GA 1M01A 1XLAA 3DBNA 3GDBA 3APGA 1ZCCA 4AIBA 3SQSA 2FB3A 4M81A 3W9ZA 2HNEA 1UWUA 2Y6ZA 1LWHA 2ZVRA 3BJSA 1C92A 1JQVA 4JAWA 1RQHA 5TNVA 4LBRA 3DFYA 2PGRA 1E4NA 1WOBA 2VCBA 1T40A 1I2RA 4Z1DA 1GOMA 2VI0A 3STFA 3WNPA 4AHOA 1MWOA 4RZ4A 1VBGA 4JIQA 3PB0A 2RAGA 1VZWA 1OGSA 5CZJA 1W6TA 2B31A 3W72A 1NAL1 3VKAA 1UIOA 3LEPA 3MI2A 4J4KA 5LZLA 3KWSA 2A21A 1H50A 3OVGA 1YIXA 2FMOA 1LT7A 3J7HA 4NJGA 3GW3A 3QF0A 2RDTA 2OELA 2HMCA 1XGEA 3U2OA 1N7KA 2QXWA 3DH7A 4O0ZA 5HUPA 1TUFA 4PMVA 4PTMA 3KP1A 1XQLA 5G1YA 4JQ2A 3GX9A 4A22A 4NZFA 3UCDA 2P76A 1U1UA 3GVQA 3R2GA 1UA7A 4CQAA 4LS2A 1KM1A 4MLRA 1PO9A 5H6HA 1KTNA 5ABFA 4GQRA 3V18A 3VNKA 4CD6A 4CVWA 1QPKA 3MKCA 3FSTA 1F05A 3DU0A 4HB7A 5FESA 1QOQA 1WCGA 2E1WA 1GYLA 4ZQRA 1FWTA 3EDJA 2RFGA 3AS1A 1ZSXA 3COTA 5AHNA 1J11A 2PDFA 4CCDA 1JZ2A 2QCFA 2OMAA 1D3GA 2B81A 3LCXA 1HTIA 1WO2A 1NIUA 4LUSA 3WK2A 2BNJA 2Y4SA 1PIGA 4OT7A 1NJJA 3NIYA 1U33A 2GWGA 4Y8EA 3CZEA 1XBVA 1ZTVA 2WHMA 3MI6A 3PNUA 4A2SA 4DO5A 1DE6A 4S2BA 3SW6A 2AOSA 3MVTA 3M47A 4DYEA 3GBEA 4AEOA 3U8GA 2PBOA 2PWDA 3ZJ6A 2ZXAA 2VL4A 3GDRA 4ACZA 4L6HA 4YPJA 3KOYA 4OE7A 1UUMA 2FKPA 3MUAA 3U4AA 1EQPA 2HBVA 3P6LA 3MUIA 2XVLA 2HVMA 3DEQA 3VFLA 1K9EA 2VMFA 4FSAA 3AICA 4X3ZA 5A2AA 3JS3A 5JMUA 3RPDA 2W92A 1LDCA 4F2UA 1RCXB 4J2MA 4JL2A 4Z0JA 5E0CA 3RLUA 3PJUA 2AQWA 4GI6A 1GT8A 3T7VA 1E0VA 3NO1A 3K8MA 3BC9A 1SO6A 3ABZA 1GGOA 2ZZ3A 1IEIA 5CBJA 3Q67A 2ACSA 3WFZA 1J0ZA 1OGGA 2AAAA 1EF3A 1UJPA 1O68A 5E70A 4OVXA 4PUUA 3E38A 3W3OA 1JCXA 3O16A 4M6UA 1JF5A 2XH4A 4GQ0A 4GOAA 3KHDA 3BAWA 1QNRA 4HHMA 2ZQ0A 4AXNA 4TMBA 2PZNA 5AC4A 3UG3A 1CLKA 2H90A 1TMLA 1NF0A 4HTYA 1ZY9A 4WF7A 5TIMA 1UQZA 4F9DA 1CGYA 1M1BA 4BR1A 1YTKA 2PD9A 2D0HA 1J6PA 4ZSTA 1XYAA 3KLLA 4U28A 2XIOA 3HGJA 1OVDA 3EA1A 1R3RA 5DEZA 1RLCL 4UR7A 3Q2DA 3B8DA 3UPWA 1US3A 3IUIA 3CUXA 5CC5A 2QAPA 3DG6A 5HMFA 3EDFA 5BRQA 3O3RA 3HA1A 2DPEA 1VPQA 4GI4A 3MO7A 1BXNA 4JFUA 2IKIA 5FJOA 3OZOA 5KZMA 3BW2A 1OY0A 3T1GA 2CLIA 4QIUA 3WH5A 2GQ3A 4B15A 4CQ9A 2PU1A 4X2RA 3H2MA 3SY8A 4M6VA 3REQB 2UY5A 4DN1A 3CUFA 3E0FA 1O1ZA 4E5TA 3A12A 1SMAA 3N19B 3H7VA 3MV11 3W81A 1XLJA 1EKOA 1J2WA 3XINA 2FFCA 3E74A 3GKAA 1JULA 1S3HA 1U5VA 4EIVA 3CIXA 4E38A 3GNDA 4Q6XA 4KCVA 1DOSA 2WSKA 2QDDA 4DF2A 1CECA 3ZZ1A 2QMKA 2FZ9A 3PPGA 5JH1A 3LV5A 4GPNA 3DFQA 2CPUA 5BXRA 1C7SA 4QHRA 1EF2A 5KMYA 3EKZA 4D2JA 4FX8A 5BMWA 3G1FA 1C93A 3SM0A 1Z89A 3CV6A 1TPVA 4LVBA 1H3GA 5U7SA 3RPMA 2EEXA 4L1XA 1OC6A 1EJRC 1E43A 5LHFA 1XRSA 1OFEA 1UMLA 1VH7A 4N4PA 3W6LA 3AXIA 2IXUA 4JTKA 1RR2A 3AHXA 1UCWA 2QCGA 3WD0A 1RD5A 1CI1A 1JRCA 1QPRA 3GVRA 4Q4SA 1AW5A 2O9OA 4J3VA 3TOPA 4L65A 3WLRA 1PX4A 4JTLA 1Q6OA 4QG8A 4XZ9A 5DBTA 4AD0A 5LA1A 3FNDA 1FFQA 3FYYA 3VINA 3CL8A 3PZNA 3AISA 4FS9A 3S8HA 2A3LA 1AJZA 3IJLA 4O14A 5I3GA 1PDYA 1QI4A 2XJ7A 4ZE5A 3RLGA 3JW7A 3W2MA 4I3GA 1NF7A 4DXVA 2QUNA 4TVCA 2X05A 2YXOA 3VMNA 2HROA 1VPXA 4G1KA 2IPJA 1NM9A 2YBTA 4MM1A 1TMHA 4GUJA 3M46A 2WAGA 3O7UA 5A8QA 3FA4A 5AYIA 1MXSA 3LDVA 1C9DA 1QOXA 3VDHA 1H0IA 4PB4A 3GYEA 3KOWA 1EBHA 1K6WA 2R14A 2E7FA 3JZUA 1WE5A 1V7AA 1R7OA 3GXDA 4XAYA 5DXYA 4AY1A 3QXBA 1Q6QA 3S83A 1S2VA 3RRXA 1ADSA 2HS8A 4NZ1A 2F7FA 2GPTA 3DC0A 2OXNA 4Q8MA 4ZCWA 2Z7GA 3GHTA 3W24A 4PR4A 1C91A 3W28A 2IKHA 3M5VA 4F40A 4GVIA 3AI0A 3UGRA 1F3XA 1W5QA 1QFEA 4GYPA 5I02A 1P4CA 4ERIA 4J3WA 1GONA 2FFIA 5BOOA 2VVSA 2ZC8A 3K30A 4JTJA 3PTMA 3NZGA 4AD5A 2R1PA 3CUHA 2XVKA 4RZ5A 3LBMA 1I75A 1VB9A 2DZTA 4MB5A 4RPPA 2E5DA 1GQNA 4IMGA 4GY0A 3N12A 4F0MA 1FWNA 4WVXA 3IGUA 5EMKA 4W5ZA 2ZZ7A 2V69A 4H6RA 3HJZA 3W22A 1V79A 3A9IA 2BMBA 3F5JA 1JCNA 1FKWA 4A3YA 3CBWA 3VMPA 1I60A 3RM8A 4U33A 3SI9A 4S1FA 4PFHA 2B4GA 3S9IA 3KL0A 2QDHA 4Z42C 3A13A 4YTTA 3H2FA 4O28A 1WZMA 2DIJA 3ARPA 2C79A 2XFYA 5K3VA 1RD6A 5A6MA 1TV3A 1EOMA 1X8CA 1W5MA 3LRMA 4PTXA 3L12A 5FCZA 5EL1A 1PZ0A 3F03K 2HXUA 1OG6A 1XYMA 4W87A 1J8VA 1X6LA 2P53A 2DUZA 1GJPA 1UZDA 3FHQA 1O1HA 3ZO9A 3KVJA 4CNUA 4UQCA 1E51A 1V8EA 4XAGA 1M04A 1E4LA 1FY6A 2Y7DA 3UZWA 4FZIA 4DIAA 2ABBA 3ARRA 5BROA 3AIWA 1KM0A 4MSSA 2VP8A 4ML4A 2B7OA 4YYFA 1V3LA 1VFTA 3L68A 4HYRA 4L9YA 4GABA 1T0OA 1EWDA 1GW1A 3ARUA 4I8DA 4ZXLA 4AX6A 3W70A 1LROA 5EFDA 3RITA 4ERGA 4W84A 4GXMA 4P7LA 3MCOA 1F61A 1M5WA 5CXPA 2Z27A 2WM1A 3CPUA 3UZJA 4FLRA 2OYMA 4RNJA 3L5LA 2YFNA 4U5KA 4DZHA 3NPXA 5DXXA 2NVAA 3DCPA 2GK1A 1OB0A 4A3RA 2WC4A 1XWYA 4EKJA 1UH2A 4BZYA 3UR7A 3TXZA 5D9NA 3HJEA 3H2OA 3QQ1A 1W3TA 5A8MA 4W4QA 1B5TA 3WLLA 1R46A 2WM0A 3B9EA 1BFNA 1K8CA 4WD0A 3W37A 3H2EA 5CLTA 2JGYA 1Q2SA 1BHGA 1BSLA 1ISVA 4XIMA 5D9MA 2GUYA 3WF0A 3USBA 3GBDA 1VEPA 1BAGA 1TPH1 2PDJA 2PWHA 4DJFD 1W32A 2RH9A 3GVWA 1TRDA 1DXIA 5I0DA 2VR5A 3SUWA 1J10A 3MC5A 3HGRA 5D32A 3EDEA 2ISVA 3ITVA 3BV7A 1RAKA 2WJZA 2V2DA 1KCZA 3FKRA 3KBNA 4L4OA 2CLOA 1EWEA 7TIMA 4ADTA 2AL2B 2YBVA 1SZFA 2PTDA 4IFKA 1LTDA 2XZ9A 3OPSA 1Q6FA 3AJ7A 3N2OA 4JTFA 1I0DA 3GVGA 1PIFA 3BSGA 3GXMA 1UKTA 2I9UA 2QCNA 5C2GA 4CEUC 4S3EA 4C6KA 2XFRA 4NNAA 3RMEA 3PBWA 3UYCA 1FP9A 4KRUA 4INFA 3DIPA 1DE5A 4C65A 3STEA 1PWLA 3PJTA 3VNZA 3FIGA 1CZ1A 5F2IA 3VGFA 1TB3A 4CN4A 2TPSA 2BVYA 5EYWA 1UOKA 5HATA 1IGWA 3NQMA 1PUDA 3CT7A 1A5BA 3CZGA 3I7SA 1E9ZB 3WBAA 3L21A 1I2OA 4IIFA 2PPGA 1VR6A 3GFZA 5DY2A 4Q7NA 3AS2A 4DX3A 3PWAA 1GQLA 3HU7A 4UR9A 2YZ5A 1KCKA 1W0MA 2YIHA 1P43A 4R7WA 3WH8A 4IIBA 3K8LA 3KE0A 2CNCA 3D3AA 1IR1A 2NT0A 4AHPA 4C6JA 3QR0A 4OFCA 1F3TA 4DVOA 4EWND 4A8IA 1EUNA 1HKWA 4OECA 1J0YA 3S5SA 2O92A 4O11A 2TMDA 2DJLA 4IGSA 1LOLA 1V6UA 3QEZA 2C91A 5JXQA 3QHNA 4QG6A 2VJXA 3T05A 3VZZA 3CZKA 5EBAA 4L6DA 3TN3A 4PA8A 2WQDA 4MLJA 4WK9A 3HPAA 1QCWA 3QFEA 1SO5A 1CXLA 4BY3A 1H1NA 4P8UA 1E40A 4ES4A 4TO8A 2C13A 2GLKA 2V67A 4HYVA 4QISA 4D1IA 1VJSA 3QSRA 2LLEA 3UZXA 3T08A 2O7QA 1GQIA 1GOKA 1FDJA 1TZ7A 3THUA 3JU2A 4YU1A 3MSDA 2ICSA 2YDSA 5DF0A 1NP0A 4Y8FA 5EBUA 2WVSA 4B4FA 5DANA 2PSNA 3G2GA 4DQWA 2UY2A 4UCGA 4OTKA 3RK8A 4MWAB 4UOZA 3A6OA 3GXPA 5DFAA 3AHYA 5K9CA 2WB5A 2VQUA 1EA0A 2H3DA 1KFWA 5C9WA 3VC6A 4JS3A 1TX0A 3N9KA 2O0TA 3P0WA 3EA3A 3C61A 4GXPA 3MV01 1JL8A 1M03A 4NVTA 3TIMA 2JIEA 3GIYA 1XLEA 3TYDA 1W9UA 3WX7A 1AJ2A 1DV7A 1A5NC 1GOWA 4CN1A 2YSWA 3L4ZA 3WEMA 4LTSA 1R7AA 3KHJA 4KMQA 3VNDA 3UXDA 1FH9A 1EP1A 3GM8A 4K8EA 1VLIA 3IVUA 4QX4A 1R9XA 3SN1A 1PBGA 4N0RA 4AFYA 1K77A 1LWJA 3CLWA 3TMLA 4TR9A 1Q7ZA 4J28A 3IV8A 3NM3A 3LHYA 4HA3A 1ZGDA 3B40A 1XLGA 3IUHA 5GQBA 3UJSA 4AIOA 4A8RA 2ZX9A 3U6WA 3ITGA 4LF1A 1Y5WA 1OT2A 3MMTA 1UWIA 3H26A 1ZAIA 3E0LA 1ODZA 3BXWA 2QKFA 3WENA 1V08A 2VDIA 4H9UA 4HOWA 1YDOA 2FTPA 5CPOA 1CCWB 3KZPA 2PWFA 2GJRA 2BGQA 3DX5A 2E9MA 2PC4A 1CPUA 3BH4A 4PZVA 4N42A 2GJXA 3FEQA 4RLIA 1JD7A 2WJFA 3W7PA 4V2XA 3QSTA 3RUBL 3AXKA 1A53A 5A8PA 3CUIA 2IPFA 1ISYA 1UH3A 2IW0A 3EXTA 2X0SA 3ZS4A 3S1GA 3GXFA 3H7RA 3SR7A 2Z2AA 3VKKA 3LLDA 4HT3A 4PSRA 4DAFA 1LRQA 4AISA 2VKZG 5CAKA 4O17A 2BP1A 1K9FA 4O1DA 3TCEA 2WWCA 4IZGA 4W5UA 5ABEA 5CJNA 5A6BD 1W1B1 3PZTA 5G4HC 1ICQA 3KXQA 4P2VA 2POZA 5FF0A 1BGGA 3LB0A 5C2XA 1CXHA 1QWGA 1BGAA 2WHJA 3W1QA 4MVAA 3UXLA 4HCDA 5CGTA 2FHFA 3STCA 3CXOA 3PULA 3OVPA 4Q32A 4GIYA 5LIYX 3BOLA 3NO3A 3TSDA 3UNDA 1A49A 1P5BA 2HNHA 3U5UA 2XG9A 4NNCA 1ONRA 2V5CA 4AYGA 4GH3A 6TAAA 1DHPA 4A35A 1HT6A 4RKAA 3VIGA 4WSKA 3HMCA 4NYYA 2IS7A 3MCMA 1RQBA 1LBFA 1R9ZA 1DIOA 2OZTA 4Y9NA 1VBUA 4G7EB 1JPKA 2EXOA 3QMRA 2PWEA 3QH2A 3W00A 1ZP4A 1M7XA 1Z41A 1EZ2A 2YDQA 2BGSA 3AWOA 4AIUA 1LZOA 2FZMA 1XINA 3CQ0A 1JFXA 4IIHA 3Q94A 5KINA 3B9DA 3TUUA 1VIZA 1FWEC 3QZAA 4O8AA 2TSYA 2CLHA 4LX4A 3DDMA 3LPFA 4ICCX 4XZNX 1R2RA 2QZRA 1T41A 4CUCA 1XC4A 1DL3A 2WBKA 5DQPA 2HS6A 3G1RA 1DXFA 1REQB 1HL8A 5D9PA 1KRMA 3O1NA 3KL5A 2SFPA 4IQLA 4F0HA 2BXZA 2E8YA 4IFOA 5AHFA 3VAVA 2HE8A 2BY1A 4E8GA 2DP3A 1E9LA 3U7VA 4B91A 1C8YA 4A3HA 1RP9A 2DT3A 1BRLB 4IJRA 3SCVA 1ZZMA 2E5CA 1EJTC 1XP3A 1RY0A 3KAOA 2VFHA 3B8UA 1V02E 4HP5A 2G37A 4BEUA 4CNSA 3N15A 1AQMA 3BAJA 2VNCA 2Y5JA 2ZRVA 1GWJA 4ZB0A 3B8SA 1KFEA 1J01A 3G22A 1CB7B 5E9XA 3QN3A 3QW4B 5J5RA 5A5WA 2XVNA 4GUGA 3IAPA 3P7YA 4I5RA 3W7QA 3W4RA 1XM3A 1ZBVA 3IARA 1NY1A 1E6SM 2V3DA 4XKYA 4IG2A 3FKKA 3V1HA 4REQB 3HQOA 3ONBA 1F3EA 3PTDA 2VXNA 4PODA 2Z1XA 4Q7BA 4HHPA 3O0FA 1KFKA 5AN7A 1AA1B 3CYVA 3SEPA 2NX9A 1VHNA 4C1NB 3VOJA 3WDPP 4JYFA 4CU7A 5BU9A 4UCFA 3EDKA 3NGFA 3LI1A 3W71A 2WSYA 2Y85A 4M7TA 2ODOA 3IAQA 1E73M 4NUWA 2NXGA 3IGXA 2PD5A 3SZ8A 1PB0A 4AWSA 1QNPA 4AXKA 3LQGA 5H1WA 5CJMA 4JTEA 4H1ZA 5CG7A 3TQ0A 1W9XA 1TV2A 1UW9A 2TYSA 2YPIA 4PTWA 2CZVA 3SN0A 4KFPA 1GVRA 3SFWA 1E9IA 4HSOA 5CGMA 2QLYA 1J6OA 1QI2A 2X16A 4CNPA 1O5RA 4I90A 4AD2A 4OWGA 4DBWA 4MYXA 2WJDA 3B03A 1VFFA 3S0CA 1VPYA 4GJJA 3CHFA 2OWXA 3URQA 2QCDB 2FLIA 5JH2A 2HPMA 5IDIA 4QQ3A 3VNJA 2J7EA 3GDLA 3VD9A 3TW6A 2ZZ2A 4RDWA 4FX7A 3C0JA 3UWZA 3BJFA 1LLOA 1UPMB 3GFYA 5K4XA 2PB1A 2ANUA 4X60A 3T0DA 4MKVA 1I1WA 1O7AA 2BG5A 2CLMA 4QLLA 1WX0A 1AZ2A 1B54A 3FJ4A 3VNYA 1WZKA 5FACA 5I2UA 2ALRA 2PLCA 2VELA 1LBMA 1KM5A 3LHVA 3BO9A 3TOYA 3ALFA 4Z2GA 1JZ3A 1E70M 3TNBA 5HULA 3LMYA 4DZIA 3WNMA 5FIPA 4GZJA 3T8LA 1FWBC 1HJWA 3OGVA 3WG6A 3TR2A 1I45A 2IPGA 4HNLA 2DZWA 3HIJA 4O15A 2GVEA 3E6EA 1PXGA 1QNQA 3NXLA 3G6MA 3ISIX 4MNJA 1V7YA 1SM9A 3PM6A 4V27A 3OZYA 1RV8A 2DUAA 4K36A 3WQGA 2CWXA 5KZ6A 4YVPA 2HDJA 3U5YA 3QOKA 2I5GA 3B0UX 2I5QA 1L6GA 1PHWA 3QMTA 3DAQA 3TXVA 5BXSA 5JQ9A 2PLMA 4UQ9A 4TVDA 4P61A 4DYKA 1FXPA 2NSXA 1RBAA 3ENLA 2VCCA 4Y9AA 3GVVA 3W1RA 2CKSA 4F0KA 2E1DA 5FF4A 3CNYA 1CYGA 3C3NA 4UIOA 3EMZA 1R38A 4W8LA 4Z1YA 4WR3A 3AFBA 4NAFB 1EJWC 2JKPA 5DMMA 3AALA 1VEOA 2DIKA 3CHCA 3FX4A 1AJ0A 4DJFC 1SU5A 3SSZA 3ZT7A 1OHLA 4AMAA 2G3NA 2G50A 3GWQA 5HAOA 4LY4A 2OVLA 1W3LA 1JR1A 1HP4A 4JL1A 4PUEA 4QJ4B 3FW6A 3AS3A 3FSUA 4BI6A 1OEPA 2YKKA 3UY7A 3CS2A 4UMAA 2E6AA 3TYUA 3GB6A 4LV9A 1K7EA 3VNLA 1H7OA 1A47A 1E1FA 4YS1A 2DIEA 3W74A 3QTGA 3A47A 1WXYA 3SADA 3LLXA 1NOUA 3WF3A 3NOEA 2D69A 3UJFA 3QTPA 5T26A 4F2TA 3VGDA 1IE7C 1K7XA 1OYCA 5XINA 1E3XA 3KLKA 4Y9MA 4IWWA 4JQ1A 3TDFA 4PRWA 4D8ZA 4MMWA 5C7HA 1DJGA 1NU5A 3C0SA 1S5VA 2J24A 3SO7A 5HR6A 3GW0A 2P5NA 3KOFA 3B9NA 2NX3A 6XIMA 1UR4A 3V3WA 1LORA 2XUCA 4UZSA 2YYUA 5LYRA 1GKQA 1AL7A 2J77A 2VENA 5IOBA 4KH2A 1V3JA 1DJIA 2XH7A 2R91A 2XM1A 1T5AA 1G7UA 3FHAA 4IOTA 1UZ1A 5I03A 1TE1A 5AHIA 5JBEA 3MWCA 4JHMA 3UXIA 3JRKA 1CGXA 1PTDA 1GCYA 1QHZA 3F5LA 3UA3A 1LG1A 2GGHA 2VD9A 1FBAA 1YPFA 3A4XA 1VIWA 1HJXA 1GYMA 1OFDA 1ZBWA 2Y7FA 2X1UA 3WMLA 5G1TA 1VC4A 1LG2A 1ZU8A 2HISA 3G8EA 4K37A 1J4EA 3TP4A 4XZHA 7ODCA 1W17A 3S2LA 3OGRA 1G5AA 3ZJ7A 3EWUA 1JXKA 1AK5A 2NWSA 3STPA 1MXGA 3H54A 4CD5A 4DJED 4HSHA 1TR9A 2VUYA 4H7VA 3TQPA 3TZFA 1UYQA 2QF8A 2C1HA 1LL7A 1GTEA 1XICA 4V28A 3N3MA 3DYOA 3IJ8A 2OSYA 5AC5A 3L0KA 4WKAA 3WJWA 4HK5A 1J18A 1PIIA 1K8ZA 3VZYA 4UXDA 4PRRA 1CGUA 5HANA 2D22A 3DBPA 4XB3A 4K7VA 5D2YA 2ZXQA 1WNOA 6ENLA 2WHLA 4GYKA 2CLKA 2A85A 1VENA 4PMUA 3P82A 4RXFA 4ORIA 1GKRA 2EG6A 1XD0A 4XBJA 1W1ZA 3AOFA 4BF7A 2PC8A 3Q65A 2UY3A 4YHEA 5BYWA 3RX3A 4FR6A 3NPUA 5HWNA 2XVGA 4GZ7A 1IT8A 4FMVA 4NF7A 2G4JA 3RPTA 5LA0A 3F2DA 3H4WA 1HKVA 1RP8A 3ABOA 4ZTXA 4JTIA 4BFAA 1W3HA 3UR5A 2YA2A 3P60A 3LERA 5ABFB 5HR7A 1B3OA 4U10A 1IT7A 1E0XA 2QUTA 1TV4A 2CLLA 1ZQ5A 3ZVHA 2ADAA 4WLCA 5HOSA 2BGNE 3DG3A 1DQUA 2X41A 2PS2A 2X0YA 2X8RA 3HTWA 3NQBA 4LUSB 1GQKA 1QK0A 1FVPA 4CN6A 3QY6A 4IM4A 2OSXA 2GDUA 1D8CA 5CC7A 3DENA 3PZQA 2NV1A 4ACZB 3VILA 4M29A 1LUCA 3BSMA 3W53A 5DO8A 2CEQA 4JKMA 4DLFA 4ZOCA 2AGKA 3SCTA 1NH6A 1IHIA 4AEFA 1QPNA 3WDIA 3B8VA 4YIWA 1A3HA 1HVXA 4HMDA 3FOKA 5HNUA 1EYWA 4TXEA 2H3BA 3K8KA 1OF8A 1KKOA 1N8FA 3VD3A 5FAJA 3AIRA 1WQ5A 4WGXA 4XTIA 3EX3A 3ITLA 3LCIA 2NQHA 4S23A 4J3TA 4B2DA 4HPHA 1BYDA 1R86A 1EH9A 4IMDA 1UPPA 1KXTA 4E4FA 1US2A 2G96A 3AU2A 4PUDA 3CAQA 2FVLA 3V0UA 2MANA 4AB4A 3N4FA 3NYZA 4Q4QA 3RLHA 5CGQA 3R6IA 1TO3A 3AZRA 1VYRA 4LUJA 1XUUA 2C0HA 3TLQA 2CLFA 5C0QA 1CGWA 1W37A 1I1XA 3LI0A 1YX1A 4HOXA 4XD6A 4QAIA 3S2CA 2VD8A 1FP8A 1V3HA 1UA3A 4B9YA 1JXJA 1OGBA 4TTUA 1FWIC 1FWJC 4O12A 1NDZA 2P0IA 1VHCA 2YYTA 4GX9A 3ABQA 2R6OA 3H24A 6ALDA 3BLPX 4PMZA 4JX4A 4JR5A 2ALDA 3WQ6A 1A5MC 4FLQA 5I3HA 3EKGA 4EF9A 1QO5A 3WK0A 5FAGA 2BWGA 3R11A 1E6PA 1FHDA 3E02A 4DO6A 3WQFA 5G1MA 1SGJA 2VZSA 1AH3A 3ELFA 3MANA 1J0HA 4QNEA 3QVQA 4IPIA 1HKIA 1EBGA 4U31A 3TWBA 4JTQA 4R85A 3NEHA 3I6EA 2NW0A 4X61A 1KBLA 2GQ8A 2DH2A 3CQHA 3G1SA 2E4TA 4MZ1A 4MJZA 3TQVA 3MUZ1 1Z42A 3WBYA 1MO0A 4Q8OA 4PB3A 4LT9A 1RBLA 1ME9A 1UP0A 1G9HA 1MNSA 1FHUA 3OIXA 4ZQNA 3WF1A 9XIAA 2HRWA 3EXRA 3FAXA 2BXYA 1I6NA 3AMDA 3I10A 4M80A 4YYCA 2XIBA 3LXAA 1W1TA 1OCBA 2RJGA 1ZL1A 3MDUA 2OX4A 4QAWA 3CL6A 2PUZA 1UWRA 3FCPA 3PZIA 3UCQA 1FDZA 5CPQA 1S2UA 1HKJA 3S9ZA 3PJXA 4ML9A 4O8RA 1PS9A 1PKLA 2P8CA 4XAZA 5I5RA 2Z6IA 4LC8A 3UVIA 1XD1A 4UOJA 3E96A 2CBUA 4KPLA 1EZWA 1OK4A 3GZ3A 2QIWA 5BOFA 1MW1A 3W38A 3GNRA 2F61A 1E15A 2Y1HA 4J9JA 1Q8JA 4RZBA 4UBPC 4W88A 1QT1A 3ABRA 5B7ZA 4UNKA 3MMWA 3WIJA 3ES7A 2AMGA 4HTBA 1KXHA 2VTFA 3TTEA 2DT2A 1Z44A 1SPQA 4BK9A 4KQNA 1EUAA 4C6LA 4KESA 3NWRA 4WY0A 3POHA 5HNRA 4IISA 1ONXA 1UWAA 3UQNA 1J93A 3NQFA 2I1OA 4UR8A 5G4WA 6A3HA 3WLOA 1HKMA 3QR1A 1QU4A 1L8PA 2DSKA 3AJXA 3CLMA 3L4XA 1TTPA 5CPSA 2BS9A 3U48A 2Y8UA 1TV5A 2VQTA 1O5KA 5HBFA 3PAOA 2YJQA 4LGXA 4DAIA 3C2RA 5G4EA 2EPHA 3SCSA 3G18A 1UBPC 1DWIM 3EPOA 1V5XA 3R0DA 1QNVA 3IIVA 3E5BA 4JFVA 1KW1A 4J3ZA 3VKBA 3TR9A 3FVDA 1EXPA 3L4VA 4AD1A 5CBIA 2E6FA 3XIMA 2VOTA 3OODA 3S1XA 1W31A 1ZS2A 3UP8A 3P80A 3VIMA 3NEVA 3TA9A 3ZIZA 3G5EA 2A7RA 2VRQA 3CAVA 5HMSA 4L61A 4HU3A 1BTCA 1MMFA 2C0AA 4P7OA 4GC3A 1R9YA 3M0XA 4UTWC 7REQA 3NG3A 4OKDA 1B4KA 4Q4PA 5D33A 4XD5A 3W2UA 1AH4A 5CPNA 4B3LA 1H7WA 3ARXA 3SCUA 3F4VA 4RV8A 1US0A 1RCOB 4HCHA 3UG8A 1FFRA 3VKDA 5HXMA 1Z32X 4AY8A 4AU0A 4J35A 5EMJA 2WK2A 1EGMA 3WK3A 4K6AA 4MUZA 3F4NA 5AZ0A 3V5CA 3VX0A 3VE9A 3OIHA 1H5YA 1S2WA 3LHUA 4I9JA 3WF4A 5BWAA 5L6UA 3E0IA 3W01A 1TTIA 1OC5A 2OKTA 1QVBA 1C3FA 2QPUA 2BOEX 5TF0A 1XQKA 3TMQA 1HXJA 3A21A 3LXCA 3PB2A 4AW7A 3WQCA 4K39A 3DYMA 1A0EA 3PSVA 3EYPA 3MHUA 5GVJA 4JICA 2OT0A 3AYSA 3BURA 1VKFA 2D24A 4JFTA 2E67A 1GG0A 3D47A 3SGZA 3WFLA 2VO5A 4LCRA 1EC9A 3UXAA 4LAKA 5D04C 1GJWA 3OU8A 4OHQA 2DQXA 4OBRA 4URIA 1LL6A 4UTKA 1J5TA 4AAJA 2CHRA 1A5KC 1ZALA 3P74A 1XKYA 1F4AA 3S5NA 3CQIA 3TAKA 5LNSA 3FA5A 3BE7A 1SJDA 2W3ZA 1LLWA 1TA3A 3PPCA 4N4QA 3T09A 3F4WA 4D72A 5FF7A 1A5AA 1VCVA 2PODA 4NZ5A 1DIDA 4QDWA 3BOFA 3KX6A 2YCKX 5AFDA 3A64A 4ZR8A 4IGNA 4ZO9A 1MW3A 1EQCA 4DWSA 2ZX6A 1DWGM 2GK1B 2DEPA 4PTNA 1TCMA 1ISWA 5D8WA 4QE4A 4GVFA 3N73A 4NG3A 4UTHA 3AYRA 4IP5A 3HFYA 4YTQA 3ZT5A 1D7KA 4DEFA 4HD5A 1RHCA 4I7WA 1G6CA 1B90A 3OBEA 3WDHA 4GD0A 2FJKA 4WIWA 3GXTA 2Q8XA 2Q09A 2WC3A 3H2AA 3B8IA 3EX4A 4ICNA 5F4SA 4F0SA 4DM1A 3U2ZA 4Q22A 2ZVIA 1XCXA 3MZ2A 4N9CA 1EX5A 1UZHA 4LEQA 3IWPA 2YX0A 4FAMA 1K7FA 4QS6A 4DM2A 4H4IA 3VGBA 4H2CA 4QM1A 4IFKB 1GORA 1ISZA 3QV8A 2NLYA 1BQCA 3W85A 3CC1A 1KR1A 4AH7A 2CERA 4D6JA 3IJQA 4MKNA 5A3HA 2PA6A 4WJ8A 1QI3A 4PH6A 4WKHA 4OBTA 3RAOA 3B97A 1OM0A 1V3KA 3GKFA 5M2FX 5IXEA 5D30A 3M0LA 3R13A 4E4PA 1A80A 2VZOA 3CYJA 3AQUA 4FIRA 3W86A 1KD0A 3MY9A 2YCIX 3BVJA 3EOLA 5CAHA 1WV2A 2XPKA 2JF7A 3S2MA 1DWJM 1U30A 1WUFA 2GSHA 3SCPA 5EGRA 2E28A 1TIMA 3VD4A 1OQFA 2Y7EA 1H62A 4PTVA 2ZZ5A 3V5OA 4PMQA 1C7TA 3OVRA 1S2TA 4XSLA 1TVPA 1EP3A 4GKLA 3GTHA 2W63A 3U4FA 2C3ZA 1L6SA 4B5SA 4US5D 1M53A 3NA8A 4O1FA 3HGOA 4D6GA 1Z69A 2GSEA 2BHYA 4Q8PA 4JEQA 4Q8QA 4XWUA 1OABA 4TOQA 3L2MA 4EAMA 4B5NA 3ME3A 3ZJKA 1Z7AA 3WLKX 1XGDA 2NV2A 4J7RA 3ONCA 1K8XA 5KZDA 1TRIA 2WBGA 1XLCA 1FCVA 1DJWA 4KS0A 4MJ2A 4NI3A 3N11A 2YR1A 3IIPA 3S42A 3WUEA 3HQ1A 3AWNA 2NQLA 2BTMA 1JG9A 2YLLA 4PMXA 3QC3A 1H4PA 4PCTA 2PDBA 2NX1A 2KZHA 2D2HA 1EGVA 2EO7A 2DH3A 3NZRA 2VX4A 3MUCA 2WZMA 1QASA 4DWSC 3M0MA 4Q8TA 4JKKA 1Q85A 2Z4GA 1D2KA 4FXSA 5AYYA 1X38A 4GX8A 3LTSA 1VGAA 5HDRA 4ONVA 3B4UA 1FTXA 2FH6A 3H8AA 3WEOA 2YCLA 1XLIA 2J4GA 2X1RA 4PMNA 1FCBA 5AC6A 3DFNA 3T40A 1NWRA 2OLHA 3VKJA 2GGJA 1XSIA 3FDKA 5CZTA 4NZCA 1VCGA 4GQBA 3ABSA 3ZSSA 5RUBA 4YL2A 1MRAA 3M4HA 4JFSA 4DELA 4R3UA 5CC6A 3UY8A 1C8QA 2ZZ4A 4C7GA 1JCYA 4JNYA 1OCQA 1YE6A 4FR1A 1PL9A 3NQ2A 1BYAA 2WLYA 3P14A 2X1IA 1FWFC 2XDFA 3KS6A 5LGXA 3HQNA 3T44A 5AHMA 2D2JA 2OEKA 2WPBA 1XLBA 2FZDA 5D8ZA 3RGTA 3UWYA 2VRKA 3W07A 1W9PA 4IPJA 3MW7A 4DO4A 1TV8A 3PNZA 1YPXA 3TN4A 5A1AA 5H91A 1UG6A 2A3EA 2AKZA 3A3WA 2ZE0A 2G3MA 1UD3A 1QR7A 4FA3A 1J5SA 5PTDA 1EDTA 2C15A 3W84A 4FHAA 1VFUA 1O4UA 3LY0A 3G0XA 1B30A 3CO8A 5I3FA 2VEGA 3EX6A 1G1YA 2V5LA 1VS1A 3KOZA 4JOMA 3RFAA 1AODA 3AXMA 4FO4A 1S5NA 2QPSA 2DFAA 2C7FA 2GJXB 3UEQA 5LNVA 4MZYA 3WMCA 4S3BA 4HGXA 4P7QA 5C8BB 5CCZA 3U2CA 2XSAA 2EG7A 2CWNA 4OQVA 4JDYA 1JI2A 2WKLA 2YLAA 3D5HA 1YRRA 3OO2A 4DF1A 2WMJA 4H00A 2PI6A 4W7VA 3V75A 4M5PA 4WDWA 2E9BA 2VR4A 4ADSA 4YVXA 3HB9A 5DRCA 1JIBA 3HPXA 5LIWX 4IGMA 4JCLA 4KW2A 3MB9A 2BBFA 1SW7A 4E8CA 4I7UA 4K38A 2CZFA 4MIMA 2HTMA 4A8LA 1AMYA 3H4GA 3FK4A 3TN5A 1W5PA 3O0KA 3VZXA 4UTUA 3T4CA 2EPOA 1ELSA 4N02A 2EJ1A 3R12A 5AECA 2A7PA 3A4AA 3E0WA 4JIHA 1DBTA 1L6YA 3C8FA 4FNRA 4FB7A 1R3QA 3L4WA 3M0YA 4CD4A 1VLWA 3OYXA 2DU2A 1FWAC 1S5WA 3QY7A 4Z1BA 3B0VC 2EPMX 3R8RA 1QMLA 3VM7A 2OOGA 3NURA 4BF5A 3R10A 3M43A 3A9BA 4B5WA 3AMKA 4TX9A 2V5JA 2C71A 2VYOA 2J75A 4MWAD 3VD5A 2ISFA 1UWTA 4DZ5A 4ZL1A 2HWGA 5HK4A 1SO3A 3I3EA 1V6XA 2QGHA 1Q65A 1GYNA 1EX1A 3OGSA 1GHSA 5D9OA 2ZCGA 3TYBA 1RA5A 4L4LA 3QMSA 1WKYA 5CZSA 5C70A 3TSMA 3DERA 4W93A 2FTYA 5DN1A 5I79A 3SBFA 1VJIA 1RJPA 2DJXA 3CHEA 1XLLA 2DZBA 2FQIA 3M6DA 3GTNA 1VYSX 2V38A 1RSCA 2V68A 3MT1A 4LYQA 3H4XA 5HJYA 4KGJA 4WSJA 1E71M 3WJZA 4V33A 4GZIA 1Y5VA 1MSSA 2EKCA 3W1MA 4W86A 1XLFA 4TV6A 2OG9A 4TV5A 3SQLA 1YNYA 1DIKA 3N18A 5CZ0A 3EKLA 2DSZA 3OG3A 2W61A 1S1PA 1QNOA 4CVUA 4R27A 1J96A 3KUMA 2AL1A 5J04A 2EBNA 2GOUA 2UBPC 1NFBA 2ZUMA 1ADOA 3ARQA 4NHVA 1YQ2A 3SRKA 3GC2A 3TONA 1GVQA 1XRTA 1MEHA 5A94A 3QYQA 3PAJA 3W7LA 5FSEC 4QFUA 3VX1A 1U22A 3RHGA 3GTXA 3PN8A 1MUMA 5A6JA 4XKYB 4D1JA 2P0OA 4IP7A 2EJAA 4JEJA 4XZIA 4CU8A 2QYGA 4JTAA 1PV8A 1VF8A 2AMXA 1UD4A 3VIPA 4UTMA 1HJQA 4LUTA 3TX9A 3VO0A 1DJHA 2WMGA 1BWLA 1ONEA 4PCSA 1W1VA 1W3IA 4A8NA 4ZMGA 2E6YA 5I78A 1CGTA 3GK0A 2C8NA 3N2BA 3C2VA 1VCFA 4W7WA 3GO2A 1R47A 4NRRA 3BLIA 3F4DA 5D38A 2BASA 2ZDSA 1H51A 2FVMA 3EA2A 4RNHA 2Y5EA 5CJ5A 3LCLA 2L5HA 4Q8UA 2PF0A 3RJXA 3QKEA 1BYCA 1R3YA 1XG4A 1ZAJA 3FS2A 4DY1A 3DUGA 1H1ZA 3URBA 3BTNA 3ZQ9A 2FH8A 1PTGA 4MF4A 3CQJA 2YDRA 3NFUA 4WDUA 1H0GA 3BQ5A 3PPFA 4C6CA 4ZODA 2VX5A 4GHRA 1MDLA 1Q4WA 4I6KA 1K4GA 5EU9A 3MMDA 4H04A 5HUOA 2JIWA 1OD0A 1V02A 1QOPA 3VGGA 1PKNA 4UTTC 1IZJA 4LYPA 3GU9A 1NOWA 4O16A 4M6PA 1P6CA 4ASTA 3MP4A 4AZCA 4IL0A 3TA6A 4S39A 5FEWA 2QR6A 3E0VA 4QBXA 1X7IA 6PTDA 1QI0A 5BMXA 3RIKA 1RPXA 3WD2A 3TYAA 2E40A 1AH0A 4CEXC 4IJBA 4PSPA 5H2ZA 3M0KA 3G0SA 3M5YA 5M03A 5EY5A 1POJA 3IRDA 2Y5SA 2FPYA 4YTSA 4NYUA 4J3XA 2QF7A 4IQDA 1AL8A 1TG7A 1DQXA 1YXYA 2IUZA 3BK0A 2VC7A 3I65A 3L5MA 1PYFA 3CIVA 3S2JA 2J9YA 1VFHA 4BQ2A 3S6DA 1AW1A 1IQ8A 3A24A 3BGAA 1Y8BA 3EEZA 5KSWA 1YE4A 1X6UA 1CGVA 3TV8A 2EKGA 3EB3A 4WJXA 1A3XA 4ZO7A 1NOFA 5REQA 1M6JA 1PHQA 3SY5A 2GVGA 4MJ4A 1KGUA 1UQYA 2GVLA 3LK6A 3C0QA 1MVYA 3RM9A 3N04A 2O9TA 4H6QA 3MS8A 1LBLA 3MSYA 2OCZA 3CK5A 5H8PA 1OC7A 1POKA 2QJHA 4IF2A 1R3SA 2VWTA 3S6OA 4ROQA 4FI4A 3DG7A 3QQ0A 5FL0A 1W9VA 1UWQA 3DGBA 3VU2A 1W2PA 1JI1A 2J74A 3LGEA 3GG8A 4X9SA 2DVUA 3VFCA 3E5PA 2XISA 2ZICA 2PDWA 5E9AA 1GUVA 2J25A 3T2PA 2FGLA 4PCNA 5CPMA 4S38A 4QE5A 1W3JA 2J62A 2ZTJA 3BOXA 4JTUA 1FWCC 2Q8ZA 1JZ8A 3TVAA 2O4MA 1NELA 1DJXA 4HU8A 4N2YA 1F07A 4R7JA 1GOIA 1VFOA 2O9PA 1Q7QA 1K8YA 5AVHA 1NQ6A 3W7CA 5DT7A 2WSRA 3ZLGA 4NX5A 5D2WA 3OQEA 2OQYA 2Y88A 2J27A 1AQ0A 3THAA 2W62A 4IH3A 2J7DA 3U7BA 5CZKA 1O95A 3VABA 1BKSA 3NYDA 2V3GA 4JTGA 4QGCA 2OODA 1DORA 1D3HA 5I00A 1KO0A 1XFBA 4HNUA 3UT0A 3VE7A 1Q6RA 4QLJA 4QS5A 2G0WA 2BHZA 3UZ5A 2J8GA 3GHSA 4DYJA 1S38A 2G97A 1XF0A 4G1NA 1UMYA 3NQAA 3WMSA 2RGLA 5FJUA 4OUEA 1VRDA 1HW6A 1V0MA 1FA2A 3TU9A 4RL3A 3VIKA 1B9ZA 3TQKA 2X09A 4UTLA 1XCFA 1ALDA 2WZTA 3KZSA 1M7PA 3OLEA 4KEUA 3KCJA 3QKZA 2G3JA 4LXFA 2QCLA 2IPWA 5AC7A 4LUYA 1WDQA 2OZ3A 3ZLFA 5ECUA 1P0NA 1LP6A 1LLZA 5C9XA 2J8TA 3O63A 4FK9A 1IEVA 3E9AA 4BF9A 1E1EA 2YW4A 4H6KA 5J5DA 4QJ1A 2QJGA 1FH8A 3L66A 5FL1A 2OWWA 1F4HA 3T0BA 2YL9A 2O4QA 4HZMA 4ZB5A 2RDUA 1R2TA 4M0XA 1HZYA 1IGSA 3NQ7A 2OB3A 2ZA1A 1DWHM 4MGGA 1A4MA 1JDCA 3RMJA 1ZRQA 4UQDA 2XYLA 4LSBA 1BVZA 2POTA 2R8WA 2ZUTA 1P0DA 4YMZA 5EB8A 4QNWA 3LHTA 3QLDA 4IICA 5J8LA 2UZ9A 1PYMA 2Z25A 4H3DA 5I3JA 1BF6A 1JJKA 5FKYA 4RJEA 1KWKA 1V77A 3N6QA 3CV7A 1XDJA 2VZTA 3DZ1A 1FWSA 3XISA 4NJJA 4DUVA 3KFTA 3QJAA 3R79A 3BMXA 2WYSA 3FJNA 2BY0A 3O6DA 2ON3A 2VX6A 3AMGA 4X22A 3RF9A 4LW7A 3OYZA 2V0TA 4AWTA 1EOKA 3BGGA 3BLLA 3U57A 4PMRA 5A95A 3P5YA 2P88A 3K13A 1H5VA 2WVUA 2ZWZA 1KFLA 2VEPA 5G2WA 5BRBA 3N4AA 2G3FA 1PSCA 2V8ZA 4ZQMA 4FLSA 4ROPA 1UD6A 2DW6A 3W7NA 1P7TA 4L1WA 2W67A 2JFEX 2BVDA 4HVXA 2ZX8A 1R3WA 3ZM8A 3GXNA 3RXZA 3VGHA 1BVWA 1JAKA 2OWCA 3CJPA 4LS1A 4PCPA 3T0AA 4MYAA 4Y6GA 4K1WA 4AZBA 3W2KA 1K1DA 4PMJA 1GVFA 3Q37A 2JE8A 3ZVHB 4UQAA 3FGCB 1WDPA 4GGBA 3UFYA 4BHYA 3P84A 3CTLA 4JGDA 4CCCA 3A4WA 1LQ0A 3G1HA 4JX5A 7PTDA 1JZ4A 1G01A 4EACA 1QATA 4D8LA 2V3EA 3LS9A 2V3FA 3ABXA 3B8TA 4MY1A 1KLYA 4N9EA 4MNKA 1I0BA 4QITA 1O66A 2EAWA 1S5MA 3I68A 1BYBA 3OP2A 1KXQA 2PE4A 1KGWA 1JPMA 5C6MA 1LUCB 1JYNA 1QRQA 3GNOA 4W8BA 3R8HA 3ZVIA 1UOZA 5CC3A 2VC9A 1RBOB 1E6QM 5M5DA 3CH0A 4FEZA 4GIAA 4HPNA 4JIIX 3WH7A 3DHDA 2A5HA 5A6AA 3A5VA 3R0UA 3GY1A 2W91A 5G2IA 3OOQA 1AZ1A 4QCEA 3HM7A 1KM3A 4NNBA 4EANA 2DQWA 1YLVA 2OTDA 4WUIA 4O1CA 3CV1A 2OJPA 1A5LC 2V82A 3UU0A 4DJDA 2VZVA 3L23A 4GK8A 1OYBA 1T8XA 3KTCA 2H6RA 5D09A 4IL2A 5IBXC 3P67A 2OLSA 3KTXA 2TRSA 2Y63A 4A3UA 2GGEA 2YOCA 3CUGA 3RG6A 3CV2A 3T07A 5FD0A 3UERA 3VI2A 3NZ1A 3PY2A 5I7GA 3ZR6A 1PKMA 2PDPA 3VDAA 4A29A 3ITOA 3NQGA 2DVTA 2E77A 5AYXA 1WA3A 4K8GA 1KM2A 2FYMA 1V6WA 3UA4A 2I56A 3SSJA 2KX9A 3CPRA 1NTHA 2PTYA 1SR0A 3CZLA 2QNEA 3JZEA 4Y9OA 3SURA 1WXJA 1A0DA 2PP1A 3ZWSA 1BXCA 1XIIA 3QY8A 5F4XA 3K2GA 4ZOEA 1F7BA 4NSBA 2GJPA 1CEOA 4MWAC 1EC7A 1SJBA 2P8BA 3R43A 3WQEA 1KB3A 1V6VA 1PZ2A 4FNPA 1QPQA 4MY8A 3WNKA 5E0KA 3BAXA 1ZJIA 2J7FA 5BW6A 1X39A 1EO7A 2PZ0A 4WKFA 3LD5A 2Y70A 4FOUA 2Q71A 3WLHA 4ATWA 4GNJA 4MB3A 3VOIA 4G7EA 3PSWA 4PUMA 4LALA 2G95A 1X1ZA 3QGVA 4F79A 2ZRXA 1N82A 1SZGA 3NDZA 2A4AA 4W8AA 1HUVA 2DZXA 4UFMA 2VOMA 2WOQA 2Z28A 5FEZA 1OZQA 1FHLA 3LYEA 3PG9A 3O6CA 4B5TA 3B04A 3LCGA 4U2ZA 5GJNA 1OX6A 3CZ8A 4XZLX 3V4BA 4H9MA 4R34A 2X1SA 1ITQA 2HVOA 2D20A 3MQTA 2PTXA 5AYBA 1H7XA 1TUXA 4B3ZA 4WOZA 2CHOA 2PRLA 1UZ4A 4GNVA 3TSBA 4J3SA 4XD3A 4U5IA 3B4YA 4LS0A 4QJ5B 3A22A 1IZCA 2VFEA 3CAKA 2XINA 2YA1A 4CNTA 1XHGA 1K70A 1X1NA 3MHGA 3LRLA 4M8UA 3ZJ8A 3V0SA 1GW9A 4BCEA 2Q3OA 2W5FA 2WCGA 4GCXA 3P8IA 3V36A 3GUWA 3CB8A 3DI0A 3W25A 1BSIA 4H6EA 2WVTA 3SRDA 4DNMA 3POCA 5C9UA 1F8MA 3K4DA 2E3ZA 3TZNA 1YDVA 3NPWA 4DPQA 3R1ZA 3DFPA 4GJIA 1MW2A 3TEVA 5C2CA 3IVTA 3OZPA 4MB1A 4LPCA 3DOPA 1W3NA 1KFBA 1O60A 3ATYA 3T0TA 3SUVA 3OQ8A 4WY0B 1W1YA 2XIJA 1F6KA 4DUWA 4DJDC 1KXVA 4JD4A 3W2JA 4RPQA 3VIJA 4HOZA 4UFKA 4X63A 3FJLA 1NSJA 2D0GA 4ZXOA 3HOJA 4NZJA 4UQEA 4F48A 1KGXA 4W7UA 1F2JA 1X6NA 1HFBA 2WO5A 2P10A 1KNWA 2EQDA 2Z24A 3VIHA 2F6XA 4LQ1A 5KZEA 3OTRA 3C2YA 1E6ZA 1E0UA 1XC6A 3KDOA 3ANVA 3C52A 5BOEA 1OFRA 1DJNA 3P93A 3HQPA 2VURA 5IRPA 3ITYA 3AYVA 2NQZA 4AIEA 1NARA 4EX4A 2PCEA 1YYAA 4M6QA 1NWTA 4NY2A 5T8GA 3W76A 5GNXA 4LC6A 3KL3A 2ZRZA 3CUZA 3LSCA 7REQB 1OIMA 3EMCA 5CSRA 1OZMA 2Q8LA 4UZUA 4IP4A 4DXKA 3W1XA 3WLIA 3BDKA 4HNVA 1L6FA 1FKXA 4ALDA 2OLAA 3A4JA 2JKEA 3K4AA 1CTNA 4PB5A 4GGHA 1Z3NA 4RDZA 5HNTA 1JPHA 4AF0B 4CGTA 3WD3A 2P3EA 3ARTA 1UROA 1G4EA 5SWUA 1YDYA 2QJJA 3HO8A 4M7SA 4LCSA 3VXGA 3WYZA 1AUSL 1A5SA 2ZA2A 1MQPA 1R5YA 1TPDA 1BG4A 2W66A 3MYPA 4JY8A 6REQB 1JDEA 4POCA 4DRSA 3HG2A 3MO4A 1UD5A 1JD9A 4IUGA 3OBKA 4Z0SA 2YA0A 2GWNA 4DI9A 3W2NA 4AYSA 3WLQA 3T81A 3EBVA 3TYCA 2FHBA 1RPKA 1YBQA 1NFGA 3L2LA 1XIMA 4XO7A 4Q4OA 4DBUA 1KQZA 4AD3A 3L7RA 1Q6LA 3G1AA 3KRUA 1RLDA 4AMCA 4K2SA 1RVKA 2PLKA 4C6PA 1F73A 1XBZA 2YL5A 4JY9A 3LBOA 1XG3A 5A6TC 1EDGA 3S47A 2CIPA 4MTVA 1ZJBA 1V03A 2QCHA 2GFTA 2ZX7A 1N55A 4HNCA 4GIRA 1Y0EA 1GHRA 4GI9A 4RE4A 4HPGA 3WKZA 1TA3B 2OGYA 1XYLA 2WANA 4QCFA 4XISA 2HJPA 4LYRA 2FGBA 5AZ1A 4JCMA 3CMFA 1HGWA 5D2TA 1K6AA 4HBKA 4JHZA 4PUNA 1ZBCA 2AGTA 1TR1A 3PZUA 1T8QA 1WAUA 1HX0A 1R8LA 3TLLA 1JZ5A 1K9TA 4DWSB 4XUYA 1GOXA 5DCDA 4Z2IA 1M7JA 3HPFA 1XIBA 2F9RA 4B16A 3AYTA 1CXKA 2J6XA 3PZGA 3BAKA 2QJMA 3BLKA 2R9RA 4HNNA 1V3MA 1XH0A 3UF9A 1HJSA 1VBHA 2J7GA 3CEPA 3V0TA 5DMNA 3RX4A 2CITA 2PDGA 4MADA 1Q7MA 1WYIA 4QR6A 5E09A 1N8IA 3QR3A 3W7DA 4PUWA 3FYOA 1QW9A 5C9ZA 3R0KA 2Z1WA 2IXVA 1KRCC 3CHVA 4G56A 4PMDA 2CHNA 2CZDA 4RXGA 5A8OA 1TPWA 4C5ZA 3M64A 4F8XA 3A3HA 1Q5MA 1TTJA 3LPPA 4GACA 2V63A 2WMIA 4O1EA 3LGDA 3PFMA 4OV9A 2H9AA 1XGZA 4E2OA 2YCJA 2ZIDA 2G41A 3I7QA 2ACUA 3W6MA 3RO6A 1TVNA 3WL1A 4B5UA 3MPGA 1YW1A 1H7NA 1O5QA 3LTYA 1VFSA 3PTKA 5A8NA 4WY0F 3M0IA 3MUY1 3NL5A 3VVGA 1KTCA 2OSWA 1JPIA 4YXGA 5KEZA 1RK6A 2CKRA 3ZYZA 5EMUA 1QHOA 5G5IA 3KDNA 2C1IA 5A2CA 1BWVA 3HG4A 4JTRA 2DY3A 1U2YA 3R58A 4PMYA 2JF6A 3CU2A 1OYAA 1ENUA 1VFLA 1QO2A 4E2BA 2YL6A 4MFEA 2RKXA 4E2VA 5A8GA 1MNZA 2CESA 3VNIA 3W27A 4UOQA 2V5BA 1TPB1 2OQLA 3WQWA 3S5YA 4H9ZA 1XBXA 1OFPA 2BSLA 1QJWA 1OX4A 1V0KA 3UPMA 1EHAA 3LRKA 1B4EA 2Z2UA 4GVGA 1YXCA 3AMLA 4ZVJA 3RN6A 3WFAA 4GCAA 4I5UA 1CWYA 2F2KA 1CB2A 1TYGA 3LZ3A 4C90A 3AZSA 1H7RA 3PANA 3P3BA 5AHEA 8TIMA 3RM4A 3PHAA 1OBAA 1MXDA 4P8VA 5A6SA 1M7OA 1PDZA 4D6FA 3TTQA 5MKGA 3WCZA 4C5YA 1FWGC 5K2ZA 3LENA 4WOQA 5XIAA 2NVDA 1L6WA 1QW8A 4NX0A 3N14A 3NQVA 4S2CA 4G9PA 4W89A 3PUDA 3NCOA 3UR8A 4IHCA 1EHNA 3WN6A 3PZ9A 4LNYA 4UB9A 5CBBA 3MKVA 4GZEA 5HQLA 1W2VA 4RNIA 4A2RA 4TX6A 3GNXA 3R4IA 3NQDA 1ZB5A 1YADA 3VUPA 5FSDC 2ZRWA 3W73A 3QGKC 3GG0A 4GMEA 1SW3A 3LPOA 3RU6A 3MYOA 4Q8VA 3FV9A 2QW5A 5FF2A 1EJVC 4PN2A 1Q2RA 2QIIA 4FNSA 1DP0A 1H1YA 2WMHA 2YCLB 4GUIA 3CL7A 2XIMA 1SZEA 5HWMA 4R5EA 4NJHA 1JCLA 2BDQA 8RUCA 5F2GA 3V5FA 3BG3A 5EFFA 1MEWA 5LIXX 1TPFA 2ZADA 3PUGA 3HFTA 4I9MA 1XIFA 4O19A 4B92A 2DV0A 4DJFA 2A0NA 1CXIA 1PE1A 2V2CA 2WXDM 1YKWA 5LNWA 5BZAA 3INPA 4O10A 2PURA 3PWIA 2C19A 5BRPA 3IS4A 3W7OA 1BQGA 4ADUA 3UYIA 3G6LA 2VZUA 4V1XA 1EA9C 4JNZA 1CLVA 4K8HA 3MUXA 3WD1A 2ISSA 3TROA 1OK6A 2PTWA 1X1OA 4E3VA 3N29A 1Q13A 1QXLA 1EGZA </