4U3FE

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
total genus 39
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4u3fE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4u3fE02
2HMOA 3GTSA 4H13D 4QDFB 3AZCA 1NU1E 2E75D 1BE3E 3GL2A 2YFLA 2YFJA 4H0LD 2GBWA 4U3FE 4HM6A 4NBFD 2NVFA 2DE6D 4NBDD 2JZAA 1G8KB 4QUPA 2E76D 4NBCD 2HMLA 3H1KE 4OGQD 1SJGA 2NWFA 1Q90C 1NTME 5CXMA 1O7NA 4PD4E 4AIVA 2NUKA 4NBAD 1SQVE 2ZYLA 4HM7A 1BCCE 4QDDA 3FOUA 3TGUE 2QPZA 4HM4A 3DQYA 4NB9D 3L75E 3GKEA 4HJLA 4HM1A 1SQPE 4NBED 3EN1A 1PP9E 4PV1D 5HL4A 5BOKA 2JO6A 2FYUE 4HM3A 2QJYC 4NBBD 3VMID 1O7GA 1EZVE 2YIUC 1EG9A 1VF5D 3CXHE 3GZYA 1SQBE 2NVGA 2XSHA 3EQQA 1UUVA 3L72E 5KKZC 1NDOA 2I7FA 2B24A 4H44D 2QJKC 3GCEA 1SQXE 3H1LE 1NTKE 2HMJA 2NUMA 2NVEA 1RIEA 2BMOA 4QURA 2BMQA 4HM0A 1O7MA 1KB9E 1P84E 2DE7D 2B1XA 2E4PA 5KLVE 3N0QA 2A06E 4HKVA 2XRXA 2BMRA 2IBZE 3CWBE 4NBHD 4EMJB 2GBXA 2YFIA 1SQQE 4QDFA 2DE5D 3H1IE 3GB4A 1WQLA 2HMNA 2HMKA 1FQTA 1O7PA 2XSOA 1VM9A 3CX5E 1NTZE 2QJPC 3H1HE 1ZRTE 3VCPA 2XR8A 4AAYB 2BCCE 4HM8A 1ULJA 1PPJE 3VCAA 5AEWA 3VMHD 1NYKA 4P1CH 1L0LE 1L0NE 2HMMA 5KLIC 4HM2A 3L73E 1VCKA 3GTEA 5AEUA 4D6TE 1G8JB 3GL0A 2ZT9D 3L74E 4P1BH 1O7HA 2Q3WA 1BGYE 3GZXA 4HM5A 3L71E 2YVJB 1RFSA 4QCKA 1KYOE 2E74D 3H1JE 4NBGD 3L70E 4QDCA 4NB8D 2FYNC 3GOBA 4QUQA 1ULIA 1JM1A 2CKFA 2D2CD 1O7WA 1UUWA 3C0DA 3D89A 3BCCE 2E4QA 3VMGD
chains in the Genus database with same CATH superfamily
3MHVA 3VOPA 1N7SB 1SQVG 1IFNA 4JYBA 2YFJA 2QSIA 4W7YA 2WSSH 5KJ7A 1NTMK 2FBWC 4D6TD 1SQVE 1LJ2A 4I7ZC 2M0BA 1G2CB 3FWLA 2K9JB 1CI6B 4XFJA 1OX3A 2FFDB 4PJ0H 5APVA 1YJNP 1QVFO 4GODA 1EDIA 2I7FA 2Q9IA 1P84H 4GOEA 5AVRB 3AECC 2BMOA 4QURA 3A5TA 2BMQA 1OVVA 2NRGA 2FXMA 1H88A 1YITP 1OWAA 1DD3A 1SFCC 1W2EA 1SQQE 4ASWA 5AVWB 2ZAEB 1MFZA 1L0LD 3P8MC 2HG5D 4U3FD 2KSEA 1FQTA 3AEEC 4P1CH 5CJ4A 3RGUA 1L0ND 1VL2A 4K35A 3H1JJ 1CZQA 3LIDA 4YXDC 2QJPB 3NTNA 3MUDC 1LTJA 2N9YB 2FYNC 2WSCJ 1ULIA 2R3SA 4UB8H 5CBOA 2D2CD 2AXCA 3H25A 4WWIA 2E4QA 1SQXK 3L72D 1GTWA 4LC1A 2P7JA 2E75D 1M1JB 4H13C 4EYYQ 3PTZA 5APWA 1VQKP 1BCCE 4R4LA 1N73B 2D2CC 3LW5J 4C46A 1KILC 1P84I 1SQVJ 1OZHA 1RHZB 3A3YB 1L0LG 2O01H 4L75A 4PV1D 2R5DA 2WSFJ 3GF3A 3TF5A 4Y28J 1NU1G 2E42A 3WUTA 4XE5B 1FZEA 4WY4D 1LTSC 1ZR2A 5KLVK 1IK9A 1Y47A 1L0NJ 4NPFX 3VN0A 4HM0A 1P84E 3WU2H 1NAYA 4B86A 1NGMB 1MKMA 3CD6P 1HH0A 3A0HE 3E7KA 2GBXA 2KLVA 2HMKA 1SQQJ 3I5CA 1ULJA 2N9BA 4PD4D 1USDA 3L75J 1VQPP 5M1BA 1FZGA 3OAKA 1QEXA 1SVFA 2K88A 1M57D 3V4QA 3Q1MA 1NO4A 4WB4A 2OYHB 3M0DA 2H8PD 5KAIE 4KHXA 1EDKA 3H1IJ 4ASVA 2HPCB 1IJDB 3H1HJ 2CK3H 1RE3A 2CKFA 4N78D 1G2CA 1KILD 2KS1A 1X8YA 1VPCA 2M3BA 1LTJC 4H13D 1LTTC 4HYTB 3H6PA 2IBZG 3O8ZA 2W6JH 3GF7A 3H1KE 1RF1B 1QL2A 1FU1A 3FXEA 1SQBG 3FGAD 3Q5RA 2J59M 1FZAA 1HGVA 2J5UA 2KZIA 5KLVD 2O1JA 5BOKA 2JO6A 3TDKA 1W5CE 3P8CD 3RL0B 1SQBE 4W7ZA 3JSVC 5CCHD 4JPZB 1JMMA 1SQXE 1KQLA 2NVEA 3CCVP 1EZVD 5AW1B 4JYCA 4IL6E 3C1LA 4N3YB 4H44B 3L71G 5KAFH 1J1EC 3AE6C 1GD2E 1LT9A 1WQLA 4W80A 2AEMA 4ZMDA 4R4MA 2M3EA 3V4WA 1T2KC 3RK3E 5CJ0A 1SFCD 2HODB 3ABVC 4IFFA 2KNCB 5GTIH 5APUA 1VCKA 1LWUB 3WMM0 1L0LJ 1YJ9P 5AW7B 4A7PA 1KB9H 1FDIA 3RK3D 2ZXEB 3L75G 2FYUG 1S1CX 2GA1A 2JP3A 5TJHA 3D6YA 2IBZD 4AUWA 5AVTB 1KD1Q 3MIWA 2ZT9C 1JY3O 1IK7A 4EOTA 1KZUB 2OYHC 4NBDD 1J1DC 2O01J 5CCGD 4OGQD 2NWFA 1QX8A 2P2UA 1PP9J 1U7MA 1KYOI 5KJ7D 1RY3A 3H1KD 1NTMJ 2WSEH 2MJZA 1Q2NA 3HUSB 5AW6B 2YIUC 2LXCB 1RQUA 3HD7A 2A45H 5AVUB 3AE3C 1S9KE 3VYIA 3V2PA 3BATA 1NDOA 3CWBD 2CPSA 1KYOH 1KILA 2E4PA 5APSA 1QVGO 4M3LA 1BE3J 2JKVA 2POHA 3Q5PA 5KLVJ 3B5NA 1Q81Q 1IC2A 2KLUA 1EC5A 3TGUG 3IN6A 1EZVG 2OYOA 1YQ3C 2WSCH 1N7SA 1SQPK 1GW3A 4DJGA 3II6A 1PIXA 3RK2B 5GTIE 1H0TA 1M56D 3PP5A 1VQ8P 4HM5A 3D6ZA 3CCQP 1AV1A 2WPSA 1EXJA 5KAIH 3V6IA 3VP9A 3SWKA 4H0LB 2N1TD 2YIUB 3BCCD 3H1LD 3AE5C 2NPSA 4IL6X 1L4AA 3L73G 3K5BA 1DH3A 1ZOYC 2OGUA 2B87B 1NTKJ 1QL1A 1KFMA 2ZYLA 3SWYA 1CSBA 4HM4A 1JTHA 4HM1A 3QWOC 1PP9E 3HUSC 2FYUE 3HE4A 2E5TA 3AE1C 2XSHA 2Z4EA 3L72E 2LXBA 3VTPC 1VQ4P 3RL0C 3TNUB 2CPBA 1LTJB 1S5LH 2WITA 4KT0J 1WMKA 1DIPA 1L0NK 2K37A 4HKVA 2M8RA 3H1JG 2HFED 2GUVA 2BCCG 1R5SA 1LTBC 1KB9I 3CX5E 3CWBG 1IFMA 3GW6A 1YJWP 1ZRTE 2G8YA 2HLOA 1NU1D 3OW2O 5CHXA 1X79B 3A2AA 1GL2D 2K3RA 2W83C 1ZN5A 2YXRB 1Y8AA 1HJBA 1OMIA 1PPJD 2FY8A 2E76B 2B88A 3L71E 1VQ7P 2YMKA 4OH8B 3V5BA 4DZOA 2IZ0A 2W27A 1ZRTD 4NB8D 2O01N 3MD0A 1SQPJ 2OTLP 4AYCA 1HBWA 3C9IA 2QA4P 1ZW0A 5AW2B 2ZVOB 1PV3A 3H1HD 1PZQA 3L74J 2J58A 2BCCJ 1CW5A 1Y9BA 1NVOA 4LGDE 1KILE 3L75E 2A06D 2Q6QA 1AFOA 2XNDH 3JCUE 2V7QH 1N7SD 5BU8B 3CMAP 2OTJP 2L91A 1LTAC 2RKLA 4GKGA 1JNMA 2XDJA 1HUCA 1N8RQ 1KQFB 1IFIA 2H89C 3BCCJ 2ITAA 3A0BE 1KB9E 3CX5I 5CBNA 2YKPA 2C0WA 3L70D 1H0TB 5AW3B 2IBZI 2GUSA 3GHGC 5AW5B 4CPGA 4HH2A 1T3JA 2BCCE 3VMYA 3L73J 1DX7A 3FWNA 1HGZA 1GL2C 4RKUJ 2Q7CA 1AA0A 2AEFA 2C9NY 1BGYE 2AEJA 4JBZA 1S2EA 2NPSD 3NXSA 3HE5A 3P7KA 1KILB 2FFDA 1YQ4C 3G6EP 2FYZA 1GU5A 3FX0A 1SQXG 1FJKA 3D71A 3A7OA 3H1IG 3ITKA 3CCEP 3C0DA 1AQ5A 5DJUB 3UIAA 3KPEA 5GTHE 1R5LA 2YKQA 1BDCA 2D2CB 2KZJA 2IFMA 3TGUJ 5CCHC 1XTCC 1NH4A 2ZYGA 1O7NA 2FYUD 2QIWA 3LW5H 2NUKA 1AJYA 1NHLA 1S9KD 3V2RA 4C7RA 3TGUE 1X9VA 2P58A 4NBED 4PJ0E 5CCGC 5AVQB 3VMID 5AW9B 3L70G 3GZYA 3CXHE 1K04A 1W2BO 3AEAC 3G71P 2JDIH 3CC7P 2BEQD 4NPEA 4IFMA 1SQVK 5KLVE 1VQ5P 2H88C 3CCRP 4U3FJ 3G9RA 2XRXA 2PGDA 3HTKA 2IBZE 1NTZG 2NPSB 1CI6A 1RE4C 2DE5D 2LKMA 5K5GB 1JEKA 3L75D 2B9BA 3N4XA 1A02F 2Q1KA 3RK3C 4HM8A 4WY4B 1PGOA 2WPRA 2Z5HA 2KIKA 1AVOA 2R32A 3H1JD 1SS1A 1A02J 3BRTB 4D6TE 3HE4B 1YI2P 2Q3WA 1ZLLA 1KORA 5B66E 1KYOD 2YO2A 4D6TJ 1GZLA 4QUQA 2WTYA 3GTSA 3L35A 3MTUE 1BE3E 1LP1A 2WVRA 4HM6A 2NVFA 2DE6D 4C7NB 1N86A 2QE7H 2E76D 1HJ0A 2IYPA 3E1IA 1FJPA 3L37A 4NBAD 3HD7C 1LWUA 1L4AD 4QDDA 2JWAA 3R2PA 2QPZA 2W8ZA 1L2PA 1NJIQ 3AE4C 3B5NC 3MZWB 1U7JA 1LTIC 3T97B 4EDFA 3IFMA 4Y99C 2QJKC 1NTKE 2HPCA 2HMJA 4Z1MH 2OYHA 5B5EE 1BCCJ 3A0HH 3GLMA 3N0QA 1BDDA 1KN7A 2P67A 1NTKG 1BCCD 4XA4A 2C0XA 1HWTC 3CCLP 4HB1A 2B87A 1E5WA 1G1IA 4GT1A 3TNUA 1PPJE 3TK1A 2Y9ZA 1MUUA 1JY2O 4H0LC 2JJLA 3B4SA 2O1KA 1KMIZ 1NTKD 3L74E 1H8AA 1NU1K 1EQ7A 1ZP0C 1FS0E 1JTHB 3H1LG 2PFXA 5KLVG 4EI2A 1OW7A 2E74D 4OWFA 2Y0CA 3AEFC 1H89A 4NBGD 1URQA 3L74D 2KUBA 3H32B 3V2NA 3P8CE 3B8EB 3CXHI 2A45I 4EIJA 2W90A 1RF0A 1M1KQ 1K73Q 5CCHA 1URQC 4IOIH 5AVSB 3RK3B 1KB9D 2I1JA 3DQYA 3TGUD 3GKEA 3O6QA 2FYNB 4BRYA 4NBBD 2ZYAA 4C7NA 4L73A 4N78E 1RH5B 3EQQA 2HYNA 3HE5B 1NU1J 1SQQG 2NUMA 2WZ7A 2WMMA 3B5ND 1OW8A 5AVYB 3PH0A 2B1XA 1DEBA 3BASA 3KZIH 5E79H 4HKZH 4I6MC 3RBXA 3H1IE 1RE3C 3IR9A 5KJ7C 1KTMA 3P32A 4ZKUA 1RF0C 4I2LC 5TISH 2OTKE 2XU6A 3KYQA 5AEWA 3B71A 2K9YA 2E74C 5AEUA 3GL0A 1O7HA 3L70J 3H1ID 1P84D 3MGNA 1FDOA 1NWQA 1KYOE 5APQA 3NFQA 1LT9B 2BEZF 3L70E 4QDCA 2XV5A 3EWKA 1FAVA 1JM1A 1NTZJ 3AE8C 1VQNP 4YXWH 1VQLP 3VMGD 3H1KG 3GL2A 1K8AQ 3FXDA 4NBCD 3JC22 3NMDA 3EQ2A 1IZNB 5BU5A 1LGHB 1Q90C 1E79H 2JEEA 4N6JA 1T6AA 2YMYA 2YKOA 1SQBJ 2YXQB 3M91A 1JY3N 1K9MQ 5APYA 4OGQB 2W6BA 2FFDC 3CPWO 3U59A 3MP7B 3ZDMA 1FOSE 3PRJA 2O3JA 2V7QJ 2OYIA 2Q3IA 1BGYG 1JY3P 2KK7A 2FYUK 4D6TG 2KP8A 3VMXA 1SQPD 4H44D 2E75C 2JR8A 3WUUA 2KXPB 3N7NA 1FZCC 4WBAA 1UIIA 2L5GB 1EDJA 4DOJA 4U3FG 3I55P 2WPVB 1YTZT 2IPPA 1X22A 1O7PA 1JOCA 1NYHA 1RF1A 4AAYB 5TISE 1NTMG 2N1TA 1U57A 3VMAA 3L73E 1NTZD 3L72G 5DJTB 4L76A 3U1CA 1IFJA 2C9LY 1LT1A 3MUDA 2HMOA 3RL0D 4UB6E 4NBFD 2QRXA 1EZVI 2A06G 1FZCB 3S9OA 4QUPA 2RH0A 2A45G 1URQD 1ZV8A 5CXMA 1SQPG 5APTA 1DEEG 5KTBA 4NB9D 3TSIA 1JY2N 1NOHA 1VQ9P 4HM3A 3H1LJ 1EZVE 4I1LA 4NPDA 2KYVA 4DCKA 1FE6A 3M9BA 2XKMA 3GCEA 1JM0A 3H1LE 1BSNA 1IO4A 1N73C 2QJYB 1OXZA 2G3AA 2KS1B 2ZJSE 3CCSP 3CX5D 2M5AB 4ZKPA 2KSJA 3VP8A 4YTPC 4NBHD 2Z5IA 1FBMA 3D70A 1XTGB 3GB4A 2HR3A 2HMNA 2XSOA 2IZ1A 1ZMEC 3R4YA 2IDBA 1BGYD 1YBKA 3AE9C 2WPQA 1OFCX 3KZIE 2YVJB 4RJTA 4QMAA 1VQOP 1PP9G 2FKWB 1PGJA 4JF7A 1OVUA 4WY4A 3HTKB 3AZCA 4TT3H 5E79E 1OW6A 2JZAA 3A0BH 1SP4A 2HMLA 4H13B 4PD4I 1SJGA 1SQXJ 4AIVA 3CLQA 2PAJA 1JB0J 3GMAA 2KNCA 1HTLC 2E43A 3QH9A 4HJLA 1SQPE 2HODA 3EN1A 1PGPA 1Q86Q 1O7GA 1GMJA 1GU4A 2OYIC 2ZXXA 4BXLA 3E1RA 1NTZK 3KQGA 1K05A 2Y0DA 1PPJG 3SFEC 1FDMA 2BMRA 4YPCA 4ZNCA 1HVVA 2I1KA 3CWBE 1JCDA 4QDFA 5EFWB 3TYYA 4PD4H 1PGQA 4KJMA 3L74G 2QJPC 3H1HE 3CCMP 4PV1C 3CWBJ 3M0AA 1USEA 3KXDA 4MN4C 4RO0A 2XR8A 1AVYA 1LT9C 1RF1C 3VCAA 3VMHD 2IYOA 3AEDC 1L0NE 2HMMA 5KLIC 3EFFK 1N2DC 1JUNA 3GTEA 1BCCG 3L73D 3HUSA 4P1BH 3WU2E 1SQVD 1KV4A 3H1KJ 5CMZA 3T97A 3BCCG 1WRGA 4QCKA 2QG4A 1SQXD 2BASA 2FXOA 3F5HA 3OJAB 1SFCB 1RE4A 3CXHD 2E76C 4HJGH 3BCCE 5GTHH 1AQTA 1NAFA 1S3JA 1FC2C 1KFNA 1RQVA 1QLED 3SWFA 2QJKB 1FZBA 3GHGB 3W68A 3V2QA 3USSA 3IF4A 2UWJE 3KDPB 3B5NB 1SQQD 2K1AA 5H2FE 1NKNA 2N1TB 1SLQA 4BWNA 2V4HA 3M9QA 3CXHH 1L0LK 1VF5D 3AEBC 1BGYJ 3M0DC 1VF5B 1URQB 2WT7B 1RIEA 3F89A 3CMEP 1ZR4A 1NTKK 1EDLA 1GK4A 4IL6H 4EMJB 1DD4A 1SQBD 5KLIB 1VM9A 1M90Q 1UIXA 1IFPA 1S4XA 3W67A 2Q3EA 1N73A 1JCCA 3SFDC 3H32A 3H1HG 1BE3G 2YO3A 2KI7B 1G8JB 1BE3D 2ZT9D 2BCCD 3L71D 2IX7C 1FOSF 2JWDA 2H7HA 3GG2A 1YHQP 1BSHA 1MZ9A 2M5AA 1O7WA 1UUWA 3RK2C 3D89A 1VDFA 2OQQA 2WQYC 3O6QB 3L4FA 2FYUJ 4H0LD 1VF5C 4U3FE 5KAFE 1G8KB 4GOFA 2QM7A 4O9BA 1PP9D 5AW4B 4HM7A 1PL5A 2ZVNB 3AE7C 2ZYDA 1N7LA 1SQBK 5HL4A 3M9HA 3PJSK 5BVZA 1EG9A 3G4SP 3WUVA 1VQ6P 1JY2P 4AQRD 2LR2A 2B24A 1G1JA 5B5EH 1MFTA 3HRNA 1QGKB 2XNXA 1S72P 3RK2D 2DE7D 3CC2P 1L4AB 2QVAA 4OGQC 1OVRA 2ZT9B 4H44C 2YFIA 3S1KA 3HD7D 4PV1B 1LP1B 3VCPA 1KQSO 5AVZB 1FZCA 2K9JA 1L0LE 2RMZA 2DW3A 1Q7YQ 1Q90D 5B66H 1PFIA 2XZRA 2Y0EA 3Q3DA 2WT7A 2R3CA 3I56P 2B89A 2YNYA 3H1JE 3AE2C 1VQMP 1M7LA 3CI9A 2NZ2A 1NKZB 2E74B 2E5YA 4GIFA 3Q2YA 1L0NG 3RL0g 2GBWA 1KQGB 3L72J 2W6AA 3AEGC 5KKZB 2KOGA 4K3AA 1NTME 5L8RJ 3Q5SA 4PD4E 1M8OB 3FOUA 2WSFH 3L36A 3CCUP 5AVVB 1T2KD 2ZFCA 4JQ0D 2N1TC 1UUVA 1Z56A 5KKZC 1GDTA 3S4RA 2PP6A 1OIPA 1L4AC 1FZFA 4Y99B 5H2FH 1KC8Q 5AW8B 4UB8E 2QM8A 4I7ZB 1TU3F 3CX5H 2JO1A 2SPZA 3BRVB 3LIEA 5APXA 1YTZI 3M06A 4HM2A 2AXTE 2WWWA 4U7JA 3CCJP 2NPSC 3KHUA 1RFSA 1SQQK 4BRYB 1MV8A 1T8ZA 2P1JA 1LNQA 2Q5UA 3GOBA 2E75B 1GL2A 2IFNA 1J2JB 2PRRA 1JO5A 1D7MA 3EFGA 1GK6A 2I8DA 1S5LX 1S5LE 4QDFB 1NU1E 1LWUC 1YIJP 2YFLA 4LLHA 2FXPA 1J1EB 3L71J 1WT6A 1YYCA 1N7SC 1T3UA 1IFDA 4L74A 2RN0A 1LTGC 5AW0B 2R5BA 2QJYC 3JCUH 4GDOA 2NVGA 4TLFA 2R44A 1GW4A 1Q82Q 2OARA 3C8VA 1J1DB 1X0TA 1NTMD 5C39A 2KB7P 1O7MA 1ZXGA 3PHLA 2Y9YA 3RBZA 3IAOA 2A06E 3U1AA 1M1JC 3CL3D 4WY4C 1SFCA 2GM4A 1EXIA 4WVZA 2WSEJ 1NTZE 1M1JA 4DT0A 1GL2B 3PLNA 3G3ZA 1JMBA 2H43A 4UB6H 1NYKA 3GHGA 2MKVA 3OA7A 3BVHA 2P10A 3CC4P 2AXTH 3GZXA 3HD7B 2QEXP 1HF9A 1R8EA 4OVNF 5AVXB 2VRSA 4IFDK 3SSUA 5CCGA 4RESB 2OYIB 3VMZA
chains in the Genus database with same CATH topology
2HMOA 3GTSA 4H13D 4QDFB 3AZCA 1NU1E 2E75D 1BE3E 3GL2A 2YFLA 2YFJA 4H0LD 2GBWA 4U3FE 4HM6A 4NBFD 2NVFA 2DE6D 4NBDD 2JZAA 1G8KB 4QUPA 2E76D 4NBCD 2HMLA 3H1KE 4OGQD 1SJGA 2NWFA 1Q90C 1NTME 5CXMA 1O7NA 4PD4E 4AIVA 2NUKA 4NBAD 1SQVE 2ZYLA 4HM7A 1BCCE 4QDDA 3FOUA 3TGUE 2QPZA 4HM4A 3DQYA 4NB9D 3L75E 3GKEA 4HJLA 4HM1A 1SQPE 4NBED 3EN1A 1PP9E 4PV1D 5HL4A 5BOKA 2JO6A 2FYUE 4HM3A 2QJYC 4NBBD 3VMID 1O7GA 1EZVE 2YIUC 1EG9A 1VF5D 3CXHE 3GZYA 1SQBE 2NVGA 2XSHA 3EQQA 1UUVA 3L72E 5KKZC 1NDOA 2I7FA 2B24A 4H44D 2QJKC 3GCEA 1SQXE 3H1LE 1NTKE 2HMJA 2NUMA 2NVEA 1RIEA 2BMOA 4QURA 2BMQA 4HM0A 1O7MA 1KB9E 1P84E 2DE7D 2B1XA 2E4PA 5KLVE 3N0QA 2A06E 4HKVA 2XRXA 2BMRA 2IBZE 3CWBE 4NBHD 4EMJB 2GBXA 2YFIA 1SQQE 4QDFA 2DE5D 3H1IE 3GB4A 1WQLA 2HMNA 2HMKA 1FQTA 1O7PA 2XSOA 1VM9A 3CX5E 1NTZE 2QJPC 3H1HE 1ZRTE 3VCPA 2XR8A 4AAYB 2BCCE 4HM8A 1ULJA 1PPJE 3VCAA 5AEWA 3VMHD 1NYKA 4P1CH 1L0LE 1L0NE 2HMMA 5KLIC 4HM2A 3L73E 1VCKA 3GTEA 5AEUA 4D6TE 1G8JB 3GL0A 2ZT9D 3L74E 4P1BH 1O7HA 2Q3WA 1BGYE 3GZXA 4HM5A 3L71E 2YVJB 1RFSA 4QCKA 1KYOE 2E74D 3H1JE 4NBGD 3L70E 4QDCA 4NB8D 2FYNC 3GOBA 4QUQA 1ULIA 1JM1A 2CKFA 2D2CD 1O7WA 1UUWA 3C0DA 3D89A 3BCCE 2E4QA 3VMGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMO A;  3GTS A;  4H13 D;  4QDF B;  3AZC A;  1NU1 E;  2E75 D;  1BE3 E;  3GL2 A;  2YFL A;  2YFJ A;  4H0L D;  2GBW A;  4U3F E;  4HM6 A;  4NBF D;  2NVF A;  2DE6 D;  4NBD D;  2JZA A;  1G8K B;  4QUP A;  2E76 D;  4NBC D;  2HML A;  3H1K E;  4OGQ D;  1SJG A;  2NWF A;  1Q90 C;  1NTM E;  5CXM A;  1O7N A;  4PD4 E;  4AIV A;  2NUK A;  4NBA D;  1SQV E;  2ZYL A;  4HM7 A;  1BCC E;  4QDD A;  3FOU A;  3TGU E;  2QPZ A;  4HM4 A;  3DQY A;  4NB9 D;  3L75 E;  3GKE A;  4HJL A;  4HM1 A;  1SQP E;  4NBE D;  3EN1 A;  1PP9 E;  4PV1 D;  5HL4 A;  5BOK A;  2JO6 A;  2FYU E;  4HM3 A;  2QJY C;  4NBB D;  3VMI D;  1O7G A;  1EZV E;  2YIU C;  1EG9 A;  1VF5 D;  3CXH E;  3GZY A;  1SQB E;  2NVG A;  2XSH A;  3EQQ A;  1UUV A;  3L72 E;  5KKZ C;  1NDO A;  2I7F A;  2B24 A;  4H44 D;  2QJK C;  3GCE A;  1SQX E;  3H1L E;  1NTK E;  2HMJ A;  2NUM A;  2NVE A;  1RIE A;  2BMO A;  4QUR A;  2BMQ A;  4HM0 A;  1O7M A;  1KB9 E;  1P84 E;  2DE7 D;  2B1X A;  2E4P A;  5KLV E;  3N0Q A;  2A06 E;  4HKV A;  2XRX A;  2BMR A;  2IBZ E;  3CWB E;  4NBH D;  4EMJ B;  2GBX A;  2YFI A;  1SQQ E;  4QDF A;  2DE5 D;  3H1I E;  3GB4 A;  1WQL A;  2HMN A;  2HMK A;  1FQT A;  1O7P A;  2XSO A;  1VM9 A;  3CX5 E;  1NTZ E;  2QJP C;  3H1H E;  1ZRT E;  3VCP A;  2XR8 A;  4AAY B;  2BCC E;  4HM8 A;  1ULJ A;  1PPJ E;  3VCA A;  5AEW A;  3VMH D;  1NYK A;  4P1C H;  1L0L E;  1L0N E;  2HMM A;  5KLI C;  4HM2 A;  3L73 E;  1VCK A;  3GTE A;  5AEU A;  4D6T E;  1G8J B;  3GL0 A;  2ZT9 D;  3L74 E;  4P1B H;  1O7H A;  2Q3W A;  1BGY E;  3GZX A;  4HM5 A;  3L71 E;  2YVJ B;  1RFS A;  4QCK A;  1KYO E;  2E74 D;  3H1J E;  4NBG D;  3L70 E;  4QDC A;  4NB8 D;  2FYN C;  3GOB A;  4QUQ A;  1ULI A;  1JM1 A;  2CKF A;  2D2C D;  1O7W A;  1UUW A;  3C0D A;  3D89 A;  3BCC E;  2E4Q A;  3VMG D; 
#chains in the Genus database with same CATH topology
 3MHV A;  3VOP A;  1N7S B;  1SQV G;  1IFN A;  4JYB A;  2YFJ A;  2QSI A;  4W7Y A;  2WSS H;  5KJ7 A;  1NTM K;  2FBW C;  4D6T D;  1SQV E;  1LJ2 A;  4I7Z C;  2M0B A;  1G2C B;  3FWL A;  2K9J B;  1CI6 B;  4XFJ A;  1OX3 A;  2FFD B;  4PJ0 H;  5APV A;  1YJN P;  1QVF O;  4GOD A;  1EDI A;  2I7F A;  2Q9I A;  1P84 H;  4GOE A;  5AVR B;  3AEC C;  2BMO A;  4QUR A;  3A5T A;  2BMQ A;  1OVV A;  2NRG A;  2FXM A;  1H88 A;  1YIT P;  1OWA A;  1DD3 A;  1SFC C;  1W2E A;  1SQQ E;  4ASW A;  5AVW B;  2ZAE B;  1MFZ A;  1L0L D;  3P8M C;  2HG5 D;  4U3F D;  2KSE A;  1FQT A;  3AEE C;  4P1C H;  5CJ4 A;  3RGU A;  1L0N D;  1VL2 A;  4K35 A;  3H1J J;  1CZQ A;  3LID A;  4YXD C;  2QJP B;  3NTN A;  3MUD C;  1LTJ A;  2N9Y B;  2FYN C;  2WSC J;  1ULI A;  2R3S A;  4UB8 H;  5CBO A;  2D2C D;  2AXC A;  3H25 A;  4WWI A;  2E4Q A;  1SQX K;  3L72 D;  1GTW A;  4LC1 A;  2P7J A;  2E75 D;  1M1J B;  4H13 C;  4EYY Q;  3PTZ A;  5APW A;  1VQK P;  1BCC E;  4R4L A;  1N73 B;  2D2C C;  3LW5 J;  4C46 A;  1KIL C;  1P84 I;  1SQV J;  1OZH A;  1RHZ B;  3A3Y B;  1L0L G;  2O01 H;  4L75 A;  4PV1 D;  2R5D A;  2WSF J;  3GF3 A;  3TF5 A;  4Y28 J;  1NU1 G;  2E42 A;  3WUT A;  4XE5 B;  1FZE A;  4WY4 D;  1LTS C;  1ZR2 A;  5KLV K;  1IK9 A;  1Y47 A;  1L0N J;  4NPF X;  3VN0 A;  4HM0 A;  1P84 E;  3WU2 H;  1NAY A;  4B86 A;  1NGM B;  1MKM A;  3CD6 P;  1HH0 A;  3A0H E;  3E7K A;  2GBX A;  2KLV A;  2HMK A;  1SQQ J;  3I5C A;  1ULJ A;  2N9B A;  4PD4 D;  1USD A;  3L75 J;  1VQP P;  5M1B A;  1FZG A;  3OAK A;  1QEX A;  1SVF A;  2K88 A;  1M57 D;  3V4Q A;  3Q1M A;  1NO4 A;  4WB4 A;  2OYH B;  3M0D A;  2H8P D;  5KAI E;  4KHX A;  1EDK A;  3H1I J;  4ASV A;  2HPC B;  1IJD B;  3H1H J;  2CK3 H;  1RE3 A;  2CKF A;  4N78 D;  1G2C A;  1KIL D;  2KS1 A;  1X8Y A;  1VPC A;  2M3B A;  1LTJ C;  4H13 D;  1LTT C;  4HYT B;  3H6P A;  2IBZ G;  3O8Z A;  2W6J H;  3GF7 A;  3H1K E;  1RF1 B;  1QL2 A;  1FU1 A;  3FXE A;  1SQB G;  3FGA D;  3Q5R A;  2J59 M;  1FZA A;  1HGV A;  2J5U A;  2KZI A;  5KLV D;  2O1J A;  5BOK A;  2JO6 A;  3TDK A;  1W5C E;  3P8C D;  3RL0 B;  1SQB E;  4W7Z A;  3JSV C;  5CCH D;  4JPZ B;  1JMM A;  1SQX E;  1KQL A;  2NVE A;  3CCV P;  1EZV D;  5AW1 B;  4JYC A;  4IL6 E;  3C1L A;  4N3Y B;  4H44 B;  3L71 G;  5KAF H;  1J1E C;  3AE6 C;  1GD2 E;  1LT9 A;  1WQL A;  4W80 A;  2AEM A;  4ZMD A;  4R4M A;  2M3E A;  3V4W A;  1T2K C;  3RK3 E;  5CJ0 A;  1SFC D;  2HOD B;  3ABV C;  4IFF A;  2KNC B;  5GTI H;  5APU A;  1VCK A;  1LWU B;  3WMM 0;  1L0L J;  1YJ9 P;  5AW7 B;  4A7P A;  1KB9 H;  1FDI A;  3RK3 D;  2ZXE B;  3L75 G;  2FYU G;  1S1C X;  2GA1 A;  2JP3 A;  5TJH A;  3D6Y A;  2IBZ D;  4AUW A;  5AVT B;  1KD1 Q;  3MIW A;  2ZT9 C;  1JY3 O;  1IK7 A;  4EOT A;  1KZU B;  2OYH C;  4NBD D;  1J1D C;  2O01 J;  5CCG D;  4OGQ D;  2NWF A;  1QX8 A;  2P2U A;  1PP9 J;  1U7M A;  1KYO I;  5KJ7 D;  1RY3 A;  3H1K D;  1NTM J;  2WSE H;  2MJZ A;  1Q2N A;  3HUS B;  5AW6 B;  2YIU C;  2LXC B;  1RQU A;  3HD7 A;  2A45 H;  5AVU B;  3AE3 C;  1S9K E;  3VYI A;  3V2P A;  3BAT A;  1NDO A;  3CWB D;  2CPS A;  1KYO H;  1KIL A;  2E4P A;  5APS A;  1QVG O;  4M3L A;  1BE3 J;  2JKV A;  2POH A;  3Q5P A;  5KLV J;  3B5N A;  1Q81 Q;  1IC2 A;  2KLU A;  1EC5 A;  3TGU G;  3IN6 A;  1EZV G;  2OYO A;  1YQ3 C;  2WSC H;  1N7S A;  1SQP K;  1GW3 A;  4DJG A;  3II6 A;  1PIX A;  3RK2 B;  5GTI E;  1H0T A;  1M56 D;  3PP5 A;  1VQ8 P;  4HM5 A;  3D6Z A;  3CCQ P;  1AV1 A;  2WPS A;  1EXJ A;  5KAI H;  3V6I A;  3VP9 A;  3SWK A;  4H0L B;  2N1T D;  2YIU B;  3BCC D;  3H1L D;  3AE5 C;  2NPS A;  4IL6 X;  1L4A A;  3L73 G;  3K5B A;  1DH3 A;  1ZOY C;  2OGU A;  2B87 B;  1NTK J;  1QL1 A;  1KFM A;  2ZYL A;  3SWY A;  1CSB A;  4HM4 A;  1JTH A;  4HM1 A;  3QWO C;  1PP9 E;  3HUS C;  2FYU E;  3HE4 A;  2E5T A;  3AE1 C;  2XSH A;  2Z4E A;  3L72 E;  2LXB A;  3VTP C;  1VQ4 P;  3RL0 C;  3TNU B;  2CPB A;  1LTJ B;  1S5L H;  2WIT A;  4KT0 J;  1WMK A;  1DIP A;  1L0N K;  2K37 A;  4HKV A;  2M8R A;  3H1J G;  2HFE D;  2GUV A;  2BCC G;  1R5S A;  1LTB C;  1KB9 I;  3CX5 E;  3CWB G;  1IFM A;  3GW6 A;  1YJW P;  1ZRT E;  2G8Y A;  2HLO A;  1NU1 D;  3OW2 O;  5CHX A;  1X79 B;  3A2A A;  1GL2 D;  2K3R A;  2W83 C;  1ZN5 A;  2YXR B;  1Y8A A;  1HJB A;  1OMI A;  1PPJ D;  2FY8 A;  2E76 B;  2B88 A;  3L71 E;  1VQ7 P;  2YMK A;  4OH8 B;  3V5B A;  4DZO A;  2IZ0 A;  2W27 A;  1ZRT D;  4NB8 D;  2O01 N;  3MD0 A;  1SQP J;  2OTL P;  4AYC A;  1HBW A;  3C9I A;  2QA4 P;  1ZW0 A;  5AW2 B;  2ZVO B;  1PV3 A;  3H1H D;  1PZQ A;  3L74 J;  2J58 A;  2BCC J;  1CW5 A;  1Y9B A;  1NVO A;  4LGD E;  1KIL E;  3L75 E;  2A06 D;  2Q6Q A;  1AFO A;  2XND H;  3JCU E;  2V7Q H;  1N7S D;  5BU8 B;  3CMA P;  2OTJ P;  2L91 A;  1LTA C;  2RKL A;  4GKG A;  1JNM A;  2XDJ A;  1HUC A;  1N8R Q;  1KQF B;  1IFI A;  2H89 C;  3BCC J;  2ITA A;  3A0B E;  1KB9 E;  3CX5 I;  5CBN A;  2YKP A;  2C0W A;  3L70 D;  1H0T B;  5AW3 B;  2IBZ I;  2GUS A;  3GHG C;  5AW5 B;  4CPG A;  4HH2 A;  1T3J A;  2BCC E;  3VMY A;  3L73 J;  1DX7 A;  3FWN A;  1HGZ A;  1GL2 C;  4RKU J;  2Q7C A;  1AA0 A;  2AEF A;  2C9N Y;  1BGY E;  2AEJ A;  4JBZ A;  1S2E A;  2NPS D;  3NXS A;  3HE5 A;  3P7K A;  1KIL B;  2FFD A;  1YQ4 C;  3G6E P;  2FYZ A;  1GU5 A;  3FX0 A;  1SQX G;  1FJK A;  3D71 A;  3A7O A;  3H1I G;  3ITK A;  3CCE P;  3C0D A;  1AQ5 A;  5DJU B;  3UIA A;  3KPE A;  5GTH E;  1R5L A;  2YKQ A;  1BDC A;  2D2C B;  2KZJ A;  2IFM A;  3TGU J;  5CCH C;  1XTC C;  1NH4 A;  2ZYG A;  1O7N A;  2FYU D;  2QIW A;  3LW5 H;  2NUK A;  1AJY A;  1NHL A;  1S9K D;  3V2R A;  4C7R A;  3TGU E;  1X9V A;  2P58 A;  4NBE D;  4PJ0 E;  5CCG C;  5AVQ B;  3VMI D;  5AW9 B;  3L70 G;  3GZY A;  3CXH E;  1K04 A;  1W2B O;  3AEA C;  3G71 P;  2JDI H;  3CC7 P;  2BEQ D;  4NPE A;  4IFM A;  1SQV K;  5KLV E;  1VQ5 P;  2H88 C;  3CCR P;  4U3F J;  3G9R A;  2XRX A;  2PGD A;  3HTK A;  2IBZ E;  1NTZ G;  2NPS B;  1CI6 A;  1RE4 C;  2DE5 D;  2LKM A;  5K5G B;  1JEK A;  3L75 D;  2B9B A;  3N4X A;  1A02 F;  2Q1K A;  3RK3 C;  4HM8 A;  4WY4 B;  1PGO A;  2WPR A;  2Z5H A;  2KIK A;  1AVO A;  2R32 A;  3H1J D;  1SS1 A;  1A02 J;  3BRT B;  4D6T E;  3HE4 B;  1YI2 P;  2Q3W A;  1ZLL A;  1KOR A;  5B66 E;  1KYO D;  2YO2 A;  4D6T J;  1GZL A;  4QUQ A;  2WTY A;  3GTS A;  3L35 A;  3MTU E;  1BE3 E;  1LP1 A;  2WVR A;  4HM6 A;  2NVF A;  2DE6 D;  4C7N B;  1N86 A;  2QE7 H;  2E76 D;  1HJ0 A;  2IYP A;  3E1I A;  1FJP A;  3L37 A;  4NBA D;  3HD7 C;  1LWU A;  1L4A D;  4QDD A;  2JWA A;  3R2P A;  2QPZ A;  2W8Z A;  1L2P A;  1NJI Q;  3AE4 C;  3B5N C;  3MZW B;  1U7J A;  1LTI C;  3T97 B;  4EDF A;  3IFM A;  4Y99 C;  2QJK C;  1NTK E;  2HPC A;  2HMJ A;  4Z1M H;  2OYH A;  5B5E E;  1BCC J;  3A0H H;  3GLM A;  3N0Q A;  1BDD A;  1KN7 A;  2P67 A;  1NTK G;  1BCC D;  4XA4 A;  2C0X A;  1HWT C;  3CCL P;  4HB1 A;  2B87 A;  1E5W A;  1G1I A;  4GT1 A;  3TNU A;  1PPJ E;  3TK1 A;  2Y9Z A;  1MUU A;  1JY2 O;  4H0L C;  2JJL A;  3B4S A;  2O1K A;  1KMI Z;  1NTK D;  3L74 E;  1H8A A;  1NU1 K;  1EQ7 A;  1ZP0 C;  1FS0 E;  1JTH B;  3H1L G;  2PFX A;  5KLV G;  4EI2 A;  1OW7 A;  2E74 D;  4OWF A;  2Y0C A;  3AEF C;  1H89 A;  4NBG D;  1URQ A;  3L74 D;  2KUB A;  3H32 B;  3V2N A;  3P8C E;  3B8E B;  3CXH I;  2A45 I;  4EIJ A;  2W90 A;  1RF0 A;  1M1K Q;  1K73 Q;  5CCH A;  1URQ C;  4IOI H;  5AVS B;  3RK3 B;  1KB9 D;  2I1J A;  3DQY A;  3TGU D;  3GKE A;  3O6Q A;  2FYN B;  4BRY A;  4NBB D;  2ZYA A;  4C7N A;  4L73 A;  4N78 E;  1RH5 B;  3EQQ A;  2HYN A;  3HE5 B;  1NU1 J;  1SQQ G;  2NUM A;  2WZ7 A;  2WMM A;  3B5N D;  1OW8 A;  5AVY B;  3PH0 A;  2B1X A;  1DEB A;  3BAS A;  3KZI H;  5E79 H;  4HKZ H;  4I6M C;  3RBX A;  3H1I E;  1RE3 C;  3IR9 A;  5KJ7 C;  1KTM A;  3P32 A;  4ZKU A;  1RF0 C;  4I2L C;  5TIS H;  2OTK E;  2XU6 A;  3KYQ A;  5AEW A;  3B71 A;  2K9Y A;  2E74 C;  5AEU A;  3GL0 A;  1O7H A;  3L70 J;  3H1I D;  1P84 D;  3MGN A;  1FDO A;  1NWQ A;  1KYO E;  5APQ A;  3NFQ A;  1LT9 B;  2BEZ F;  3L70 E;  4QDC A;  2XV5 A;  3EWK A;  1FAV A;  1JM1 A;  1NTZ J;  3AE8 C;  1VQN P;  4YXW H;  1VQL P;  3VMG D;  3H1K G;  3GL2 A;  1K8A Q;  3FXD A;  4NBC D;  3JC2 2;  3NMD A;  3EQ2 A;  1IZN B;  5BU5 A;  1LGH B;  1Q90 C;  1E79 H;  2JEE A;  4N6J A;  1T6A A;  2YMY A;  2YKO A;  1SQB J;  2YXQ B;  3M91 A;  1JY3 N;  1K9M Q;  5APY A;  4OGQ B;  2W6B A;  2FFD C;  3CPW O;  3U59 A;  3MP7 B;  3ZDM A;  1FOS E;  3PRJ A;  2O3J A;  2V7Q J;  2OYI A;  2Q3I A;  1BGY G;  1JY3 P;  2KK7 A;  2FYU K;  4D6T G;  2KP8 A;  3VMX A;  1SQP D;  4H44 D;  2E75 C;  2JR8 A;  3WUU A;  2KXP B;  3N7N A;  1FZC C;  4WBA A;  1UII A;  2L5G B;  1EDJ A;  4DOJ A;  4U3F G;  3I55 P;  2WPV B;  1YTZ T;  2IPP A;  1X22 A;  1O7P A;  1JOC A;  1NYH A;  1RF1 A;  4AAY B;  5TIS E;  1NTM G;  2N1T A;  1U57 A;  3VMA A;  3L73 E;  1NTZ D;  3L72 G;  5DJT B;  4L76 A;  3U1C A;  1IFJ A;  2C9L Y;  1LT1 A;  3MUD A;  2HMO A;  3RL0 D;  4UB6 E;  4NBF D;  2QRX A;  1EZV I;  2A06 G;  1FZC B;  3S9O A;  4QUP A;  2RH0 A;  2A45 G;  1URQ D;  1ZV8 A;  5CXM A;  1SQP G;  5APT A;  1DEE G;  5KTB A;  4NB9 D;  3TSI A;  1JY2 N;  1NOH A;  1VQ9 P;  4HM3 A;  3H1L J;  1EZV E;  4I1L A;  4NPD A;  2KYV A;  4DCK A;  1FE6 A;  3M9B A;  2XKM A;  3GCE A;  1JM0 A;  3H1L E;  1BSN A;  1IO4 A;  1N73 C;  2QJY B;  1OXZ A;  2G3A A;  2KS1 B;  2ZJS E;  3CCS P;  3CX5 D;  2M5A B;  4ZKP A;  2KSJ A;  3VP8 A;  4YTP C;  4NBH D;  2Z5I A;  1FBM A;  3D70 A;  1XTG B;  3GB4 A;  2HR3 A;  2HMN A;  2XSO A;  2IZ1 A;  1ZME C;  3R4Y A;  2IDB A;  1BGY D;  1YBK A;  3AE9 C;  2WPQ A;  1OFC X;  3KZI E;  2YVJ B;  4RJT A;  4QMA A;  1VQO P;  1PP9 G;  2FKW B;  1PGJ A;  4JF7 A;  1OVU A;  4WY4 A;  3HTK B;  3AZC A;  4TT3 H;  5E79 E;  1OW6 A;  2JZA A;  3A0B H;  1SP4 A;  2HML A;  4H13 B;  4PD4 I;  1SJG A;  1SQX J;  4AIV A;  3CLQ A;  2PAJ A;  1JB0 J;  3GMA A;  2KNC A;  1HTL C;  2E43 A;  3QH9 A;  4HJL A;  1SQP E;  2HOD A;  3EN1 A;  1PGP A;  1Q86 Q;  1O7G A;  1GMJ A;  1GU4 A;  2OYI C;  2ZXX A;  4BXL A;  3E1R A;  1NTZ K;  3KQG A;  1K05 A;  2Y0D A;  1PPJ G;  3SFE C;  1FDM A;  2BMR A;  4YPC A;  4ZNC A;  1HVV A;  2I1K A;  3CWB E;  1JCD A;  4QDF A;  5EFW B;  3TYY A;  4PD4 H;  1PGQ A;  4KJM A;  3L74 G;  2QJP C;  3H1H E;  3CCM P;  4PV1 C;  3CWB J;  3M0A A;  1USE A;  3KXD A;  4MN4 C;  4RO0 A;  2XR8 A;  1AVY A;  1LT9 C;  1RF1 C;  3VCA A;  3VMH D;  2IYO A;  3AED C;  1L0N E;  2HMM A;  5KLI C;  3EFF K;  1N2D C;  1JUN A;  3GTE A;  1BCC G;  3L73 D;  3HUS A;  4P1B H;  3WU2 E;  1SQV D;  1KV4 A;  3H1K J;  5CMZ A;  3T97 A;  3BCC G;  1WRG A;  4QCK A;  2QG4 A;  1SQX D;  2BAS A;  2FXO A;  3F5H A;  3OJA B;  1SFC B;  1RE4 A;  3CXH D;  2E76 C;  4HJG H;  3BCC E;  5GTH H;  1AQT A;  1NAF A;  1S3J A;  1FC2 C;  1KFN A;  1RQV A;  1QLE D;  3SWF A;  2QJK B;  1FZB A;  3GHG B;  3W68 A;  3V2Q A;  3USS A;  3IF4 A;  2UWJ E;  3KDP B;  3B5N B;  1SQQ D;  2K1A A;  5H2F E;  1NKN A;  2N1T B;  1SLQ A;  4BWN A;  2V4H A;  3M9Q A;  3CXH H;  1L0L K;  1VF5 D;  3AEB C;  1BGY J;  3M0D C;  1VF5 B;  1URQ B;  2WT7 B;  1RIE A;  3F89 A;  3CME P;  1ZR4 A;  1NTK K;  1EDL A;  1GK4 A;  4IL6 H;  4EMJ B;  1DD4 A;  1SQB D;  5KLI B;  1VM9 A;  1M90 Q;  1UIX A;  1IFP A;  1S4X A;  3W67 A;  2Q3E A;  1N73 A;  1JCC A;  3SFD C;  3H32 A;  3H1H G;  1BE3 G;  2YO3 A;  2KI7 B;  1G8J B;  1BE3 D;  2ZT9 D;  2BCC D;  3L71 D;  2IX7 C;  1FOS F;  2JWD A;  2H7H A;  3GG2 A;  1YHQ P;  1BSH A;  1MZ9 A;  2M5A A;  1O7W A;  1UUW A;  3RK2 C;  3D89 A;  1VDF A;  2OQQ A;  2WQY C;  3O6Q B;  3L4F A;  2FYU J;  4H0L D;  1VF5 C;  4U3F E;  5KAF E;  1G8K B;  4GOF A;  2QM7 A;  4O9B A;  1PP9 D;  5AW4 B;  4HM7 A;  1PL5 A;  2ZVN B;  3AE7 C;  2ZYD A;  1N7L A;  1SQB K;  5HL4 A;  3M9H A;  3PJS K;  5BVZ A;  1EG9 A;  3G4S P;  3WUV A;  1VQ6 P;  1JY2 P;  4AQR D;  2LR2 A;  2B24 A;  1G1J A;  5B5E H;  1MFT A;  3HRN A;  1QGK B;  2XNX A;  1S72 P;  3RK2 D;  2DE7 D;  3CC2 P;  1L4A B;  2QVA A;  4OGQ C;  1OVR A;  2ZT9 B;  4H44 C;  2YFI A;  3S1K A;  3HD7 D;  4PV1 B;  1LP1 B;  3VCP A;  1KQS O;  5AVZ B;  1FZC A;  2K9J A;  1L0L E;  2RMZ A;  2DW3 A;  1Q7Y Q;  1Q90 D;  5B66 H;  1PFI A;  2XZR A;  2Y0E A;  3Q3D A;  2WT7 A;  2R3C A;  3I56 P;  2B89 A;  2YNY A;  3H1J E;  3AE2 C;  1VQM P;  1M7L A;  3CI9 A;  2NZ2 A;  1NKZ B;  2E74 B;  2E5Y A;  4GIF A;  3Q2Y A;  1L0N G;  3RL0 g;  2GBW A;  1KQG B;  3L72 J;  2W6A A;  3AEG C;  5KKZ B;  2KOG A;  4K3A A;  1NTM E;  5L8R J;  3Q5S A;  4PD4 E;  1M8O B;  3FOU A;  2WSF H;  3L36 A;  3CCU P;  5AVV B;  1T2K D;  2ZFC A;  4JQ0 D;  2N1T C;  1UUV A;  1Z56 A;  5KKZ C;  1GDT A;  3S4R A;  2PP6 A;  1OIP A;  1L4A C;  1FZF A;  4Y99 B;  5H2F H;  1KC8 Q;  5AW8 B;  4UB8 E;  2QM8 A;  4I7Z B;  1TU3 F;  3CX5 H;  2JO1 A;  2SPZ A;  3BRV B;  3LIE A;  5APX A;  1YTZ I;  3M06 A;  4HM2 A;  2AXT E;  2WWW A;  4U7J A;  3CCJ P;  2NPS C;  3KHU A;  1RFS A;  1SQQ K;  4BRY B;  1MV8 A;  1T8Z A;  2P1J A;  1LNQ A;  2Q5U A;  3GOB A;  2E75 B;  1GL2 A;  2IFN A;  1J2J B;  2PRR A;  1JO5 A;  1D7M A;  3EFG A;  1GK6 A;  2I8D A;  1S5L X;  1S5L E;  4QDF B;  1NU1 E;  1LWU C;  1YIJ P;  2YFL A;  4LLH A;  2FXP A;  1J1E B;  3L71 J;  1WT6 A;  1YYC A;  1N7S C;  1T3U A;  1IFD A;  4L74 A;  2RN0 A;  1LTG C;  5AW0 B;  2R5B A;  2QJY C;  3JCU H;  4GDO A;  2NVG A;  4TLF A;  2R44 A;  1GW4 A;  1Q82 Q;  2OAR A;  3C8V A;  1J1D B;  1X0T A;  1NTM D;  5C39 A;  2KB7 P;  1O7M A;  1ZXG A;  3PHL A;  2Y9Y A;  3RBZ A;  3IAO A;  2A06 E;  3U1A A;  1M1J C;  3CL3 D;  4WY4 C;  1SFC A;  2GM4 A;  1EXI A;  4WVZ A;  2WSE J;  1NTZ E;  1M1J A;  4DT0 A;  1GL2 B;  3PLN A;  3G3Z A;  1JMB A;  2H43 A;  4UB6 H;  1NYK A;  3GHG A;  2MKV A;  3OA7 A;  3BVH A;  2P10 A;  3CC4 P;  2AXT H;  3GZX A;  3HD7 B;  2QEX P;  1HF9 A;  1R8E A;  4OVN F;  5AVX B;  2VRS A;  4IFD K;  3SSU A;  5CCG A;  4RES B;  2OYI B;  3VMZ A; 
#chains in the Genus database with same CATH homology
 2HMO A;  3GTS A;  4H13 D;  4QDF B;  3AZC A;  1NU1 E;  2E75 D;  1BE3 E;  3GL2 A;  2YFL A;  2YFJ A;  4H0L D;  2GBW A;  4U3F E;  4HM6 A;  4NBF D;  2NVF A;  2DE6 D;  4NBD D;  2JZA A;  1G8K B;  4QUP A;  2E76 D;  4NBC D;  2HML A;  3H1K E;  4OGQ D;  1SJG A;  2NWF A;  1Q90 C;  1NTM E;  5CXM A;  1O7N A;  4PD4 E;  4AIV A;  2NUK A;  4NBA D;  1SQV E;  2ZYL A;  4HM7 A;  1BCC E;  4QDD A;  3FOU A;  3TGU E;  2QPZ A;  4HM4 A;  3DQY A;  4NB9 D;  3L75 E;  3GKE A;  4HJL A;  4HM1 A;  1SQP E;  4NBE D;  3EN1 A;  1PP9 E;  4PV1 D;  5HL4 A;  5BOK A;  2JO6 A;  2FYU E;  4HM3 A;  2QJY C;  4NBB D;  3VMI D;  1O7G A;  1EZV E;  2YIU C;  1EG9 A;  1VF5 D;  3CXH E;  3GZY A;  1SQB E;  2NVG A;  2XSH A;  3EQQ A;  1UUV A;  3L72 E;  5KKZ C;  1NDO A;  2I7F A;  2B24 A;  4H44 D;  2QJK C;  3GCE A;  1SQX E;  3H1L E;  1NTK E;  2HMJ A;  2NUM A;  2NVE A;  1RIE A;  2BMO A;  4QUR A;  2BMQ A;  4HM0 A;  1O7M A;  1KB9 E;  1P84 E;  2DE7 D;  2B1X A;  2E4P A;  5KLV E;  3N0Q A;  2A06 E;  4HKV A;  2XRX A;  2BMR A;  2IBZ E;  3CWB E;  4NBH D;  4EMJ B;  2GBX A;  2YFI A;  1SQQ E;  4QDF A;  2DE5 D;  3H1I E;  3GB4 A;  1WQL A;  2HMN A;  2HMK A;  1FQT A;  1O7P A;  2XSO A;  1VM9 A;  3CX5 E;  1NTZ E;  2QJP C;  3H1H E;  1ZRT E;  3VCP A;  2XR8 A;  4AAY B;  2BCC E;  4HM8 A;  1ULJ A;  1PPJ E;  3VCA A;  5AEW A;  3VMH D;  1NYK A;  4P1C H;  1L0L E;  1L0N E;  2HMM A;  5KLI C;  4HM2 A;  3L73 E;  1VCK A;  3GTE A;  5AEU A;  4D6T E;  1G8J B;  3GL0 A;  2ZT9 D;  3L74 E;  4P1B H;  1O7H A;  2Q3W A;  1BGY E;  3GZX A;  4HM5 A;  3L71 E;  2YVJ B;  1RFS A;  4QCK A;  1KYO E;  2E74 D;  3H1J E;  4NBG D;  3L70 E;  4QDC A;  4NB8 D;  2FYN C;  3GOB A;  4QUQ A;  1ULI A;  1JM1 A;  2CKF A;  2D2C D;  1O7W A;  1UUW A;  3C0D A;  3D89 A;  3BCC E;  2E4Q A;  3VMG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...