4U3FE

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 39
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4u3fE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4u3fE02
4QDFA 1NTZE 1EZVE 3GB4A 4NB8D 1O7GA 2XSOA 2YIUC 5KLIC 2BMOA 4QUPA 3GOBA 1SQXE 2B24A 2HMMA 1O7WA 1VCKA 1NU1E 3DQYA 3GTEA 5KLVE 2BMRA 3GL0A 1O7HA 1WQLA 3CX5E 1BGYE 1RIEA 2NWFA 1BE3E 4NBGD 5CXMA 4NBAD 3L72E 1ZRTE 3VCPA 2NVGA 1BCCE 2XSHA 4QURA 2QJKC 1RFSA 1O7NA 4NBCD 4NBDD 3L73E 2XR8A 1NTME 3L75E 2IBZE 3H1KE 1P84E 4PD4E 2E4PA 2E76D 2BCCE 1VF5D 2GBWA 3H1IE 1PP9E 1SJGA 2DE5D 2QJYC 5BOKA 2FYUE 4H0LD 5HL4A 1NYKA 3GTSA 2DE7D 4OGQD 4QCKA 1SQPE 4HM3A 4HM7A 5KKZC 2B1XA 2NUMA 3CXHE 2Q3WA 2YFLA 3VMGD 2JZAA 5AEWA 1KYOE 4AIVA 4PV1D 1ULIA 3D89A 2D2CD 1UUVA 2FYNC 3H1JE 1O7MA 4HM6A 3GL2A 1SQQE 2JO6A 3VCAA 1G8JB 1ULJA 4D6TE 2I7FA 1VM9A 1NTKE 1SQVE 4NBHD 2HMLA 4HM4A 4NBED 4HM2A 4HM8A 2A06E 4P1CH 4AAYB 2NUKA 2XRXA 2CKFA 3AZCA 2ZT9D 3EN1A 3BCCE 2YFJA 3H1LE 4H44D 1NDOA 3GKEA 4EMJB 4HM0A 1FQTA 2HMJA 2NVEA 1JM1A 4NBFD 2HMKA 2HMNA 3GZXA 4NB9D 4QDDA 2BMQA 4U3FE 4QDCA 1L0NE 4QUQA 3TGUE 3L70E 2YFIA 3FOUA 2ZYLA 1Q90C 4HM5A 1KB9E 4P1BH 2QJPC 2DE6D 4NBBD 3VMHD 3L74E 3GZYA 1SQBE 3N0QA 4H13D 3C0DA 4HJLA 5AEUA 2E4QA 3L71E 3VMID 3CWBE 1L0LE 1PPJE 2HMOA 1UUWA 3EQQA 3H1HE 1O7PA 4HM1A 4QDFB 2YVJB 2E74D 2GBXA 2E75D 4HKVA 2QPZA 3GCEA 1EG9A 1G8KB 2NVFA
chains in the Genus database with same CATH superfamily
1LP1A 1LTSC 2KOGA 5KLIC 3WUTA 2ZAEB 3CXHH 2FYUG 1HJBA 3IAOA 1LT9A 1YQ3C 3HUSA 3OJAB 5CJ4A 3JSVC 1PV3A 4WBAA 1GL2A 3P7KA 2YKQA 1D7MA 3NXSA 1JY3N 1OZHA 3KZIH 3KYQA 3AEFC 1NTKG 3L71D 4KT0J 2H7HA 2IX7C 2PP6A 1SQQJ 1KZUB 3D71A 1PP9E 2W90A 3CCSP 1SQVJ 3SWFA 1JNMA 4C46A 2DE7D 2GUVA 2QJKB 2Q3WA 4PV1D 5AW5B 4OGQB 1YBKA 5E79H 4NPFX 1RY3A 1NKNA 1RQUA 1S3JA 2P67A 1ZV8A 4HM8A 3PH0A 5AW3B 5AVTB 3NTNA 1CSBA 2J58A 1VF5B 1NDOA 1G2CB 3AECC 4UB6H 4HM0A 4N78E 1FQTA 1RF0C 3MHVA 4QDCA 3TGUE 1LTTC 4P1BH 5AW6B 3C0DA 1X22A 1IFIA 1URQB 1BGYG 3CWBE 1L0LE 2W8ZA 1G8KB 3RK2C 1RF0A 3H6PA 3E1RA 2E74B 1NTZK 1U7JA 1LT9B 2R3SA 3HUSB 2KYVA 2YXQB 3KDPB 5AW4B 2BEQD 1FDMA 2NPSD 4WB4A 2O1KA 1EDLA 1L2PA 4WY4A 5KLIB 2Y0DA 2JKVA 3OAKA 2E4PA 3EFFK 2Q7CA 1BE3D 3P8CD 2AXTE 1SJGA 3PP5A 1M8OB 3GHGA 1K8AQ 1NAFA 1FZEA 4NPDA 1PP9J 4HM3A 3RBXA 2JZAA 1SP4A 2FYNC 4XFJA 1SQPK 1U7MA 3AE1C 2W83C 3GL2A 4JQ0D 2PAJA 2OYHC 2YXRB 3L70J 4M3LA 3EN1A 2ZT9D 2YFJA 2ZYGA 1ZR4A 5BU8B 3MUDC 1M1JA 1JCCA 1KYOI 1HJ0A 3L75D 3LW5J 3R2PA 1HH0A 1N7SC 4GT1A 3SFEC 4ASVA 4K35A 3VMHD 2QJPC 3L74E 1L0NK 5B5EE 1RF1C 2E4QA 1PPJE 2FBWC 5APUA 1JY3P 4JPZB 1JO5A 1NTMG 5AVSB 2KSJA 5GTIE 1SQBD 2WMMA 4XA4A 3SWYA 3S9OA 3VMAA 1N7SA 1YTZI 2Z5HA 3A0HE 1VCKA 2ITAA 3H1KJ 3DQYA 5H2FH 3T97A 1RF1A 3GL0A 3RK2B 4WY4B 1E5WA 3FXDA 2N9BA 3V2PA 1M57D 1OMIA 2E76D 1XTCC 3H1JJ 1JY2N 4DZOA 2C0WA 5AVZB 2PGDA 1HBWA 2V4HA 3RL0B 1MKMA 2ZVNB 3H32A 1NTZD 2Q3EA 3BCCJ 1EZVG 1WMKA 5CHXA 4IL6E 1UUVA 4RKUJ 2VRSA 1BDCA 1ULJA 4N3YB 3TYYA 2QM7A 1T6AA 2E5YA 3KQGA 2FYNB 2WT7B 5AW9B 4RESB 2HMKA 2BMQA 1K73Q 2OYHB 1NTKD 2OYIC 1KFMA 1CW5A 1JTHA 2DE6D 3IN6A 2WPRA 2K88A 1Q2NA 3C1LA 1FZFA 4CPGA 2IDBA 4MN4C 4H13B 4PJ0H 2M0BA 2UWJE 4EOTA 1N73A 1N7SB 1S5LE 1G1IA 2QJPB 1RF1B 2PRRA 3GOBA 1QL1A 2JDIH 3L75J 1PP9G 5AVWB 1EDKA 1NU1K 2YKPA 1W5CE 1R5LA 1L0ND 5KLVK 5KJ7D 1KTMA 4QURA 4NBDD 1LWUC 2M8RA 4HB1A 1AVYA 5GTHE 2XNXA 3TNUA 1GTWA 3H32B 1LTJA 1JY3O 1SFCD 5CJ0A 1QVGO 3GTSA 2KK7A 3VN0A 4HM7A 1OFCX 3CC4P 3TGUG 5AW1B 1BDDA 1O7MA 1X79B 1L4AC 2JO1A 2E75C 1JB0J 2OTKE 1S9KD 2OARA 1VQPP 1ZMEC 3M0DA 1KORA 4B86A 3A2AA 2XV5A 3V2RA 5AVUB 1L0LG 2L5GB 2R5BA 1USEA 3AEGC 5KJ7A 4EMJB 3QH9A 2NVEA 3OW2O 4IL6X 3Q2YA 4NBBD 1SFCA 4I1LA 3O8ZA 5AEUA 3AE8C 3VMID 2HMOA 3TK1A 3EQQA 3CXHD 3H1HE 4HM1A 2J59M 2O01J 4EDFA 1KMIZ 3UIAA 2OYIB 1JY2P 3WU2H 2Q3IA 3L72J 1DEEG 5KAIH 2H8PD 1SQXE 3L73J 2WSEJ 1SVFA 2R44A 2HG5D 2KNCA 2Q9IA 1GW4A 1SQPJ 1S5LX 2O01N 1M56D 1X8YA 4JYBA 1LTJB 3A0BE 2GBWA 3CX5D 3VMXA 1VQNP 2V7QJ 4OGQD 5CBOA 1YTZT 1NTMD 3MP7B 2WWWA 1FE6A 1LWUB 1MFTA 1SQQE 2Q5UA 2WSCJ 2JO6A 1NU1D 1L0NJ 3L74G 3ITKA 1S1CX 1SQVE 3M9HA 1PPJG 2A06E 3JCUE 3H1LE 5CCGC 1J1EC 3AEBC 1L4AB 2HMNA 3CCUP 1RE4A 2QEXP 1URQD 4BRYB 4UB6E 4IFMA 3RK3E 3PJSK 4I7ZB 4IOIH 1UUWA 2E74D 3RK3C 1IFJA 4HKVA 4Y99C 2OTJP 1YQ4C 2WSFJ 4QDFA 3H1HJ 2YKOA 1EZVE 1JM0A 2YNYA 2FY8A 1NYHA 1BCCJ 2RH0A 1IK9A 3AEEC 2XNDH 1EXIA 2KNCB 2D2CC 2BCCJ 3P8MC 3E7KA 3V2QA 3V4QA 1KQLA 1URQA 1NO4A 2K1AA 5AW0B 1EDJA 3TF5A 3HE5A 2A45H 1K05A 1BSHA 3AE3C 1H8AA 1VPCA 2JP3A 3CX5I 5HL4A 4IFDK 3CC7P 3M9QA 1NHLA 3F89A 1JY2O 1YJ9P 3BVHA 1OIPA 2E43A 1N2DC 1ZLLA 4H44C 5B66E 1KFNA 4AAYB 5AVVB 3L72G 2Q1KA 3GKEA 5AVQB 3L73G 3H1LJ 3Q1MA 2Z5IA 1Z56A 2FKWB 3L70E 3AE2C 3CX5H 2ZYLA 3U59A 3CL3D 1WRGA 1LJ2A 3H25A 1M90Q 1IFDA 3L71E 3AEDC 1S72P 1J1EB 1A02F 5KAFE 4QDFB 1SQBK 1KYOD 1QL2A 5KLVJ 1KD1Q 4LLHA 1JMBA 3TGUD 1Y47A 4HJGH 1EZVI 4NB8D 1N8RQ 1VQ7P 2GM4A 1IK7A 3CMEP 3B5NC 3CWBD 5BU5A 3RK2D 1L0LD 4WY4D 4PV1C 3GTEA 4TT3H 1HF9A 4WVZA 2NWFA 4Y99B 1H0TA 3M0AA 1LTIC 4ASWA 3HE5B 3H1KE 3RL0D 1FBMA 4Z1MH 4D6TJ 4C7RA 3CCVP 2K9JA 1Q7YQ 1RH5B 3B8EB 2FYUK 1ZN5A 3H1JE 3GF7A 3D6ZA 1S4XA 4U3FJ 1PGQA 3HD7C 2KS1B 2XRXA 3H1HG 3BCCE 5APSA 1ZRTD 1NTKK 4ZMDA 4GODA 3A7OA 2HMJA 1JM1A 1OWAA 4AYCA 2PFXA 4H44B 5AVXB 4BXLA 2M5AA 4HM5A 3H1ID 1KB9E 1SQXG 4H13D 4TLFA 2QVAA 2HPCA 4UB8E 3IF4A 3BRTB 2WZ7A 1N7SD 3B4SA 3P8CE 2YVJB 4DJGA 3AEAC 3L71J 3AE6C 2GA1A 3HTKA 1MUUA 2AXCA 3L74D 2ZYDA 3HRNA 2WT7A 4QUPA 1VQLP 1PPJD 1H0TB 2OYHA 2ZFCA 2IFNA 1GZLA 1HWTC 1R5SA 4Y28J 3D6YA 3IFMA 3MUDA 5KTBA 3B5NB 2P1JA 3VTPC 1SQQG 3W68A 3L75E 2IBZE 4H0LC 1SQVG 2A06G 2LKMA 2K9JB 1KYOH 1LTGC 1RQVA 3H1LG 1IO4A 4YPCA 5KKZC 2NUMA 2IFMA 1HVVA 2POHA 1NAYA 3GF3A 1TU3F 3SSUA 2KZJA 2JEEA 1M1KQ 3Q3DA 3OA7A 2KZIA 2ZXEB 1FZCC 2RKLA 1VL2A 5DJTB 2M5AB 1UIXA 4NB9D 4OH8B 1YJNP 1KB9I 2HPCB 3HD7B 1GW3A 1NGMB 3MIWA 3CLQA 2FYUD 3L36A 2C0XA 1FZCA 3USSA 3VOPA 3HTKB 4BWNA 2GBXA 4L74A 1BE3J 1NTZE 3A5TA 3CCEP 2AXTH 3R4YA 4HKZH 1QX8A 2BMOA 2JWDA 2HFED 2B24A 2HMMA 2KLUA 2KXPB 1VQ8P 1HGZA 1AFOA 2YMYA 2C9NY 1AQ5A 2W6JH 3L72E 3W67A 2WPSA 1FS0E 2E5TA 4NBCD 3L73E 2IBZI 2N1TC 5APYA 1DD3A 2N9YB 1P84E 4PD4E 4W80A 2OYIA 1KQSO 3PLNA 2AEJA 1NWQA 1LTAC 1NTMK 2P2UA 5TJHA 4OWFA 1NYKA 3Q5SA 1SQPE 4YTPC 3VMGD 3KHUA 1FJKA 4H0LB 1IJDB 2AEMA 5M1BA 3L70G 2O3JA 3V2NA 4U7JA 1NH4A 2HMLA 1BGYD 3L71G 2GUSA 3PRJA 5KKZB 2CKFA 5APTA 1SQBJ 1L4AD 5GTIH 2LXCB 1KILE 2KLVA 1X0TA 3A0HH 5CMZA 1L0NE 1KQGB 1KILC 1Q90C 3GLMA 4EYYQ 3VMYA 1NKZB 2FXMA 1FZCB 1LWUA 2KP8A 2H43A 1MFZA 1RE3C 3V4WA 1ZW0A 2E42A 2FFDC 1OX3A 1AJYA 3H1KG 4I6MC 1LGHB 1NTZJ 2L91A 1L4AA 1FDOA 1R8EA 4BRYA 4JBZA 4LGDE 5EFWB 1USDA 4NBGD 1PIXA 5TISH 2FYUJ 2CPBA 3N7NA 1BCCE 2FFDA 4R4LA 3H1JG 1SQXD 4PD4I 4ZNCA 1Y9BA 2BCCE 1KQFB 1SS1A 2ZXXA 3M9BA 3CPWO 2QJYC 1EXJA 2P7JA 3BCCG 1NTKJ 2M3EA 1PL5A 2AEFA 3CXHE 1AVOA 2N1TB 1IFNA 1FOSE 4ZKPA 1FDIA 4HM6A 4HM2A 3CCQP 3KZIE 2NUKA 2HLOA 3I56P 1KV4A 1DIPA 1VQKP 1CI6A 4RO0A 2G8YA 2WSSH 1T2KC 1EC5A 1SQVD 5CCGD 2A06D 4HJLA 4IFFA 5E79E 3GW6A 2HODA 5K5GB 2CPSA 3PHLA 1MZ9A 1EG9A 1GDTA 1L0LK 1KILB 3GB4A 2E75B 3L75G 2IBZG 2NRGA 1KN7A 3K5BA 1NU1E 1OXZA 3M06A 5KLVE 3BATA 3I55P 3U1CA 4QMAA 2FXPA 2FFDB 4R4MA 2RMZA 1EZVD 1QLED 2C9LY 5CXMA 5CCGA 1VF5C 2MKVA 1QGKB 1O7NA 2K37A 2XU6A 5L8RJ 3LIDA 5CCHC 2YO3A 4AQRD 4HH2A 3AE9C 1VQ4P 2WTYA 1PZQA 1HTLC 1ULIA 3D89A 3EQ2A 5CBNA 3TDKA 2E74C 4D6TE 2I7FA 2QJYB 3WUUA 5CCHA 1Q86Q 3HUSC 3S1KA 1CI6B 3C8VA 3C9IA 2Z4EA 4H44D 1GL2C 1IFMA 1NTZG 2WQYC 4U3FE 3GG2A 1GU5A 2IPPA 1PP9D 3L37A 2HODB 4N6JA 1W2BO 4L75A 3FGAD 2NZ2A 2QPZA 2KS1A 3L70D 3A0BH 3CCMP 2P58A 1FAVA 1OVVA 3VP8A 1YIJP 1ZOYC 1NTMJ 2G3AA 4AUWA 3FWLA 4DCKA 1WQLA 4C7NB 4N78D 1SQPG 1NU1J 3B5ND 1GMJA 4NBAD 2XR8A 3JCUH 2Y0CA 3EFGA 3EWKA 2QIWA 1Q82Q 1FZGA 3G4SP 1RHZB 3RGUA 2Y9YA 1J1DC 3RK3B 1G1JA 4GDOA 2OYOA 3MZWB 4A7PA 4ZKUA 5H2FE 1KYOE 3H1KD 4YXDC 1L0NG 1J2JB 2WPVB 3V6IA 1ZR2A 3B5NA 5AW8B 2D2CB 3GMAA 2WPQA 2WITA 3AZCA 3CCLP 1LP1B 4EI2A 1K04A 3HE4A 4WY4C 3H1JD 3HD7D 2LXBA 4O9BA 2B9BA 3SFDC 5AVYB 4L76A 3BCCD 3F5HA 2SPZA 3GHGC 3AE5C 1GL2B 1H88A 3RL0C 3TSIA 2NVFA 1BCCG 1YJWP 1KB9D 2JWAA 3ZDMA 2XSOA 2BCCG 4K3AA 2NPSC 3G3ZA 3PTZA 1O7WA 3HD7A 2A45G 1BE3E 1M1JC 2QG4A 2FXOA 3N4XA 1ZRTE 2H89C 2OGUA 1RFSA 5B66H 3CC2P 2IZ0A 2KI7B 3KPEA 4PJ0E 3RL0g 2NPSA 3H1IE 2DE5D 2ZVOB 4H0LD 1GD2E 3WMM0 4GKGA 4DOJA 2YFLA 4H13C 3BASA 4AIVA 2IBZD 1W2EA 1Q81Q 2W6BA 4WWIA 3CI9A 3VMZA 2ZT9C 3ABVC 2QA4P 5KAFH 4PV1B 3TGUJ 1J1DB 1FZBA 3LW5H 2XKMA 3HE4B 4P1CH 1QEXA 3CD6P 3VP9A 3CWBJ 2BASA 1L0LJ 1LTBC 4GOFA 2Y0EA 3FOUA 1N7LA 1DX7A 2IYPA 1NU1G 1S2EA 1SQBE 1WT6A 5KLVG 1BSNA 1H89A 4JF7A 1FC2C 3NMDA 3GCEA 1M7LA 5AW2B 1KC8Q 4HYTB 2IZ1A 2HR3A 1GK6A 3GHGB 2Q6QA 4I2LC 3P32A 2KIKA 1E79H 2BMRA 3E1IA 1RIEA 1JUNA 2J5UA 1SQXK 1FOSF 1GK4A 3KXDA 2E76C 3MTUE 2P10A 2XSHA 3I5CA 2NPSB 5TISE 3B71A 4D6TG 1JOCA 1PGJA 2JJLA 2QE7H 1OVUA 3WU2E 2JR8A 1M1JB 1HUCA 2N1TD 2FYUE 3L72D 5KAIE 3H1IJ 4QCKA 3CCJP 1DD4A 1N73C 1KB9H 1N86A 3L73D 1CZQA 3SWKA 1Y8AA 4U3FG 1P84D 4PD4D 5C39A 4UB8H 1SLQA 1ZXGA 3JC22 1NTKE 2QRXA 1FJPA 1VM9A 4NBHD 1SQQK 1SQPD 1OVRA 3L74J 1SQVK 4RJTA 1VQ5P 2HYNA 2ZT9B 1DH3A 3GZXA 3Q5RA 5B5EH 2I1KA 4KJMA 1VQMP 1NVOA 1YITP 1JCDA 3T97B 1AV1A 2YFIA 2N1TA 1JEKA 1LTJC 1KILD 1Q90D 2E75D 2O1JA 1PFIA 1NJIQ 4W7ZA 2MJZA 2YIUC 4KHXA 1A02J 3M0DC 1GU4A 1PGOA 4DT0A 1T3JA 2XZRA 3O6QA 5KJ7C 2M3BA 1BGYE 2H88C 3G6EP 4GOEA 1VDFA 2NVGA 3BRVB 2ZJSE 2B87A 1SFCC 1KILA 1ZP0C 1T8ZA 3A3YB 2OTLP 1EDIA 3CWBG 1HGVA 3H1HD 1S9KE 5BOKA 2R32A 2E76B 4I7ZC 1DEBA 1FZAA 4IL6H 1XTGB 1BCCD 3MD0A 4W7YA 5APWA 2Y9ZA 2FYZA 2B1XA 1EQ7A 1MV8A 1UIIA 5AEWA 2RN0A 1RE3A 1JTHB 2QSIA 3CMAP 1IFPA 2BCCD 4LC1A 2K3RA 1P84I 1JMMA 1YI2P 2KSEA 3AE7C 4HM4A 4NBED 4JYCA 1VQ9P 1IC2A 1N73B 3NFQA 1QVFO 3QWOC 3AE4C 2YMKA 1YHQP 1IZNB 4EIJA 4QDDA 4QUQA 2XDJA 3VYIA 2O01H 2DW3A 2W27A 3GZYA 1NOHA 1T2KD 3G9RA 2K9YA 1U57A 2OQQA 1BE3G 1S5LH 1VQOP 1O7PA 3RBZA 2WSEH 2I1JA 1P84H 4PD4H 2YO2A 3II6A 1SQQD 5APXA 5APQA 3TNUB 1O7GA 2KUBA 1T3UA 3O6QB 4XE5B 3H1IG 3S4RA 4YXWH 3FX0A 3FXEA 3H1LD 2QM8A 1O7HA 2ZYAA 3CX5E 1OW6A 2CK3H 3FWNA 3IR9A 1BGYJ 3VCPA 2B87B 1RE4C 2YIUB 5GTHH 2V7QH 2QJKC 3WUVA 1NTME 3L4FA 3RK3D 4OGQC 5KLVD 1AA0A 1VF5D 1OW8A 2B89A 3MGNA 2W6AA 2WSCH 2R5DA 4GIFA 5AW7B 5CCHD 1YYCA 4C7NA 1AQTA 1SFCB 2D2CD 2KB7P 1K9MQ 2B88A 3VCAA 4OVNF 1G8JB 3U1AA 1SQBG 3V5BA 1LT1A 1X9VA 2IYOA 2WVRA 1LNQA 2A45I 3CCRP 3M91A 1URQC 3LIEA 2R3CA 3CXHI 5BVZA 3L35A 4NPEA 4NBFD 2BEZF 5AVRB 5APVA 4D6TD 1G2CA 2I8DA 2LR2A 5DJUB 1GL2D 2WSFH 3D70A 3N0QA 3G71P 1OW7A 1LT9C 1SQXJ 1PGPA 1FU1A 4L73A 1VQ6P 4U3FD 3Q5PA
chains in the Genus database with same CATH topology
4QDFA 1NTZE 1EZVE 3GB4A 4NB8D 1O7GA 2XSOA 2YIUC 5KLIC 2BMOA 4QUPA 3GOBA 1SQXE 2B24A 2HMMA 1O7WA 1VCKA 1NU1E 3DQYA 3GTEA 5KLVE 2BMRA 3GL0A 1O7HA 1WQLA 3CX5E 1BGYE 1RIEA 2NWFA 1BE3E 4NBGD 5CXMA 4NBAD 3L72E 1ZRTE 3VCPA 2NVGA 1BCCE 2XSHA 4QURA 2QJKC 1RFSA 1O7NA 4NBCD 4NBDD 3L73E 2XR8A 1NTME 3L75E 2IBZE 3H1KE 1P84E 4PD4E 2E4PA 2E76D 2BCCE 1VF5D 2GBWA 3H1IE 1PP9E 1SJGA 2DE5D 2QJYC 5BOKA 2FYUE 4H0LD 5HL4A 1NYKA 3GTSA 2DE7D 4OGQD 4QCKA 1SQPE 4HM3A 4HM7A 5KKZC 2B1XA 2NUMA 3CXHE 2Q3WA 2YFLA 3VMGD 2JZAA 5AEWA 1KYOE 4AIVA 4PV1D 1ULIA 3D89A 2D2CD 1UUVA 2FYNC 3H1JE 1O7MA 4HM6A 3GL2A 1SQQE 2JO6A 3VCAA 1G8JB 1ULJA 4D6TE 2I7FA 1VM9A 1NTKE 1SQVE 4NBHD 2HMLA 4HM4A 4NBED 4HM2A 4HM8A 2A06E 4P1CH 4AAYB 2NUKA 2XRXA 2CKFA 3AZCA 2ZT9D 3EN1A 3BCCE 2YFJA 3H1LE 4H44D 1NDOA 3GKEA 4EMJB 4HM0A 1FQTA 2HMJA 2NVEA 1JM1A 4NBFD 2HMKA 2HMNA 3GZXA 4NB9D 4QDDA 2BMQA 4U3FE 4QDCA 1L0NE 4QUQA 3TGUE 3L70E 2YFIA 3FOUA 2ZYLA 1Q90C 4HM5A 1KB9E 4P1BH 2QJPC 2DE6D 4NBBD 3VMHD 3L74E 3GZYA 1SQBE 3N0QA 4H13D 3C0DA 4HJLA 5AEUA 2E4QA 3L71E 3VMID 3CWBE 1L0LE 1PPJE 2HMOA 1UUWA 3EQQA 3H1HE 1O7PA 4HM1A 4QDFB 2YVJB 2E74D 2GBXA 2E75D 4HKVA 2QPZA 3GCEA 1EG9A 1G8KB 2NVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QDF A;  1NTZ E;  1EZV E;  3GB4 A;  4NB8 D;  1O7G A;  2XSO A;  2YIU C;  5KLI C;  2BMO A;  4QUP A;  3GOB A;  1SQX E;  2B24 A;  2HMM A;  1O7W A;  1VCK A;  1NU1 E;  3DQY A;  3GTE A;  5KLV E;  2BMR A;  3GL0 A;  1O7H A;  1WQL A;  3CX5 E;  1BGY E;  1RIE A;  2NWF A;  1BE3 E;  4NBG D;  5CXM A;  4NBA D;  3L72 E;  1ZRT E;  3VCP A;  2NVG A;  1BCC E;  2XSH A;  4QUR A;  2QJK C;  1RFS A;  1O7N A;  4NBC D;  4NBD D;  3L73 E;  2XR8 A;  1NTM E;  3L75 E;  2IBZ E;  3H1K E;  1P84 E;  4PD4 E;  2E4P A;  2E76 D;  2BCC E;  1VF5 D;  2GBW A;  3H1I E;  1PP9 E;  1SJG A;  2DE5 D;  2QJY C;  5BOK A;  2FYU E;  4H0L D;  5HL4 A;  1NYK A;  3GTS A;  2DE7 D;  4OGQ D;  4QCK A;  1SQP E;  4HM3 A;  4HM7 A;  5KKZ C;  2B1X A;  2NUM A;  3CXH E;  2Q3W A;  2YFL A;  3VMG D;  2JZA A;  5AEW A;  1KYO E;  4AIV A;  4PV1 D;  1ULI A;  3D89 A;  2D2C D;  1UUV A;  2FYN C;  3H1J E;  1O7M A;  4HM6 A;  3GL2 A;  1SQQ E;  2JO6 A;  3VCA A;  1G8J B;  1ULJ A;  4D6T E;  2I7F A;  1VM9 A;  1NTK E;  1SQV E;  4NBH D;  2HML A;  4HM4 A;  4NBE D;  4HM2 A;  4HM8 A;  2A06 E;  4P1C H;  4AAY B;  2NUK A;  2XRX A;  2CKF A;  3AZC A;  2ZT9 D;  3EN1 A;  3BCC E;  2YFJ A;  3H1L E;  4H44 D;  1NDO A;  3GKE A;  4EMJ B;  4HM0 A;  1FQT A;  2HMJ A;  2NVE A;  1JM1 A;  4NBF D;  2HMK A;  2HMN A;  3GZX A;  4NB9 D;  4QDD A;  2BMQ A;  4U3F E;  4QDC A;  1L0N E;  4QUQ A;  3TGU E;  3L70 E;  2YFI A;  3FOU A;  2ZYL A;  1Q90 C;  4HM5 A;  1KB9 E;  4P1B H;  2QJP C;  2DE6 D;  4NBB D;  3VMH D;  3L74 E;  3GZY A;  1SQB E;  3N0Q A;  4H13 D;  3C0D A;  4HJL A;  5AEU A;  2E4Q A;  3L71 E;  3VMI D;  3CWB E;  1L0L E;  1PPJ E;  2HMO A;  1UUW A;  3EQQ A;  3H1H E;  1O7P A;  4HM1 A;  4QDF B;  2YVJ B;  2E74 D;  2GBX A;  2E75 D;  4HKV A;  2QPZ A;  3GCE A;  1EG9 A;  1G8K B;  2NVF A; 
#chains in the Genus database with same CATH topology
 1LP1 A;  1LTS C;  2KOG A;  5KLI C;  3WUT A;  2ZAE B;  3CXH H;  2FYU G;  1HJB A;  3IAO A;  1LT9 A;  1YQ3 C;  3HUS A;  3OJA B;  5CJ4 A;  3JSV C;  1PV3 A;  4WBA A;  1GL2 A;  3P7K A;  2YKQ A;  1D7M A;  3NXS A;  1JY3 N;  1OZH A;  3KZI H;  3KYQ A;  3AEF C;  1NTK G;  3L71 D;  4KT0 J;  2H7H A;  2IX7 C;  2PP6 A;  1SQQ J;  1KZU B;  3D71 A;  1PP9 E;  2W90 A;  3CCS P;  1SQV J;  3SWF A;  1JNM A;  4C46 A;  2DE7 D;  2GUV A;  2QJK B;  2Q3W A;  4PV1 D;  5AW5 B;  4OGQ B;  1YBK A;  5E79 H;  4NPF X;  1RY3 A;  1NKN A;  1RQU A;  1S3J A;  2P67 A;  1ZV8 A;  4HM8 A;  3PH0 A;  5AW3 B;  5AVT B;  3NTN A;  1CSB A;  2J58 A;  1VF5 B;  1NDO A;  1G2C B;  3AEC C;  4UB6 H;  4HM0 A;  4N78 E;  1FQT A;  1RF0 C;  3MHV A;  4QDC A;  3TGU E;  1LTT C;  4P1B H;  5AW6 B;  3C0D A;  1X22 A;  1IFI A;  1URQ B;  1BGY G;  3CWB E;  1L0L E;  2W8Z A;  1G8K B;  3RK2 C;  1RF0 A;  3H6P A;  3E1R A;  2E74 B;  1NTZ K;  1U7J A;  1LT9 B;  2R3S A;  3HUS B;  2KYV A;  2YXQ B;  3KDP B;  5AW4 B;  2BEQ D;  1FDM A;  2NPS D;  4WB4 A;  2O1K A;  1EDL A;  1L2P A;  4WY4 A;  5KLI B;  2Y0D A;  2JKV A;  3OAK A;  2E4P A;  3EFF K;  2Q7C A;  1BE3 D;  3P8C D;  2AXT E;  1SJG A;  3PP5 A;  1M8O B;  3GHG A;  1K8A Q;  1NAF A;  1FZE A;  4NPD A;  1PP9 J;  4HM3 A;  3RBX A;  2JZA A;  1SP4 A;  2FYN C;  4XFJ A;  1SQP K;  1U7M A;  3AE1 C;  2W83 C;  3GL2 A;  4JQ0 D;  2PAJ A;  2OYH C;  2YXR B;  3L70 J;  4M3L A;  3EN1 A;  2ZT9 D;  2YFJ A;  2ZYG A;  1ZR4 A;  5BU8 B;  3MUD C;  1M1J A;  1JCC A;  1KYO I;  1HJ0 A;  3L75 D;  3LW5 J;  3R2P A;  1HH0 A;  1N7S C;  4GT1 A;  3SFE C;  4ASV A;  4K35 A;  3VMH D;  2QJP C;  3L74 E;  1L0N K;  5B5E E;  1RF1 C;  2E4Q A;  1PPJ E;  2FBW C;  5APU A;  1JY3 P;  4JPZ B;  1JO5 A;  1NTM G;  5AVS B;  2KSJ A;  5GTI E;  1SQB D;  2WMM A;  4XA4 A;  3SWY A;  3S9O A;  3VMA A;  1N7S A;  1YTZ I;  2Z5H A;  3A0H E;  1VCK A;  2ITA A;  3H1K J;  3DQY A;  5H2F H;  3T97 A;  1RF1 A;  3GL0 A;  3RK2 B;  4WY4 B;  1E5W A;  3FXD A;  2N9B A;  3V2P A;  1M57 D;  1OMI A;  2E76 D;  1XTC C;  3H1J J;  1JY2 N;  4DZO A;  2C0W A;  5AVZ B;  2PGD A;  1HBW A;  2V4H A;  3RL0 B;  1MKM A;  2ZVN B;  3H32 A;  1NTZ D;  2Q3E A;  3BCC J;  1EZV G;  1WMK A;  5CHX A;  4IL6 E;  1UUV A;  4RKU J;  2VRS A;  1BDC A;  1ULJ A;  4N3Y B;  3TYY A;  2QM7 A;  1T6A A;  2E5Y A;  3KQG A;  2FYN B;  2WT7 B;  5AW9 B;  4RES B;  2HMK A;  2BMQ A;  1K73 Q;  2OYH B;  1NTK D;  2OYI C;  1KFM A;  1CW5 A;  1JTH A;  2DE6 D;  3IN6 A;  2WPR A;  2K88 A;  1Q2N A;  3C1L A;  1FZF A;  4CPG A;  2IDB A;  4MN4 C;  4H13 B;  4PJ0 H;  2M0B A;  2UWJ E;  4EOT A;  1N73 A;  1N7S B;  1S5L E;  1G1I A;  2QJP B;  1RF1 B;  2PRR A;  3GOB A;  1QL1 A;  2JDI H;  3L75 J;  1PP9 G;  5AVW B;  1EDK A;  1NU1 K;  2YKP A;  1W5C E;  1R5L A;  1L0N D;  5KLV K;  5KJ7 D;  1KTM A;  4QUR A;  4NBD D;  1LWU C;  2M8R A;  4HB1 A;  1AVY A;  5GTH E;  2XNX A;  3TNU A;  1GTW A;  3H32 B;  1LTJ A;  1JY3 O;  1SFC D;  5CJ0 A;  1QVG O;  3GTS A;  2KK7 A;  3VN0 A;  4HM7 A;  1OFC X;  3CC4 P;  3TGU G;  5AW1 B;  1BDD A;  1O7M A;  1X79 B;  1L4A C;  2JO1 A;  2E75 C;  1JB0 J;  2OTK E;  1S9K D;  2OAR A;  1VQP P;  1ZME C;  3M0D A;  1KOR A;  4B86 A;  3A2A A;  2XV5 A;  3V2R A;  5AVU B;  1L0L G;  2L5G B;  2R5B A;  1USE A;  3AEG C;  5KJ7 A;  4EMJ B;  3QH9 A;  2NVE A;  3OW2 O;  4IL6 X;  3Q2Y A;  4NBB D;  1SFC A;  4I1L A;  3O8Z A;  5AEU A;  3AE8 C;  3VMI D;  2HMO A;  3TK1 A;  3EQQ A;  3CXH D;  3H1H E;  4HM1 A;  2J59 M;  2O01 J;  4EDF A;  1KMI Z;  3UIA A;  2OYI B;  1JY2 P;  3WU2 H;  2Q3I A;  3L72 J;  1DEE G;  5KAI H;  2H8P D;  1SQX E;  3L73 J;  2WSE J;  1SVF A;  2R44 A;  2HG5 D;  2KNC A;  2Q9I A;  1GW4 A;  1SQP J;  1S5L X;  2O01 N;  1M56 D;  1X8Y A;  4JYB A;  1LTJ B;  3A0B E;  2GBW A;  3CX5 D;  3VMX A;  1VQN P;  2V7Q J;  4OGQ D;  5CBO A;  1YTZ T;  1NTM D;  3MP7 B;  2WWW A;  1FE6 A;  1LWU B;  1MFT A;  1SQQ E;  2Q5U A;  2WSC J;  2JO6 A;  1NU1 D;  1L0N J;  3L74 G;  3ITK A;  1S1C X;  1SQV E;  3M9H A;  1PPJ G;  2A06 E;  3JCU E;  3H1L E;  5CCG C;  1J1E C;  3AEB C;  1L4A B;  2HMN A;  3CCU P;  1RE4 A;  2QEX P;  1URQ D;  4BRY B;  4UB6 E;  4IFM A;  3RK3 E;  3PJS K;  4I7Z B;  4IOI H;  1UUW A;  2E74 D;  3RK3 C;  1IFJ A;  4HKV A;  4Y99 C;  2OTJ P;  1YQ4 C;  2WSF J;  4QDF A;  3H1H J;  2YKO A;  1EZV E;  1JM0 A;  2YNY A;  2FY8 A;  1NYH A;  1BCC J;  2RH0 A;  1IK9 A;  3AEE C;  2XND H;  1EXI A;  2KNC B;  2D2C C;  2BCC J;  3P8M C;  3E7K A;  3V2Q A;  3V4Q A;  1KQL A;  1URQ A;  1NO4 A;  2K1A A;  5AW0 B;  1EDJ A;  3TF5 A;  3HE5 A;  2A45 H;  1K05 A;  1BSH A;  3AE3 C;  1H8A A;  1VPC A;  2JP3 A;  3CX5 I;  5HL4 A;  4IFD K;  3CC7 P;  3M9Q A;  1NHL A;  3F89 A;  1JY2 O;  1YJ9 P;  3BVH A;  1OIP A;  2E43 A;  1N2D C;  1ZLL A;  4H44 C;  5B66 E;  1KFN A;  4AAY B;  5AVV B;  3L72 G;  2Q1K A;  3GKE A;  5AVQ B;  3L73 G;  3H1L J;  3Q1M A;  2Z5I A;  1Z56 A;  2FKW B;  3L70 E;  3AE2 C;  3CX5 H;  2ZYL A;  3U59 A;  3CL3 D;  1WRG A;  1LJ2 A;  3H25 A;  1M90 Q;  1IFD A;  3L71 E;  3AED C;  1S72 P;  1J1E B;  1A02 F;  5KAF E;  4QDF B;  1SQB K;  1KYO D;  1QL2 A;  5KLV J;  1KD1 Q;  4LLH A;  1JMB A;  3TGU D;  1Y47 A;  4HJG H;  1EZV I;  4NB8 D;  1N8R Q;  1VQ7 P;  2GM4 A;  1IK7 A;  3CME P;  3B5N C;  3CWB D;  5BU5 A;  3RK2 D;  1L0L D;  4WY4 D;  4PV1 C;  3GTE A;  4TT3 H;  1HF9 A;  4WVZ A;  2NWF A;  4Y99 B;  1H0T A;  3M0A A;  1LTI C;  4ASW A;  3HE5 B;  3H1K E;  3RL0 D;  1FBM A;  4Z1M H;  4D6T J;  4C7R A;  3CCV P;  2K9J A;  1Q7Y Q;  1RH5 B;  3B8E B;  2FYU K;  1ZN5 A;  3H1J E;  3GF7 A;  3D6Z A;  1S4X A;  4U3F J;  1PGQ A;  3HD7 C;  2KS1 B;  2XRX A;  3H1H G;  3BCC E;  5APS A;  1ZRT D;  1NTK K;  4ZMD A;  4GOD A;  3A7O A;  2HMJ A;  1JM1 A;  1OWA A;  4AYC A;  2PFX A;  4H44 B;  5AVX B;  4BXL A;  2M5A A;  4HM5 A;  3H1I D;  1KB9 E;  1SQX G;  4H13 D;  4TLF A;  2QVA A;  2HPC A;  4UB8 E;  3IF4 A;  3BRT B;  2WZ7 A;  1N7S D;  3B4S A;  3P8C E;  2YVJ B;  4DJG A;  3AEA C;  3L71 J;  3AE6 C;  2GA1 A;  3HTK A;  1MUU A;  2AXC A;  3L74 D;  2ZYD A;  3HRN A;  2WT7 A;  4QUP A;  1VQL P;  1PPJ D;  1H0T B;  2OYH A;  2ZFC A;  2IFN A;  1GZL A;  1HWT C;  1R5S A;  4Y28 J;  3D6Y A;  3IFM A;  3MUD A;  5KTB A;  3B5N B;  2P1J A;  3VTP C;  1SQQ G;  3W68 A;  3L75 E;  2IBZ E;  4H0L C;  1SQV G;  2A06 G;  2LKM A;  2K9J B;  1KYO H;  1LTG C;  1RQV A;  3H1L G;  1IO4 A;  4YPC A;  5KKZ C;  2NUM A;  2IFM A;  1HVV A;  2POH A;  1NAY A;  3GF3 A;  1TU3 F;  3SSU A;  2KZJ A;  2JEE A;  1M1K Q;  3Q3D A;  3OA7 A;  2KZI A;  2ZXE B;  1FZC C;  2RKL A;  1VL2 A;  5DJT B;  2M5A B;  1UIX A;  4NB9 D;  4OH8 B;  1YJN P;  1KB9 I;  2HPC B;  3HD7 B;  1GW3 A;  1NGM B;  3MIW A;  3CLQ A;  2FYU D;  3L36 A;  2C0X A;  1FZC A;  3USS A;  3VOP A;  3HTK B;  4BWN A;  2GBX A;  4L74 A;  1BE3 J;  1NTZ E;  3A5T A;  3CCE P;  2AXT H;  3R4Y A;  4HKZ H;  1QX8 A;  2BMO A;  2JWD A;  2HFE D;  2B24 A;  2HMM A;  2KLU A;  2KXP B;  1VQ8 P;  1HGZ A;  1AFO A;  2YMY A;  2C9N Y;  1AQ5 A;  2W6J H;  3L72 E;  3W67 A;  2WPS A;  1FS0 E;  2E5T A;  4NBC D;  3L73 E;  2IBZ I;  2N1T C;  5APY A;  1DD3 A;  2N9Y B;  1P84 E;  4PD4 E;  4W80 A;  2OYI A;  1KQS O;  3PLN A;  2AEJ A;  1NWQ A;  1LTA C;  1NTM K;  2P2U A;  5TJH A;  4OWF A;  1NYK A;  3Q5S A;  1SQP E;  4YTP C;  3VMG D;  3KHU A;  1FJK A;  4H0L B;  1IJD B;  2AEM A;  5M1B A;  3L70 G;  2O3J A;  3V2N A;  4U7J A;  1NH4 A;  2HML A;  1BGY D;  3L71 G;  2GUS A;  3PRJ A;  5KKZ B;  2CKF A;  5APT A;  1SQB J;  1L4A D;  5GTI H;  2LXC B;  1KIL E;  2KLV A;  1X0T A;  3A0H H;  5CMZ A;  1L0N E;  1KQG B;  1KIL C;  1Q90 C;  3GLM A;  4EYY Q;  3VMY A;  1NKZ B;  2FXM A;  1FZC B;  1LWU A;  2KP8 A;  2H43 A;  1MFZ A;  1RE3 C;  3V4W A;  1ZW0 A;  2E42 A;  2FFD C;  1OX3 A;  1AJY A;  3H1K G;  4I6M C;  1LGH B;  1NTZ J;  2L91 A;  1L4A A;  1FDO A;  1R8E A;  4BRY A;  4JBZ A;  4LGD E;  5EFW B;  1USD A;  4NBG D;  1PIX A;  5TIS H;  2FYU J;  2CPB A;  3N7N A;  1BCC E;  2FFD A;  4R4L A;  3H1J G;  1SQX D;  4PD4 I;  4ZNC A;  1Y9B A;  2BCC E;  1KQF B;  1SS1 A;  2ZXX A;  3M9B A;  3CPW O;  2QJY C;  1EXJ A;  2P7J A;  3BCC G;  1NTK J;  2M3E A;  1PL5 A;  2AEF A;  3CXH E;  1AVO A;  2N1T B;  1IFN A;  1FOS E;  4ZKP A;  1FDI A;  4HM6 A;  4HM2 A;  3CCQ P;  3KZI E;  2NUK A;  2HLO A;  3I56 P;  1KV4 A;  1DIP A;  1VQK P;  1CI6 A;  4RO0 A;  2G8Y A;  2WSS H;  1T2K C;  1EC5 A;  1SQV D;  5CCG D;  2A06 D;  4HJL A;  4IFF A;  5E79 E;  3GW6 A;  2HOD A;  5K5G B;  2CPS A;  3PHL A;  1MZ9 A;  1EG9 A;  1GDT A;  1L0L K;  1KIL B;  3GB4 A;  2E75 B;  3L75 G;  2IBZ G;  2NRG A;  1KN7 A;  3K5B A;  1NU1 E;  1OXZ A;  3M06 A;  5KLV E;  3BAT A;  3I55 P;  3U1C A;  4QMA A;  2FXP A;  2FFD B;  4R4M A;  2RMZ A;  1EZV D;  1QLE D;  2C9L Y;  5CXM A;  5CCG A;  1VF5 C;  2MKV A;  1QGK B;  1O7N A;  2K37 A;  2XU6 A;  5L8R J;  3LID A;  5CCH C;  2YO3 A;  4AQR D;  4HH2 A;  3AE9 C;  1VQ4 P;  2WTY A;  1PZQ A;  1HTL C;  1ULI A;  3D89 A;  3EQ2 A;  5CBN A;  3TDK A;  2E74 C;  4D6T E;  2I7F A;  2QJY B;  3WUU A;  5CCH A;  1Q86 Q;  3HUS C;  3S1K A;  1CI6 B;  3C8V A;  3C9I A;  2Z4E A;  4H44 D;  1GL2 C;  1IFM A;  1NTZ G;  2WQY C;  4U3F E;  3GG2 A;  1GU5 A;  2IPP A;  1PP9 D;  3L37 A;  2HOD B;  4N6J A;  1W2B O;  4L75 A;  3FGA D;  2NZ2 A;  2QPZ A;  2KS1 A;  3L70 D;  3A0B H;  3CCM P;  2P58 A;  1FAV A;  1OVV A;  3VP8 A;  1YIJ P;  1ZOY C;  1NTM J;  2G3A A;  4AUW A;  3FWL A;  4DCK A;  1WQL A;  4C7N B;  4N78 D;  1SQP G;  1NU1 J;  3B5N D;  1GMJ A;  4NBA D;  2XR8 A;  3JCU H;  2Y0C A;  3EFG A;  3EWK A;  2QIW A;  1Q82 Q;  1FZG A;  3G4S P;  1RHZ B;  3RGU A;  2Y9Y A;  1J1D C;  3RK3 B;  1G1J A;  4GDO A;  2OYO A;  3MZW B;  4A7P A;  4ZKU A;  5H2F E;  1KYO E;  3H1K D;  4YXD C;  1L0N G;  1J2J B;  2WPV B;  3V6I A;  1ZR2 A;  3B5N A;  5AW8 B;  2D2C B;  3GMA A;  2WPQ A;  2WIT A;  3AZC A;  3CCL P;  1LP1 B;  4EI2 A;  1K04 A;  3HE4 A;  4WY4 C;  3H1J D;  3HD7 D;  2LXB A;  4O9B A;  2B9B A;  3SFD C;  5AVY B;  4L76 A;  3BCC D;  3F5H A;  2SPZ A;  3GHG C;  3AE5 C;  1GL2 B;  1H88 A;  3RL0 C;  3TSI A;  2NVF A;  1BCC G;  1YJW P;  1KB9 D;  2JWA A;  3ZDM A;  2XSO A;  2BCC G;  4K3A A;  2NPS C;  3G3Z A;  3PTZ A;  1O7W A;  3HD7 A;  2A45 G;  1BE3 E;  1M1J C;  2QG4 A;  2FXO A;  3N4X A;  1ZRT E;  2H89 C;  2OGU A;  1RFS A;  5B66 H;  3CC2 P;  2IZ0 A;  2KI7 B;  3KPE A;  4PJ0 E;  3RL0 g;  2NPS A;  3H1I E;  2DE5 D;  2ZVO B;  4H0L D;  1GD2 E;  3WMM 0;  4GKG A;  4DOJ A;  2YFL A;  4H13 C;  3BAS A;  4AIV A;  2IBZ D;  1W2E A;  1Q81 Q;  2W6B A;  4WWI A;  3CI9 A;  3VMZ A;  2ZT9 C;  3ABV C;  2QA4 P;  5KAF H;  4PV1 B;  3TGU J;  1J1D B;  1FZB A;  3LW5 H;  2XKM A;  3HE4 B;  4P1C H;  1QEX A;  3CD6 P;  3VP9 A;  3CWB J;  2BAS A;  1L0L J;  1LTB C;  4GOF A;  2Y0E A;  3FOU A;  1N7L A;  1DX7 A;  2IYP A;  1NU1 G;  1S2E A;  1SQB E;  1WT6 A;  5KLV G;  1BSN A;  1H89 A;  4JF7 A;  1FC2 C;  3NMD A;  3GCE A;  1M7L A;  5AW2 B;  1KC8 Q;  4HYT B;  2IZ1 A;  2HR3 A;  1GK6 A;  3GHG B;  2Q6Q A;  4I2L C;  3P32 A;  2KIK A;  1E79 H;  2BMR A;  3E1I A;  1RIE A;  1JUN A;  2J5U A;  1SQX K;  1FOS F;  1GK4 A;  3KXD A;  2E76 C;  3MTU E;  2P10 A;  2XSH A;  3I5C A;  2NPS B;  5TIS E;  3B71 A;  4D6T G;  1JOC A;  1PGJ A;  2JJL A;  2QE7 H;  1OVU A;  3WU2 E;  2JR8 A;  1M1J B;  1HUC A;  2N1T D;  2FYU E;  3L72 D;  5KAI E;  3H1I J;  4QCK A;  3CCJ P;  1DD4 A;  1N73 C;  1KB9 H;  1N86 A;  3L73 D;  1CZQ A;  3SWK A;  1Y8A A;  4U3F G;  1P84 D;  4PD4 D;  5C39 A;  4UB8 H;  1SLQ A;  1ZXG A;  3JC2 2;  1NTK E;  2QRX A;  1FJP A;  1VM9 A;  4NBH D;  1SQQ K;  1SQP D;  1OVR A;  3L74 J;  1SQV K;  4RJT A;  1VQ5 P;  2HYN A;  2ZT9 B;  1DH3 A;  3GZX A;  3Q5R A;  5B5E H;  2I1K A;  4KJM A;  1VQM P;  1NVO A;  1YIT P;  1JCD A;  3T97 B;  1AV1 A;  2YFI A;  2N1T A;  1JEK A;  1LTJ C;  1KIL D;  1Q90 D;  2E75 D;  2O1J A;  1PFI A;  1NJI Q;  4W7Z A;  2MJZ A;  2YIU C;  4KHX A;  1A02 J;  3M0D C;  1GU4 A;  1PGO A;  4DT0 A;  1T3J A;  2XZR A;  3O6Q A;  5KJ7 C;  2M3B A;  1BGY E;  2H88 C;  3G6E P;  4GOE A;  1VDF A;  2NVG A;  3BRV B;  2ZJS E;  2B87 A;  1SFC C;  1KIL A;  1ZP0 C;  1T8Z A;  3A3Y B;  2OTL P;  1EDI A;  3CWB G;  1HGV A;  3H1H D;  1S9K E;  5BOK A;  2R32 A;  2E76 B;  4I7Z C;  1DEB A;  1FZA A;  4IL6 H;  1XTG B;  1BCC D;  3MD0 A;  4W7Y A;  5APW A;  2Y9Z A;  2FYZ A;  2B1X A;  1EQ7 A;  1MV8 A;  1UII A;  5AEW A;  2RN0 A;  1RE3 A;  1JTH B;  2QSI A;  3CMA P;  1IFP A;  2BCC D;  4LC1 A;  2K3R A;  1P84 I;  1JMM A;  1YI2 P;  2KSE A;  3AE7 C;  4HM4 A;  4NBE D;  4JYC A;  1VQ9 P;  1IC2 A;  1N73 B;  3NFQ A;  1QVF O;  3QWO C;  3AE4 C;  2YMK A;  1YHQ P;  1IZN B;  4EIJ A;  4QDD A;  4QUQ A;  2XDJ A;  3VYI A;  2O01 H;  2DW3 A;  2W27 A;  3GZY A;  1NOH A;  1T2K D;  3G9R A;  2K9Y A;  1U57 A;  2OQQ A;  1BE3 G;  1S5L H;  1VQO P;  1O7P A;  3RBZ A;  2WSE H;  2I1J A;  1P84 H;  4PD4 H;  2YO2 A;  3II6 A;  1SQQ D;  5APX A;  5APQ A;  3TNU B;  1O7G A;  2KUB A;  1T3U A;  3O6Q B;  4XE5 B;  3H1I G;  3S4R A;  4YXW H;  3FX0 A;  3FXE A;  3H1L D;  2QM8 A;  1O7H A;  2ZYA A;  3CX5 E;  1OW6 A;  2CK3 H;  3FWN A;  3IR9 A;  1BGY J;  3VCP A;  2B87 B;  1RE4 C;  2YIU B;  5GTH H;  2V7Q H;  2QJK C;  3WUV A;  1NTM E;  3L4F A;  3RK3 D;  4OGQ C;  5KLV D;  1AA0 A;  1VF5 D;  1OW8 A;  2B89 A;  3MGN A;  2W6A A;  2WSC H;  2R5D A;  4GIF A;  5AW7 B;  5CCH D;  1YYC A;  4C7N A;  1AQT A;  1SFC B;  2D2C D;  2KB7 P;  1K9M Q;  2B88 A;  3VCA A;  4OVN F;  1G8J B;  3U1A A;  1SQB G;  3V5B A;  1LT1 A;  1X9V A;  2IYO A;  2WVR A;  1LNQ A;  2A45 I;  3CCR P;  3M91 A;  1URQ C;  3LIE A;  2R3C A;  3CXH I;  5BVZ A;  3L35 A;  4NPE A;  4NBF D;  2BEZ F;  5AVR B;  5APV A;  4D6T D;  1G2C A;  2I8D A;  2LR2 A;  5DJU B;  1GL2 D;  2WSF H;  3D70 A;  3N0Q A;  3G71 P;  1OW7 A;  1LT9 C;  1SQX J;  1PGP A;  1FU1 A;  4L73 A;  1VQ6 P;  4U3F D;  3Q5P A; 
#chains in the Genus database with same CATH homology
 4QDF A;  1NTZ E;  1EZV E;  3GB4 A;  4NB8 D;  1O7G A;  2XSO A;  2YIU C;  5KLI C;  2BMO A;  4QUP A;  3GOB A;  1SQX E;  2B24 A;  2HMM A;  1O7W A;  1VCK A;  1NU1 E;  3DQY A;  3GTE A;  5KLV E;  2BMR A;  3GL0 A;  1O7H A;  1WQL A;  3CX5 E;  1BGY E;  1RIE A;  2NWF A;  1BE3 E;  4NBG D;  5CXM A;  4NBA D;  3L72 E;  1ZRT E;  3VCP A;  2NVG A;  1BCC E;  2XSH A;  4QUR A;  2QJK C;  1RFS A;  1O7N A;  4NBC D;  4NBD D;  3L73 E;  2XR8 A;  1NTM E;  3L75 E;  2IBZ E;  3H1K E;  1P84 E;  4PD4 E;  2E4P A;  2E76 D;  2BCC E;  1VF5 D;  2GBW A;  3H1I E;  1PP9 E;  1SJG A;  2DE5 D;  2QJY C;  5BOK A;  2FYU E;  4H0L D;  5HL4 A;  1NYK A;  3GTS A;  2DE7 D;  4OGQ D;  4QCK A;  1SQP E;  4HM3 A;  4HM7 A;  5KKZ C;  2B1X A;  2NUM A;  3CXH E;  2Q3W A;  2YFL A;  3VMG D;  2JZA A;  5AEW A;  1KYO E;  4AIV A;  4PV1 D;  1ULI A;  3D89 A;  2D2C D;  1UUV A;  2FYN C;  3H1J E;  1O7M A;  4HM6 A;  3GL2 A;  1SQQ E;  2JO6 A;  3VCA A;  1G8J B;  1ULJ A;  4D6T E;  2I7F A;  1VM9 A;  1NTK E;  1SQV E;  4NBH D;  2HML A;  4HM4 A;  4NBE D;  4HM2 A;  4HM8 A;  2A06 E;  4P1C H;  4AAY B;  2NUK A;  2XRX A;  2CKF A;  3AZC A;  2ZT9 D;  3EN1 A;  3BCC E;  2YFJ A;  3H1L E;  4H44 D;  1NDO A;  3GKE A;  4EMJ B;  4HM0 A;  1FQT A;  2HMJ A;  2NVE A;  1JM1 A;  4NBF D;  2HMK A;  2HMN A;  3GZX A;  4NB9 D;  4QDD A;  2BMQ A;  4U3F E;  4QDC A;  1L0N E;  4QUQ A;  3TGU E;  3L70 E;  2YFI A;  3FOU A;  2ZYL A;  1Q90 C;  4HM5 A;  1KB9 E;  4P1B H;  2QJP C;  2DE6 D;  4NBB D;  3VMH D;  3L74 E;  3GZY A;  1SQB E;  3N0Q A;  4H13 D;  3C0D A;  4HJL A;  5AEU A;  2E4Q A;  3L71 E;  3VMI D;  3CWB E;  1L0L E;  1PPJ E;  2HMO A;  1UUW A;  3EQQ A;  3H1H E;  1O7P A;  4HM1 A;  4QDF B;  2YVJ B;  2E74 D;  2GBX A;  2E75 D;  4HKV A;  2QPZ A;  3GCE A;  1EG9 A;  1G8K B;  2NVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...