4U3FE

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 39
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4u3fE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4u3fE02
4P1BH 2NWFA 2IBZE 2CKFA 3GOBA 1VM9A 2E76D 3EQQA 4NBHD 4AAYB 1SQBE 4NBGD 4QCKA 1NDOA 1EG9A 4NBDD 3VCAA 4NB8D 1EZVE 1UUVA 2NVFA 4HM6A 3GCEA 3L74E 4U3FE 2QJKC 2QJPC 2ZYLA 2HMNA 4OGQD 4HM1A 5AEWA 3GL0A 4QDCA 4HM0A 4EMJB 2I7FA 4QDDA 2GBXA 4HM3A 4HM5A 2FYUE 3GZXA 4H0LD 2FYNC 2NVEA 1RFSA 4NBAD 3H1IE 4D6TE 3GB4A 3C0DA 1KB9E 3GTSA 4H44D 2XRXA 4QURA 4HJLA 1NYKA 4HM8A 2YFJA 3D89A 3H1JE 4NBFD 3L72E 1SQPE 2BMOA 4HKVA 5CXMA 2BCCE 4PV1D 4QUPA 2DE7D 1WQLA 5KLVE 4H13D 3BCCE 2D2CD 1BCCE 2B1XA 3DQYA 2ZT9D 4NBED 4QUQA 2YVJB 1NU1E 2YIUC 2B24A 4AIVA 2DE6D 2HMLA 3L71E 1ULJA 2XSOA 2XR8A 5AEUA 3VCPA 1L0LE 1FQTA 3VMID 3CWBE 1ZRTE 4QDFA 1PPJE 1ULIA 1BE3E 4NBCD 3L73E 2Q3WA 2E75D 2XSHA 5KLIC 3GTEA 1G8JB 2QPZA 4PD4E 3CX5E 1G8KB 1O7PA 1O7MA 2YFIA 3GKEA 1PP9E 1O7GA 1SQVE 1JM1A 2HMJA 1O7HA 2E74D 2JO6A 1BGYE 1RIEA 3H1HE 3EN1A 2DE5D 2HMMA 2NUMA 4P1CH 3VMGD 1Q90C 2A06E 2NUKA 4NBBD 5HL4A 1NTZE 1NTME 1KYOE 2E4QA 1NTKE 4HM7A 4NB9D 2E4PA 5BOKA 3N0QA 2QJYC 3AZCA 3GZYA 1SQXE 3TGUE 1VF5D 1SJGA 2JZAA 2NVGA 3CXHE 3L75E 5KKZC 4HM2A 3H1KE 1UUWA 3FOUA 4QDFB 1VCKA 2BMRA 1P84E 3L70E 1L0NE 2YFLA 3GL2A 3VMHD 2BMQA 2GBWA 4HM4A 2HMKA 2HMOA 1O7NA 1O7WA 3H1LE 1SQQE
chains in the Genus database with same CATH superfamily
2NZ2A 2E76D 3RK2C 2CK3H 1SQBE 4NBDD 1L4AA 1UUVA 2Q9IA 2L91A 2DW3A 2HLOA 2WZ7A 3H1LJ 3T97B 1HUCA 1JY3O 3RK2D 4JYCA 4U3FG 3Q1MA 3IR9A 1FDIA 2GA1A 2AXTH 3D6YA 2WPVB 4Y99B 3H1JE 1A02F 4HKVA 1L0LD 3AEBC 4QUPA 2H8PD 5H2FE 4ZMDA 3SWFA 2O01J 1LTGC 4UB6H 3F5HA 1ZW0A 3GHGC 1DIPA 3L4FA 3VMID 1FJPA 3M9QA 1GMJA 4W7YA 2KYVA 3CLQA 3AEFC 4ASVA 2QM8A 2CPBA 2ZT9B 3PP5A 4I6MC 3N4XA 1VQ4P 2IYOA 5KJ7A 3GLMA 3PRJA 1NJIQ 3N0QA 1RE4C 1MV8A 3H1HG 2JZAA 2K9JB 1NU1K 2A06G 2PFXA 2PRRA 1OZHA 1RF1A 2HMKA 1LP1A 1BSHA 3FXDA 1H88A 3P32A 5APXA 1KILB 1RHZB 4OVNF 1BSNA 1JTHB 4PJ0E 1NU1D 1SQXJ 1OWAA 4IL6H 2OTJP 2E42A 1ZXGA 1P84I 3A7OA 1XTCC 1NTKK 4D6TG 1QL2A 1SQBK 3IFMA 3SSUA 3A2AA 4AUWA 2JR8A 1KQFB 2FY8A 2HPCA 1KTMA 1UIXA 4R4MA 3AE2C 2VRSA 3D89A 1SQPE 4N6JA 2RKLA 1PPJG 4IFFA 2WSFH 3QH9A 4KT0J 1KC8Q 3GMAA 5AEUA 5KAIH 5AW7B 1LWUB 2KI7B 2QJYB 2B89A 1BE3E 5AVXB 3S9OA 4NBCD 1BGYG 1URQD 2BASA 1FC2C 2QJPB 1G8KB 3GKEA 4WVZA 1S5LE 2OGUA 3M9BA 3RBZA 4H13B 3KHUA 3CC4P 2K9JA 3AE4C 2E4QA 1NWQA 2RH0A 4HJGH 1N7SC 1VF5D 5BU8B 1G1IA 1CI6A 1NTZG 1T6AA 1P84E 2WVRA 1IJDB 1KILA 1JTHA 2W6AA 1IK7A 3MTUE 3HTKA 1N7SD 5KLIB 1K05A 1GW3A 3L75J 1EDJA 1K9MQ 1HF9A 1JY2N 2HMNA 4OGQD 2A45I 2ZAEB 3HUSA 4C7NB 2Y9YA 1K73Q 4ASWA 3CD6P 2FFDB 3RK3B 3PTZA 4D6TE 1SVFA 3NFQA 3IAOA 1LT9B 4XE5B 1EQ7A 2QG4A 1KN7A 1KV4A 3SFEC 3BCCE 1NOHA 1HWTC 4QUQA 4A7PA 3L70D 3GG2A 1PIXA 3CWBE 4N78E 3AE6C 1PPJE 1ULIA 2XV5A 1YQ4C 2XU6A 4EOTA 3UIAA 5CBOA 4IOIH 5CCGC 1FZAA 1O7PA 1W2EA 2FYUK 2Q3IA 1KORA 4PV1B 2OARA 1PGOA 2K9YA 1M8OB 2JO6A 1BGYE 4GKGA 1NU1J 1EZVD 2NUKA 1LJ2A 2PAJA 1PP9G 2WMMA 2G3AA 5KLVK 2LKMA 2FYUD 1U7JA 3A0BE 1SQQG 1M56D 2QJKB 1ZP0C 3WMM0 3S4RA 5H2FH 3USSA 2IDBA 5KLVD 1X0TA 1NTKJ 1T3UA 1SQBJ 3KDPB 3G71P 4NBGD 3CXHI 1EG9A 1VQPP 1IO4A 3L74E 1FE6A 3B8EB 1HBWA 1KILE 5AEWA 2FFDA 1JY3N 1YTZI 4WY4C 4GT1A 3GZXA 1LT9A 2WSEJ 3EFFK 3H1JJ 4H44D 1GZLA 1FZGA 3R4YA 2ZJSE 1Y47A 1PL5A 3RL0D 3WUVA 4WY4D 1RQVA 1YYCA 5CJ4A 4AIVA 2DE6D 2KSJA 2CPSA 3VCPA 1L2PA 4PJ0H 3H32B 1BCCG 1BDCA 1VDFA 3GTEA 3GHGA 5EFWB 4Y99C 1Z56A 3LW5H 4JYBA 2P1JA 1ZR4A 2DE5D 3EFGA 4NPEA 1OVUA 1N73B 3CXHE 2HODB 1D7MA 1X9VA 1GDTA 2M3BA 2E74B 2NPSB 1FZCB 1GL2B 2Q3WA 2IZ0A 1SQQE 5B5EE 4P1BH 1FAVA 1CZQA 1L0NG 1IK9A 1IFJA 2FKWB 1JB0J 2JDIH 1NTZK 1S5LH 3KYQA 2KS1A 1AV1A 1QEXA 2LXBA 4M3LA 2NRGA 1IFNA 4HM5A 3VMAA 4DOJA 4MN4C 1Q2NA 1VQKP 2WITA 2Y0DA 4HJLA 1IFIA 3JCUE 3L71G 4PD4H 4U3FJ 1SFCD 2Q6QA 2Z4EA 3L73G 3RK3E 1L4AB 1HJBA 1RE3C 3P8CD 1URQA 2FYUJ 1T2KD 1L0LE 1Q86Q 3CCJP 5AVQB 2QIWA 2FXMA 5KLVJ 2YKOA 1JM1A 2D2CB 2H7HA 2M5AA 3BRVB 1GTWA 3CCSP 3AEEC 3M0AA 2OYHA 2YKPA 1GW4A 2HODA 1JEKA 1LWUC 2QJYC 2E75B 3GZYA 1NGMB 3FOUA 4B86A 4YTPC 1NYHA 2KIKA 1N7SA 3U59A 3H1HJ 5AW6B 4HM4A 4H13C 5AVSB 1O7WA 3AE9C 2H89C 1SS1A 2KZJA 1YJWP 4HB1A 3EQQA 4QCKA 1OW6A 2WQYC 1SP4A 1KB9D 4CPGA 2YXQB 4QDDA 1HTLC 1FOSE 1HJ0A 3L72G 2FYNC 4D6TJ 1RF1B 1LP1B 2OQQA 1MFZA 1NYKA 3A0BH 3MP7B 4W80A 2W27A 4EDFA 2O3JA 3CCRP 2A45H 2N1TC 2YVJB 3CX5D 1YBKA 1LTJC 3TNUA 3OW2O 1JUNA 3L71E 1IC2A 1SQPG 5CHXA 2RMZA 1ZRTE 5APWA 1SQVG 5TISE 3L73E 2YO2A 3G4SP 2QPZA 1S5LX 3AEDC 5L8RJ 3AECC 4U7JA 2HPCB 1S4XA 1S9KE 1QGKB 1PZQA 2N1TD 1IFPA 1BE3G 2Z5HA 1S1CX 3EN1A 3L75D 1K8AQ 1Q90C 2J59M 1Q82Q 3SFDC 5BOKA 2AXCA 2B87A 3AZCA 2I1KA 5KKZC 2QM7A 2IPPA 2IBZD 4PV1C 3GL2A 1Q90D 2J5UA 2BMQA 3JSVC 1JOCA 1NTZJ 3AEGC 1VPCA 1N8RQ 1NH4A 3IF4A 4NB8D 2Y9ZA 1RQUA 3NTNA 3V2RA 2QJKC 3ITKA 3Q5SA 4HM0A 1VL2A 3S1KA 4YXWH 2P10A 5AVWB 1CI6B 2BCCG 4IFMA 1M1JB 3V6IA 3Q2YA 2R3SA 1L0NK 3FX0A 3M9HA 3E1RA 2K1AA 3A5TA 3CXHH 3L72E 1J1EB 3N7NA 3HTKB 4LGDE 3FWNA 3MUDC 4DT0A 4I7ZB 3TGUD 3JC22 2KOGA 2KSEA 3H25A 1OX3A 2R44A 4RESB 1FQTA 2Y0CA 3EQ2A 3KZIE 2FYZA 2J58A 1KD1Q 3BCCG 3HUSB 1AVYA 3E7KA 1NTMG 3I5CA 1NTKD 4XA4A 1LNQA 4R4LA 1SQBD 3CWBG 1SQVE 1WMKA 1O7HA 3VMGD 3B5NC 2P2UA 3IN6A 5K5GB 3M0DA 4L76A 3H1KG 2ZXEB 3G9RA 3VN0A 1DH3A 3ABVC 3D6ZA 2E5YA 5DJTB 1AFOA 2WPRA 4WB4A 2NVGA 2IFMA 3H1LG 4DJGA 3JCUH 3AE5C 2AEMA 1PP9J 3VMYA 2BMRA 3E1IA 3B5ND 1KQGB 2YIUB 3VMHD 2GBWA 1HVVA 3TDKA 2HMOA 3H1JD 1S2EA 3I56P 1DEEG 3V2QA 3HD7B 5GTIE 3B4SA 1RF0C 4BXLA 2OYIB 1EDKA 2WWWA 2A45G 1N73C 1JO5A 4K3AA 2YMYA 3GCEA 5AVUB 1VQ8P 2KLUA 1QVFO 2WSFJ 2BEZF 1M1JA 2NPSC 1FZCC 1GL2C 1NAYA 3L74G 2E76B 1USDA 1SFCA 3PHLA 2R32A 1J1DB 1YI2P 2JJLA 2I1JA 2BCCE 1QL1A 4L74A 1JY2P 3RK2B 3PLNA 4TLFA 1AA0A 2AEFA 1FBMA 4GODA 1G8JB 4KJMA 2LXCB 3W67A 3TYYA 2POHA 1BCCJ 2KB7P 1SQXG 1NKNA 3VTPC 4NBBD 1NTME 1SQPK 2OYOA 3I55P 2ZVOB 4IL6X 2LR2A 1JM0A 4OWFA 2ZYDA 3H1KE 4KHXA 1T8ZA 2W90A 2ZXXA 4HKZH 3HD7A 3D70A 3GHGB 2D2CC 2OYIA 3H1LE 2GUSA 1KYOI 1YQ3C 4U3FD 2NWFA 5AVTB 1M1KQ 1X8YA 3O6QB 4H0LC 2AEJA 4WWIA 3TGUJ 1H89A 5CCGD 4RKUJ 1LTSC 1WT6A 1VQOP 5AVZB 1L0NJ 4AYCA 3CMEP 4QMAA 3H1IG 2YNYA 3BASA 4QDCA 2I7FA 3C8VA 1KQSO 4H0LD 5CCHC 4QURA 1OXZA 2C0XA 1OW8A 5CXMA 5KJ7C 3FGAD 3VP8A 3B71A 1FZFA 1VQ7P 2B1XA 1FDOA 1OMIA 3L71J 4PD4D 2B24A 1EXIA 5CCHD 3W68A 4QDFA 2KS1B 1PV3A 2E5TA 1KB9I 3VYIA 1JY3P 2N1TA 3H1HD 1RF1C 2XSHA 1LTJA 2A06D 1JCCA 4OH8B 1L0LG 3RBXA 1H0TB 1VQNP 1TU3F 1YJ9P 3F89A 2KLVA 1KYOE 2WSSH 3CPWO 3ZDMA 2N9YB 1URQB 3CC2P 2MKVA 1SQXE 3CX5I 3CC7P 4D6TD 3MGNA 1OW7A 2ZFCA 3O6QA 5BU5A 1R5LA 3PJSK 3C1LA 4LC1A 2H43A 5KTBA 3CCVP 2M5AB 2G8YA 1HGZA 1NDOA 1U57A 2W6JH 1VF5B 2OYHB 4BRYB 1M90Q 2M8RA 3CWBD 4N78D 1PPJD 2V7QH 1ZLLA 1N7LA 2GUVA 1RE4A 2ZYLA 3HE5A 3PH0A 1PGQA 1LTBC 2IBZI 2ZT9C 5C39A 1R5SA 1N7SB 1BGYD 3H1IE 4XFJA 3GB4A 3C0DA 1KB9E 2WPQA 1NU1G 3L72J 1GU4A 5AW5B 4NBFD 1S3JA 3LW5J 4OGQB 3CCMP 1U7MA 2V4HA 2ZT9D 4NBED 1QX8A 1M7LA 4HYTB 2O1JA 2OTKE 2XSOA 5GTIH 2KZIA 1KILC 3AE7C 1FJKA 1SQPJ 1NTZD 3CX5E 1H0TA 2YFIA 1PGJA 5AW8B 1LTTC 3TSIA 1X22A 4JQ0D 1YTZT 1P84H 2JP3A 3GF7A 5AW3B 1MUUA 4I7ZC 5B66E 5M1BA 2GM4A 1JNMA 1BE3J 1KILD 2ZVNB 3TNUB 1LT1A 2FBWC 3II6A 3L75E 2KP8A 4JF7A 3A0HE 2WPSA 5KAFE 1LTIC 4BRYA 1GU5A 4UB8E 1ZOYC 2IBZE 2B88A 2ITAA 1JMBA 3L37A 3GOBA 2PGDA 3WU2E 4AAYB 4ZKUA 5CJ0A 1LGHB 2P58A 2RN0A 1Q81Q 2QJPC 2B87B 1QVGO 3OJAB 1W5CE 2QEXP 3M06A 1RFSA 2XNDH 1MZ9A 3GF3A 1RY3A 2XRXA 3RL0g 3NXSA 4ZNCA 2Z5IA 1SQQK 4H13D 3VMZA 3DQYA 3TK1A 1NU1E 3K5BA 2WT7B 4EYYQ 1Q7YQ 4GOEA 1PP9D 3G6EP 2KNCA 5APUA 1IZNB 1SQQD 5KLIC 4H44B 2QVAA 4RJTA 3V2PA 3BCCJ 1O7GA 3RL0B 2HMJA 1G2CA 1WRGA 3FWLA 4WY4B 2NUMA 3CWBJ 1NTKE 3L70G 4L73A 1AJYA 1OVRA 1GK6A 1GD2E 2O01N 2Q5UA 2FFDC 1EDIA 3RK3C 3H1KJ 5AVVB 1LT9C 4NPFX 1L0LK 5APSA 1BGYJ 1HGVA 3SWYA 2YXRB 4N3YB 5CCGA 3MZWB 1EZVG 1Y9BA 5GTHE 1VM9A 1NHLA 2N9BA 3RK3D 1EXJA 2OTLP 1JCDA 2FYUG 2IZ1A 3O8ZA 3OAKA 2ZYAA 3H6PA 1X79B 2GBXA 1IFDA 4HM3A 1KYOH 2NVEA 3MD0A 5KLVG 1KFNA 1BCCD 1OIPA 3SWKA 1VQLP 1EZVI 4HM8A 3CCQP 2YFJA 3L74J 1NAFA 4PV1D 5CCHA 1WQLA 2WT7A 2B9BA 1VQMP 1KQLA 5E79E 1M57D 3L36A 1UIIA 1ULJA 2XR8A 3OA7A 4TT3H 1NVOA 2KK7A 3HE4A 1ZR2A 5TJHA 3WUTA 4WY4A 4C7RA 1FZEA 1SFCB 1Y8AA 3KXDA 5B5EH 1HH0A 1L0ND 4HM7A 1KB9H 3P8MC 4PD4I 1SJGA 3T97A 1NO4A 3L70E 2FXOA 3Q5PA 4JBZA 2K88A 3BVHA 1CSBA 2K3RA 1FU1A 4GDOA 2JKVA 3QWOC 3L71D 3VOPA 1URQC 2XNXA 1EZVE 3CX5H 2JO1A 1FS0E 1ZRTD 2UWJE 5APYA 2JEEA 4U3FE 2M3EA 3L73D 4Y28J 3MIWA 3CMAP 3GL0A 5B66H 1SQQJ 3WUUA 2FYUE 1S9KD 1J2JB 1KZUB 3H1IJ 3G3ZA 1W2BO 5APVA 1YJNP 1N86A 2XKMA 2WSCH 1VF5C 2OYHC 3AEAC 5KLVE 3R2PA 3A0HH 2HFED 2E74C 3Q3DA 1AQ5A 5KAFH 4UB8H 4I2LC 2WTYA 2H88C 3WU2H 3U1CA 1MKMA 3AE3C 2PP6A 1DEBA 4PD4E 1O7MA 1ZN5A 3M91A 2E74D 2NPSD 1KFMA 3H1HE 2HMMA 4OGQC 1GL2D 2FYNB 1FDMA 2A06E 2E43A 2KXPB 1L0LJ 3CCEP 1T3JA 1PFIA 2E4PA 4Z1MH 2P7JA 2Y0EA 1DX7A 2YKQA 1RE3A 2WSCJ 4BWNA 3CCLP 4HM2A 4QDFB 2N1TB 1LTJB 2R5DA 3L72D 3BRTB 1L4AC 1E5WA 4DCKA 2CKFA 2Q1KA 2ZYGA 3VMXA 1SQVK 3V4WA 1DD3A 2R5BA 1SLQA 2HYNA 1LWUA 1L4AD 2IFNA 1S72P 4JPZB 1SQPD 1YITP 1SQVD 3D71A 5KKZB 5TISH 3GTSA 5BVZA 3C9IA 2KUBA 2E75C 1VQ9P 1BE3D 5CBNA 2D2CD 2HMLA 5GTHH 1BDDA 3HE5B 1KMIZ 2E75D 2WSEH 3P7KA 2YMKA 3HRNA 2Q7CA 4EIJA 3AE1C 5CMZA 3V2NA 1ZMEC 1EDLA 3CCUP 3EWKA 4YXDC 4P1CH 5AW1B 3CI9A 1RH5B 5HL4A 1NTZE 5APQA 1P84D 1K04A 3KQGA 2IYPA 3L73J 2BEQD 2AXTE 2XDJA 5KJ7D 4H44C 1AVOA 3BATA 3P8CE 5AVYB 4C7NA 1VCKA 2YFLA 3KPEA 4W7ZA 1CW5A 1OVVA 1FOSF 4UB6E 4K35A 3RL0C 5E79H 2BCCD 3L75G 3V4QA 5AW0B 2JWAA 1G1JA 4NBHD 3VCAA 1AQTA 2QSIA 2NVFA 1FZBA 1IFMA 1NTMK 1QLED 2IBZG 3B5NB 1OFCX 3GW6A 1USEA 4HM1A 1GK4A 4NBAD 2SPZA 3BCCD 3KZIH 2HG5D 1NTMD 5DJUB 3LIDA 3M0DC 2BMOA 2QRXA 2DE7D 2C9LY 3L35A 3H1KD 2JWDA 3U1AA 3H1LD 4C46A 4IL6E 4WBAA 4GIFA 3MHVA 5AVRB 1PP9E 1EC5A 1VQ5P 2O1KA 2W8ZA 1RIEA 1NKZB 3TGUG 2K37A 2W83C 4RO0A 3MUDA 1XTGB 1M1JC 2M0BA 1N2DC 3TF5A 4AQRD 3L70J 1UUWA 2V7QJ 1SQVJ 2KNCB 4YPCA 1NTKG 3Q5RA 1J1EC 2P67A 1SQBG 1SFCC 1O7NA 1YHQP 2Q3EA 3L74D 3NMDA 5KAIE 1PGPA 1G2CB 1T2KC 3V5BA 3B5NA 2FXPA 4HM6A 3HUSC 1LTAC 2C0WA 1JMMA 4EMJB 3H32A 1JY2O 1SQXK 1YIJP 3H1JG 3CL3D 3FXEA 2HR3A 5AW4B 1KYOD 1R8EA 1H8AA 1RF0A 2R3CA 1SQXD 1BCCE 4HH2A 3AE8C 2YO3A 4O9BA 2YIUC 1N73A 2W6BA 4H0LB 1ZV8A 2C9NY 4GOFA 3HD7C 2L5GB 2NPSA 5APTA 2OYIC 1FZCA 1GL2A 2MJZA 1VQ6P 2BCCJ 4IFDK 4ZKPA 3LIEA 2IX7C 1MFTA 4EI2A 3CXHD 5AW2B 4DZOA 2XZRA 5AW9B 1E79H 3HD7D 4NB9D 1DD4A 4NPDA 4I1LA 2E76C 4LLHA 3TGUE 1J1DC 3H1ID 1A02J 3A3YB 3HE4B 1L0NE 2O01H 3VP9A 3RGUA 4L75A 2QE7H 2QA4P 1NTMJ 2I8DA
chains in the Genus database with same CATH topology
4P1BH 2NWFA 2IBZE 2CKFA 3GOBA 1VM9A 2E76D 3EQQA 4NBHD 4AAYB 1SQBE 4NBGD 4QCKA 1NDOA 1EG9A 4NBDD 3VCAA 4NB8D 1EZVE 1UUVA 2NVFA 4HM6A 3GCEA 3L74E 4U3FE 2QJKC 2QJPC 2ZYLA 2HMNA 4OGQD 4HM1A 5AEWA 3GL0A 4QDCA 4HM0A 4EMJB 2I7FA 4QDDA 2GBXA 4HM3A 4HM5A 2FYUE 3GZXA 4H0LD 2FYNC 2NVEA 1RFSA 4NBAD 3H1IE 4D6TE 3GB4A 3C0DA 1KB9E 3GTSA 4H44D 2XRXA 4QURA 4HJLA 1NYKA 4HM8A 2YFJA 3D89A 3H1JE 4NBFD 3L72E 1SQPE 2BMOA 4HKVA 5CXMA 2BCCE 4PV1D 4QUPA 2DE7D 1WQLA 5KLVE 4H13D 3BCCE 2D2CD 1BCCE 2B1XA 3DQYA 2ZT9D 4NBED 4QUQA 2YVJB 1NU1E 2YIUC 2B24A 4AIVA 2DE6D 2HMLA 3L71E 1ULJA 2XSOA 2XR8A 5AEUA 3VCPA 1L0LE 1FQTA 3VMID 3CWBE 1ZRTE 4QDFA 1PPJE 1ULIA 1BE3E 4NBCD 3L73E 2Q3WA 2E75D 2XSHA 5KLIC 3GTEA 1G8JB 2QPZA 4PD4E 3CX5E 1G8KB 1O7PA 1O7MA 2YFIA 3GKEA 1PP9E 1O7GA 1SQVE 1JM1A 2HMJA 1O7HA 2E74D 2JO6A 1BGYE 1RIEA 3H1HE 3EN1A 2DE5D 2HMMA 2NUMA 4P1CH 3VMGD 1Q90C 2A06E 2NUKA 4NBBD 5HL4A 1NTZE 1NTME 1KYOE 2E4QA 1NTKE 4HM7A 4NB9D 2E4PA 5BOKA 3N0QA 2QJYC 3AZCA 3GZYA 1SQXE 3TGUE 1VF5D 1SJGA 2JZAA 2NVGA 3CXHE 3L75E 5KKZC 4HM2A 3H1KE 1UUWA 3FOUA 4QDFB 1VCKA 2BMRA 1P84E 3L70E 1L0NE 2YFLA 3GL2A 3VMHD 2BMQA 2GBWA 4HM4A 2HMKA 2HMOA 1O7NA 1O7WA 3H1LE 1SQQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1B H;  2NWF A;  2IBZ E;  2CKF A;  3GOB A;  1VM9 A;  2E76 D;  3EQQ A;  4NBH D;  4AAY B;  1SQB E;  4NBG D;  4QCK A;  1NDO A;  1EG9 A;  4NBD D;  3VCA A;  4NB8 D;  1EZV E;  1UUV A;  2NVF A;  4HM6 A;  3GCE A;  3L74 E;  4U3F E;  2QJK C;  2QJP C;  2ZYL A;  2HMN A;  4OGQ D;  4HM1 A;  5AEW A;  3GL0 A;  4QDC A;  4HM0 A;  4EMJ B;  2I7F A;  4QDD A;  2GBX A;  4HM3 A;  4HM5 A;  2FYU E;  3GZX A;  4H0L D;  2FYN C;  2NVE A;  1RFS A;  4NBA D;  3H1I E;  4D6T E;  3GB4 A;  3C0D A;  1KB9 E;  3GTS A;  4H44 D;  2XRX A;  4QUR A;  4HJL A;  1NYK A;  4HM8 A;  2YFJ A;  3D89 A;  3H1J E;  4NBF D;  3L72 E;  1SQP E;  2BMO A;  4HKV A;  5CXM A;  2BCC E;  4PV1 D;  4QUP A;  2DE7 D;  1WQL A;  5KLV E;  4H13 D;  3BCC E;  2D2C D;  1BCC E;  2B1X A;  3DQY A;  2ZT9 D;  4NBE D;  4QUQ A;  2YVJ B;  1NU1 E;  2YIU C;  2B24 A;  4AIV A;  2DE6 D;  2HML A;  3L71 E;  1ULJ A;  2XSO A;  2XR8 A;  5AEU A;  3VCP A;  1L0L E;  1FQT A;  3VMI D;  3CWB E;  1ZRT E;  4QDF A;  1PPJ E;  1ULI A;  1BE3 E;  4NBC D;  3L73 E;  2Q3W A;  2E75 D;  2XSH A;  5KLI C;  3GTE A;  1G8J B;  2QPZ A;  4PD4 E;  3CX5 E;  1G8K B;  1O7P A;  1O7M A;  2YFI A;  3GKE A;  1PP9 E;  1O7G A;  1SQV E;  1JM1 A;  2HMJ A;  1O7H A;  2E74 D;  2JO6 A;  1BGY E;  1RIE A;  3H1H E;  3EN1 A;  2DE5 D;  2HMM A;  2NUM A;  4P1C H;  3VMG D;  1Q90 C;  2A06 E;  2NUK A;  4NBB D;  5HL4 A;  1NTZ E;  1NTM E;  1KYO E;  2E4Q A;  1NTK E;  4HM7 A;  4NB9 D;  2E4P A;  5BOK A;  3N0Q A;  2QJY C;  3AZC A;  3GZY A;  1SQX E;  3TGU E;  1VF5 D;  1SJG A;  2JZA A;  2NVG A;  3CXH E;  3L75 E;  5KKZ C;  4HM2 A;  3H1K E;  1UUW A;  3FOU A;  4QDF B;  1VCK A;  2BMR A;  1P84 E;  3L70 E;  1L0N E;  2YFL A;  3GL2 A;  3VMH D;  2BMQ A;  2GBW A;  4HM4 A;  2HMK A;  2HMO A;  1O7N A;  1O7W A;  3H1L E;  1SQQ E; 
#chains in the Genus database with same CATH topology
 2NZ2 A;  2E76 D;  3RK2 C;  2CK3 H;  1SQB E;  4NBD D;  1L4A A;  1UUV A;  2Q9I A;  2L91 A;  2DW3 A;  2HLO A;  2WZ7 A;  3H1L J;  3T97 B;  1HUC A;  1JY3 O;  3RK2 D;  4JYC A;  4U3F G;  3Q1M A;  3IR9 A;  1FDI A;  2GA1 A;  2AXT H;  3D6Y A;  2WPV B;  4Y99 B;  3H1J E;  1A02 F;  4HKV A;  1L0L D;  3AEB C;  4QUP A;  2H8P D;  5H2F E;  4ZMD A;  3SWF A;  2O01 J;  1LTG C;  4UB6 H;  3F5H A;  1ZW0 A;  3GHG C;  1DIP A;  3L4F A;  3VMI D;  1FJP A;  3M9Q A;  1GMJ A;  4W7Y A;  2KYV A;  3CLQ A;  3AEF C;  4ASV A;  2QM8 A;  2CPB A;  2ZT9 B;  3PP5 A;  4I6M C;  3N4X A;  1VQ4 P;  2IYO A;  5KJ7 A;  3GLM A;  3PRJ A;  1NJI Q;  3N0Q A;  1RE4 C;  1MV8 A;  3H1H G;  2JZA A;  2K9J B;  1NU1 K;  2A06 G;  2PFX A;  2PRR A;  1OZH A;  1RF1 A;  2HMK A;  1LP1 A;  1BSH A;  3FXD A;  1H88 A;  3P32 A;  5APX A;  1KIL B;  1RHZ B;  4OVN F;  1BSN A;  1JTH B;  4PJ0 E;  1NU1 D;  1SQX J;  1OWA A;  4IL6 H;  2OTJ P;  2E42 A;  1ZXG A;  1P84 I;  3A7O A;  1XTC C;  1NTK K;  4D6T G;  1QL2 A;  1SQB K;  3IFM A;  3SSU A;  3A2A A;  4AUW A;  2JR8 A;  1KQF B;  2FY8 A;  2HPC A;  1KTM A;  1UIX A;  4R4M A;  3AE2 C;  2VRS A;  3D89 A;  1SQP E;  4N6J A;  2RKL A;  1PPJ G;  4IFF A;  2WSF H;  3QH9 A;  4KT0 J;  1KC8 Q;  3GMA A;  5AEU A;  5KAI H;  5AW7 B;  1LWU B;  2KI7 B;  2QJY B;  2B89 A;  1BE3 E;  5AVX B;  3S9O A;  4NBC D;  1BGY G;  1URQ D;  2BAS A;  1FC2 C;  2QJP B;  1G8K B;  3GKE A;  4WVZ A;  1S5L E;  2OGU A;  3M9B A;  3RBZ A;  4H13 B;  3KHU A;  3CC4 P;  2K9J A;  3AE4 C;  2E4Q A;  1NWQ A;  2RH0 A;  4HJG H;  1N7S C;  1VF5 D;  5BU8 B;  1G1I A;  1CI6 A;  1NTZ G;  1T6A A;  1P84 E;  2WVR A;  1IJD B;  1KIL A;  1JTH A;  2W6A A;  1IK7 A;  3MTU E;  3HTK A;  1N7S D;  5KLI B;  1K05 A;  1GW3 A;  3L75 J;  1EDJ A;  1K9M Q;  1HF9 A;  1JY2 N;  2HMN A;  4OGQ D;  2A45 I;  2ZAE B;  3HUS A;  4C7N B;  2Y9Y A;  1K73 Q;  4ASW A;  3CD6 P;  2FFD B;  3RK3 B;  3PTZ A;  4D6T E;  1SVF A;  3NFQ A;  3IAO A;  1LT9 B;  4XE5 B;  1EQ7 A;  2QG4 A;  1KN7 A;  1KV4 A;  3SFE C;  3BCC E;  1NOH A;  1HWT C;  4QUQ A;  4A7P A;  3L70 D;  3GG2 A;  1PIX A;  3CWB E;  4N78 E;  3AE6 C;  1PPJ E;  1ULI A;  2XV5 A;  1YQ4 C;  2XU6 A;  4EOT A;  3UIA A;  5CBO A;  4IOI H;  5CCG C;  1FZA A;  1O7P A;  1W2E A;  2FYU K;  2Q3I A;  1KOR A;  4PV1 B;  2OAR A;  1PGO A;  2K9Y A;  1M8O B;  2JO6 A;  1BGY E;  4GKG A;  1NU1 J;  1EZV D;  2NUK A;  1LJ2 A;  2PAJ A;  1PP9 G;  2WMM A;  2G3A A;  5KLV K;  2LKM A;  2FYU D;  1U7J A;  3A0B E;  1SQQ G;  1M56 D;  2QJK B;  1ZP0 C;  3WMM 0;  3S4R A;  5H2F H;  3USS A;  2IDB A;  5KLV D;  1X0T A;  1NTK J;  1T3U A;  1SQB J;  3KDP B;  3G71 P;  4NBG D;  3CXH I;  1EG9 A;  1VQP P;  1IO4 A;  3L74 E;  1FE6 A;  3B8E B;  1HBW A;  1KIL E;  5AEW A;  2FFD A;  1JY3 N;  1YTZ I;  4WY4 C;  4GT1 A;  3GZX A;  1LT9 A;  2WSE J;  3EFF K;  3H1J J;  4H44 D;  1GZL A;  1FZG A;  3R4Y A;  2ZJS E;  1Y47 A;  1PL5 A;  3RL0 D;  3WUV A;  4WY4 D;  1RQV A;  1YYC A;  5CJ4 A;  4AIV A;  2DE6 D;  2KSJ A;  2CPS A;  3VCP A;  1L2P A;  4PJ0 H;  3H32 B;  1BCC G;  1BDC A;  1VDF A;  3GTE A;  3GHG A;  5EFW B;  4Y99 C;  1Z56 A;  3LW5 H;  4JYB A;  2P1J A;  1ZR4 A;  2DE5 D;  3EFG A;  4NPE A;  1OVU A;  1N73 B;  3CXH E;  2HOD B;  1D7M A;  1X9V A;  1GDT A;  2M3B A;  2E74 B;  2NPS B;  1FZC B;  1GL2 B;  2Q3W A;  2IZ0 A;  1SQQ E;  5B5E E;  4P1B H;  1FAV A;  1CZQ A;  1L0N G;  1IK9 A;  1IFJ A;  2FKW B;  1JB0 J;  2JDI H;  1NTZ K;  1S5L H;  3KYQ A;  2KS1 A;  1AV1 A;  1QEX A;  2LXB A;  4M3L A;  2NRG A;  1IFN A;  4HM5 A;  3VMA A;  4DOJ A;  4MN4 C;  1Q2N A;  1VQK P;  2WIT A;  2Y0D A;  4HJL A;  1IFI A;  3JCU E;  3L71 G;  4PD4 H;  4U3F J;  1SFC D;  2Q6Q A;  2Z4E A;  3L73 G;  3RK3 E;  1L4A B;  1HJB A;  1RE3 C;  3P8C D;  1URQ A;  2FYU J;  1T2K D;  1L0L E;  1Q86 Q;  3CCJ P;  5AVQ B;  2QIW A;  2FXM A;  5KLV J;  2YKO A;  1JM1 A;  2D2C B;  2H7H A;  2M5A A;  3BRV B;  1GTW A;  3CCS P;  3AEE C;  3M0A A;  2OYH A;  2YKP A;  1GW4 A;  2HOD A;  1JEK A;  1LWU C;  2QJY C;  2E75 B;  3GZY A;  1NGM B;  3FOU A;  4B86 A;  4YTP C;  1NYH A;  2KIK A;  1N7S A;  3U59 A;  3H1H J;  5AW6 B;  4HM4 A;  4H13 C;  5AVS B;  1O7W A;  3AE9 C;  2H89 C;  1SS1 A;  2KZJ A;  1YJW P;  4HB1 A;  3EQQ A;  4QCK A;  1OW6 A;  2WQY C;  1SP4 A;  1KB9 D;  4CPG A;  2YXQ B;  4QDD A;  1HTL C;  1FOS E;  1HJ0 A;  3L72 G;  2FYN C;  4D6T J;  1RF1 B;  1LP1 B;  2OQQ A;  1MFZ A;  1NYK A;  3A0B H;  3MP7 B;  4W80 A;  2W27 A;  4EDF A;  2O3J A;  3CCR P;  2A45 H;  2N1T C;  2YVJ B;  3CX5 D;  1YBK A;  1LTJ C;  3TNU A;  3OW2 O;  1JUN A;  3L71 E;  1IC2 A;  1SQP G;  5CHX A;  2RMZ A;  1ZRT E;  5APW A;  1SQV G;  5TIS E;  3L73 E;  2YO2 A;  3G4S P;  2QPZ A;  1S5L X;  3AED C;  5L8R J;  3AEC C;  4U7J A;  2HPC B;  1S4X A;  1S9K E;  1QGK B;  1PZQ A;  2N1T D;  1IFP A;  1BE3 G;  2Z5H A;  1S1C X;  3EN1 A;  3L75 D;  1K8A Q;  1Q90 C;  2J59 M;  1Q82 Q;  3SFD C;  5BOK A;  2AXC A;  2B87 A;  3AZC A;  2I1K A;  5KKZ C;  2QM7 A;  2IPP A;  2IBZ D;  4PV1 C;  3GL2 A;  1Q90 D;  2J5U A;  2BMQ A;  3JSV C;  1JOC A;  1NTZ J;  3AEG C;  1VPC A;  1N8R Q;  1NH4 A;  3IF4 A;  4NB8 D;  2Y9Z A;  1RQU A;  3NTN A;  3V2R A;  2QJK C;  3ITK A;  3Q5S A;  4HM0 A;  1VL2 A;  3S1K A;  4YXW H;  2P10 A;  5AVW B;  1CI6 B;  2BCC G;  4IFM A;  1M1J B;  3V6I A;  3Q2Y A;  2R3S A;  1L0N K;  3FX0 A;  3M9H A;  3E1R A;  2K1A A;  3A5T A;  3CXH H;  3L72 E;  1J1E B;  3N7N A;  3HTK B;  4LGD E;  3FWN A;  3MUD C;  4DT0 A;  4I7Z B;  3TGU D;  3JC2 2;  2KOG A;  2KSE A;  3H25 A;  1OX3 A;  2R44 A;  4RES B;  1FQT A;  2Y0C A;  3EQ2 A;  3KZI E;  2FYZ A;  2J58 A;  1KD1 Q;  3BCC G;  3HUS B;  1AVY A;  3E7K A;  1NTM G;  3I5C A;  1NTK D;  4XA4 A;  1LNQ A;  4R4L A;  1SQB D;  3CWB G;  1SQV E;  1WMK A;  1O7H A;  3VMG D;  3B5N C;  2P2U A;  3IN6 A;  5K5G B;  3M0D A;  4L76 A;  3H1K G;  2ZXE B;  3G9R A;  3VN0 A;  1DH3 A;  3ABV C;  3D6Z A;  2E5Y A;  5DJT B;  1AFO A;  2WPR A;  4WB4 A;  2NVG A;  2IFM A;  3H1L G;  4DJG A;  3JCU H;  3AE5 C;  2AEM A;  1PP9 J;  3VMY A;  2BMR A;  3E1I A;  3B5N D;  1KQG B;  2YIU B;  3VMH D;  2GBW A;  1HVV A;  3TDK A;  2HMO A;  3H1J D;  1S2E A;  3I56 P;  1DEE G;  3V2Q A;  3HD7 B;  5GTI E;  3B4S A;  1RF0 C;  4BXL A;  2OYI B;  1EDK A;  2WWW A;  2A45 G;  1N73 C;  1JO5 A;  4K3A A;  2YMY A;  3GCE A;  5AVU B;  1VQ8 P;  2KLU A;  1QVF O;  2WSF J;  2BEZ F;  1M1J A;  2NPS C;  1FZC C;  1GL2 C;  1NAY A;  3L74 G;  2E76 B;  1USD A;  1SFC A;  3PHL A;  2R32 A;  1J1D B;  1YI2 P;  2JJL A;  2I1J A;  2BCC E;  1QL1 A;  4L74 A;  1JY2 P;  3RK2 B;  3PLN A;  4TLF A;  1AA0 A;  2AEF A;  1FBM A;  4GOD A;  1G8J B;  4KJM A;  2LXC B;  3W67 A;  3TYY A;  2POH A;  1BCC J;  2KB7 P;  1SQX G;  1NKN A;  3VTP C;  4NBB D;  1NTM E;  1SQP K;  2OYO A;  3I55 P;  2ZVO B;  4IL6 X;  2LR2 A;  1JM0 A;  4OWF A;  2ZYD A;  3H1K E;  4KHX A;  1T8Z A;  2W90 A;  2ZXX A;  4HKZ H;  3HD7 A;  3D70 A;  3GHG B;  2D2C C;  2OYI A;  3H1L E;  2GUS A;  1KYO I;  1YQ3 C;  4U3F D;  2NWF A;  5AVT B;  1M1K Q;  1X8Y A;  3O6Q B;  4H0L C;  2AEJ A;  4WWI A;  3TGU J;  1H89 A;  5CCG D;  4RKU J;  1LTS C;  1WT6 A;  1VQO P;  5AVZ B;  1L0N J;  4AYC A;  3CME P;  4QMA A;  3H1I G;  2YNY A;  3BAS A;  4QDC A;  2I7F A;  3C8V A;  1KQS O;  4H0L D;  5CCH C;  4QUR A;  1OXZ A;  2C0X A;  1OW8 A;  5CXM A;  5KJ7 C;  3FGA D;  3VP8 A;  3B71 A;  1FZF A;  1VQ7 P;  2B1X A;  1FDO A;  1OMI A;  3L71 J;  4PD4 D;  2B24 A;  1EXI A;  5CCH D;  3W68 A;  4QDF A;  2KS1 B;  1PV3 A;  2E5T A;  1KB9 I;  3VYI A;  1JY3 P;  2N1T A;  3H1H D;  1RF1 C;  2XSH A;  1LTJ A;  2A06 D;  1JCC A;  4OH8 B;  1L0L G;  3RBX A;  1H0T B;  1VQN P;  1TU3 F;  1YJ9 P;  3F89 A;  2KLV A;  1KYO E;  2WSS H;  3CPW O;  3ZDM A;  2N9Y B;  1URQ B;  3CC2 P;  2MKV A;  1SQX E;  3CX5 I;  3CC7 P;  4D6T D;  3MGN A;  1OW7 A;  2ZFC A;  3O6Q A;  5BU5 A;  1R5L A;  3PJS K;  3C1L A;  4LC1 A;  2H43 A;  5KTB A;  3CCV P;  2M5A B;  2G8Y A;  1HGZ A;  1NDO A;  1U57 A;  2W6J H;  1VF5 B;  2OYH B;  4BRY B;  1M90 Q;  2M8R A;  3CWB D;  4N78 D;  1PPJ D;  2V7Q H;  1ZLL A;  1N7L A;  2GUV A;  1RE4 A;  2ZYL A;  3HE5 A;  3PH0 A;  1PGQ A;  1LTB C;  2IBZ I;  2ZT9 C;  5C39 A;  1R5S A;  1N7S B;  1BGY D;  3H1I E;  4XFJ A;  3GB4 A;  3C0D A;  1KB9 E;  2WPQ A;  1NU1 G;  3L72 J;  1GU4 A;  5AW5 B;  4NBF D;  1S3J A;  3LW5 J;  4OGQ B;  3CCM P;  1U7M A;  2V4H A;  2ZT9 D;  4NBE D;  1QX8 A;  1M7L A;  4HYT B;  2O1J A;  2OTK E;  2XSO A;  5GTI H;  2KZI A;  1KIL C;  3AE7 C;  1FJK A;  1SQP J;  1NTZ D;  3CX5 E;  1H0T A;  2YFI A;  1PGJ A;  5AW8 B;  1LTT C;  3TSI A;  1X22 A;  4JQ0 D;  1YTZ T;  1P84 H;  2JP3 A;  3GF7 A;  5AW3 B;  1MUU A;  4I7Z C;  5B66 E;  5M1B A;  2GM4 A;  1JNM A;  1BE3 J;  1KIL D;  2ZVN B;  3TNU B;  1LT1 A;  2FBW C;  3II6 A;  3L75 E;  2KP8 A;  4JF7 A;  3A0H E;  2WPS A;  5KAF E;  1LTI C;  4BRY A;  1GU5 A;  4UB8 E;  1ZOY C;  2IBZ E;  2B88 A;  2ITA A;  1JMB A;  3L37 A;  3GOB A;  2PGD A;  3WU2 E;  4AAY B;  4ZKU A;  5CJ0 A;  1LGH B;  2P58 A;  2RN0 A;  1Q81 Q;  2QJP C;  2B87 B;  1QVG O;  3OJA B;  1W5C E;  2QEX P;  3M06 A;  1RFS A;  2XND H;  1MZ9 A;  3GF3 A;  1RY3 A;  2XRX A;  3RL0 g;  3NXS A;  4ZNC A;  2Z5I A;  1SQQ K;  4H13 D;  3VMZ A;  3DQY A;  3TK1 A;  1NU1 E;  3K5B A;  2WT7 B;  4EYY Q;  1Q7Y Q;  4GOE A;  1PP9 D;  3G6E P;  2KNC A;  5APU A;  1IZN B;  1SQQ D;  5KLI C;  4H44 B;  2QVA A;  4RJT A;  3V2P A;  3BCC J;  1O7G A;  3RL0 B;  2HMJ A;  1G2C A;  1WRG A;  3FWL A;  4WY4 B;  2NUM A;  3CWB J;  1NTK E;  3L70 G;  4L73 A;  1AJY A;  1OVR A;  1GK6 A;  1GD2 E;  2O01 N;  2Q5U A;  2FFD C;  1EDI A;  3RK3 C;  3H1K J;  5AVV B;  1LT9 C;  4NPF X;  1L0L K;  5APS A;  1BGY J;  1HGV A;  3SWY A;  2YXR B;  4N3Y B;  5CCG A;  3MZW B;  1EZV G;  1Y9B A;  5GTH E;  1VM9 A;  1NHL A;  2N9B A;  3RK3 D;  1EXJ A;  2OTL P;  1JCD A;  2FYU G;  2IZ1 A;  3O8Z A;  3OAK A;  2ZYA A;  3H6P A;  1X79 B;  2GBX A;  1IFD A;  4HM3 A;  1KYO H;  2NVE A;  3MD0 A;  5KLV G;  1KFN A;  1BCC D;  1OIP A;  3SWK A;  1VQL P;  1EZV I;  4HM8 A;  3CCQ P;  2YFJ A;  3L74 J;  1NAF A;  4PV1 D;  5CCH A;  1WQL A;  2WT7 A;  2B9B A;  1VQM P;  1KQL A;  5E79 E;  1M57 D;  3L36 A;  1UII A;  1ULJ A;  2XR8 A;  3OA7 A;  4TT3 H;  1NVO A;  2KK7 A;  3HE4 A;  1ZR2 A;  5TJH A;  3WUT A;  4WY4 A;  4C7R A;  1FZE A;  1SFC B;  1Y8A A;  3KXD A;  5B5E H;  1HH0 A;  1L0N D;  4HM7 A;  1KB9 H;  3P8M C;  4PD4 I;  1SJG A;  3T97 A;  1NO4 A;  3L70 E;  2FXO A;  3Q5P A;  4JBZ A;  2K88 A;  3BVH A;  1CSB A;  2K3R A;  1FU1 A;  4GDO A;  2JKV A;  3QWO C;  3L71 D;  3VOP A;  1URQ C;  2XNX A;  1EZV E;  3CX5 H;  2JO1 A;  1FS0 E;  1ZRT D;  2UWJ E;  5APY A;  2JEE A;  4U3F E;  2M3E A;  3L73 D;  4Y28 J;  3MIW A;  3CMA P;  3GL0 A;  5B66 H;  1SQQ J;  3WUU A;  2FYU E;  1S9K D;  1J2J B;  1KZU B;  3H1I J;  3G3Z A;  1W2B O;  5APV A;  1YJN P;  1N86 A;  2XKM A;  2WSC H;  1VF5 C;  2OYH C;  3AEA C;  5KLV E;  3R2P A;  3A0H H;  2HFE D;  2E74 C;  3Q3D A;  1AQ5 A;  5KAF H;  4UB8 H;  4I2L C;  2WTY A;  2H88 C;  3WU2 H;  3U1C A;  1MKM A;  3AE3 C;  2PP6 A;  1DEB A;  4PD4 E;  1O7M A;  1ZN5 A;  3M91 A;  2E74 D;  2NPS D;  1KFM A;  3H1H E;  2HMM A;  4OGQ C;  1GL2 D;  2FYN B;  1FDM A;  2A06 E;  2E43 A;  2KXP B;  1L0L J;  3CCE P;  1T3J A;  1PFI A;  2E4P A;  4Z1M H;  2P7J A;  2Y0E A;  1DX7 A;  2YKQ A;  1RE3 A;  2WSC J;  4BWN A;  3CCL P;  4HM2 A;  4QDF B;  2N1T B;  1LTJ B;  2R5D A;  3L72 D;  3BRT B;  1L4A C;  1E5W A;  4DCK A;  2CKF A;  2Q1K A;  2ZYG A;  3VMX A;  1SQV K;  3V4W A;  1DD3 A;  2R5B A;  1SLQ A;  2HYN A;  1LWU A;  1L4A D;  2IFN A;  1S72 P;  4JPZ B;  1SQP D;  1YIT P;  1SQV D;  3D71 A;  5KKZ B;  5TIS H;  3GTS A;  5BVZ A;  3C9I A;  2KUB A;  2E75 C;  1VQ9 P;  1BE3 D;  5CBN A;  2D2C D;  2HML A;  5GTH H;  1BDD A;  3HE5 B;  1KMI Z;  2E75 D;  2WSE H;  3P7K A;  2YMK A;  3HRN A;  2Q7C A;  4EIJ A;  3AE1 C;  5CMZ A;  3V2N A;  1ZME C;  1EDL A;  3CCU P;  3EWK A;  4YXD C;  4P1C H;  5AW1 B;  3CI9 A;  1RH5 B;  5HL4 A;  1NTZ E;  5APQ A;  1P84 D;  1K04 A;  3KQG A;  2IYP A;  3L73 J;  2BEQ D;  2AXT E;  2XDJ A;  5KJ7 D;  4H44 C;  1AVO A;  3BAT A;  3P8C E;  5AVY B;  4C7N A;  1VCK A;  2YFL A;  3KPE A;  4W7Z A;  1CW5 A;  1OVV A;  1FOS F;  4UB6 E;  4K35 A;  3RL0 C;  5E79 H;  2BCC D;  3L75 G;  3V4Q A;  5AW0 B;  2JWA A;  1G1J A;  4NBH D;  3VCA A;  1AQT A;  2QSI A;  2NVF A;  1FZB A;  1IFM A;  1NTM K;  1QLE D;  2IBZ G;  3B5N B;  1OFC X;  3GW6 A;  1USE A;  4HM1 A;  1GK4 A;  4NBA D;  2SPZ A;  3BCC D;  3KZI H;  2HG5 D;  1NTM D;  5DJU B;  3LID A;  3M0D C;  2BMO A;  2QRX A;  2DE7 D;  2C9L Y;  3L35 A;  3H1K D;  2JWD A;  3U1A A;  3H1L D;  4C46 A;  4IL6 E;  4WBA A;  4GIF A;  3MHV A;  5AVR B;  1PP9 E;  1EC5 A;  1VQ5 P;  2O1K A;  2W8Z A;  1RIE A;  1NKZ B;  3TGU G;  2K37 A;  2W83 C;  4RO0 A;  3MUD A;  1XTG B;  1M1J C;  2M0B A;  1N2D C;  3TF5 A;  4AQR D;  3L70 J;  1UUW A;  2V7Q J;  1SQV J;  2KNC B;  4YPC A;  1NTK G;  3Q5R A;  1J1E C;  2P67 A;  1SQB G;  1SFC C;  1O7N A;  1YHQ P;  2Q3E A;  3L74 D;  3NMD A;  5KAI E;  1PGP A;  1G2C B;  1T2K C;  3V5B A;  3B5N A;  2FXP A;  4HM6 A;  3HUS C;  1LTA C;  2C0W A;  1JMM A;  4EMJ B;  3H32 A;  1JY2 O;  1SQX K;  1YIJ P;  3H1J G;  3CL3 D;  3FXE A;  2HR3 A;  5AW4 B;  1KYO D;  1R8E A;  1H8A A;  1RF0 A;  2R3C A;  1SQX D;  1BCC E;  4HH2 A;  3AE8 C;  2YO3 A;  4O9B A;  2YIU C;  1N73 A;  2W6B A;  4H0L B;  1ZV8 A;  2C9N Y;  4GOF A;  3HD7 C;  2L5G B;  2NPS A;  5APT A;  2OYI C;  1FZC A;  1GL2 A;  2MJZ A;  1VQ6 P;  2BCC J;  4IFD K;  4ZKP A;  3LIE A;  2IX7 C;  1MFT A;  4EI2 A;  3CXH D;  5AW2 B;  4DZO A;  2XZR A;  5AW9 B;  1E79 H;  3HD7 D;  4NB9 D;  1DD4 A;  4NPD A;  4I1L A;  2E76 C;  4LLH A;  3TGU E;  1J1D C;  3H1I D;  1A02 J;  3A3Y B;  3HE4 B;  1L0N E;  2O01 H;  3VP9 A;  3RGU A;  4L75 A;  2QE7 H;  2QA4 P;  1NTM J;  2I8D A; 
#chains in the Genus database with same CATH homology
 4P1B H;  2NWF A;  2IBZ E;  2CKF A;  3GOB A;  1VM9 A;  2E76 D;  3EQQ A;  4NBH D;  4AAY B;  1SQB E;  4NBG D;  4QCK A;  1NDO A;  1EG9 A;  4NBD D;  3VCA A;  4NB8 D;  1EZV E;  1UUV A;  2NVF A;  4HM6 A;  3GCE A;  3L74 E;  4U3F E;  2QJK C;  2QJP C;  2ZYL A;  2HMN A;  4OGQ D;  4HM1 A;  5AEW A;  3GL0 A;  4QDC A;  4HM0 A;  4EMJ B;  2I7F A;  4QDD A;  2GBX A;  4HM3 A;  4HM5 A;  2FYU E;  3GZX A;  4H0L D;  2FYN C;  2NVE A;  1RFS A;  4NBA D;  3H1I E;  4D6T E;  3GB4 A;  3C0D A;  1KB9 E;  3GTS A;  4H44 D;  2XRX A;  4QUR A;  4HJL A;  1NYK A;  4HM8 A;  2YFJ A;  3D89 A;  3H1J E;  4NBF D;  3L72 E;  1SQP E;  2BMO A;  4HKV A;  5CXM A;  2BCC E;  4PV1 D;  4QUP A;  2DE7 D;  1WQL A;  5KLV E;  4H13 D;  3BCC E;  2D2C D;  1BCC E;  2B1X A;  3DQY A;  2ZT9 D;  4NBE D;  4QUQ A;  2YVJ B;  1NU1 E;  2YIU C;  2B24 A;  4AIV A;  2DE6 D;  2HML A;  3L71 E;  1ULJ A;  2XSO A;  2XR8 A;  5AEU A;  3VCP A;  1L0L E;  1FQT A;  3VMI D;  3CWB E;  1ZRT E;  4QDF A;  1PPJ E;  1ULI A;  1BE3 E;  4NBC D;  3L73 E;  2Q3W A;  2E75 D;  2XSH A;  5KLI C;  3GTE A;  1G8J B;  2QPZ A;  4PD4 E;  3CX5 E;  1G8K B;  1O7P A;  1O7M A;  2YFI A;  3GKE A;  1PP9 E;  1O7G A;  1SQV E;  1JM1 A;  2HMJ A;  1O7H A;  2E74 D;  2JO6 A;  1BGY E;  1RIE A;  3H1H E;  3EN1 A;  2DE5 D;  2HMM A;  2NUM A;  4P1C H;  3VMG D;  1Q90 C;  2A06 E;  2NUK A;  4NBB D;  5HL4 A;  1NTZ E;  1NTM E;  1KYO E;  2E4Q A;  1NTK E;  4HM7 A;  4NB9 D;  2E4P A;  5BOK A;  3N0Q A;  2QJY C;  3AZC A;  3GZY A;  1SQX E;  3TGU E;  1VF5 D;  1SJG A;  2JZA A;  2NVG A;  3CXH E;  3L75 E;  5KKZ C;  4HM2 A;  3H1K E;  1UUW A;  3FOU A;  4QDF B;  1VCK A;  2BMR A;  1P84 E;  3L70 E;  1L0N E;  2YFL A;  3GL2 A;  3VMH D;  2BMQ A;  2GBW A;  4HM4 A;  2HMK A;  2HMO A;  1O7N A;  1O7W A;  3H1L E;  1SQQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...