4U3QA

Crystal structure of recombinant tp0435 from treponema pallidum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
93
Chain Sequence
b'KAKAEKVECALKGGIFRGTLPIDTTVTFNADGTAQKVELSPLTYRGTWMVREDGIVELSLVEKELYELIDSNSVRYMGAPGAEMAPFYVLKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17 kDa lipoprotein
publication title Insights into the potential function and membrane organization of the TP0435 (Tp17) lipoprotein from Treponema pallidum derived from structural and biophysical analyses.
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Lipid binding protein
total genus 22
structure length 93
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04170 NlpE NlpE N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.640 Mainly Beta Beta Barrel Lipocalin Lipocalin 4u3qA00
4U3QA 3LHNA
chains in the Genus database with same CATH superfamily
1SXXA 1X8OA 3FYFA 4YDBA 2N93A 4QNIA 4QYNA 5KHPA 2JU7A 4OMWA 2RCTA 1JYDA 4GD9A 3T6FA 2AH7X 4BX7B 3UEUA 4CV7A 2QCBA 5HZQA 5KIDA 2OZQA 1SRFA 1HN2A 1T0VA 1Y53X 1FDQA 2FS7A 3FMZA 2RTKA 1ZNEA 4ORSA 3FR4A 1KT6A 2AL0X 1LDQA 1EXSA 3RY1A 1JIWI 3NQ9A 3IFBA 4Y0RA 2IZKA 4I9SA 4JHQA 2WQAE 4CPFA 4MVLA 1EPBA 1OPAA 2RTEB 3NQ3A 4OKAA 1YWDA 4PSQA 4O9SA 4FBVA 5EZ2A 5F6ZA 1BBPA 1WBIA 3ZW1A 2FT9A 1KZWA 1IIUA 1DZMA 2DJFA 2X45A 3WVMA 3EMMA 1D3SA 1MOYA 2KT4B 4M6SA 2AT0X 2K23A 5F58A 2NNQA 3S26A 1LCZA 1OEEA 1E2TA 4Z28A 1W5RA 5CHKA 2WSJA 3WJFA 3FELA 4DQ4A 1SRJA 4D6BA 3WJGA 2JMBA 3TF6A 2RTMA 4AZNA 4MVIA 2LKKA 4WHIA 1SLDB 2NNEA 2GJ5A 4K19A 2Y32A 2RTNB 2WEXA 3AKNA 3BLGA 2WUTA 5HZ8A 1UZ2X 3PQSA 4MISA 2L67A 4RUNA 3QKGA 1DZPA 2IZGB 2OVSA 4ORWA 4ORRA 3BX7A 4BGFA 3ZW2A 4YBPA 2BHVA 1Y52X 1JQPA 3STMX 4CPEA 1SWBA 1RBPA 3C77X 2Q39A 1OSPO 1SXYA 4MEEA 4O4SA 1STPA 1BSOA 2OF9A 2R56A 3FEPA 5AEOA 2CBSA 4MVEA 1MDCA 2RTQB 5F2BA 3FDCA 5KICA 4GGRA 1B0OA 2RTHB 1CBIA 1G74A 4EKVA 3VG4A 3BDRA 4JO6A 5JR8A 3ZUOA 5IO7A 5IRAA 3B2IA 2FTBA 1E00A 5D45A 2LBVA 2ANSA 3SLJA 1L6MA 1QQSA 5K68A 1B4MA 2IZIA 1SY1A 1AB0A 4CSBA 2QO6A 1DF8A 1TVQA 4MIRA 3STNA 1RAVA 4IAWA 1FEMA 1LCWA 3CQNA 2R73A 3K3LA 2JW1A 4IABA 4IMNA 1SMPI 4N7DA 1SWDA 3UAQA 3BY0A 2OFMX 5B29A 4I3CA 2KTSA 4BCSA 5L8IA 1HQQA 4LZUA 4YKMA 3U0DA 1SY3A 1T8VA 3WZNA 3ZQ3A 4AZPA 1Y9LA 1KL3A 1P6PA 4IAXA 4AZQA 4EDEA 3FA8A 1Y55X 4IBAA 4NNSA 1DFVA 2EU7X 5LJBA 2FKJA 4WFUA 1AVDA 1QWDA 2C1QA 4IB7A 2QOSC 3RBYA 1HXLA 3BU1A 1QFVA 1N43A 2Z4HA 1PM1X 3EW1A 4HFOA 1JZUA 3MX7A 4GGZA 1SWGA 4OS0A 1N9YA 3KQ0A 4KCAA 1BSQA 1LF7A 1KFFA 3L4RA 2MHDA 1VWDB 4NLJA 4U8UM 1MVGA 1JJJA 1I9HA 3EBWA 3F9DA 2OFAA 4Z27A 2WR6A 5H9LA 1YWBA 3S5VA 2LA7A 2XKLA 4O3YA 4GK9A 2KTDA 4YCEA 1SXUA 3IA8A 4XMEA 5H9KA 1SY0A 2RD7C 4KC8A 3RDXA 1SWLA 3FEKA 3ELZA 2OVEA 4KIIA 2CZTA 4COTA 1I05A 1HBPA 3LTWA 5AJCA 4Z2VA 4ES7A 1STSB 4JGLA 5BVQA 1UREA 4QAEA 1G85A 4CPHB 3CBCA 3SZIA 4I95A 3PH6A 1E5PA 1MX7A 2Z4IA 3CR6A 3RSWA 3V8UA 3ZW0B 5HZ9A 4YFRA 2HZQA 1SXWA 2WPUA 5LJCA 1IKEA 1ZNDA 3NX1A 4R0BA 4A60A 1EALA 3WJDA 3WZQA 2ZAIA 2A2GA 2IFBA 5B10O 1X8NA 2F01A 2OY5O 1U0XA 2IZEB 1QFTA 4QGXA 4ALOA 2HMBA 2X56A 1G7NA 2POAA 4YGHA 2JGSA 1VWNB 2M4LA 1A18A 4YMYA 5HAEA 1LIEA 1VWCB 5HZ5A 4QQ1A 1SWEA 2GTFX 3S5XA 2X8SA 4YGZA 4XMGA 4ZH9A 2ZSCA 1LIFA 2IZHB 2QM9A 4QGWA 3FENA 4BBOA 3U9PC 3WOVA 1OEJA 1A2DA 3F8AA 4UU2A 3KFHA 3EBKA 2ALLX 3HWDA 1BSYA 1NC9A 3BS2A 1T68X 1GKAA 2MJIA 4BX6B 4Y0SA 3KFIA 4KC7A 1BRPA 1ICMA 2F73A 3EM0A 4KH8A 1VYFA 3T2XA 4LKTA 1OEKA 3MM0A 2AF5A 2Y3FA 3OD9A 3FR2A 1GX9A 2I5VO 1OPBA 3ELXA 4L3RA 4NYRA 1SWQA 1KT7A 4TNNA 1MUPA 3NQKA 3Q6LA 4I3DA 1RXHA 2PY1A 1B56A 4QZTA 1BEBA 4AZRA 4GDZA 4ID2A 1OBPA 2W2BA 3VG6A 1ZNHA 4YCHA 2OY7A 5CYBA 4INNA 1SWSA 4A1HA 5AJBA 1A3YA 3PPTA 1K24A 4YH0A 3LHNA 4ZHFA 5HTDA 1CJ5A 1RLBE 3PEDA 4ZHGA 5HZ6A 3FLLA 1SA8A 1GT1A 3Q34A 5FQ7E 3LV4A 1IKJA 5D8JA 3HTYA 1N0SA 1EQDA 3CKFA 2CZUA 3F6ZB 2AT6X 4I6SA 1JJXA 2ACPX 2OL8O 5HA0A 1EI5A 1JYJA 3FW5A 3X00A 4CDCA 1HXZA 1SLFB 4UU3A 5H8TA 1DF3A 2Q9SA 4PJ2A 2G5LA 4YGGA 1GT3A 3SOTA 2MF6A 4BVMA 2FR2A 1GGLA 2JU3A 2G8CO 4BX5B 4EFGA 1HQPA 1KL5A 1DV9A 1ICNA 1X89A 4EQAC 2HKDA 2K62A 3RDUA 2L9CA 2GTLM 1AVGI 3TGCA 2QO5A 4Z6JA 2A8GA 2IZJA 3C78X 4CDFA 2KD2A 2X8TA 3PQUA 5F7GA 3VG2A 2IZCB 4IB6A 5LKEA 1NQMA 5EDBA 1VWEB 3UEVA 3O2YA 1LNMA 1VWBB 4IB8A 3HK1A 4TKBA 1GT4A 2YMSA 4AW8A 3RE6A 1RSUB 4DCBA 3RKGA 2R74A 1FJ1E 3QQ2A 2WQ9A 1JJUA 1NP4A 3CKGA 4FQBB 4U3QA 2FHNX 4M7MA 5B3MO 3RDQA 1JBHA 1SWPA 2FRSA 4OMXA 1FE3A 1ZNKA 3ZUIA 5IRUA 4ARHA 1R0UA 2OVDA 1SRGA 3P6EA 1E06A 2A5CA 3D9WA 1H91A 1VWIB 1S44A 2G78A 2AT8X 3JS1A 1LIDA 4ON1A 5LKFA 3PK2A 2X4MA 2FWVA 4L1NA 5H9NA 3SZHA 3KVNA 4OEMA 1ERXA 2RA6A 4HPCA 2L5PA 4NP1A 4WBKA 2FS6A 2RTRB 3C76X 5B2AO 1VYOA 5LJDA 4ZGUA 1MM9A 2DM5A 5C0NA 3VE1A 1N4JA 3HWFA 4YVBA 1GM6A 2F09A 3VG7A 4BOEA 1G5WA 1LFOA 1N7YA 3UEXA 1VWMB 1IW2A 1EW3A 1RSTB 4JNJA 3D95A 5K06A 2XSTA 3WZPA 2P8GA 5LJEA 4OS8A 5EPQA 3NBXX 2DJGA 2ACOA 4GETA 1JMZA 2OL7A 3APWA 3ZI8A 1FTPA 4NW4A 4O3ZA 2CM4A 5FQ6E 3BX8A 2ASNX 3MBTA 1LIBA 2LB6A 2C4IA 3WYPA 1Z24A 1D2UA 2BC3A 4I9RA 1AVEA 3B2HA 1BLRA 3I17A 4C5PA 1KT3A 1SWJA 3TGBA 2HYSA 2RTDB 1DZJA 3WBGA 1CBRA 1LPJA 5EDCA 2FR3A 2QO4A 1EPAA 4Y0PA 5LJGA 2CBRA 3CBSA 4CPHA 5B5FA 4GGTA 3SAOA 2HNXA 5K67A 4A8ZA 1VWKB 3PDFA 1UYNX 2A13A 4YBUA 5CSEA 4A1YA 5HCCC 2FKGA 2KW1A 4LKPA 1VWFB 2E4JA 3VHMA 1KL4A 3VHIA 1SWKA 3RDSA 4NV8A 4XMFA 3O19A 4YFPA 1OBQA 2CM9A 4U8UO 1JV4A 2MWHA 3P6CA 1QY2A 3NADA 4ORYA 4Y0QA 4Y59A 5EEDA 1O8VA 3DSZA 1SWNA 2OY1O 5B11O 2UZ2A 3O22A 3WYQA 3KZAA 4BJ8A 5HCDC 2OL6O 5D47A 1X8PA 1KT4A 4QGVA 4O3XB 1PEEA 3KFFA 1LKEA 3AKMA 2G7BA 1ERBA 5FQ8E 1KQWA 2C1SA 5IXGA 1AQBA 4XMDA 1HBQA 3OBLA 4BX7A 2RTFB 5AQ6A 2A2UA 2X46A 4OS3A 4BX6A 2G79A 5B5GA 2I5ZO 4EXZA 2Y3EA 3UEWA 2AKQA 1Y9TA 4IB9A 5HCEC 3B2LA 1ACDA 3NR3A 3PH5A 1S2PA 3GE2A 4IRWA 1TOWA 4BQUA 4CK4A 1KGLA 4U9CA 4B55A 1U18A 1SREA 2VDFA 1QABE 1NDJA 2NNDA 1QY0A 2A3FX 2GH7A 2RN4A 1VWQB 2VFBA 5EEEA 1YWAA 5F1EA 1MX8A 4LQZA 3VGWA 1BM5A 3B2JA 2RCQA 1BJ7A 2LFOA 2OFBA 2RTPB 4GJVA 5D4AA 4ZHHA 1W6FA 2X34A 3VPJE 3EC5A 1SLGB 4XMCA 2OFRX 3SLTA 5FENA 1EUOA 3FR5A 3KFGA 1X8UA 4GJSA 3VG5A 4AZOA 1GX8A 5LJKA 4RUUA 3VHHA 3D4RA 1BRQA 3APUA 1KZXA 1RXKA 1XCAA 3FA6A 3HPEA 1U17A 3EW2A 3FA9A 3TGAA 4O49A 3RDOA 5F6BA 1GKAB 4BX5A 2FHLA 4TJZA 4NYQA 5B27A 4XMHA 1E02A 4AZMA 1IFBA 1QG5A 2RQ0A 4CDEA 1N9MA 1SWTA 2GTLN 3WXQA 4GDAA 2RTGB 3VE2A 4DNEA 1VWOB 1A57A 2BS5A 3VU1A 3JSQA 3TZSA 2Q4NA 3AUMO 3WJEA 4ORXA 1KT5A 5HBSA 3P24A 3B2KA 2VFCA 5FFHA 3GAQA 3ZW1B 4GU8A 3D96A 1SWUA 2MO5A 1ZNLA 5L8OA 2BS6A 2FLJA 1BWYA 4D6AA 1PBYA 1STRB 4GNWA 3P6FA 1NP1A 1SWHA 4QRLA 4QYPA 4ZR2A 2RTCB 4TLJA 1VWAB 3NP1A 1VWPB 3E3CA 1I78A 1PMPA 5IRWA 4GE1A 4Y5DA 2BSZA 4GNYA 1SWFA 3HOEA 4ZHDA 1EIOA 2Q2PA 1YWCA 4CDDA 1PTSA 4FBRA 1LDOA 1EIIA 1VPRA 2O62A 3BRNA 1W4TA 4N7CA 1X8QA 3T6LA 4TQ2A 3PECA 4NV7A 3WJBA 3WZOA 4ZFXA 1NQNA 1LCVA 1RXJA 2X32A 1S7DA 1SLEB 4FBOA 3H3IA 2OVAA 4WFVA 2PI3O 4YFQA 2RTLA 1TW4A 4IMOA 5L3YA 2YG2A 2GTLO 1FELA 2Q2MA 2GC9A 3G7XA 1MEPA 1IFCA 2ZAGA 3FA7A 1ADLA 2W2AA 4HPAA 3RZYA 4O4UA 4DQ3A 4I60A 2IZDB 2A5BA 3ZWEA 1FENA 4GKCA 4U8UN 3N91A 1TXLA 2HLVA 1YUPA 1B8EA 1DC9A 2FGSA 2X8FA 2AMMX 3NPOA 4ORUA 1GX3A 1IJ8A 2AT5X 4NLIA 4QZUA 5D48A 1SWOA 1X71A 4ALBA 1HY2A 1CRBA 3RY2A 2IZBA 3AEHA 2W2FA 1SWRA 1VWGB 5DPQA 4ML7B 1O1UA 4FGIB 1ALBA 4CPIA 5BYPA 2CAMA 2LBAA 2NP1A 4O4OA 1TOUA 3HWGA 5LJHA 3P02A 3BU9A 2JOZA 5CE4A 2BT9A 3OJYC 1HMSA 1XKIA 3OE3A 3RE5A 2L68A 5BVTA 3CWKA 2JU8A 3FIDA 4ZH6A 1YIVA 4ZJ0A 5FAZA 1AELA 3HWEA 5HTEA 3FW4A 2OF8A 4ODDA 3ZW0A 1SY2A 1O1VA 1YP7A 2BLGA 3PP6A 2RTJA 3SLOA 1MK5A 1GXAA 1LELA 1VWRB 1SWCA 1KOIA 3U03A 1ML7A 4MVKA 1SRHA 1HMRA 2WEWA 3ZZVA 2RTAA 3P6HA 3SZJA 2OYBO 3FIQA 4KT5A 2RTOB 5IO5A 3S60A 2JN3A 3MVFA 4GRJA 2RTIB 2IZAA 5DG4A 1I4UA 1I06A 2QMIA 5H9AA 3APVA 2MM3A 3MG5A 4ZHCA 2AVIA 4LZVA 1NBXA 2WWPA 1CBSA 2RTBB 3APXA 3JQOA 4HPBA 4U46A 1VWJB 3STKA 5IO6A 4GUZA 1I04A 2A0AA 1YP6A 2QOMA 1SWAA 3WJCA 4ZGFA 3HOLA 3DTQA 1VWHB 5JD2A 1Y0GA 1ZNGA 2HZRA 1VYGA 1OBUA 1WUBA 2AT3X 2UYWA 1JMXA 3D97A 4TKJA 1NGLA 3T2WA 3CMPA 4Z2PA 1UYOX 1LUQA 1ZRYA 2X55A 5HA1A 1GT5A 1KXOA 1LICA 4NNTA 3CQRA 4ZCBA 1HMTA 3I0AA 2IZFB 4HPDA 4O3WA 1DZKA 4Z2OA 1KQXA 5BVSA 2OY8A 4HWMA 3NX2A 4GZVA 4OELA 1K3BA 3T1DA 5HWZA 4GH7A 1CBQA 3BSZE 1VWLB 4I3BA 5L8NA 3RDMA 4YKOA 1PBOA 4O4XA 4TKHA 3EYCA 3VG3A 4EEJA 3P6DA 1SRIA 4YDAA 3P6GA 3RWXA 4AYHA 2IZLB 1QY1A
chains in the Genus database with same CATH topology
1SXXA 1X8OA 3FYFA 4YDBA 2N93A 4QNIA 4QYNA 5KHPA 2JU7A 4OMWA 2RCTA 1JYDA 2AH7X 3UEUA 4CV7A 5HZQA 5KIDA 2OZQA 1HN2A 1T0VA 2FS7A 1FDQA 3FMZA 4ORSA 1ZNEA 3FR4A 1KT6A 2AL0X 1EXSA 1JIWI 3NQ9A 3IFBA 4Y0RA 4I9SA 2WQAE 4MVLA 1EPBA 1OPAA 4PSQA 3NQ3A 1YWDA 4O9SA 4FBVA 5EZ2A 5F6ZA 1BBPA 3ZW1A 2FT9A 1KZWA 1IIUA 1DZMA 3WVMA 2X45A 3EMMA 1D3SA 2KT4B 4M6SA 2AT0X 2K23A 5F58A 2NNQA 3S26A 1OEEA 2WSJA 3WJFA 3FELA 4DQ4A 4D6BA 3WJGA 2JMBA 3TF6A 4AZNA 4MVIA 2LKKA 4WHIA 2NNEA 2GJ5A 4K19A 2WEXA 3AKNA 3BLGA 2WUTA 5HZ8A 1UZ2X 3PQSA 4MISA 2L67A 4RUNA 1QY1A 1DZPA 2OVSA 3QKGA 4ORWA 4ORRA 3BX7A 5LJKA 3ZW2A 4YBPA 2BHVA 3STMX 1RBPA 3C77X 2Q39A 1SXYA 4O4SA 1BSOA 3FEPA 2R56A 5AEOA 5KICA 2CBSA 4MVEA 1MDCA 1B0OA 1CBIA 1G74A 3VG4A 3BDRA 5JR8A 3ZUOA 5IO7A 3B2IA 2FTBA 1E00A 5D45A 2LBVA 2ANSA 1L6MA 1QQSA 1B4MA 1AB0A 1SY1A 4CSBA 2QO6A 1TVQA 4MIRA 3STNA 4IAWA 4IMNA 1FEMA 3CQNA 3K3LA 2R73A 4IABA 2JW1A 4N7DA 3UAQA 1SMPI 5B29A 3BY0A 2OFMX 4I3CA 2KTSA 5L8IA 4LZUA 4YKMA 3U0DA 1SY3A 1T8VA 3ZQ3A 4AZPA 1Y9LA 1P6PA 4IAXA 4AZQA 4EDEA 3FA8A 4IBAA 4NNSA 1DFVA 2EU7X 5LJBA 4WFUA 1QWDA 4IB7A 2QOSC 3RBYA 3BU1A 1QFVA 2Z4HA 1JZUA 1PM1X 4HFOA 3MX7A 4OS0A 3KQ0A 4KCAA 1BSQA 1LF7A 3L4RA 4NLJA 2MHDA 4U8UM 4ARHA 1JJJA 1MVGA 3EBWA 3F9DA 2WR6A 5H9LA 1YWBA 3S5VA 2LA7A 2XKLA 4O3YA 4GK9A 2KTDA 4YCEA 1SXUA 3IA8A 4XMEA 5H9KA 1SY0A 2RD7C 4KC8A 3FEKA 3ELZA 2OVEA 4KIIA 2CZTA 4COTA 1I05A 1HBPA 5AJCA 4ES7A 4JGLA 5BVQA 1UREA 4QAEA 1G85A 3CBCA 4I95A 3PH6A 1E5PA 1MX7A 2Z4IA 3CR6A 3RSWA 3V8UA 3ZW0B 5HZ9A 4YFRA 2HZQA 1SXWA 5LJCA 1IKEA 1ZNDA 3NX1A 4R0BA 4A60A 1EALA 3WJDA 2ZAIA 2A2GA 2IFBA 1X8NA 1U0XA 1QFTA 4QGXA 4ALOA 2HMBA 1G7NA 2POAA 4YGHA 4YMYA 2M4LA 1A18A 5HZ5A 5HAEA 1LIEA 4QQ1A 2GTFX 3S5XA 2X8SA 4YGZA 4XMGA 4ZH9A 1LIFA 2QM9A 4QGWA 3FENA 3U9PC 3WOVA 1OEJA 1A2DA 3F8AA 4UU2A 3KFHA 3EBKA 2ALLX 3HWDA 1BSYA 3BS2A 1T68X 1GKAA 2MJIA 4Y0SA 3KFIA 4KC7A 1BRPA 1ICMA 2F73A 3EM0A 4KH8A 1VYFA 4LKTA 1OEKA 3OD9A 3FR2A 1GX9A 3ELXA 1OPBA 4L3RA 4NYRA 4TNNA 1KT7A 1MUPA 3NQKA 3Q6LA 4I3DA 2PY1A 4QZTA 1B56A 1BEBA 4AZRA 4GDZA 4ID2A 1OBPA 2W2BA 3VG6A 1ZNHA 4YCHA 5CYBA 4INNA 4A1HA 5AJBA 1A3YA 3PPTA 4YH0A 3LHNA 4ZHFA 5HTDA 1CJ5A 1RLBE 3PEDA 4ZHGA 5HZ6A 3FLLA 1SA8A 1GT1A 5FQ7E 3LV4A 1IKJA 5D8JA 3HTYA 1N0SA 1EQDA 2CZUA 3F6ZB 2AT6X 4I6SA 1JJXA 2ACPX 5HA0A 1EI5A 1JYJA 3FW5A 4UU3A 5H8TA 1DF3A 2Q9SA 4PJ2A 4YGGA 1GT3A 3SOTA 4BVMA 2FR2A 1GGLA 2JU3A 4EFGA 1HQPA 1DV9A 1ICNA 1X89A 4EQAC 2K62A 2L9CA 2GTLM 1AVGI 3TGCA 2QO5A 3C78X 2KD2A 2X8TA 3PQUA 5F7GA 3VG2A 4IB6A 5EDBA 3UEVA 3O2YA 1LNMA 4IB8A 3HK1A 4TKBA 1GT4A 2YMSA 4AW8A 3RKGA 2R74A 2WQ9A 4FQBB 1NP4A 4U3QA 4M7MA 1JBHA 2FRSA 4OMXA 1FE3A 1ZNKA 3ZUIA 1R0UA 2OVDA 3P6EA 1E06A 1H91A 1S44A 2G78A 2AT8X 3JS1A 1LIDA 4ON1A 5LKFA 2FWVA 4L1NA 5H9NA 1ERXA 2RA6A 4HPCA 2L5PA 4NP1A 4WBKA 2FS6A 3C76X 4ZGUA 5LJDA 5C0NA 2DM5A 3VE1A 3HWFA 1GM6A 2F09A 3VG7A 4BOEA 1G5WA 1LFOA 3UEXA 1IW2A 1EW3A 3D95A 5K06A 2XSTA 2P8GA 5LJEA 4OS8A 5EPQA 3NBXX 2ACOA 4GETA 3ZI8A 3APWA 1FTPA 4NW4A 4O3ZA 2CM4A 5FQ6E 3BX8A 2ASNX 3MBTA 1LIBA 2LB6A 1Z24A 1D2UA 4I9RA 1BLRA 3B2HA 3I17A 1KT3A 3TGBA 2HYSA 1DZJA 3WBGA 1CBRA 1LPJA 5EDCA 2FR3A 2QO4A 1EPAA 4Y0PA 5LJGA 2CBRA 3CBSA 3SAOA 2HNXA 4A8ZA 2A13A 4YBUA 4A1YA 5HCCC 2KW1A 4LKPA 2E4JA 4XMFA 3O19A 4YFPA 1OBQA 2CM9A 4U8UO 1JV4A 2MWHA 3P6CA 1QY2A 3NADA 4ORYA 4Y0QA 5EEDA 5LKEA 1O8VA 3DSZA 5HCDC 3O22A 3KZAA 5D47A 1X8PA 1KT4A 4QGVA 4O3XB 1PEEA 3KFFA 1LKEA 3AKMA 2G7BA 1ERBA 5FQ8E 1KQWA 1AQBA 4XMDA 1HBQA 3OBLA 5AQ6A 2A2UA 2X46A 4OS3A 2G79A 4EXZA 3UEWA 2AKQA 1Y9TA 4IB9A 5HCEC 3B2LA 1ACDA 3NR3A 3PH5A 1S2PA 3GE2A 4BQUA 1TOWA 4CK4A 1KGLA 4U9CA 1U18A 1QABE 2NNDA 1QY0A 2A3FX 2RN4A 5EEEA 1YWAA 5F1EA 1MX8A 4LQZA 1BM5A 3B2JA 2RCQA 1BJ7A 2LFOA 5D4AA 4ZHHA 3VPJE 4XMCA 2OFRX 5FENA 1EUOA 3FR5A 3KFGA 1X8UA 3VG5A 4AZOA 1GX8A 4RUUA 3D4RA 1BRQA 3APUA 1KZXA 1XCAA 3FA6A 1U17A 3TGAA 3FA9A 4O49A 5F6BA 1GKAB 4TJZA 4NYQA 5B27A 4XMHA 1E02A 4AZMA 1IFBA 1QG5A 2RQ0A 2GTLN 3WXQA 3VE2A 1A57A 2BS5A 3VU1A 3JSQA 3TZSA 2Q4NA 3WJEA 4ORXA 1KT5A 5HBSA 3P24A 3B2KA 5FFHA 3GAQA 3ZW1B 4GU8A 3D96A 2MO5A 1ZNLA 5L8OA 2BS6A 2FLJA 1BWYA 4D6AA 4GNWA 3P6FA 1NP1A 4QRLA 4QYPA 4ZR2A 4TLJA 3NP1A 3E3CA 1PMPA 4GE1A 4GNYA 3HOEA 4ZHDA 1EIOA 2Q2PA 1YWCA 1EIIA 4FBRA 1VPRA 3BRNA 4N7CA 1X8QA 4TQ2A 3PECA 3WJBA 4ZFXA 1S7DA 4WFVA 4FBOA 3H3IA 2OVAA 4YFQA 1TW4A 4IMOA 2YG2A 2GTLO 1FELA 2Q2MA 2GC9A 3G7XA 1IFCA 2ZAGA 3FA7A 1ADLA 2W2AA 4HPAA 3RZYA 4O4UA 4DQ3A 3ZWEA 1FENA 4GKCA 4U8UN 3N91A 1TXLA 2HLVA 1YUPA 1B8EA 1DC9A 2X8FA 3NPOA 2AMMX 4ORUA 2AT5X 4NLIA 5D48A 4QZUA 1X71A 4ALBA 1CRBA 2W2FA 5DPQA 4ML7B 1O1UA 4FGIB 1ALBA 5BYPA 2LBAA 2NP1A 4O4OA 1TOUA 3HWGA 5LJHA 3P02A 3BU9A 2JOZA 5CE4A 2BT9A 3OJYC 1HMSA 1XKIA 3OE3A 5BVTA 2L68A 3CWKA 2JU8A 4ZH6A 4ZJ0A 1YIVA 1AELA 5FAZA 3HWEA 5HTEA 3FW4A 4ODDA 3ZW0A 1SY2A 1O1VA 1YP7A 2BLGA 3PP6A 1GXAA 1KOIA 3U03A 1ML7A 4MVKA 1HMRA 2WEWA 3ZZVA 3P6HA 5IO5A 3FIQA 4KT5A 3S60A 2JN3A 3MVFA 4GRJA 5DG4A 1I4UA 1I06A 2QMIA 5H9AA 3APVA 2MM3A 4ZHCA 4LZVA 2WWPA 1CBSA 3APXA 3JQOA 3STKA 4HPBA 5IO6A 1I04A 2A0AA 1YP6A 3WJCA 4ZGFA 3HOLA 3DTQA 1ZNGA 2HZRA 1VYGA 1OBUA 2AT3X 3D97A 4TKJA 1NGLA 3CMPA 1ZRYA 5HA1A 1GT5A 1KXOA 1LICA 4NNTA 3CQRA 4ZCBA 1HMTA 3I0AA 4HPDA 4O3WA 1DZKA 1KQXA 5BVSA 4HWMA 5HWZA 3NX2A 4GZVA 3T1DA 4GH7A 1CBQA 3BSZE 4I3BA 5L8NA 4YKOA 1PBOA 4O4XA 4TKHA 3EYCA 3VG3A 4EEJA 3P6DA 4YDAA 3P6GA 3RWXA 4AYHA 2O62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3Q A;  3LHN A; 
#chains in the Genus database with same CATH topology
 1SXX A;  1X8O A;  3FYF A;  4YDB A;  2N93 A;  4QNI A;  4QYN A;  5KHP A;  2JU7 A;  4OMW A;  2RCT A;  1JYD A;  4GD9 A;  3T6F A;  2AH7 X;  4BX7 B;  3UEU A;  4CV7 A;  2QCB A;  5HZQ A;  5KID A;  2OZQ A;  1SRF A;  1HN2 A;  1T0V A;  1Y53 X;  1FDQ A;  2FS7 A;  3FMZ A;  2RTK A;  1ZNE A;  4ORS A;  3FR4 A;  1KT6 A;  2AL0 X;  1LDQ A;  1EXS A;  3RY1 A;  1JIW I;  3NQ9 A;  3IFB A;  4Y0R A;  2IZK A;  4I9S A;  4JHQ A;  2WQA E;  4CPF A;  4MVL A;  1EPB A;  1OPA A;  2RTE B;  3NQ3 A;  4OKA A;  1YWD A;  4PSQ A;  4O9S A;  4FBV A;  5EZ2 A;  5F6Z A;  1BBP A;  1WBI A;  3ZW1 A;  2FT9 A;  1KZW A;  1IIU A;  1DZM A;  2DJF A;  2X45 A;  3WVM A;  3EMM A;  1D3S A;  1MOY A;  2KT4 B;  4M6S A;  2AT0 X;  2K23 A;  5F58 A;  2NNQ A;  3S26 A;  1LCZ A;  1OEE A;  1E2T A;  4Z28 A;  1W5R A;  5CHK A;  2WSJ A;  3WJF A;  3FEL A;  4DQ4 A;  1SRJ A;  4D6B A;  3WJG A;  2JMB A;  3TF6 A;  2RTM A;  4AZN A;  4MVI A;  2LKK A;  4WHI A;  1SLD B;  2NNE A;  2GJ5 A;  4K19 A;  2Y32 A;  2RTN B;  2WEX A;  3AKN A;  3BLG A;  2WUT A;  5HZ8 A;  1UZ2 X;  3PQS A;  4MIS A;  2L67 A;  4RUN A;  3QKG A;  1DZP A;  2IZG B;  2OVS A;  4ORW A;  4ORR A;  3BX7 A;  4BGF A;  3ZW2 A;  4YBP A;  2BHV A;  1Y52 X;  1JQP A;  3STM X;  4CPE A;  1SWB A;  1RBP A;  3C77 X;  2Q39 A;  1OSP O;  1SXY A;  4MEE A;  4O4S A;  1STP A;  1BSO A;  2OF9 A;  2R56 A;  3FEP A;  5AEO A;  2CBS A;  4MVE A;  1MDC A;  2RTQ B;  5F2B A;  3FDC A;  5KIC A;  4GGR A;  1B0O A;  2RTH B;  1CBI A;  1G74 A;  4EKV A;  3VG4 A;  3BDR A;  4JO6 A;  5JR8 A;  3ZUO A;  5IO7 A;  5IRA A;  3B2I A;  2FTB A;  1E00 A;  5D45 A;  2LBV A;  2ANS A;  3SLJ A;  1L6M A;  1QQS A;  5K68 A;  1B4M A;  2IZI A;  1SY1 A;  1AB0 A;  4CSB A;  2QO6 A;  1DF8 A;  1TVQ A;  4MIR A;  3STN A;  1RAV A;  4IAW A;  1FEM A;  1LCW A;  3CQN A;  2R73 A;  3K3L A;  2JW1 A;  4IAB A;  4IMN A;  1SMP I;  4N7D A;  1SWD A;  3UAQ A;  3BY0 A;  2OFM X;  5B29 A;  4I3C A;  2KTS A;  4BCS A;  5L8I A;  1HQQ A;  4LZU A;  4YKM A;  3U0D A;  1SY3 A;  1T8V A;  3WZN A;  3ZQ3 A;  4AZP A;  1Y9L A;  1KL3 A;  1P6P A;  4IAX A;  4AZQ A;  4EDE A;  3FA8 A;  1Y55 X;  4IBA A;  4NNS A;  1DFV A;  2EU7 X;  5LJB A;  2FKJ A;  4WFU A;  1AVD A;  1QWD A;  2C1Q A;  4IB7 A;  2QOS C;  3RBY A;  1HXL A;  3BU1 A;  1QFV A;  1N43 A;  2Z4H A;  1PM1 X;  3EW1 A;  4HFO A;  1JZU A;  3MX7 A;  4GGZ A;  1SWG A;  4OS0 A;  1N9Y A;  3KQ0 A;  4KCA A;  1BSQ A;  1LF7 A;  1KFF A;  3L4R A;  2MHD A;  1VWD B;  4NLJ A;  4U8U M;  1MVG A;  1JJJ A;  1I9H A;  3EBW A;  3F9D A;  2OFA A;  4Z27 A;  2WR6 A;  5H9L A;  1YWB A;  3S5V A;  2LA7 A;  2XKL A;  4O3Y A;  4GK9 A;  2KTD A;  4YCE A;  1SXU A;  3IA8 A;  4XME A;  5H9K A;  1SY0 A;  2RD7 C;  4KC8 A;  3RDX A;  1SWL A;  3FEK A;  3ELZ A;  2OVE A;  4KII A;  2CZT A;  4COT A;  1I05 A;  1HBP A;  3LTW A;  5AJC A;  4Z2V A;  4ES7 A;  1STS B;  4JGL A;  5BVQ A;  1URE A;  4QAE A;  1G85 A;  4CPH B;  3CBC A;  3SZI A;  4I95 A;  3PH6 A;  1E5P A;  1MX7 A;  2Z4I A;  3CR6 A;  3RSW A;  3V8U A;  3ZW0 B;  5HZ9 A;  4YFR A;  2HZQ A;  1SXW A;  2WPU A;  5LJC A;  1IKE A;  1ZND A;  3NX1 A;  4R0B A;  4A60 A;  1EAL A;  3WJD A;  3WZQ A;  2ZAI A;  2A2G A;  2IFB A;  5B10 O;  1X8N A;  2F01 A;  2OY5 O;  1U0X A;  2IZE B;  1QFT A;  4QGX A;  4ALO A;  2HMB A;  2X56 A;  1G7N A;  2POA A;  4YGH A;  2JGS A;  1VWN B;  2M4L A;  1A18 A;  4YMY A;  5HAE A;  1LIE A;  1VWC B;  5HZ5 A;  4QQ1 A;  1SWE A;  2GTF X;  3S5X A;  2X8S A;  4YGZ A;  4XMG A;  4ZH9 A;  2ZSC A;  1LIF A;  2IZH B;  2QM9 A;  4QGW A;  3FEN A;  4BBO A;  3U9P C;  3WOV A;  1OEJ A;  1A2D A;  3F8A A;  4UU2 A;  3KFH A;  3EBK A;  2ALL X;  3HWD A;  1BSY A;  1NC9 A;  3BS2 A;  1T68 X;  1GKA A;  2MJI A;  4BX6 B;  4Y0S A;  3KFI A;  4KC7 A;  1BRP A;  1ICM A;  2F73 A;  3EM0 A;  4KH8 A;  1VYF A;  3T2X A;  4LKT A;  1OEK A;  3MM0 A;  2AF5 A;  2Y3F A;  3OD9 A;  3FR2 A;  1GX9 A;  2I5V O;  1OPB A;  3ELX A;  4L3R A;  4NYR A;  1SWQ A;  1KT7 A;  4TNN A;  1MUP A;  3NQK A;  3Q6L A;  4I3D A;  1RXH A;  2PY1 A;  1B56 A;  4QZT A;  1BEB A;  4AZR A;  4GDZ A;  4ID2 A;  1OBP A;  2W2B A;  3VG6 A;  1ZNH A;  4YCH A;  2OY7 A;  5CYB A;  4INN A;  1SWS A;  4A1H A;  5AJB A;  1A3Y A;  3PPT A;  1K24 A;  4YH0 A;  3LHN A;  4ZHF A;  5HTD A;  1CJ5 A;  1RLB E;  3PED A;  4ZHG A;  5HZ6 A;  3FLL A;  1SA8 A;  1GT1 A;  3Q34 A;  5FQ7 E;  3LV4 A;  1IKJ A;  5D8J A;  3HTY A;  1N0S A;  1EQD A;  3CKF A;  2CZU A;  3F6Z B;  2AT6 X;  4I6S A;  1JJX A;  2ACP X;  2OL8 O;  5HA0 A;  1EI5 A;  1JYJ A;  3FW5 A;  3X00 A;  4CDC A;  1HXZ A;  1SLF B;  4UU3 A;  5H8T A;  1DF3 A;  2Q9S A;  4PJ2 A;  2G5L A;  4YGG A;  1GT3 A;  3SOT A;  2MF6 A;  4BVM A;  2FR2 A;  1GGL A;  2JU3 A;  2G8C O;  4BX5 B;  4EFG A;  1HQP A;  1KL5 A;  1DV9 A;  1ICN A;  1X89 A;  4EQA C;  2HKD A;  2K62 A;  3RDU A;  2L9C A;  2GTL M;  1AVG I;  3TGC A;  2QO5 A;  4Z6J A;  2A8G A;  2IZJ A;  3C78 X;  4CDF A;  2KD2 A;  2X8T A;  3PQU A;  5F7G A;  3VG2 A;  2IZC B;  4IB6 A;  5LKE A;  1NQM A;  5EDB A;  1VWE B;  3UEV A;  3O2Y A;  1LNM A;  1VWB B;  4IB8 A;  3HK1 A;  4TKB A;  1GT4 A;  2YMS A;  4AW8 A;  3RE6 A;  1RSU B;  4DCB A;  3RKG A;  2R74 A;  1FJ1 E;  3QQ2 A;  2WQ9 A;  1JJU A;  1NP4 A;  3CKG A;  4FQB B;  4U3Q A;  2FHN X;  4M7M A;  5B3M O;  3RDQ A;  1JBH A;  1SWP A;  2FRS A;  4OMX A;  1FE3 A;  1ZNK A;  3ZUI A;  5IRU A;  4ARH A;  1R0U A;  2OVD A;  1SRG A;  3P6E A;  1E06 A;  2A5C A;  3D9W A;  1H91 A;  1VWI B;  1S44 A;  2G78 A;  2AT8 X;  3JS1 A;  1LID A;  4ON1 A;  5LKF A;  3PK2 A;  2X4M A;  2FWV A;  4L1N A;  5H9N A;  3SZH A;  3KVN A;  4OEM A;  1ERX A;  2RA6 A;  4HPC A;  2L5P A;  4NP1 A;  4WBK A;  2FS6 A;  2RTR B;  3C76 X;  5B2A O;  1VYO A;  5LJD A;  4ZGU A;  1MM9 A;  2DM5 A;  5C0N A;  3VE1 A;  1N4J A;  3HWF A;  4YVB A;  1GM6 A;  2F09 A;  3VG7 A;  4BOE A;  1G5W A;  1LFO A;  1N7Y A;  3UEX A;  1VWM B;  1IW2 A;  1EW3 A;  1RST B;  4JNJ A;  3D95 A;  5K06 A;  2XST A;  3WZP A;  2P8G A;  5LJE A;  4OS8 A;  5EPQ A;  3NBX X;  2DJG A;  2ACO A;  4GET A;  1JMZ A;  2OL7 A;  3APW A;  3ZI8 A;  1FTP A;  4NW4 A;  4O3Z A;  2CM4 A;  5FQ6 E;  3BX8 A;  2ASN X;  3MBT A;  1LIB A;  2LB6 A;  2C4I A;  3WYP A;  1Z24 A;  1D2U A;  2BC3 A;  4I9R A;  1AVE A;  3B2H A;  1BLR A;  3I17 A;  4C5P A;  1KT3 A;  1SWJ A;  3TGB A;  2HYS A;  2RTD B;  1DZJ A;  3WBG A;  1CBR A;  1LPJ A;  5EDC A;  2FR3 A;  2QO4 A;  1EPA A;  4Y0P A;  5LJG A;  2CBR A;  3CBS A;  4CPH A;  5B5F A;  4GGT A;  3SAO A;  2HNX A;  5K67 A;  4A8Z A;  1VWK B;  3PDF A;  1UYN X;  2A13 A;  4YBU A;  5CSE A;  4A1Y A;  5HCC C;  2FKG A;  2KW1 A;  4LKP A;  1VWF B;  2E4J A;  3VHM A;  1KL4 A;  3VHI A;  1SWK A;  3RDS A;  4NV8 A;  4XMF A;  3O19 A;  4YFP A;  1OBQ A;  2CM9 A;  4U8U O;  1JV4 A;  2MWH A;  3P6C A;  1QY2 A;  3NAD A;  4ORY A;  4Y0Q A;  4Y59 A;  5EED A;  1O8V A;  3DSZ A;  1SWN A;  2OY1 O;  5B11 O;  2UZ2 A;  3O22 A;  3WYQ A;  3KZA A;  4BJ8 A;  5HCD C;  2OL6 O;  5D47 A;  1X8P A;  1KT4 A;  4QGV A;  4O3X B;  1PEE A;  3KFF A;  1LKE A;  3AKM A;  2G7B A;  1ERB A;  5FQ8 E;  1KQW A;  2C1S A;  5IXG A;  1AQB A;  4XMD A;  1HBQ A;  3OBL A;  4BX7 A;  2RTF B;  5AQ6 A;  2A2U A;  2X46 A;  4OS3 A;  4BX6 A;  2G79 A;  5B5G A;  2I5Z O;  4EXZ A;  2Y3E A;  3UEW A;  2AKQ A;  1Y9T A;  4IB9 A;  5HCE C;  3B2L A;  1ACD A;  3NR3 A;  3PH5 A;  1S2P A;  3GE2 A;  4IRW A;  1TOW A;  4BQU A;  4CK4 A;  1KGL A;  4U9C A;  4B55 A;  1U18 A;  1SRE A;  2VDF A;  1QAB E;  1NDJ A;  2NND A;  1QY0 A;  2A3F X;  2GH7 A;  2RN4 A;  1VWQ B;  2VFB A;  5EEE A;  1YWA A;  5F1E A;  1MX8 A;  4LQZ A;  3VGW A;  1BM5 A;  3B2J A;  2RCQ A;  1BJ7 A;  2LFO A;  2OFB A;  2RTP B;  4GJV A;  5D4A A;  4ZHH A;  1W6F A;  2X34 A;  3VPJ E;  3EC5 A;  1SLG B;  4XMC A;  2OFR X;  3SLT A;  5FEN A;  1EUO A;  3FR5 A;  3KFG A;  1X8U A;  4GJS A;  3VG5 A;  4AZO A;  1GX8 A;  5LJK A;  4RUU A;  3VHH A;  3D4R A;  1BRQ A;  3APU A;  1KZX A;  1RXK A;  1XCA A;  3FA6 A;  3HPE A;  1U17 A;  3EW2 A;  3FA9 A;  3TGA A;  4O49 A;  3RDO A;  5F6B A;  1GKA B;  4BX5 A;  2FHL A;  4TJZ A;  4NYQ A;  5B27 A;  4XMH A;  1E02 A;  4AZM A;  1IFB A;  1QG5 A;  2RQ0 A;  4CDE A;  1N9M A;  1SWT A;  2GTL N;  3WXQ A;  4GDA A;  2RTG B;  3VE2 A;  4DNE A;  1VWO B;  1A57 A;  2BS5 A;  3VU1 A;  3JSQ A;  3TZS A;  2Q4N A;  3AUM O;  3WJE A;  4ORX A;  1KT5 A;  5HBS A;  3P24 A;  3B2K A;  2VFC A;  5FFH A;  3GAQ A;  3ZW1 B;  4GU8 A;  3D96 A;  1SWU A;  2MO5 A;  1ZNL A;  5L8O A;  2BS6 A;  2FLJ A;  1BWY A;  4D6A A;  1PBY A;  1STR B;  4GNW A;  3P6F A;  1NP1 A;  1SWH A;  4QRL A;  4QYP A;  4ZR2 A;  2RTC B;  4TLJ A;  1VWA B;  3NP1 A;  1VWP B;  3E3C A;  1I78 A;  1PMP A;  5IRW A;  4GE1 A;  4Y5D A;  2BSZ A;  4GNY A;  1SWF A;  3HOE A;  4ZHD A;  1EIO A;  2Q2P A;  1YWC A;  4CDD A;  1PTS A;  4FBR A;  1LDO A;  1EII A;  1VPR A;  2O62 A;  3BRN A;  1W4T A;  4N7C A;  1X8Q A;  3T6L A;  4TQ2 A;  3PEC A;  4NV7 A;  3WJB A;  3WZO A;  4ZFX A;  1NQN A;  1LCV A;  1RXJ A;  2X32 A;  1S7D A;  1SLE B;  4FBO A;  3H3I A;  2OVA A;  4WFV A;  2PI3 O;  4YFQ A;  2RTL A;  1TW4 A;  4IMO A;  5L3Y A;  2YG2 A;  2GTL O;  1FEL A;  2Q2M A;  2GC9 A;  3G7X A;  1MEP A;  1IFC A;  2ZAG A;  3FA7 A;  1ADL A;  2W2A A;  4HPA A;  3RZY A;  4O4U A;  4DQ3 A;  4I60 A;  2IZD B;  2A5B A;  3ZWE A;  1FEN A;  4GKC A;  4U8U N;  3N91 A;  1TXL A;  2HLV A;  1YUP A;  1B8E A;  1DC9 A;  2FGS A;  2X8F A;  2AMM X;  3NPO A;  4ORU A;  1GX3 A;  1IJ8 A;  2AT5 X;  4NLI A;  4QZU A;  5D48 A;  1SWO A;  1X71 A;  4ALB A;  1HY2 A;  1CRB A;  3RY2 A;  2IZB A;  3AEH A;  2W2F A;  1SWR A;  1VWG B;  5DPQ A;  4ML7 B;  1O1U A;  4FGI B;  1ALB A;  4CPI A;  5BYP A;  2CAM A;  2LBA A;  2NP1 A;  4O4O A;  1TOU A;  3HWG A;  5LJH A;  3P02 A;  3BU9 A;  2JOZ A;  5CE4 A;  2BT9 A;  3OJY C;  1HMS A;  1XKI A;  3OE3 A;  3RE5 A;  2L68 A;  5BVT A;  3CWK A;  2JU8 A;  3FID A;  4ZH6 A;  1YIV A;  4ZJ0 A;  5FAZ A;  1AEL A;  3HWE A;  5HTE A;  3FW4 A;  2OF8 A;  4ODD A;  3ZW0 A;  1SY2 A;  1O1V A;  1YP7 A;  2BLG A;  3PP6 A;  2RTJ A;  3SLO A;  1MK5 A;  1GXA A;  1LEL A;  1VWR B;  1SWC A;  1KOI A;  3U03 A;  1ML7 A;  4MVK A;  1SRH A;  1HMR A;  2WEW A;  3ZZV A;  2RTA A;  3P6H A;  3SZJ A;  2OYB O;  3FIQ A;  4KT5 A;  2RTO B;  5IO5 A;  3S60 A;  2JN3 A;  3MVF A;  4GRJ A;  2RTI B;  2IZA A;  5DG4 A;  1I4U A;  1I06 A;  2QMI A;  5H9A A;  3APV A;  2MM3 A;  3MG5 A;  4ZHC A;  2AVI A;  4LZV A;  1NBX A;  2WWP A;  1CBS A;  2RTB B;  3APX A;  3JQO A;  4HPB A;  4U46 A;  1VWJ B;  3STK A;  5IO6 A;  4GUZ A;  1I04 A;  2A0A A;  1YP6 A;  2QOM A;  1SWA A;  3WJC A;  4ZGF A;  3HOL A;  3DTQ A;  1VWH B;  5JD2 A;  1Y0G A;  1ZNG A;  2HZR A;  1VYG A;  1OBU A;  1WUB A;  2AT3 X;  2UYW A;  1JMX A;  3D97 A;  4TKJ A;  1NGL A;  3T2W A;  3CMP A;  4Z2P A;  1UYO X;  1LUQ A;  1ZRY A;  2X55 A;  5HA1 A;  1GT5 A;  1KXO A;  1LIC A;  4NNT A;  3CQR A;  4ZCB A;  1HMT A;  3I0A A;  2IZF B;  4HPD A;  4O3W A;  1DZK A;  4Z2O A;  1KQX A;  5BVS A;  2OY8 A;  4HWM A;  3NX2 A;  4GZV A;  4OEL A;  1K3B A;  3T1D A;  5HWZ A;  4GH7 A;  1CBQ A;  3BSZ E;  1VWL B;  4I3B A;  5L8N A;  3RDM A;  4YKO A;  1PBO A;  4O4X A;  4TKH A;  3EYC A;  3VG3 A;  4EEJ A;  3P6D A;  1SRI A;  4YDA A;  3P6G A;  3RWX A;  4AYH A;  2IZL B;  1QY1 A; 
#chains in the Genus database with same CATH homology
 1SXX A;  1X8O A;  3FYF A;  4YDB A;  2N93 A;  4QNI A;  4QYN A;  5KHP A;  2JU7 A;  4OMW A;  2RCT A;  1JYD A;  2AH7 X;  3UEU A;  4CV7 A;  5HZQ A;  5KID A;  2OZQ A;  1HN2 A;  1T0V A;  2FS7 A;  1FDQ A;  3FMZ A;  4ORS A;  1ZNE A;  3FR4 A;  1KT6 A;  2AL0 X;  1EXS A;  1JIW I;  3NQ9 A;  3IFB A;  4Y0R A;  4I9S A;  2WQA E;  4MVL A;  1EPB A;  1OPA A;  4PSQ A;  3NQ3 A;  1YWD A;  4O9S A;  4FBV A;  5EZ2 A;  5F6Z A;  1BBP A;  3ZW1 A;  2FT9 A;  1KZW A;  1IIU A;  1DZM A;  3WVM A;  2X45 A;  3EMM A;  1D3S A;  2KT4 B;  4M6S A;  2AT0 X;  2K23 A;  5F58 A;  2NNQ A;  3S26 A;  1OEE A;  2WSJ A;  3WJF A;  3FEL A;  4DQ4 A;  4D6B A;  3WJG A;  2JMB A;  3TF6 A;  4AZN A;  4MVI A;  2LKK A;  4WHI A;  2NNE A;  2GJ5 A;  4K19 A;  2WEX A;  3AKN A;  3BLG A;  2WUT A;  5HZ8 A;  1UZ2 X;  3PQS A;  4MIS A;  2L67 A;  4RUN A;  1QY1 A;  1DZP A;  2OVS A;  3QKG A;  4ORW A;  4ORR A;  3BX7 A;  5LJK A;  3ZW2 A;  4YBP A;  2BHV A;  3STM X;  1RBP A;  3C77 X;  2Q39 A;  1SXY A;  4O4S A;  1BSO A;  3FEP A;  2R56 A;  5AEO A;  5KIC A;  2CBS A;  4MVE A;  1MDC A;  1B0O A;  1CBI A;  1G74 A;  3VG4 A;  3BDR A;  5JR8 A;  3ZUO A;  5IO7 A;  3B2I A;  2FTB A;  1E00 A;  5D45 A;  2LBV A;  2ANS A;  1L6M A;  1QQS A;  1B4M A;  1AB0 A;  1SY1 A;  4CSB A;  2QO6 A;  1TVQ A;  4MIR A;  3STN A;  4IAW A;  4IMN A;  1FEM A;  3CQN A;  3K3L A;  2R73 A;  4IAB A;  2JW1 A;  4N7D A;  3UAQ A;  1SMP I;  5B29 A;  3BY0 A;  2OFM X;  4I3C A;  2KTS A;  5L8I A;  4LZU A;  4YKM A;  3U0D A;  1SY3 A;  1T8V A;  3ZQ3 A;  4AZP A;  1Y9L A;  1P6P A;  4IAX A;  4AZQ A;  4EDE A;  3FA8 A;  4IBA A;  4NNS A;  1DFV A;  2EU7 X;  5LJB A;  4WFU A;  1QWD A;  4IB7 A;  2QOS C;  3RBY A;  3BU1 A;  1QFV A;  2Z4H A;  1JZU A;  1PM1 X;  4HFO A;  3MX7 A;  4OS0 A;  3KQ0 A;  4KCA A;  1BSQ A;  1LF7 A;  3L4R A;  4NLJ A;  2MHD A;  4U8U M;  4ARH A;  1JJJ A;  1MVG A;  3EBW A;  3F9D A;  2WR6 A;  5H9L A;  1YWB A;  3S5V A;  2LA7 A;  2XKL A;  4O3Y A;  4GK9 A;  2KTD A;  4YCE A;  1SXU A;  3IA8 A;  4XME A;  5H9K A;  1SY0 A;  2RD7 C;  4KC8 A;  3FEK A;  3ELZ A;  2OVE A;  4KII A;  2CZT A;  4COT A;  1I05 A;  1HBP A;  5AJC A;  4ES7 A;  4JGL A;  5BVQ A;  1URE A;  4QAE A;  1G85 A;  3CBC A;  4I95 A;  3PH6 A;  1E5P A;  1MX7 A;  2Z4I A;  3CR6 A;  3RSW A;  3V8U A;  3ZW0 B;  5HZ9 A;  4YFR A;  2HZQ A;  1SXW A;  5LJC A;  1IKE A;  1ZND A;  3NX1 A;  4R0B A;  4A60 A;  1EAL A;  3WJD A;  2ZAI A;  2A2G A;  2IFB A;  1X8N A;  1U0X A;  1QFT A;  4QGX A;  4ALO A;  2HMB A;  1G7N A;  2POA A;  4YGH A;  4YMY A;  2M4L A;  1A18 A;  5HZ5 A;  5HAE A;  1LIE A;  4QQ1 A;  2GTF X;  3S5X A;  2X8S A;  4YGZ A;  4XMG A;  4ZH9 A;  1LIF A;  2QM9 A;  4QGW A;  3FEN A;  3U9P C;  3WOV A;  1OEJ A;  1A2D A;  3F8A A;  4UU2 A;  3KFH A;  3EBK A;  2ALL X;  3HWD A;  1BSY A;  3BS2 A;  1T68 X;  1GKA A;  2MJI A;  4Y0S A;  3KFI A;  4KC7 A;  1BRP A;  1ICM A;  2F73 A;  3EM0 A;  4KH8 A;  1VYF A;  4LKT A;  1OEK A;  3OD9 A;  3FR2 A;  1GX9 A;  3ELX A;  1OPB A;  4L3R A;  4NYR A;  4TNN A;  1KT7 A;  1MUP A;  3NQK A;  3Q6L A;  4I3D A;  2PY1 A;  4QZT A;  1B56 A;  1BEB A;  4AZR A;  4GDZ A;  4ID2 A;  1OBP A;  2W2B A;  3VG6 A;  1ZNH A;  4YCH A;  5CYB A;  4INN A;  4A1H A;  5AJB A;  1A3Y A;  3PPT A;  4YH0 A;  3LHN A;  4ZHF A;  5HTD A;  1CJ5 A;  1RLB E;  3PED A;  4ZHG A;  5HZ6 A;  3FLL A;  1SA8 A;  1GT1 A;  5FQ7 E;  3LV4 A;  1IKJ A;  5D8J A;  3HTY A;  1N0S A;  1EQD A;  2CZU A;  3F6Z B;  2AT6 X;  4I6S A;  1JJX A;  2ACP X;  5HA0 A;  1EI5 A;  1JYJ A;  3FW5 A;  4UU3 A;  5H8T A;  1DF3 A;  2Q9S A;  4PJ2 A;  4YGG A;  1GT3 A;  3SOT A;  4BVM A;  2FR2 A;  1GGL A;  2JU3 A;  4EFG A;  1HQP A;  1DV9 A;  1ICN A;  1X89 A;  4EQA C;  2K62 A;  2L9C A;  2GTL M;  1AVG I;  3TGC A;  2QO5 A;  3C78 X;  2KD2 A;  2X8T A;  3PQU A;  5F7G A;  3VG2 A;  4IB6 A;  5EDB A;  3UEV A;  3O2Y A;  1LNM A;  4IB8 A;  3HK1 A;  4TKB A;  1GT4 A;  2YMS A;  4AW8 A;  3RKG A;  2R74 A;  2WQ9 A;  4FQB B;  1NP4 A;  4U3Q A;  4M7M A;  1JBH A;  2FRS A;  4OMX A;  1FE3 A;  1ZNK A;  3ZUI A;  1R0U A;  2OVD A;  3P6E A;  1E06 A;  1H91 A;  1S44 A;  2G78 A;  2AT8 X;  3JS1 A;  1LID A;  4ON1 A;  5LKF A;  2FWV A;  4L1N A;  5H9N A;  1ERX A;  2RA6 A;  4HPC A;  2L5P A;  4NP1 A;  4WBK A;  2FS6 A;  3C76 X;  4ZGU A;  5LJD A;  5C0N A;  2DM5 A;  3VE1 A;  3HWF A;  1GM6 A;  2F09 A;  3VG7 A;  4BOE A;  1G5W A;  1LFO A;  3UEX A;  1IW2 A;  1EW3 A;  3D95 A;  5K06 A;  2XST A;  2P8G A;  5LJE A;  4OS8 A;  5EPQ A;  3NBX X;  2ACO A;  4GET A;  3ZI8 A;  3APW A;  1FTP A;  4NW4 A;  4O3Z A;  2CM4 A;  5FQ6 E;  3BX8 A;  2ASN X;  3MBT A;  1LIB A;  2LB6 A;  1Z24 A;  1D2U A;  4I9R A;  1BLR A;  3B2H A;  3I17 A;  1KT3 A;  3TGB A;  2HYS A;  1DZJ A;  3WBG A;  1CBR A;  1LPJ A;  5EDC A;  2FR3 A;  2QO4 A;  1EPA A;  4Y0P A;  5LJG A;  2CBR A;  3CBS A;  3SAO A;  2HNX A;  4A8Z A;  2A13 A;  4YBU A;  4A1Y A;  5HCC C;  2KW1 A;  4LKP A;  2E4J A;  4XMF A;  3O19 A;  4YFP A;  1OBQ A;  2CM9 A;  4U8U O;  1JV4 A;  2MWH A;  3P6C A;  1QY2 A;  3NAD A;  4ORY A;  4Y0Q A;  5EED A;  5LKE A;  1O8V A;  3DSZ A;  5HCD C;  3O22 A;  3KZA A;  5D47 A;  1X8P A;  1KT4 A;  4QGV A;  4O3X B;  1PEE A;  3KFF A;  1LKE A;  3AKM A;  2G7B A;  1ERB A;  5FQ8 E;  1KQW A;  1AQB A;  4XMD A;  1HBQ A;  3OBL A;  5AQ6 A;  2A2U A;  2X46 A;  4OS3 A;  2G79 A;  4EXZ A;  3UEW A;  2AKQ A;  1Y9T A;  4IB9 A;  5HCE C;  3B2L A;  1ACD A;  3NR3 A;  3PH5 A;  1S2P A;  3GE2 A;  4BQU A;  1TOW A;  4CK4 A;  1KGL A;  4U9C A;  1U18 A;  1QAB E;  2NND A;  1QY0 A;  2A3F X;  2RN4 A;  5EEE A;  1YWA A;  5F1E A;  1MX8 A;  4LQZ A;  1BM5 A;  3B2J A;  2RCQ A;  1BJ7 A;  2LFO A;  5D4A A;  4ZHH A;  3VPJ E;  4XMC A;  2OFR X;  5FEN A;  1EUO A;  3FR5 A;  3KFG A;  1X8U A;  3VG5 A;  4AZO A;  1GX8 A;  4RUU A;  3D4R A;  1BRQ A;  3APU A;  1KZX A;  1XCA A;  3FA6 A;  1U17 A;  3TGA A;  3FA9 A;  4O49 A;  5F6B A;  1GKA B;  4TJZ A;  4NYQ A;  5B27 A;  4XMH A;  1E02 A;  4AZM A;  1IFB A;  1QG5 A;  2RQ0 A;  2GTL N;  3WXQ A;  3VE2 A;  1A57 A;  2BS5 A;  3VU1 A;  3JSQ A;  3TZS A;  2Q4N A;  3WJE A;  4ORX A;  1KT5 A;  5HBS A;  3P24 A;  3B2K A;  5FFH A;  3GAQ A;  3ZW1 B;  4GU8 A;  3D96 A;  2MO5 A;  1ZNL A;  5L8O A;  2BS6 A;  2FLJ A;  1BWY A;  4D6A A;  4GNW A;  3P6F A;  1NP1 A;  4QRL A;  4QYP A;  4ZR2 A;  4TLJ A;  3NP1 A;  3E3C A;  1PMP A;  4GE1 A;  4GNY A;  3HOE A;  4ZHD A;  1EIO A;  2Q2P A;  1YWC A;  1EII A;  4FBR A;  1VPR A;  3BRN A;  4N7C A;  1X8Q A;  4TQ2 A;  3PEC A;  3WJB A;  4ZFX A;  1S7D A;  4WFV A;  4FBO A;  3H3I A;  2OVA A;  4YFQ A;  1TW4 A;  4IMO A;  2YG2 A;  2GTL O;  1FEL A;  2Q2M A;  2GC9 A;  3G7X A;  1IFC A;  2ZAG A;  3FA7 A;  1ADL A;  2W2A A;  4HPA A;  3RZY A;  4O4U A;  4DQ3 A;  3ZWE A;  1FEN A;  4GKC A;  4U8U N;  3N91 A;  1TXL A;  2HLV A;  1YUP A;  1B8E A;  1DC9 A;  2X8F A;  3NPO A;  2AMM X;  4ORU A;  2AT5 X;  4NLI A;  5D48 A;  4QZU A;  1X71 A;  4ALB A;  1CRB A;  2W2F A;  5DPQ A;  4ML7 B;  1O1U A;  4FGI B;  1ALB A;  5BYP A;  2LBA A;  2NP1 A;  4O4O A;  1TOU A;  3HWG A;  5LJH A;  3P02 A;  3BU9 A;  2JOZ A;  5CE4 A;  2BT9 A;  3OJY C;  1HMS A;  1XKI A;  3OE3 A;  5BVT A;  2L68 A;  3CWK A;  2JU8 A;  4ZH6 A;  4ZJ0 A;  1YIV A;  1AEL A;  5FAZ A;  3HWE A;  5HTE A;  3FW4 A;  4ODD A;  3ZW0 A;  1SY2 A;  1O1V A;  1YP7 A;  2BLG A;  3PP6 A;  1GXA A;  1KOI A;  3U03 A;  1ML7 A;  4MVK A;  1HMR A;  2WEW A;  3ZZV A;  3P6H A;  5IO5 A;  3FIQ A;  4KT5 A;  3S60 A;  2JN3 A;  3MVF A;  4GRJ A;  5DG4 A;  1I4U A;  1I06 A;  2QMI A;  5H9A A;  3APV A;  2MM3 A;  4ZHC A;  4LZV A;  2WWP A;  1CBS A;  3APX A;  3JQO A;  3STK A;  4HPB A;  5IO6 A;  1I04 A;  2A0A A;  1YP6 A;  3WJC A;  4ZGF A;  3HOL A;  3DTQ A;  1ZNG A;  2HZR A;  1VYG A;  1OBU A;  2AT3 X;  3D97 A;  4TKJ A;  1NGL A;  3CMP A;  1ZRY A;  5HA1 A;  1GT5 A;  1KXO A;  1LIC A;  4NNT A;  3CQR A;  4ZCB A;  1HMT A;  3I0A A;  4HPD A;  4O3W A;  1DZK A;  1KQX A;  5BVS A;  4HWM A;  5HWZ A;  3NX2 A;  4GZV A;  3T1D A;  4GH7 A;  1CBQ A;  3BSZ E;  4I3B A;  5L8N A;  4YKO A;  1PBO A;  4O4X A;  4TKH A;  3EYC A;  3VG3 A;  4EEJ A;  3P6D A;  4YDA A;  3P6G A;  3RWX A;  4AYH A;  2O62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...