4U4IA

Megavirus chilensis superoxide dismutase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
126
Chain Sequence
FFNVVTAICQLDKPHDYGYAIFTQLPDCTEIQFHLKNLPPGKHGCHIHKSGDRRNGCTSMGPHFNPFNLGDLGNIVVNNNGECNEIICVKYLPLTGSNQIIGRGLVIHEKEDDGDRIACGIIAYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cu/Zn superoxide dismutase
publication title The megavirus chilensis cu,zn-superoxide dismutase: the first viral structure of a typical cellular copper chaperone-independent hyperstable dimeric enzyme.
pubmed doi rcsb
source organism Megavirus chiliensis
molecule tags Oxidoreductase
total genus 30
structure length 126
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4u4iA00
2C9UA 1Q0EA 3GZOA 1F18A 3QQDA 4A7VA 2Z7YA 2Z7UA 1COBA 3KH4A 2R27A 1SXZA 2XJKA 3HW7A 2AQPA 1F1AA 1RK7A 3CQPA 1OALA 3GQFA 4A7UA 2AEOA 2JLPA 3K91A 4A7QA 1PTZA 1U3NA 1SRDA 2AQRA 2V0AA 2APSA 3H2QA 2C9SA 2E46A 3S0PA 1N18A 2WWOA 3L9EA 1OAJA 2XJLA 1XTLA 2SODB 3F7KA 1SXSA 1E9OA 1JK9A 2JCWA 5KBMA 4BCZA 1SXCA 1PU0A 1B4TA 1IBFA 2AF2A 4A7GF 1KMGA 4N3TA 1B4LA 1OZUA 1N19A 5CU9A 2GBVA 3KM1A 3GZPA 3PU7A 1E9PB 2LU5A 1E9QB 1IBHA 4A7TA 4N3UA 2ZOWA 1OZTG 2E47A 2VR6A 4MCNA 1CBJA 3KM2A 4B3EA 2WYTA 2WKOF 1F1DA 1L3NA 1TO4A 1YAIA 1SXBA 2NNXA 3GTTA 1Z9NA 2ZKWA 1XSOA 3HFFA 4BCYA 2C9VA 2ZKXA 1DO5A 3CQQA 1SDAB 2AQNA 3LTVA 1BZOA 2AQTA 2GBUA 2WZ5A 1OEZW 1SDYA 4L05A 3F7LA 4U4IA 3GZQA 1HL5A 1E9OB 1S4IA 1YSOA 1DSWA 2Z7WA 3KBFA 1SXNA 4BD4A 3HOGA 3QQDB 2Z7ZA 1EJ8A 1IBBA 3H2PA 2AQSA 2WZ0A 2ZKYA 1BA9A 4A7GA 5KBKA 2K4WA 1TO5A 2WZ6A 1IB5A 1SXAA 3KH3A 3L9YA 4MCMA 3ECWA 1SPDA 1PZSA 2Q2LA 2VR8A 4FF9A 1F1GA 3MKGA 1EQWA 4A7SA 3KBEA 2WKOA 1E9PA 2GBTA 3CE1A 1UXMA 1CB4A 2WWNA 3RE0A 1E9QA 5KBLA 1HL4A 1JK9B 1MFMA 4OJAA 1IBDA 3ECUA 3MNDA 1Z9PA 3SODB 3T5WA 1QUPA 3GTVA 2AQQA 1JCVA 1SOSA 1YAZA 1XTMA 1FUNA 4OH2A 1UXLA 1ESOA 3ECVA 2WYZA 1P1VA 1AZVA 2VR7A
chains in the Genus database with same CATH superfamily
5CJ8A 3N41F 2D73A 4NAQA 4C47A 1MFCH 1S7RB 2VN5A 3BPLB 3KPLB 4HHWA 3NGBB 3VXTA 4ZW5A 5HDWA 1GC1C 3OKKA 2CHZA 4J23A 1DVYA 4P5RA 2F5AH 4I5BB 3TN0C 1AZNA 3US9A 1MDAA 1J1PL 2NY0C 3NQKA 4JQVA 1OALA 1DTUA 4ODHL 2B1OA 3ECBB 4HPYL 3MBWA 1MHEB 5F7NC 5JIDA 4M02A 1UXWB 1O5PA 1BM3H 1LMIA 1H3PH 4KXCA 4EUPG 2DYRB 2XQYK 2AK1L 1J05A 2AI0L 4GO9A 5HHQB 3D33A 1L7IL 3FCSA 5MP6L 1T1WB 4IIQA 1M05B 4LARL 5ISZB 1TXKA 5I1LA 1G7JA 2WYHA 5EFIB 3DX9B 3IFPA 4ONHA 1YN7B 2F53B 4N2CA 1PZ5A 4N26A 5AYTA 2P5WB 1D9KB 4N2NA 1HJCA 5I8KL 1ZIAA 5LBSA 3EIFA 3GBLA 3HHSB 4AVIA 2XU9A 1M1SA 3BLBA 4ZOCA 4XO9A 2EE9A 1S9VA 4JFOA 4XGZA 2HLAA 5D2LB 4P3WA 3G6AB 5DDHB 4R0LA 1WA1X 1E27A 1OE2A 3ZTEA 3UJTH 1O6TA 3DROB 1E6OL 4X5PA 5BRQA 3CZSA 4KRPB 4EN2A 2VDMH 4J3OF 4S1SH 1G7LA 2DKSA 4ZSOA 5I73C 2CALA 2X42A 3QEHA 2IAMA 4P23D 3DYMA 4AENB 1ZS2A 3PQYD 3MLTA 3KLKA 1MCCA 5FECA 1T1XB 5DJDA 3ARZA 3EDDA 4JLRB 5CJQL 1YEIL 3GBDA 3V0GA 4Q9QH 1MHHB 3FU5A 3N1GC 3SKJH 3RZCB 3C5ZD 3L4VA 2FATH 4O2CB 5T3ZH 3W11D 2V37A 3WNLA 1KZYA 3E3QC 2DQFB 4E9QA 3QI9B 4PB9H 3PV7A 2E8ZA 4LCCB 1PD1A 4FF9A 2IBZY 2W5PA 1BECA 3LEVL 2DAVA 5L7XL 3OKMB 3WN5A 2J1XA 1A4BA 2WMPB 4GRLC 4UU9A 3FTGB 1YEJL 3JWDH 1JK9B 1JDAA 1G43A 3Q9PA 3AUWB 1JCKA 1S9WA 1YEKH 2Q76B 5EU6D 4BSVA 1FFPB 1MVUB 3D12B 5JOFB 5F7KC 5EEUA 5EF3A 5D7IB 1OM3L 4XAWH 2V3DA 4XP6L 4UTAA 3N91A 5IQ7H 2Q7NA 3QUMB 4WWPA 3HTLX 5FUCE 3WHXB 1SHXA 2EAEA 5BXFA 5AVZB 3KWUA 3KH4A 2BOCA 1BWWA 1OHZA 1FGVL 2X1WL 2IPKA 4Z6AT 3RWDB 4GW1B 4HS8L 1DN0A 1OAKH 1WFUA 4XP9H 2H26A 3S5YA 5DJCB 5D7JA 3G6JF 4XMLH 1OF0A 2JJSA 3KJ6L 4DPCX 2ZYHA 1X5ZA 3AM8A 4AMWA 3KWWB 2D4FA 1N18A 4JFXA 1JZ2A 4WSGA 4XR8C 3VWKC 1NCAL 2R0WH 3EH1A 1XBDA 3JTSB 4W9GC 1QW8A 3JWOH 4F15B 5D55A 4ZUTA 3FO2A 2VR5A 1OAUH 2H2PD 1IEBA 5CILH 4HJJH 2KDGA 2XVGA 3A6OA 4TNFA 4AKQA 2GSGB 4C83A 3VXUD 4FP8H 3TIEA 1MFDL 1LK3H 4G8FB 1JZJA 3QYMA 2XDHA 4U1HA 2YC1A 4HJ1A 4H8QA 4HC1H 4PP2A 1OQXA 3EF4A 3QRFM 4G3YH 4E9SA 2HB0A 2QKIA 4P4KD 3WGVB 4HFWA 1GRWA 4OZIE 2R1WA 1WE5A 3OZ9H 4LCUA 2WQVA 2IALB 4EAEA 2DM2A 4B9PA 1L6ZA 3CN0A 3L3KA 2WLLB 2F61A 3P9MB 4QOKD 4MD5B 3TT1L 5IY5B 2Q87A 5JDSA 3HKFA 5C08D 2HKAA 1NQBA 4QR7A 5FYKE 3HR5B 4GIAA 2ZYSA 4GLRH 2GEEA 1UZ8A 1Y6MR 2WTPA 2XWZA 4K8RL 4W4OC 1AG6A 4WK2B 3KCWA 4WWNA 4PRIE 3DGGA 3N0AA 2YS4A 1SJHA 4K9EL 1KYOJ 4LCVA 3KWTA 5KVFL 5DEGB 4TSCL 4KVCH 5TH2B 4YSQA 4M6AA 2EQDA 2WLIA 3BKCH 1A6UH 4MX7B 1L0QA 4YE0A 4RDQG 5G2NA 5C6TH 2OSLA 2VZTA 3KBEA 5BPPA 1D6EB 2EABA 2J20A 4P9MH 4Y5XB 4EI5B 2NSQA 4HMEA 4PEEA 4F5CE 2A9ML 5E6ZA 3TGXA 1CICB 2DIJA 4JDTH 4NXKA 2CH8A 3UACA 5DJYA 4PJ7F 2GHWB 4MYWB 2VLJE 5ITBH 4ELKB 5ICXA 4PUBH 1HXMA 4KZ0A 1Q9OB 1Q0XL 1XWVA 4BKLB 4DOHE 5IW6A 4PU2A 3L17A 5DZNA 3REVB 4EIBA 5ANME 1KELL 3FSAA 3O2WH 4UDUA 3RB7A 3F5WA 3SJVB 3KYKL 4YNYB 1ES0A 3OWEA 3KPQA 2MSPA 2NR6D 5AB0A 4S11A 2B0SL 4MA7H 1KLUA 3F00A 3VH8A 4KVNL 4JY6B 2B4CH 2WXRA 1N59B 3NCJH 1HCVA 3GJFH 3ZKQD 4HH9B 1U92B 2Z31B 3ZY7A 3EKCA 2H3XC 5E8OA 3NP4A 2C1PA 2OFQA 3S2CA 1HWWA 1X7QA 3D3VA 3O8XA 1NIFA 3IFOB 4UYPA 4XXDB 2NXZB 2X1OA 5DMIL 4AGNA 4Z76B 5CCKL 1NAML 2IAMD 1Q1PA 4HKZB 1TZOA 1V3JA 4X8JA 4PRPA 3HI5L 2C4FT 4PHZA 2JWYA 4GG8B 1WISA 3BVDB 4GSQA 4PS4H 1TKWA 2XLLA 1DQML 1D7CA 3EYSH 1M1XB 2IMNA 4ANUA 4N2GA 2B1HL 3LPGA 3RWFA 3IN2A 3X1NA 2DOCA 3MRRB 2WQ8A 3SKMB 1PG7X 1KENH 1ADQH 4TYUA 1FH5H 3CX2A 1RULH 2XI9A 2FECL 5CZXC 5I8EA 2EDTA 3MX0B 3T2LA 3FN3A 4GQQA 1R3JA 1AZZC 1RPQA 1MRFH 3JT0A 5A7BA 5I6XC 1F2QA 2NTSP 3C09B 4O4YL 1R0AL 1UURA 3B3BA 4ZW7A 1RZ8B 1AIZA 4LSTL 3VGEA 1YMMA 3DVFA 2M83A 2Y2TA 5DVPA 2WNKA 4MDIB 4Y16A 4DZ8B 4PJGF 5C0BE 7PCYA 43C9A 4M62H 5LO7A 1OSPL 1PBYA 2XQBL 4UV4L 3INUL 2JELH 3EYVA 1KCUL 1F00I 1E43A 4NM8L 5IBLD 3IXTA 4IOFC 3QCUL 2WTRA 2XN9E 1XZ0A 4OD2B 1XH3B 4DPBX 3ARBB 1VA9A 4M9PA 5DS1A 5L88H 2ETWA 1UJ3A 4ERSH 2FUQA 5TE4H 2IF7A 5D7JD 5BVPL 3SZKC 1PY4A 3QUML 3MNDA 3CFUA 3RX5A 4PJEF 5IESL 3SHSA 3BRDA 3L16A 1YPZA 3ESUF 3AXHA 2WUCL 2JB6B 1XH2A 4UDTB 1USQA 1U8QA 4OCSL 2DMCA 4YHNA 5KVGH 4YXHL 1WICA 5F9JB 4OTXL 3HAEG 5B1CA 15C8H 3QQDA 2IQAA 2VAJA 4TQEL 3HRZC 3MRGB 3MRFB 4LEEA 5E9DB 3PJNA 2V2TB 4QRFA 3V7MA 4PJ5B 4ZFFA 5IMMB 1GTNA 4ZPTB 1MCLA 1GZQB 1VAHA 5CN1A 1KEGH 4TVSa 1KULA 5AAPA 2J8UF 2UZXB 1TJGH 1BVLA 5F1IA 2DQDH 2J6WA 3DJ9A 2Y22A 3W1ZA 1GJIA 2P4AB 4FEIA 4YDMA 4NPYB 3SKOB 3EYFA 2VLRA 4PJ9C 3ZU8A 4A2DA 1E4XL 1W0VB 1WZKA 3SGEI 1EANA 4ZPVA 5ADOL 4AE1A 2R2HB 3GMNB 4FERA 1GW6A 1P4IH 1B4LA 3IJYA 3KPRA 4UQCA 4XHJD 5EHFA 4ZK8A 2KQNA 3KPPB 4IU2B 5IQOA 1FYTE 5KZCD 5CXPA 3BW9A 4YDJA 1BVZA 1TCMA 3MJ9L 3N44B 2HRGA 2XPYA 4BH8A 2EVHA 4MMZA 5K9OA 3NIGF 4NO2A 4TLSA 5H37G 1EHLL 4HUXA 5I66A 2IG2L 4XPTH 2PCFA 4GI6A 1LGVA 4L8SB 4MB1A 4ABWA 2XXFA 3S9DB 2LV4A 2X5PA 3KPLA 4UT7H 5I76B 3P73B 4BIKA 1J0ZA 1N9PA 1TQCB 3EHBC 4FXGC 1DO5A 4P2QB 2JKNA 3VI4B 3ZDYE 4I5BA 3U1PA 2Z0UA 2ZJSL 1HAUA 2BHZA 2GABA 4JVPA 5AW1B 3ULUC 1TZHB 1YSOA 3FQNA 3TPUB 3O4LE 3UCRA 1QTSA 1MHEA 5AOMA 5F0JB 1UXWA 5CCJA 3UMNA 2XQYA 1BAFH 4ODVL 3OR6A 4FCAA 4OB5L 1M05A 5TQ2H 1DQQB 1G9NL 3ARGB 1OGTA 3E8VA 3LPPA 4AGPA 2FRGP 5JYLA 5EFIA 4XXWC 4PG9B 1L0XA 1YN7A 3SBWC 1FQ9C 2E59A 3U9PH 4KNUA 5KJRL 2QQKH 1D9KA 3MRIB 1JGEB 1PDKB 3NPSC 4HJSA 1LD9B 4K15A 4Y88A 1K9TA 1UWEL 5F1NA 3HHSA 5DHEA 1DVFB 1BG1A 2FYVA 3BISA 4XO8A 3BQUB 1S5IH 5D2LA 3TT3L 3WFDL 2OLDA 3G6AA 4IDJH 5DDHA 3X13B 1Z2KA 1L4IA 3NIFE 2AK4A 4LOEA 4I88A 4NKMB 4OFPA 3D6GA 1KTJA 1V7NH 1OB1B 5IW1B 3KLHD 4LVNB 4HGKC 2DIEA 4YAQB 4H20L 3ESOA 4PWIA 3AT0A 3O8XD 3QH3B 4M7KL 2MWCA 1A9EB 2J73A 1YNTB 3H42H 3MV9A 3Q6FB 3R1GH 4PW4A 4WUUB 5BQDA 1Q0XH 3PWVB 1XMWA 2ITDB 1PKQE 2DQGH 4LPCA 4PRPD 5DLMH 3S3SA 5EF0A 5C3LD 5E9NA 1T1XA 1KF9B 4JLRA 3P4NB 2YK1L 1DJGA 1KELH 1MHHA 2F74B 3RZCA 4U3CA 3CVIH 1RV6X 4AYFB 4M3JA 2DQFA 2VH5H 2EIBA 1KC5L 1A7OL 4XNZC 3TESA 4KVNH 4LEXH 4XXCC 1YMHB 4IK7A 1A6ZB 1GW0A 3KBPA 3OKMA 3QZWA 3FQ1A 1Z6JT 3UAAA 3UL4A 4HHGA 4M7LH 1A47A 3FTGA 5ES4B 2CCVA 1J8RA 1JK9A 1PX4A 2X4RB 4FHJA 4N5UA 2NMSA 4GSDL 3BAEH 4CKQA 4F33B 2Q76A 1PPIA 4WWKC 1FFPA 2ZSWA 2X70B 3Q5YA 4PJIF 2D3NA 3VRLF 1MVUA 4PWJA 4OD3H 1CDJA 4E41A 3HMWL 2Y25A 4ALAC 3VXME 4LSVL 4FQCL 1E9PB 4KZDH 3SPHA 3N0PB 1EEYB 2QSCH 5CBAB 1MRCL 3WHXA 4GAGH 2HUHA 4UQBA 3FFCB 2Z92B 3S48A 5I6MA 2YAEA 2P8PB 3NAAL 4NQVA 4AW4A 1I75A 1XIWC 1N64H 4NWUL 3NCWA 4JRFA 4UIKH 1JPEA 1WUNT 3HMXH 5DJCA 1D3CA 2H0EA 4JQXC 3PWLB 4LIQH 1MFNA 1EV2E 2VDPB 2YAMA 4QAWA 5KVEL 5FM8A 3POHA 5EBWA 1XF2B 1N2RB 4XXWA 5FUCC 5I6OA 1CZ8L 1RZ7H 1XXDC 4HK3N 3ILQC 4EZMA 4KHXH 4EXKA 1BHGA 4CN6A 4WK0B 1UUSA 4XPFL 2K70A 2YD6A 3QJXA 3CC1A 5D8JH 2X53A 2AEWA 4CU6A 2CPCA 3MGAA 4MTMA 1F1GA 4K5MA 4OCXL 6FABH 2GSGA 5DWUL 3P3YA 1AR1D 5E2VH 4FQHB 2WKOA 4QRRE 4G8FA 5AAWC 4I0PC 3FC8A 4F8PA 2YA1A 5IBTH 3UBXB 1CGSL 2WQUA 3BIBX 1UYWL 1I9EA 1P2CB 3SYCA 1H6UA 4K8RD 4TULH 4UBDD 1KBKA 3VTAA 1Z9OA 2IALA 1BCIA 1T03H 3S97C 3WKQA 5CFHA 1IO4C 3P9MA 3NFNB 2VO5A 4MD5A 4CILA 1ZT1B 5JMOC 5DJAA 1RIVH 1YNKH 2VLRD 1FHGA 3NZHH 4HJ0D 5IESH 2LW3A 3HR5A 3P4MB 2DQJH 5JIMA 3BH9A 1Y7VA 4JS7A 3KPRD 2AV7B 2ZAIA 4I77H 4X99A 3PXJA 1SXZA 4OLUL 2AXWA 4OTXH 1BPVA 1N0XH 4U1MA 5DEGA 3DOSB 3SO3B 3ZDZE 5AALA 4G8AC 4P46D 2DQHL 2IWKA 4Q58C 1Q0YH 4M43H 4XNUH 3L3OC 1CQYA 4TSAL 1D6EA 1U0QA 1DVQA 1FZJA 5DJ0B 5DZAA 3QQ3A 3V5KB 1UQSB 3FBKA 2O5XL 4XNQA 2HCZX 5TK2A 2QADB 3E9UA 5FO2A 1JGUL 3G5YB 5B3JE 5EO9B 2IBBA 1X5FA 1HK6A 3MLVH 4OGZA 4Z7OB 4WW2B 1J5OH 1Q9OA 2MPVA 5ETUB 5CZRA 1RFDH 3DRTB 4MXVF 5C0CB 3B2MA 3MRHB 5LN8A 2Y6SC 4YNYA 2F53D 3QHZH 4NHUA 2PYFB 2BNQB 5I17B 2P5WD 1D9KD 4HWZB 1WLHA 2HT2D 1IGFL 4M7JL 1AGFA 4JY6A 4XP1H 4EPSA 3T1WA 1MW2A 1UADC 1MZZA 1BBJB 4GEJA 1RZIB 2IWEA 4HH9A 2Z3FA 3RWJA 2Z31A 3G5WA 3L5JA 4YPGB 5F6HJ 4E5XG 4O02B 3LN5A 3W2DH 1T1ZA 3BMVA 2CA4A 4KQ4H 4MSWB 1WYJA 3NCYP 3P0YH 4NM4L 4PJHB 2RA1A 2N56A 4Z76A 4GG6B 3P69A 5AVSB 1MJUH 4K0OA 4LPWA 4MKTA 4IS6B 4A38A 3TJEH 4OFIA 1VLXA 2OTUB 4S1QL 2VR8A 4GG8A 3BD3A 4TUJB 5AL0A 4KY1H 3CG8A 1F4YL 1MH5B 1OW0A 1VDGA 3QXVA 4HFUL 5TD4A 3RZCD 1U3JA 1GSMA 3MACL 2F9BT 2ZUWA 1D7BA 2K3HA 3SKMA 1Q9KB 2IDQA 4XP4L 2H47C 2HN7A 2X9WA 5DQ9B 1AY1L 3CDCA 3DX6B 2R2CA 1ZEAH 5TE6L 3WY3A 2WO3B 5CEYA 1ZHLB 3S88L 4RFOL 3W39A 3NCFB 3MNMA 1R17A 1ODUA 2MPAH 3V7AE 5MI0B 3I9AA 4CVZB 4CJ1A 3V9FA 1BBDH 3CH8A 4BGLA 2EZ0D 4MDIA 2NZ9C 2WINB 4B7LA 5EU4B 1KIQB 2EXYD 3D39A 3EH4B 3QCVH 4XRCA 3U48A 3ZE2B 3EOTH 3MCKA 4MXWL 4M7KH 5T3ZE 4WJ5B 2AEIT 3HG1E 5JPMC 2CLVB 2YOCA 5EZOL 1CGVA 3RGHA 5IVXB 2HKHL 3TBSB 1CLOL 2CSPA 1YECL 2YGOA 5DRWA 2ZX6A 3BAYA 1FHNA 3R19A 5L2KB 1HHGB 2C1OB 4OD2A 3JBG7 3L6FA 1XH3A 1AQDA 1B3IA 1PLGL 3Q8AA 4DN3H 2XTJB 3D4YA 3K1KC 5E5MA 5F1KC 3ARBA 5CCHE 3RDTB 1GVIA 1I9RH 2BSCA 2MTAA 3FB5A 5FW7A 5IJVB 2P24B 3EO9H 3QRLA 4LHUA 4XN9A 1HN1A 1KTDB 3GZKA 5EA0H 2DEXX 4GRMB 5B1JC 3C5JB 3CZJA 4LU5H 4ODWB 3JXAA 1J87A 2FQEA 2ZNXA 1TTUA 2JB6A 1FG9C 2VXVH 3DBXB 4AVHA 3WAKA 1JPSL 4HJUA 4YFDB 5F9JA 1ZMYA 3K0YA 4PJDB 3SDYH 4PRBB 1NBVH 5JOPD 1FNHA 1I1AB 2FX9L 4M1GH 1U8IA 2NW3B 3MRFA 1HE8A 2ALAA 3MRGA 2H2SD 2VDPL 3NIDF 1RKRA 5KG9A 2V2TA 2VLJA 3CQQA 4PJ5A 4ZFOB 5E56A 1VADB 1T04B 1PYWA 4ZPTA 4JPVL 2VMJA 2DD8L 3SDCC 1KCWA 3RYMA 5I1HL 4YFEA 1A14L 4K7PY 4WFHD 2EVIA 4HWBA 4WFFD 2UZXA 4BQ8A 2E74C 2EEBA 3BEVB 1HFUA 2IH1B 5INDA 3QCTL 2WGXA 2JCCB 4NI3A 5GXBB 3AG4B 3QRGH 3LYRA 4NPYA 2ALWA 4WI2A 5CGYC 2YEVB 3O0RH 3SKOA 3THML 1W0VA 2WAHA 2ZQKA 1S9YB 2K9FB 5DT1H 3V0AC 3T09A 2R2HA 5GJSH 4XBGA 4L0PB 2ZWLT 3VVVA 4OCRL 1T5KA 4BSJA 4HCIA 1RSFA 4ADJA 5IVOA 3FK3A 4XPFH 2V5MA 1DEEA 2FNBA 4FQQB 1CFSA 3HNVL 1K3IA 5LB1A 1Z5YD 5GZNC 1DUYA 1VHPA 4Z0XA 4U6XB 4L8SA 4ZD3L 4LAQL 4EUPH 1E28B 1EZVY 2IBZX 1N8ZB 3ATAA 4F2MA 3T5WA 3RPKA 2YGVA 5AW8B 4NZRL 4P2QA 1RMFL 3VI4A 1B4RA 1ID5I 4X6BA 4Y1AE 3IGFA 3MCLH 2WXLA 4EI5D 2JH2A 4PWKA 5DJ6A 5BJTB 1R3KA 1YEGH 3EH3B 3I6LE 1TZHA 2WTOA 4XMXA 3TPUA 1CICD 1NGYA 2FTAA 2F18A 1WAEA 2VZOA 1BLNA 3DETC 3QC5X 4RGMC 2Z7UA 5DFAA 4S2SB 4ZTPH 5LAXB 3SKUD 5IEKB 3BEWB 4AOFA 4P9HL 2B9AA 3CMOL 2EKSB 2IH8A 2QVIA 2X3BA 3GWJA 4FMVA 4ZT1A 3QJTB 3KYMA 1DQQA 1NBCA 4F7MA 3HS0A 2X2YA 4OIAA 3DHUA 4PG9A 1SN5A 1AFVH 1I7TB 4E0RB 3C6LC 3SJVD 4XPBL 4Y9EA 5DSCB 3Q5OA 1JGEA 1PDKA 4K71C 1LD9A 3TLRA 4UWQB 3EBGA 4P48A 1DVFA 4MJIB 4YXLL 2DQHH 1XCWA 3HJEA 1KN4H 1KTLB 3X13A 3B83A 1IBFA 2AF2A 1A4KA 1WFIA 4PV9B 3D07A 3ZT6A 4NKMA 3GDCA 2MTPA 2Z31D 1KJVB 3TOPA 1N8OE 4WFGE 4CL7A 2QZQA 5GSRA 3V4UH 1U8JB 2W59A 5GIRB 1O6SA 3QH3A 2NXZD 2AFNA 3LV3A 1QNIA 1YNTA 3Q6FA 1V27A 3SKNA 3PWVA 3BFQG 3LAFA 1T7XA 1JGDB 3N04A 4NO5A 1NTDA 4U6VL 4ILDA 4F3FB 3K2IA 4JPWH 2F74A 4S10A 2H8PB 4NZTL 4O02L 1K5WA 1Y6KR 3LS5L 4UZSA 4KRNA 1CD9B 1FNFA 4Q9BA 3PDOB 3SN6N 1OTUD 3IDGB 3GSNH 1A4JB 4YWGL 5IMOB 2ROXA 1AQKH 1A6ZA 1AR2A 1EXUA 4K73A 5GHWL 1V7MH 4HOWA 4A39A 2BNUB 2WSPA 2CIKA 3I9PA 1VCAA 1J8HE 5DJ2B 1IB5A 3IRPX 2CDFB 2A6JB 4HGWA 3O6LH 4QHPA 4Y4KC 4BK4A 3BSZH 1REIA 3QAZB 2X70A 1G5GA 2P80D 3DURB 1JWSB 1WIPA 3NPZB 3D39D 2RFXB 4TNWF 4W6YB 2H41A 1E9PA 3ASNB 1U8CB 1NMCB 1D5MA 5K9KB 4OV5A 4KJPD 5CBAA 1KJMB 4DO5A 3LKPA 4L9DA 1XGUB 3FFCA 4GRWF 2Z92A 4UM9A 4W6XB 1UACL 2WP3O 3NEEA 3BKJH 4PGDB 1VFOA 1YAZA 2VUKA 1FYTA 5AZUA 4C56B 3ARBD 4XB3A 4AT6A 3Q1SH 3VO0A 4TOYH 3RJQB 3C60B 3OLEA 5FK9B 5IREA 4P06A 3RFRA 3PWLA 5I1JH 2ENSA 4AQOA 4DHLA 4N6RB 1IEAB 3QYNA 4O5LL 5HDLA 2LFGA 4Z7VE 2WV3A 1XF2A 4OIBA 2AV1B 1TMQA 3HW7A 5C8JA 1B6UA 1EAJA 4RFNC 2LOEA 4OJYA 1I8KA 4UOW1 2X1XR 1T2QL 2QQQA 3EFOB 2NNAB 3GK8H 5CP7B 1TNNA 5TFSH 4WV1B 4NN7B 1JBJA 3QIWB 1I4FB 5DC2A 4BFFA 4IHOB 3QJQB 3ZHFA 2JE8A 5GGQH 1MREH 5CIPH 2L4OA 3QWOB 2DEYX 2X7LB 2E27L 3IGLA 4N8CH 5E9DD 4FQHA 3S3CB 3WTSA 4PG2C 4EI6A 4GXVL 3QE5A 4PJ5D 3UBXA 1EJFA 4KJWD 5C0AE 2GT9B 4XVOA 3WIFB 4M8VA 2HJKB 4X4MA 2XIDA 4L4VE 2DN7A 4WO4C 2DYSB 3ULAB 3VXRE 4E5XB 5I1CL 2FZ3A 3QZBA 2CKNA 5FYKU 3BKMH 4KXBA 5EH1A 3MRDA 4JAMB 1DCLA 3ROOB 5KVGE 1AYOA 3ZZQA 4Y9CA 1G6RH 1HDMA 3CJJA 3NFNA 1ZT1A 2LE9A 1J9SA 3NJKA 1EJOH 3TIDA 4ZFOL 1YQVL 3GRWH 3DVGB 1SNRA 4QXVA 5EPMB 3P4MA 5IB4B 3QPXH 5CD3B 3CU1A 1S8DB 3UGXA 4DVRL 4HVBA 1TJIH 2PP9A 4XTRD 3EGXA 1TDQA 2AV7A 1R24B 3KJ4C 3P11H 2WLNA 3TEUA 2MFNA 3LHAA 4P5KA 1SY6H 1I3RA 3LNEA 5KW9H 4DO4A 4G8GB 3PHOB 5HSFA 2AQTA 3NMEA 3DUHA 1XF5B 2MNWA 4JK0D 2B2XL 3GYRA 2JB5L 2YQ2A 2HG5B 5HYSG 2CE6A 2FWSA 4FLQA 4U1NA 3DRQA 3QG6A 1KN2L 3UC0L 1G7PB 4UT6L 2IPTL 4P2QD 4NO3B 5I1HH 4W68A 2E9JA 3J27A 3V5KA 1H3UA 2WBKA 1NWOA 1OF2A 4E9WA 4W70A 5JLZB 1MZYA 1ACCA 3GJFK 2YFNA 4Z0BH 2PO6A 4X4ZA 1CDIA 3HHMA 5EO9A 2YPLB 1NUFA 2QV4A 4CSZA 2VR4A 3MXVL 2F8XC 2OMZA 4Y7MA 5GSVA 3DXAB 4OZHE 2PCPB 4N1HB 4XMPL 5ETUA 2V8LA 3T6VA 4M6MH 5C09B 3SDXF 3VX0A 5C0CA 3ARGD 2Y0SA 1EIBA 4YL4A 3TZVB 3EYQC 3TNNB 3PABB 1ZANH 4JB9H 2VDNB 2LVCA 2PYFA 1VGEL 2BNQA 4X8XA 1D5ZA 5HVWA 5I17A 5EOTB 4Y2OB 5I71B 4HK0B 4ZS7L 5J11B 1RK1B 3CBKB 1DVFD 1KV3A 1EWHA 2R51A 2PF6A 2NCEA 3BQUD 2YD0A 3AGVA 1BBJA 3ZMEA 1WT5C 1NFAA 2CGYA 3MV8B 1RZIA 4KKQA 4GQRA 4LPVA 3IDMA 2ZCLL 3SYPA 4O02A 5FF6B 2F58H 5LCVL 5FDYA 1TQBC 5GS3A 1YG9A 1W8NA 2E4FA 4MSWA 2RACA 4TQ8A 4PJHA 1BYOA 1XCQB 5G5DB 4EOWH 4AW7A 2G9KA 4XWGL 2EC9U 1L9SA 3LH8A 4HIHB 3FNKA 1ROCA 1QP1A 3ABKB 1SRDA 2BO0A 2D0GA 2OTUA 3CLEH 4PG2A 4WUUD 3CLWA 4G43A 5B7EA 2ADFL 5FKAB 3NYKA 4UANA 3TBVB 1MKFA 4HD9A 1LMKA 4WO4A 3ML9A 5KJ7E 4M7ZB 4FC3E 4Q74A 5D93C 1SXSA 1E9OA 3ZW3A 1FO0A 5DQ9A 4C59B 5CMAA 4WCYH 4NB7A 3DX6A 1NFKA 1MPAL 3CFMA 4FMKA 5HVGB 1CE1L 4NDMB 1W72B 1CF1A 1T0NB 1ZHLA 2EEDA 1AGEB 3CVHH 1BXXA 4KAQL 2ED9A 1RIHL 1UEMA 3WLWD 2PPAA 2J4WL 3H3PL 4JRXE 1HX0A 4PCSA 5KN5B 4QRRA 2J1ZA 2NNRA 1WITA 3QIUC 3CN2A 1OZTG 3DVIA 2UVFA 1KOAA 2FECI 3KEDA 4PRNB 1JYWA 4MAYC 1KIQA 3DGDA 4NP4L 3BZEA 4JPSA 4X0NA 3BP7B 4M8UA 3QR2A 1UFUA 2IPUG 1FSKC 3P0GB 2CLVA 4FFZH 3F12B 4K07A 5IVXA 2F68X 3H85A 2ZX5A 3N43F 1R5WB 2DDQL 4L0YA 2B3RA 1SEQH 1KPRA 4XCEB 5D1ZB 3SDAC 3W9EB 2ZP9A 3Q43A 1HHGA 2PABA 3IEAA 2C1OA 5IVZB 3UGEA 1HEZB 2D7QA 3FFCD 3QIBB 5E8DH 5ISZE 3BAKA 5DVMA 1ZTXH 2F08A 3HAEH 3U7YL 1IM9A 2JJTA 5IJVA 1NL0H 2P24A 4HHAB 1NM9A 1SYVB 2C3VB 1GL4B 1KTDA 3KW8A 4OI9A 2P5WE 5CHNA 2APTA 4AZUA 1MCIA 2NYKA 3SQBA 5I6KA 3FFOA 3NBNA 4ODWA 1MEXH 1OP9A 1XDTT 2V4LA 2VQ1B 1U8PB 4GO8A 3T0AA 1SVCP 4ACPA 2UZYB 4RISL 2Y7OA 4PJBB 1CL7L 1IARB 5DMGD 4FKEA 3ARTA 4HULB 4YSOA 1N6QL 1QQDA 1TTFA 1YEWA 4PJDA 3TJHC 4PRBA 5GRVK 1E5ZA 4PJCB 4YO0B 2I85A 4WI9A 4NJ9H 1EPFA 3ZMNA 3US1A 5FHBH 1IL1B 2HVKB 1H8NA 5E6IC 1JNNL 1E5AA 1IGTB 4P5TB 3OZKA 3IETB 1FP5A 3NJFA 4N0CC 1VADA 4QXGH 1T04A 3J8F7 2IEPA 4OCYL 2M26A 1ZD6A 5ADPL 2YRBA 4ZAKB 4LIQE 1MFAL 3FSVA 4NT6B 3RIAK 5AWNL 2O6PA 3GBNL 3BEVA 3QFGA 5H37H 5JHAA 2NXYB 3H9SB 4P99A 2JTYA 3CFDA 3N1PC 4OLZH 5LXGL 2RAMA 1F11B 1F3JB 1FFNB 1S9YA 5JW5A 3P54A 1DSFL 1LO2L 5ICUA 2JKXA 1BMWA 2UWEA 2Q8AL 4ZTOH 2DQCH 3VXPB 1F0LA 5A2AA 4W9HC 2IFFH 4LBAA 3C8HA 4I87A 4EZKA 5FM5M 2XACC 1JZ8A 4FQQA 3W0WE 3WLBA 1E4XI 4V11A 4MDRA 1BLIA 1FFTB 2VMCA 1JNLL 3CPLB 5CS7A 2R4SH 4LLUB 1N8ZA 1EMTH 1CF8L 3JWOC 4GXVH 4Y19B 5D7IE 1BYNA 3VSQA 3LZFH 1OAYH 2EC9T 5FYLH 3FTSA 4L0ZA 1X5KA 1I9JL 4FFWD 4OLWH 3NJGA 1KDJA 4KTYA 3BWUC 3LQMA 2K78A 3CDYA 2PO6D 2QADD 1YY9C 4PD4K 3TCTA 5LAXA 5ID1B 5IEKA 1MSPA 1UOKA 4NBXB 4AJVA 1OCZB 4QHLB 4UOQA 1HHJB 3FO1B 2YR3A 2ZUVA 3G6DL 3STZA 2HX7A 4OM1H 5DEFB 2QJDA 2HKFH 1AOHA 5C0CD 5T33H 1I7TA 4IRZH 5AVTB 4KK9C 5MERB 4JRYB 4OZFH 5KSUA 4G9FB 4W9LC 2BNQD 3BAXA 3QG7H 1D5IL 4NP9A 4K55A 2V2WB 4L1BA 5FYJL 1MJ8L 1CIUA 1K4CB 5JQ6L 3CFBA 5FWRA 5E6RB 3DX3A 3KR3L 2JJUA 5K33A 2CGRL 43CAB 4ZI8A 4HJTA 2V5TA 3MRBA 4HCFA 1L7TL 1KJVA 4QYAA 1HI6B 4Z8FH 1ZDQA 4MQSB 4LASL 4WFFE 2BFVH 3WNNA 4NUGL 2CCLA 4YSPA 3RBSA 5GIRA 1FLRL 1JXGA 3MLUL 3UP1A 1MWAB 2QL1A 5TGBB 3NIFF 2LU7A 4TUKL 4D3CL 1FPTH 1NOAA 1QFUL 1NGXB 1JGDA 4G7VL 5IFAL 4F3FA 5DFTA 2WM0A 4AV0A 5H2BB 5HGHA 4NPJA 1WP6A 2H8PA 2BWQA 2ZWNA 3MBXL 4OGQC 3TVMC 3F7PC 1L9PA 3C5XA 2NY3B 1VGEH 5C7XH 2J88L 3IDGA 5GS1C 2X40A 2N01B 1SHWA 1A4JA 4RX4D 4KXDA 4YSSA 2VDOB 1CFNA 1F18A 4LDLB 4ZS7H 5I1IH 2CO4A 3HI6H 3FHAA 2OI9C 3Q7JA 4I4WA 4NWTL 5ESAA 5E4OA 4Y4FB 2BNUA 4G5ZH 3RU8L 3FB8B 5IIEB 1O9VA 5J06A 4X6FB 1IKNC 3R0MA 1L6PA 2C3WA 5DJ2A 3FN0L 5D1QE 3ARDB 3IT8D 3WJJC 1U33A 2D2CC 4U4BA 3BFWA 2CDFA 4AYID 2A6JA 4QHNB 3MLPA 2OK0H 3OMNB 1A1NB 1R5VB 1JWSA 5DI8B 3HB3B 2GPZA 5AZEL 4JFDE 3IDYC 5B8CB 1W72L 2DB8A 2IFGA 5FLUA 1U8CA 5K9KA 1C5BL 5A2KH 3BPNC 4RGNE 5LVEA 3RVXD 4HJIA 1KJMA 2DQUL 5F72S 4DERA 3P4OB 4BHUI 1XGUA 1CK0L 1UM4L 4M4PA 1ORQB 4FQ2L 5JYMA 2PNDA 4NQSB 4TVUA 2XTJD 2BHFA 1NBYA 3RDTD 4C56A 3OLGA 2VUYA 5KWYC 3NTCL 4Z7NB 1R19A 1IM9D 2E9WA 5D4IA 3C60A 4N3UA 5F9AC 1ET5A 4OZGE 5FK9A 3WDHA 4D0BB 5CKAA 4X9IA 5CINH 4CNIA 1WWAX 2FJGB 4Z7UB 2KPNA 1DVZA 4MA8L 4N6RA 2BY0A 5F8QC 4NN6B 4GQPH 5AW0B 2XWEA 1XD0A 1RJZA 2AV1A 2AANA 1JTPA 4NGHH 5AYQA 4YR6A 3VB8A 3I85A 1ND0B 3KXFE 5KUMA 1FC1A 1ILUA 4PLKD 5JW4R 1QSZA 2WWMC 4WV1A 3QIWA 2EUWA 3QHFH 3C12A 5KSAC 4BFOA 2YGNA 3MNWA 3RX9A 4MA1C 1I1AD 3QWOA 1TVBB 1GTFA 3IF1B 3QHTC 1G1KA 2R0KL 4U1IB 1QW9A 3F85A 4YHKL 3CHQA 5J6HB 1IFHH 2BPBA 4X6DE 3UG4A 2GT9A 3WIFA 3NK4A 3C5SA 2V3FA 3OLDA 4KH2A 4ODSH 4P3DB 1QRNE 5FHAH 1IM3B 3HZKB 3ES6B 3B2VL 4KROC 1Q72L 3AY2A 1TZIB 4JAMA 5DRZA 4FQJL 4FTVB 2CMRH 4Y2LA 1TOXA 3DVGA 3QDMB 3B5TA 1RZKH 5IB4A 5CD3A 1S8DA 5GRJL 4FX5A 2ZOKB 4CMHB 2X12A 4JKNA 2XHNA 4N68A 3VI3B 2QGDA 1FVDA 2XKNB 3WY1A 3CWGA 1ZDSA 1E4WH 1M7DB 1OANA 3D87B 1U6AL 4N1CA 2ZOTA 1XTMA 3PHOA 3GKZA 4AKPA 1XF5A 1AC6A 1X5GA 4XVSL 1WEJL 1HSAB 1KCVH 2CUHA 2VXTH 3NRFA 1FI8C 2F7IA 1ITBB 3QULA 4G8IB 4OCYH 5CWSB 4D9QD 2YQ3A 4XBEL 3NA4A 1E7UA 4LKXB 5EU3B 1KB5H 2IANB 3DSFH 5KVEE 4JGJA 1NDTA 2MH4A 3ZDZF 4B6ZA 5JLZA 5ALCL 3MFGB 3GJFA 5E8NA 3RWCA 4JFEB 2YPLA 4MBRA 2ZUTA 3SCMB 4HPOL 3DXAA 3H9HA 3X14B 1A8ZA 2PCPA 4RA0C 2PYEA 1CTOA 3FSOA 3G3LA 4XVUD 1SMOA 1LO3L 4YDZA 2A6IB 3CXDL 1DBBH 4M1CD 1SXCA 3MLXH 1OTTD 3PABA 3WCYA 3OG4B 3WFEL 4C57C 4TM9A 2WXNA 1T7VA 4G6AC 4X4XB 4U05A 5EOTA 5AAMC 4Y2OA 4UQ3B 3SGJA 1NGPL 3H7LA 2UUDH 4B3VA 3IRZA 4MJID 1IBHA 3D52A 4HIXL 4LO9A 1QZNA 1NMAL 4M6NL 4MJ4A 4ELMB 1T4KB 3BN9D 1F8TL 2OBGA 3NFPB 2XZZA 4WNQB 5FAAA 5DK0A 3UERA 3CLFH 1A7BA 5FA3B 4XN5A 5FF6A 3HFFA 5HD8C 5FGBA 1OKEA 5DURB 4EZJA 3VFNA 4E42B 5EWIL 3ZKMC 1XCQA 1FL3B 5G5DA 1HESA 4Z7AA 2PMZA 4Q6KA 3ELAT 4NKOA 4X50A 1HIMH 4HIHA 5D7LB 3K6OA 4AL8H 3U2JA 5F7AA 2Z8SA 4TVPH 5FKAA 3FU0A 2YARA 3TBVA 1W6LA 2ATPA 4AEEA 5GGUB 3OJDB 3SB3A 4HA1A 1TZAA 3EJYD 1K5NA 5HY9B 4MNQE 12E8L 4K7PX 3ZE1E 5HDOA 5SX5H 1MWAL 1ACYL 4H1LG 4NDMA 1MNNA 4YSUA 1KB3A 4UBDC 4A6YH 2MCG1 2XBZA 2EO1A 2HT3D 4K23L 4EO5A 4K9EC 3TF4A 3PHQB 4U2YA 4EBQL 4L3AA 1ZXQA 3RNKA 4OJAA 5JORB 1UCBH 2YUWA 2F7QA 1NCCL 3U4KA 4PRNA 3FQXA 3W3BA 5HHNA 1FGNL 4MA3B 2VDOL 2N0MA 3BP7A 3LRKA 1BJ8A 4CU7A 1T83A 2ZP8A 5EORL 3ZR6A 3VFRA 4RDBA 4FA7B 2FJUB 3LKSB 4XCEA 5D1ZA 5F7EL 1EZVX 3E6HA 2OJZH 3W9EA 5IVZA 1HEZA 1URLA 3PHAA 3QIBA 3T2NL 4H25A 3CIAA 4IRSB 1EXGA 4NKQB 2WNXA 3O6FB 2H9GB 3VXSB 3TYFB 1KBGH 1PEWA 3T0EA 4C56D 1XSKA 2DWTA 4KHTL 3T9WA 2F15A 3TYGL 4X42A 3SYAA 3C60D 5JHDB 1F90H 3SYOA 1EHXA 3NSFA 1YEFL 4HPHA 2XNAB 3ETTA 2BX5A 4H26B 3UZEA 2VQ1A 1U8PA 1AXSB 3FN0H 5C07E 3GMQA 3T6WA 4YEFA 1GZHA 3FT2B 2UZYA 4HXAH 3V6OA 1TU2B 4Z7IA 2E0PA 3QS2A 5J0BA 2VC2H 3BSHA 1HZKA 5J8OA 1PFCA 3V5DB 3RZWA 3BRFA 3QIWD 4QXUH 3MLWH 1B4TA 1TTRA 2APBA 4PTUA 4PJCA 4YO0A 3FCUB 4A67A 2YD2A 4ONFH 5DFWH 3RG1C 3TNMA 1IL1A 2HVKA 3WUZA 4P5TA 2KUTA 1IGCH 3OHMB 3IETA 4RWYH 4WUUE 3SE4C 1R9FA 4OZHA 3U46A 3GKWH 1MI5B 1TZGL 1A6AB 1I8MA 4ZAKA 4X5XB 4NT6A 1DANU 2ZCHL 4KO9A 3NA9L 4R96B 2WBJC 1OY3B 4G9DA 4YDKL 3S34L 1FAIH 2A99A 3KZ8A 1DJWA 3HIZA 4JG0H 3DWTA 4KXZH 4XMKH 3B2DC 1FA4A 3H9SA 1MF2L 1MCNA 4KRPC 3OAYH 1NZRA 4U1LB 2ICWA 1IAKB 2GBUA 3VCLA 1F3JA 2A4ZA 1IGMH 3P1VA 2Q0ZX 3ALPA 1WWWX 1FFOA 1NSNH 1R3LB 3EF7A 5E08L 3PHSA 3RGBA 2VMFA 1X6LA 3DECA 4BQBA 3WEOA 3S4SG 1NKRA 1XV8A 1CWVA 2AJXH 3HI1B 4OJCA 3UBXI 3CPLA 5D7KD 3GSQB 4LLUA 1AI1H 3ZDXF 3T4AC 4DGIH 4L37A 4B9GA 3QI9C 2I5YL 2BSTB 2APFA 3D51A 2CCWA 4LCCC 5T1LD 4J27A 1E8XA 1EQWA 3WJMA 3ZE0B 3AXIA 3KMDA 1AXTH 3FB6B 3KPMB 4ENZA 4M6OL 1HL4A 3TO4C 4NX0A 2EINB 4QRUB 1DSYA 2CLRA 2YPLD 3QEQE 4L29B 4AEHH 4FQJH 5FPIA 2EXYC 5FYJD 3ZUNC 4BA8A 3DXAD 3VXNB 4FXKB 3KWVA 2F7RA 1OVZA 4NEHB 1KTBA 3WL9A 4JRWA 4JRXA 5DEFA 3TTYA 1T2JA 3UTSE 1AJ7L 3VD4A 4U1JA 3WFHB 3TZVD 2CBOA 4PY8J 2R29L 4G8EA 1CXFA 4JRYA 4U7SA 1L5GB 1UENA 2Z7YA 4B0MB 2VQUA 4AV5A 4YHML 2VDQB 1DJYA 2NLJB 1NMBL 2ZXCA 2EDYA 1KCSL 4NKDA 5GJTH 3B7TA 1K4CA 1H9DA 3MFFB 3U6RB 4KK6C 4DAGH 4CGUB 2CNYA 3CX5J 4WI4A 3CFEA 4KZCA 5IBUB 3QPQD 2RB8A 4HZ1A 3QUYB 2P1YA 1SJXA 3LXBA 2H3NB 1RUQL 3DV4B 3NSYA 1HHKA 4X98B 3LN4B 4YHZL 3F7QA 1PZCA 2FHFA 3IJEB 4RQQB 1G1CA 1P6WA 1XR8B 3UX9B 4F15C 2DTMH 1PX8A 5KSVB 3FTXA 2HSIA 1NGXA 1YY8B 3MAWA 3TFBA 5H2BA 5AB9A 2MCPL 3ARXA 3WKML 4HG4K 3WNMA 1DJXA 5T5FH 2A77H 1RZGB 5HI3C 3RVVD 4AGQA 1GYAA 4PIRF 4LLMA 2E5EA 2YZ8A 2WO4A 5A2BA 4L4TA 5IV2A 1F1DA 1QSVA 3CXHJ 1GGTA 5T5NF 4LBEA 1J86A 4BCYA 5EZJA 3WKYA 4PB0H 3ZKND 5IIEA 5TTRA 3T08A 4Z3JA 1D2PA 2K45A 3HMXA 1J5DA 1AE6L 3L4XA 4HBCL 3ARDA 3T6ZA 3DMMB 4JJ5B 4QHNA 1GIGH 2GITA 3IFLL 3T3MB 4HCRH 4XCFH 4CU8A 3O3AA 2NY7L 3M17B 1R5VA 1M71A 1PJWA 5DI8A 1OAZL 4ODUB 2P5EE 2CRYA 5I23A 2N7BA 1XEDA 1LO4H 3HS9A 1IAIL 2ADYA 4LP4A 1YJDL 2JLLA 4W9FC 2KT6A 4AC2A 4DTGL 1C9SA 4BQ6A 1SDDA 5D1ZD 1EFXA 4L2YA 3BLKA 3PNWA 4PGCB 4DEPB 4F37K 2UY6A 1AO7B 1O75A 2YEQA 3QIBD 5IQNA 2HTKD 2J21A 5D1QC 3V4PH 5IG7B 5AD0A 1F42A 3OSVA 4GAJH 5D70H 3T0ED 1SLWA 1F4XL 4Y5XC 4D0BA 3CZLA 4JKPL 3FTUA 1EDYA 5FM4A 1QLFB 1CICC 4J3OH 2WIIB 4HSAC 3VGHA 5K1NA 4RGNC 2OX5B 3UJJL 3WXWH 2MNUA 4JY5L 1OGPA 1JZGA 2Y7QB 1ND0A 1ZA6A 2GHZA 2J6EH 4G1EB 3AAZA 2EVGA 3I6KB 1ZTXE 5EORH 4X6CB 1TVBA 3CPUA 4Z7VF 2R0LL 4YGVB 1WWCA 3IF1A 4GG6E 2R27A 3SE9H 4RMQA 4P5TD 5J6HA 3N06B 3WXVL 3ZYIA 2AJUH 5KAQF 3VXQB 1M7XA 2D3VA 3DOHA 1LYQA 5AW6B 1LHZA 3ULSB 4ZAKD 5IQLA 4P3DA 3HC3L 1RSYA 5IFHH 3K46A 4OI8A 3ES6A 3FHEA 2R9HC 5A1AA 2DRUA 3IXAB 2Y4SA 2RR3A 1TG8A 5BS0B 5JUEH 3TYGH 3H9SD 5TDNA 4G6MH 3T3PB 5I75B 3O11B 2NXZC 4W9KC 4XC1L 4FZ8H 4GS7B 3D0LB 1RZJL 1NKOA 2XKNA 3HC0A 3CXFA 2RCSL 1M7DA 2C7UA 2IH3B 2H0FA 2AMUA 4OQTH 5FGCB 1AIFB 5FGRA 2VJ8A 3S36L 1M3JA 1DBMH 1W80A 2WPGA 1OTUC 2I9LA 4GXFA 2E9BA 1M9SA 5CWSA 4PS8A 1G1YA 3N3EA 3DARA 3HE6C 4LKXA 2IANA 5EU3A 4XZUB 1C16B 1SDAB 2ZCHH 4WVRA 1YEEH 5L2KE 4FG6C 1EAPA 4LSDA 4X9BA 1Q94B 1EO8H 2R29A 2YMTA 3C09C 2GJ6B 4YXKH 1JTOA 2NNCA 1YYML 4DVBA 4TTDC 3RI5K 3TA4D 5FV1L 3SCMA 4D7BA 1PW3A 3Q8FA 3MN8A 2EE0A 2Y36H 2GTZB 1GGBH 3X14A 3I74A 1B0GA 4N86A 2X10A 4JFYB 4JFQB 4PGZA 3X3FL 1KBPA 4NLAA 4RMVA 2WBWB 4EMZA 4HIIA 3M6DA 1J1OH 2DBLH 5D1QA 2JMRA 4JN2A 5FYLE 1V54B 1KYAA 3G5VB 4JRYD 4G9FD 4AKOA 3B7YA 4X4XA 4YK4B 4UQ3A 1NINA 3HR6A 4GW5B 3UTOA 1QTPA 3M1OA 3IBOA 1AHMA 3O41B 5DO8A 4ELMA 3NFPA 1C12A 1S3KH 3CDZB 3GGWB 4WNQA 2HXAA 4B53A 2C7FA 3DO7A 5FA3A 1FE8L 4QJ3B 3CVHB 3GSVB 4LSUL 2VIRB 3BE1L 1KGCE 3VDAA 2VDQL 5JW3H 2IGTA 1IIIA 3BVNA 3KLSA 5DHXB 1VCBC 2N4IA 3E0GA 1T6WA 2ICEA 2WC7A 4YBQC 1T5XB 2BM3A 1UGNA 5D7LA 4OZGA 2DMHA 4K3DL 4L8BB 2JCCE 2PR4L 4JFFE 4JL1A 2GSIB 4L9LB 1YQ2A 3P30H 4PHXA 3VQ1C 2HAZA 1KJ2B 2B59A 2G3ZA 1TCRB 4AM0Q 3JVGA 3MLYL 3OJDA 3IB4A 5HY9A 1FL5B 2NY3D 3PJSB 4LMQI 3N85H 1DVTA 2BZCA 1CI3M 3ZX1A 4P5MB 4EEEA 4J7RA 4L4TD 1EERB 1H3TA 3EFFB 4PCYA 4JFHD 2APSA 3ZRCC 2IBGA 5JIIA 2DQEL 3IGAB 2EUZA 4XE0A 2AABH 2L7EA 5DEJA 4Y4FD 2E7MA 1P5VB 1JFHA 1OAJA 1T4WA 2F8OA 2VLKE 4AMKL 2AJVH 5F71A 4ADGA 4DP0X 2CO3A 3ARDD 3PUCA 5JORA 4FAAB 1T89C 4DGUA 1FBIH 1PU0A 4PJFB 4UT9H 2R2BA 1VKXB 4D0CB 2O5ZL 5LNGA 1KGIA 4KTDH 2R39A 4DKEL 4HF5L 2KLSA 3LKSA 4PVBA 1JF1A 3EAKA 5KSBB 3GI9H 5EUOE 2XIBA 1TJXA 2WQXA 1B0RB 2YGPA 4J8QA 3ZOAA 2FGZA 2PWEA 2EIJB 3RVWD 4M5YH 2EEAA 2RJMA 1TQCC 4OCNC 4JDVB 2CBQA 2Z4QB 3ZXAC 2LLGA 5SWSB 3TA3C 1VJSA 3BSGA 1BQLL 1OSZA 4U4IA 3LKOB 1S7XB 2XNAA 5FOBA 4NNYB 2XZCH 1ED3B 5KS9B 5HHXH 2EYTA 4F8LA 4X4YA 3DJSA 3FT2A 3GHEH 3TFKD 5J3HC 4PGBB 3OKOA 1LO5B 3MA7A 3IDJA 1BQHG 1TPXB 5DF0A 1IIKA 2R8SL 4XC3H 1RVFH 2K8MA 3L7EA 1PVHA 4HUUB 4LCWE 5D2LF 4KNSA 4UILL 1S2EA 1SHSA 5ESQB 1Y1UA 2QHRL 1T0PB 1CL7I 1MI5A 2FD6H 3LS4L 5AW4B 4ZMAT 3H55A 5ILTH 1JERA 1K8DB 4X5XA 1U3HC 3N2JA 3BQUC 3QZPA 2VW7A 4ZDHA 3U4BH 3IMBA 2WANA 1GPOH 5IROA 5EIVA 5C2BL 1FVEB 3DHJA 1QUPA 1T21B 3E6FB 1L9TA 3P9WB 3NACL 4ZW6A 4FFYL 4U1LA 1IAKA 1QI4A 4PQXA 4FTVD 2ED7A 3QDMD 5ALBL 4P49A 3UJJH 1FNEB 5CSBA 1C08B 1MHPH 5F6IB 5JHMA 4MAUL 2X9XA 4GLRI 4WEBL 5BO1H 2Y24A 5I74B 1UC6A 2J1YA 4QCIB 4UAOB 2AQPA 5EN2B 5EG6C 5M94B 1MFBL 4U1GC 2NUPB 4XO3A 4KDVA 5C0JA 4HU2A 5LGKA 4BCXA 3GSQA 2EYSA 3S8GB 3QT2A 5LWYL 2VRKA 3B3IA 4F7EA 5J13C 3PFUA 4HUWB 1INQB 3GIVB 3KPSE 3G5ZB 2QR0B 1HEJC 2IAND 4JJHA 1QA9B 3FB6A 3KPMA 4P2RE 3D0VB 3V55A 5I82A 4MNQA 3IDXL 1HC1A 4ZUVA 5D7IF 3LXCA 2MKLC 1QFHA 3ULVH 4L29A 2B8OT 1KXQA 1D5BA 4GAAA 3SCMD 1D6VL 5IWLC 4KK5C 3IE9A 2YMXL 5IW3A 3VXNA 2ERJB 2B1AH 2VZSA 4WNSA 2YJQA 5INCB 4F1ZA 3LNDA 3IRCA 3WFHA 5CEZH 4V1DB 5AOZA 2NPLX 3Q8CA 3AG2B 1L5GA 4HH8A 1MJJB 3B9AA 4ODXB 1AGBA 3GO1L 4Q97A 2CPUA 2NLJA 1EZSA 2WXIA 4Z77B 5BZDB 1ET8A 2AZUA 2VXQH 4OSUH 3DX1A 5HI4C 5IJKC 2OMUA 2WUBH 1CDYA 3MFFA 1RERA 3PUUA 4KUZL 4XT1C 3VFOA 4JO1H 1ZT4A 4R5XA 3U6RA 4M7LT 1T1YA 4P3CL 1CGTA 1QACA 5IEHB 2HVJB 5BV7B 4R8WL 4LKCB 2XG5A 4MDJB 3QUYA 1HNFA 3FZUD 2G30A 3RFZB 5DURD 4A7GA 1HNGA 4X98A 4YSTA 3MDJA 4NI6A 3FKUS 3IJEA 1CLVA 3ILPA 1XGYL 1ZGLM 1HYSC 2OYKA 1QG3A 5KSVA 3BSZA 5D7LD 3IFNH 1YY8A 1X4ZA 2YKKA 4X0KB 1PG7H 5KJ4A 5C07A 1IGJB 2IVFC 5DR5H 2NDGA 4KI5D 4IRJB 1NICA 1RZGA 4O2EB 5HJBA 4NQEB 4JHWL 2RD0A 1F3DJ 1RJCA 1EO7A 3HRPA 1QFWH 2G0KA 4ODBD 5L6YL 3BKYL 1KEMH 4G8GE 1QLRB 25C8L 1ZIBA 2DZEA 1ASQA 1ONQB 1IBGH 4EIZC 3LRHA 4OFYA 3MLSL 2XCMC 5DUMH 3H56A 3O3DB 4TVPE 1URIA 4LSUH 5HHOB 1VSCA 3M17A 4JVWA 2VAAB 3OKLB 4ODUA 3U30B 1O7SA 5CZVL 1X9UA 3EDJA 5IK3B 1XF1A 4MRCA 1XSJA 2AEPL 3HZMA 5BZZA 4ETYA 4R90L 4HKJB 4NQDB 3PP3H 4WQOA 4YH6A 3OXRB 4OJFL 2BNRE 1P69B 5CIPA 5F3FA 1QKZL 5A6IA 3ZK0A 1A0QL 2A5UA 2CUIA 3OSKA 5C09E 3VGFA 5IG7A 4IRSD 3RKDD 4R7DA 3LH2H 2G5BB 3O6FD 4KQ3H 4K94L 3EJTA 4AM0A 5FUOL 3W5NA 1L3WA 3EBAA 3QDJB 4UV7H 1QLFA 2DL9A 2WIIA 1OM9A 4Q6IC 1KMGA 3CHOA 2OX5A 1J9QA 5IMKB 4NHCL 4TSBL 1G6RA 4WW2C 1NFDB 5D4JA 3LRLA 3MV8E 3PL6C 4U1KB 1HWGB 1JHKH 4G1EA 2LU5A 5FOJA 3GRWA 1GMEA 4N87A 2X87A 4FL4C 1HS6A 3V79C 4IJ3B 2K6WA 4Z3GA 3I6KA 2FEDD 2PKDA 5D1ZI 4YGVA 1SY6A 4OAWA 3VXOA 3S6CA 4M61B 4C8XA 1W16A 3VXQA 1MI5D 5BMFL 3GMMB 1BOYA 3RL2B 2RTTA 3VWJC 5DVKA 3VE0B 4UF7C 1QNZL 1OGAE 4NUQA 2F5BL 5IROD 1R75A 5BS0A 5EO1A 4QYOB 1DFBH 4K5OA 2DWYA 2G5RA 1NLDH 2E8YA 1NEZG 4BXSV 3H54A 3O11A 4WZ9A 4B50A 1T0OA 1L6XA 3GFUA 4FQ1L 3I6GB 1OOWA 2CK0L 3Q48A 3GXPA 4FNPA 3BYTA 3D0LA 4RVBA 5JXEA 3RBGA 4N1EA 3WDJA 3IE4A 2IH3A 3QQ9D 2NQ3A 2WLZA 2YRLA 4N0UE 3WO4B 3V0JA 1AIFA 3HJ0A 1HYRC 4OF5A 2Y1ZA 4FYQA 1H5BC 1KCLA 5KYYB 3WE6B 5FO7B 3SQOL 4BUQA 4MMXB 4N8VG 2I9TA 1KIPB 3WEAA 1UKSA 2UUDK 5AG9A 5I18H 5IJDC 1U2HA 1FNSH 3BT2H 1T3FB 2VDRH 4I2XA 1E2ZA 2O30A 4G1MB 3HNTL 1E40A 1KG0B 1OOAA 4U3SB 3MR9B 5FCUH 2P8LA 5DQDL 1B2WL 2ZTBA 2K3TA 3O6KH 3ESMA 5DFVC 2Y7MA 1KFAH 4MS8D 1BP3B 4E9VA 4Y9GA 1IJ9A 4JFYA 4XI5D 4JFQA 1ZLWH 5JNYA 1VESA 4Y8DC 3WELA 1MAKA 5F7YC 1OP3K 1G7MA 2G4EA 2AJYH 1T7ZA 1LP9E 3QFJA 3T04D 4PJBE 1G6VK 1WRFA 4RIRB 1ZLUK 3UO8B 3RAJH 3LB6D 3RDTC 4AQ1C 4WTZA 3O41A 2AQ1A 4IKJA 3LXAA 1YYLL 5GGTH 5SX5K 2D8KA 3GGWA 1OL0A 5D4HA 1ASOA 2MCMA 2R1XB 3MRPB 2G9HA 3CVHA 3GSVA 1JNHB 2VIRA 3D7PA 3QUYD 3V6ZA 4YHPB 2CK2A 4KK8D 4WKZA 2ZCKH 4EIGB 1BQHB 3ILDA 2D31B 1VRSA 1OPGL 2ADIA 3PGFL 4QKTA 3GSOB 3GHBH 4H1LH 2CJSA 5CLWA 1T5XA 4MNGB 5FUZH 1LDPH 3MNVA 1JVKA 4YFLI 3QJRB 1L3NA 1IC5L 2HX8A 4XN7A 4TTGA 1KJ2A 1TCRA 4GQZA 5BV7L 2NX5E 1M6UA 4FFZA 4FKKA 1IZJA 3VWJA 2Q6WB 2YXMA 2W9DH 5A2JH 4A04A 1VEPA 2PETA 3WDIA 4MXQC 2AEQL 4PYHA 1JZFA 3WE1A 4L05A 1QR1B 3BGMB 4R4BB 3P3TA 3EFFA 1HOCB 3EUUA 5MEPB 3TU6A 2AJ3A 3AADB 2TAAA 3QA3A 2WZPD 1LWJA 2R56L 3NFSH 5DD5H 1G7IB 2ZKYA 2XG4B 3MRJB 4K3JL 4AIZA 2VGLM 4Y19E 2XZAL 1PS3A 2HA1A 3QZNA 5AZ2L 5TE7L 3ZE1F 3MREB 3DMMD 3WJLA 4FJYA 2VXUH 5DS8B 5DYFA 1KPUA 4Z78B 4YUEL 1VKXA 1YNLL 3GJEB 1CIDA 1NPUA 4QAMB 1A6WL 1H5BA 3L3DB 1Z0NA 3CDGB 3RPIB 4P0DA 5KYUB 2HTLD 3AC0A 3T6QC 3MODL 2D7TL 2V2XA 3BVXA 3VI4F 4J39A 4XWOD 5FIEA 1CMOA 1B0RA 3QC6X 1NGZB 2ESVB 1AO7D 3QISA 4LRNH 1O6VA 1IVTA 2Z4QA 4FQXC 5JIHA 2CJTA 4N90E 4FJ6A 3SYQA 3O2DL 4KKNA 3HPJB 4KTGA 4GW4B 3LKOA 5JXAH 1S7XA 5KYXB 3BUYA 1S46A 4NNYA 1ED3A 2AS5M 3FT3A 4DPRA 2E6PA 1JZ6A 4ADIA 1DE4A 3CVDA 4ZBJA 4NNXB 1AKJB 3MJ8B 1AZUA 4PGBA 2Z93A 1TVHB 1WD9A 1LO5A 2A9DA 3QORA 4YC2C 4YOKA 3WD5H 1LE9A 1UH2A 5L2JA 3OD3A 4P4RA 2VOTA 1M2VB 4MS6A 4XX5A 3FONB 5LUMA 2VDLB 2J55A 2KS0A 4CSTA 4M9OA 2V0AA 1OTTC 4HUUA 2L04A 5SX4I 4AQ1A 2V17H 2AJSL 3K8MA 4BRVA 5ESQA 2X4TB 1J7VR 2D0FA 5FV2A 5JW4Q 5HBBA 4GFTB 4NS0A 2AVFA 2XRAL 1RU9L 5FKPB 4CADB 2OZNA 4WI3A 4LLVA 5AUMB 5F2FA 4K94H 2D3LA 4UQ2A 1T21A 3E6FA 1OCRB 1MFEH 2CRZA 3VFVB 3CZFA 4E9LA 5BS0D 2VW6A 1SM3L 3VYPA 2R4RL 2W38A 3BCDA 1PFOA 2YN5A 2YPVH 5D96B 2NY2B 3Q6GL 2YAPA 4OUUB 4LGRB 4LGSB 3VFMB 1FNEA 1NC2B 2OS7A 5BZWB 5D7HA 1C08A 3U4EB 5EC1B 1H3VA 2W0KA 4NRYB 5JXED 1MRDL 3L5WA 4ODTH 5EN2A 5BQ7B 3HNSL 5T1LA 2BVPB 2O1AA 2NUPA 1HEHC 2FL5A 5CU5A 4MMYB 5E1AA 1E4JA 2XKUA 3OAUL 4IRZA 1T0MA 4OZFA 4GSRA 1UZGA 5GS0H 3BVUA 4KGJA 4WDIB 4HUWA 5DD1L 5EBLA 5CKGA 1CGUA 3GBMH 1INQA 2CJUL 3GIVA 3D69B 3P2DA 5CBEB 1RUMH 1ETZB 2QR0A 3COOA 1FF5A 1ZVYA 1QA9A 1BFVH 2AQ2A 3D0VA 4BH7A 5JOEA 2XFGB 1E6JH 1S5HA 4TS6A 2GJ6D 3DYOA 3WO3B 5IUSA 3GXMA 3P77B 2BOBB 3C2AH 1VGKA 4Z7NE 5FB8B 3QAZC 4ZFZB 4AQ8C 2XY2A 3NRQA 4F24A 1G0XA 5INCA 1RUPH 2VLKA 1OAQL 3IJHA 4YE4H 5B21A 3V0IA 3DPDA 4MD0B 5KBLA 3FOMA 5JW4M 1EEQA 3QFJD 4R26H 3QDGB 2KLRA 2X28A 1NANI 2EVFA 4U49A 1PGRB 4ODXA 4S1DC 1KGXA 4G6JL 1RZKC 4F9PC 1MJ7H 1MUJB 4H5SA 4PREA 4Z77A 4JO4L 1MW3A 3G6JE 4LVEA 5BZDA 2X3AA 2NZ1A 1DLHA 1MNUH 2J56A 3EJPA 4N24A 3C9NA 1IQWL 2GQHA 5CZKA 5EC2A 5IEHA 1ZVNA 3SGDH 4RZCB 4MDJA 1JPGA 1QRKA 1U95B 3H0TA 3BN3B 4XBPB 2GUOB 4DIXA 3RFZA 2GJZB 1A1OA 3S7GA 5DQDH 4QKXB 1LE5A 5H4ZA 1KXVA 3H53A 4TPRL 4DN4L 1SUHA 4K2UH 1NAKL 5HGDB 4JY4A 3MRLB 2R69H 1JV5B 2YQGA 3QXDA 4NQTA 3LCYA 4S1RH 1GYUA 3BD4A 5C70A 1F58L 1IGJA 3RUGE 4OT1H 4L3FA 1LQBC 1A6VH 3VI3E 2ZCZA 2OW7A 1WQVT 3QK0A 1QPKA 4ENEC 1QLRA 1KSRA 4YMPA 3BWSA 2BSDA 2F1BA 2ZOLB 4OI7A 1ONQA 3VFSB 1IC4L 3CFIC 2GW5A 1NLBL 4QRPB 3CD4A 4PSRA 2X0UA 3D09A 3V4VB 1PZ2A 1UOLA 2X1QA 2NY6C 1G0YR 4JM2C 3OHXC 3BDYL 3LIZH 5IK3A 4PJXB 1KJ3H 2A6DB 3O2DA 4JFEE 2VN3A 4Y7OC 5F9OH 2CA3A 3UAJC 4KKAD 4MNHB 2FX7H 2OR7A 2G60H 4AL8C 1L0YA 4Z95L 1N0LA 3RTQB 3TM6A 1IAII 3SDDB 1VFAB 4Z7OF 3FQTA 1S7VB 4WW2F 2ZXEB 4XNYL 3U82B 4RRPM 1ETB1 2R56H 2A74C 4IMKC 4P05A 4F8QA 5T1MB 3KLLA 5FO8B 5CN2A 2HRPL 4GB9A 2IH9A 1A3QA 2C9XA 5HDQL 2N0KA 3VX1A 4RMRA 1NFDA 1LLAA 1XGZA 4Z7WB 5IZ7A 2G2RA 1YUKB 1XL6A 2EDDA 3WUWB 4DGYH 4F9PA 2Z91A 1WIUA 1YNLH 2EP6A 3ECQA 1J9TA 3TZVC 1P4BL 2A6KB 1HILB 2FJHB 5TDPA 1A5FH 1BQSA 4J4PA 2NZIA 2EDLA 3X1BA 3DSNB 5I71C 3AY4A 4UOW0 3AS2A 1HQRB 4LOUC 4GT0A 5J11C 4TUOB 4P2AA 3TEWA 2OAAA 1U8KA 3RL2A 3HE7C 4LPYA 1RL1A 3VE0A 4DGVL 4F7PA 1F5WA 1TYJA 4KI5E 2C9UA 4M1DH 2VDLL 4GG6F 1K8IB 5AQ0A 2XN2A 4ABVA 2YZ1A 3O3BB 2WXOA 2DQTH 2VXSL 1ZXKA 3EYOA 3BZDA 1I7UB 2XT1B 4JREC 5KTEH 2O61A 1W91A 4EDWL 1HQ4B 3KDPB 3PWNB 4P57A 4XCCH 2C3HA 3FT1A 3JTTA 1T80A 3CFJB 2WCGA 4JANB 3SGKA 2A73B 3C2SA 1I8AA 4MASA 4GRWH 2PWHA 4JO3H 1MIEH 1AC0A 2C3GA 4UUJB 3WE6A 2YQBA 1U3ZA 7TAAA 4HJGB 3SE3C 3Q01A 4MMXA 2J72A 4R2GD 5FGSA 1KIPA 5IHUH 4N0YH 3HC2A 1QD0A 5E6UB 2IGFL 1E3XA 4KTEL 1CLYH 2G0LA 3A6BH 1WCBA 5IB3B 4G1MA 1DBKL 1KGJA 5I26A 3MR9A 3BGFB 3ZE2F 4JM2A 4J3SA 5L4JA 1A7NL 5IVXF 3VXSE 1KIUA 5C0ND 2EDFA 4HIEB 4IOIB 3WSQL 1SJMA 5F44A 5JHDE 3ALWA 1U4EA 2CDEB 2COQA 3NN8B 5HGGS 1GJUA 4V1DD 2XX0A 5E2WL 5IB2A 4N85A 1EJ8A 5HDBB 1V05A 4BUGA 4DW2L 5GGRB 3VRJB 3AS3A 3PAVA 5F0LB 5HGBB 4HQQL 4QTFA 3HUJE 4LPUA 3ULVE 2UX6A 1DFXA 1JPFB 2IPUK 5ESVB 1M7UA 3OJVC 4NOBA 1I31A 3VH8G 1MCOL 3AREB 3JTBA 1PZSA 1CJYA 3CZKA 4G82A 3T65B 1JNHA 5FA4B 2FDBP 4DQAA 1LO0L 2D31A 5IB1B 4YDLB 4I85A 2X0WA 4DO6A 5KAQG 3UIZA 4AH2B 4H7VA 5T1DL 2BSED 3BPCB 4D0DA 2OXHB 1KCRH 3SO5A 1Y18A 5EEWA 2DQ6A 4F9LA 1PSKH 2HJFB 4N5EC 3WEMA 2NY4D 3PRZA 4L23A 2J8UE 3DIFA 4RMSA 5ERWB 4IRJD 4LVHB 4OZ4A 2CQVA 3ZR5A 3GNMH 4BELD 5G4OA 4YDIH 3RVUD 3FUMA 1QR1A 2JCCF 1LEGA 4X5QA 5DK3A 4OLYL 4QRTB 5BRZB 1UH3A 4PS7A 4QY8B 5E8PB 4Y2DC 4LQFL 4O58H 4N20A 4P4KB 3SPCA 5CFAA 3JVFC 4FJZA 3BOVA 2VRAA 1OT2A 2XG4A 2BRQA 2NXYC 5DHVB 3DO3A 4R4ND 4W93A 3MREA 1DVXA 5HVHB 3OKDB 1INEH 4QOKB 3HG0A 3RX8A 5HHOD 8CGTA 3VB9A 4NQUA 4UTBL 1BSIA 1TQVA 1OGAA 5LG6A 4KJQD 3GIZH 1ITCA 4GP5B 5T3XH 3RPIA 5KYUA 2HPOA 3OR7B 3SE3A 3Q13A 4NQCB 4G5AA 2SODB 1ZVSB 4ZO8A 5J12C 3PJLA 5FFOA 3DKHA 1JZ7A 4RRPA 4WSKA 2D7PA 2R0ZH 1IQDA 2W92A 5IHHA 5SWZE 4BSWA 1NGZA 2ESVA 3U83A 3QXTA 2HLEB 4JHVA 2Y23A 3UYRL 4N0UA 3OKKB 3HPJA 2YHGA 3Q2CA 4GW4A 4NJAH 5EUOF 4DP9X 1NH6A 5KYXA 3QDJD 3UPRB 4H4NA 4KKCD 2CO1A 3B2PA 4FHKA 1FL6A 3WEBA 4NNXA 4X9HA 4ETQA 1UASA 3AMKA 3MBWB 3Q2LA 4LGPB 5A3IC 1HTYA 1TVHA 2EEFA 2CM6A 1JE6A 2H6PB 3JSSA 1RAMA 3IVKA 4GXUM 3LMJL 1BD2B 4MLSA 5C9JB 1J05B 3FCSB 4FXLA 1L9QA 1C5CH 5HYJE 5I1LB 1G7JB 4M3KB 2WYIA 3IFPB 3QNXB 4ONHB 1KV7A 4C4UA 1IFGA 4F2FA 2X4TA 4J4PD 3SOBH 1G0DA 5CD5D 1UWYA 3O9WB 3WS6A 3C6EA 3CV5A 4XVTH 4IBYA 4CADA 3X12B 3T4YA 4FNLL 4JFOB 5AUMA 4XGZB 5AEAA 1QMUA 1FRGL 4A2GA 3RJDA 3MROA 1E27B 3VFVA 4PVNA 4XNYH 2DF3A 1FV1A 2DQIH 1TJHL 1RURH 4NO0B 1TYEB 2NW2B 1MFMA 4ZSOB 2EH8L 3A5VA 4JHUA 4TQIA 4IMLA 4PCKA 5BZWA 3U4EA 2CG9X 3QEHB 3AW5A 1UM5H 4FQLL 2XBDA 3SODB 4NRYA 3VUAA 4YLCA 1GHFH 3AACA 3KLAA 2PW2B 4GBXC 2YFOA 5DJDB 2KLTA 3CSBA 4LVOC 3HHRB 3MZTA 3NZUA 4Y2DA 3F6IA 1KBWA 4BK5A 2KMWA 2HWZH 4B60A 3BAIA 1EA9C 1PZ3A 2A9NH 3D69A 5CBEA 4H8WL 3HC4H 3KS0J 2PPCA 4PJIE 3VRLE 4DGVH 4R7XA 1QSEE 3UMTA 2EE6A 2P8MB 5AVYB 1BM7A 4JFZL 1PIFA 8PAZA 3EBIA 1GS8A 2FB4H 3GS4A 2Q86A 5FB8A 4ZFZA 1ZGLP 3TPKA 1X7SA 3U9WA 3HB3C 4BSVB 2XFXB 4CRPA 3UTPD 1A4AA 2QELA 1BGXL 4ZFGL 1JPTH 4MD0A 2VM3A 5E4EC 2VO8A 2XKSA 3L3GB 3QDGA 4FI6A 1NCDL 2DMBA 3L5XH 4MWFA 2EVJA 1P9MA 2XQYG 4CKVX 3E1ZA 4ZUWA 1MUJA 4BZ2H 3CFCH 4YHLH 3RVWC 1N19A 2OJ1A 5BXFB 4KKBD 1KYOK 3UC2A 2NY0B 5CLYA 2BOCB 4D8OA 3VYNA 3TCLB 2VWEE 1JZ4A 2IPKB 3LNIA 1WK0A 5F7FA 2VQTA 3MOBH 3O81A 2H26B 2YAFA 4RZCA 5D7JB 1QPPA 4DP8X 2K6ZA 2GUOA 2C5DC 4Y1SA 4NN6C 3Q06A 2BWIA 2GJZA 3TBWB 2D7NA 3TFKC 4AGMA 2XA8H 3KVQA 4JFXB 3UABA 5HYIA 4D8PB 5C0IA 4HCRA 5HGDA 3MRLA 4MQXD 4APXB 4A55A 4PAZA 1JV5A 3D08A 4YSRA 4X8CA 1N7MH 4NFCA 1G9EA 2H32H 3H2PA 1QYGL 5JQIB 3ERXA 2XWTB 4H0HB 4C83B 2H1PL 2X4OA 3M8OL 5GZOA 3PP3K 1QEXA 2EDMA 3BJLA 1JVOA 4U1HB 5F0PB 1KPVA 5D71L 4W9EC 4H8PA 4PP2B 1EUTA 4LNVA 3US0A 1WBZB 3FQUA 4JR9H 4WWID 5K69A 1X5IA 1E5UI 2ZKHL 3VFSA 3WIHH 4NFBA 1UGKA 3QQ4B 4J5VA 1BEYL 4N2MA 2UXFA 4RAVA 2A1WH 3QZWG 2E7LA 3V4VA 2WXQA 5JDSB 4U6TA 4N2KA 5K1JA 4U33A 3RA7H 5FYJU 4PY7B 3L2LA 2BMKB 1F4WH 3GI8L 3L9BA 3O6MH 1UZ8B 2FGWL 2YA0A 1NGQL 3SOTA 3DGGB 3ARFC 2OM5A 1HCZA 3EGSA 1I7ZB 5SV3A 4MNHA 1AZVA 5CJBA 5A2LH 2EXWD 1QBML 3ZYJA 3FT4A 3HFMH 3BDXA 2ESVD 1QBLL 4WU5A 3X1FA 2WSKA 3EZ8A 3RTQA 1FNLA 4LXFA 3SDDA 1VFAA 4X6EB 3O0LA 3QZOA 2CKBH 4L3EE 3JV6A 1S7VA 2NY5L 3LVEA 2FO1A 3SGEH 1WC7A 4GQ9H 5T1MA 4WU7B 3NH7L 1DL7L 2PXYC 3K91A 3TO2B 1U3NA 4AG4H 3ESNA 1B3JA 3PP4H 4N0FA 5DJYB 1AKJD 1TQUA 4Z7WA 3H3BC 3IK2A 4TF4A 3CN3A 5CJOH 3PYCA 5ICXB 3CHPA 2L7JA 1X9QA 1IE4A 4I18C 5IW6B 1DJIA 1NCNA 5DC4B 1E8ZA 4XX1G 3B9DA 2A6KA 2FJHA 3WKNA 2OL3H 4M48H 3BT0A 3AABA 2ATAA 3DSNA 1ES0B 1F6AB 1OLZA 2VZUA 3KPQB 4GSXA 3Q44A 2NUTB 4OQTA 4TRPL 2JNZA 1UOVA 3FFDA 1MAJA 5CSZB 4IHBA 3CAFA 4S0HA 3OGOE 1YEHH 4YHYC 3O3EA 3F01A 2P7TB 5C71A 4NKIL 2ZKXA 2RHEA 3G6JA 4PJ6A 2AQNA 2JFCA 2QSVA 3O3BA 4LSPH 3TWYA 2NY2D 2C1PB 2F54B 2F2HA 1I7UA 1Z9SB 5LQBH 3D3VB 1N5YL 4IM8A 3GZQA 3IU3B 1E50A 5LBSL 4KPHH 5GISH 4MJ6B 2GK0B 4H8VA 5DZOA 3W5MA 1ZLWK 4KX8A 2AGJH 3LMJH 3CFJA 3DV6A 1HKLH 3FHQA 4H8HA 3S5LA 2BIHA 2FBJH 2GK2A 5J56B 3QUXC 4H88L 4KI5C 4MBOA 4QDGA 1CFBA 2A73A 3GHPA 5MENA 1VF5C 2VN4A 2AKRA 4ZNEA 5F89B 2AJZB 4UUJA 1E5CA 2D3JA 4W6WB 5JZ7D 4XP5H 3HA0A 5HHVH 3KL3A 2QQLH 4R4FH 1J11A 3T8MA 4M5ZH 5I8EB 4X4KA 2DLFH 3RE0A 2WB7A 4Q9RL 3VFWA 1R3JB 2K1MA 5F7DB 5JW4N 2HX9A 4NZUL 3UBGA 4P59H 1YZZA 1DQTA 3FRUA 5ANHA 1RZFL 2B15A 3HN8A 5A16A 5SWSE 1JGVH 4PRHE 1YMMB 3OB8A 4Y16B 4FA8A 1A7QL 2CDEA 3WFBL 5IJBC 1TQSA 4EXPX 2XX1A 5KS9E 4JW3A 4MHHI 4ZS6D 4KOCA 1P1VA 3E7JA 1I8LA 2FWUA 3QDGD 1UB6B 2C3XA 4NENB 2MQ3A 3HBGA 2YJLA 3IXTB 4OLVL 4OIIH 4QWWC 4ONGH 5GGRA 1XZ0B 2B20A 2HG0A 3LQAH 3LPFA 1A7RL 5CLTA 1BIIB 4HYTB 3WNJA 1JI1A 1J1XL 4O9HH 1F13A 5ESVA 4FZEL 4WNJA 4XMZA 1VPOL 4PJBF 3UO1L 1FDLL 4OLXH 4A7QA 4GMTL 5E99L 4N22A 3BLPX 5FA4A 4LF3A 3GSWA 4I18A 3KDMB 2Y2WA 2CBPA 3QZLA 4J6RL 1GC1L 4OCLC 5IB1A 4M56A 4EF3A 3GM8A 4PJ7A 1JUFB 1KT2A 1QFWM 1YPZB 1P5UC 2BSBA 4I3SL 4OGXL 2WLJA 2LGNA 2OXHA 4UB0H 3MA9H 5CJ5A 1RD6A 5EN3A 3VRIA 3RIAF 3NJMA 1R33A 3ULVC 3KPNA 4OD1L 4GNKB 5ERWA 4GUPA 4JO2L 3G04A 4YPJA 4LSSH 4HS3B 3DTDA 3BZ5A 2QQNL 5GZOD 2HT4D 5BRZA 2HFGL 4ZFFB 1XHHA 5AOKA 1MCRA 4QY8A 5E2TL 4MVBD 4RBPH 3MBEC 4V33A 4UQAA 5T1JA 1NIAA 1MY7A 2FWLB 2J5LC 3N9GH 4RAHA 1A02N 5EIIB 1CI5A 4PGEA 4DETA 3QZMA 5F70A 4Q4EA 4HIPA 2OMTA 4WUKL 3I50H 3OKDA 4QRPD 4Q4IA 1JFQL 4LCIL 3T2PA 2YO3A 2YD4A 3EYFB 4J3OD 3VFTA 4IDLA 3CMGA 3K6DA 5DVOA 2WVVA 2BFGA 4F57L 1UM6H 2WNWA 1BZDA 2X44D 3OR7A 4ZO7A 2PWFA 2VR9A 5EOCH 5I30L 3BW9B 1TO5A 3O4OC 4TLUA 4BH8B 4MMZB 5K9OB 3V95A 4XVJH 4JZJA 5I66B 3F7YB 3OMIB 4WFED 2PCFB 4F27A 3BDBA 4LLAA 2H1PH 5D6CA 4OBSA 3EOAB 4V1DE 2XXGA 3RTQD 3S8WA 3LVTA 3A67H 3PWPE 4YZFF 3ZO0A 4JG1L 3QJVB 3SDDD 5HXMA 3DDGA 4RGOL 4ABUA 3MQIA 1HHHA 5GRUH 2XZQL 1IBDA 3UPRA 2GB2A 2M2DA 3GRBA 2W9EL 3L3HB 1UA3A 3FQNB 1MXDA 1ICTA 1XVSA 3S37H 1P7KA 2ICES 4C54A 2X88A 3F8UB 3REWB 3B2UC 2H6PA 4FXKC 1BX2B 1DLFH 3OPZL 3M7FB 1BD2A 4PJGA 5D5MB 5C9JA 3CVBA 3SPGA 1M9WA 4W1TA 3FOLA 3OR6B 1RXLA 1BREA 4XN8A 2XWXA 2Q5BA 1OD9A 1OGTB 4PJ8C 3V0VA 3VD5A 1J8KA 1MLCB 3QNXA 1QOKA 3U1SH 5ECJE 1IX2A 3QUZC 1I1YA 4WEMB 1QABA 3L4UA 4B9FA 3TWCL 3VNYA 1ZLSL 2I60L 3GSRA 3O9WA 4U7MA 5HJDA 5F1NB 4JFSA 4A7UA 3F2LA 3HBZA 4UINL 3X12A 4DQOL 4KX9A 3RX7A 2DQMA 4NQEE 4UNTA 2UY7B 3B9EA 1NCBL 2AK4B 1CGYA 4GMSH 3UYPB 4KK8C 4LRIC 4AK1A 2V9RA 4NO0A 4PJEA 2NW2A 2QT6A 3OV6A 4YX2L 1KXTA 3B43A 3KG5A 2A2QT 2W07A 3HRZB 4JN1H 4Y4HA 3BD5A 3MV9B 5J6GB 1GAFL 3GINA 1A3RL 5CU9A 2PW2A 4APQA 2O6FA 1BZ8A 4GAYB 1E4KC 3MBEA 1WAAA 2ROYA 4K9JA 5MEND 1MCHA 4WTQA 3LJ3A 1K6QH 3MI6A 2CNZA 1XH1A 4TRPH 3IPFA 4GKZA 1W6WA 4NQDE 1IGIH 4DUVA 4PJ9B 3QZWB 4EI0A 3QQXA 1XMEB 2P8MA 3LNFA 2PPEA 4XNXH 4XAKE 1I3GH 2OSYA 4JPKL 4WEEA 1GXEA 3TP4A 1HZHH 2V7HA 1KIRB 3KYOA 5I1KH 2DI7A 2ZSWB 2XFXA 2ZX8A 1QSFA 3O2VH 4KMTH 4E41B 4GRWE 3L95B 1INDH 1FLTX 2UXTA 2YD9A 1SXAA 2CZNA 3L3GA 6PCYA 4IOSD 4XWOC 4Z7NF 5CP3A 4HAGA 2XUWA 3H7BA 4FXGB 1PY9A 2GC7C 3GDBA 3TN0A 4Z7UF 5KVDH 3DO4A 1NDMB 1BXAA 2HRHA 3UTTE 4G6KH 3TCLA 4NQVB 4AIEA 4EQ3A 5LBVA 1IVLA 1S7SB 3LOWA 2VN7A 3DGCR 4AX3A 3EJZD 1NCTA 3FQ2A 4JQIH 3ARED 5A6LA 3EYUL 1X5AA 4FMFA 3TBWA 1BZEA 5K93A 5EBWB 4B95C 1Q1JL 2Y1YA 4MAZA 4D8PA 2ZPKH 3QNZB 4MB3A 3QUZA 1JV2A 1TEGA 1H15B 4APXA 1CFVH 1TNMA 3U9UB 5PCYA 4Y5VC 1AZBA 3GZOA 3NPSB 1RUKH 4HWEL 2YSSA 4LQ1A 4HX1A