4U4IA

Megavirus chilensis superoxide dismutase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
126
Chain Sequence
b'FFNVVTAICQLDKPHDYGYAIFTQLPDCTEIQFHLKNLPPGKHGCHIHKSGDRRNGCTSMGPHFNPFNLGDLGNIVVNNNGECNEIICVKYLPLTGSNQIIGRGLVIHEKEDDGDRIACGIIAYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cu/Zn superoxide dismutase
publication title The megavirus chilensis cu,zn-superoxide dismutase: the first viral structure of a typical cellular copper chaperone-independent hyperstable dimeric enzyme.
pubmed doi rcsb
source organism Megavirus chiliensis
molecule tags Oxidoreductase
total genus 30
structure length 126
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4u4iA00
1JK9A 2GBUA 1RK7A 2WZ0A 1DSWA 1E9PA 4OJAA 4A7GA 2Z7WA 3CQPA 1B4TA 1SXNA 1YAZA 3GZOA 1UXMA 2WWNA 3LTVA 1OALA 1KMGA 1PZSA 1F18A 1Z9PA 1HL5A 1TO4A 2VR8A 1YAIA 4BCYA 3H2QA 4N3TA 3ECWA 2ZKYA 3GTVA 2VR7A 1PU0A 3QQDA 4BCZA 2ZKXA 5KBKA 1IBBA 1JCVA 4B3EA 2K4WA 1BA9A 2C9SA 2WZ5A 1EQWA 2XJKA 3S0PA 3ECUA 1TO5A 4A7GF 1IBFA 1JK9B 1OZUA 1OAJA 4A7TA 4A7UA 4L05A 1XTLA 2ZKWA 2WYZA 3HFFA 2JLPA 1SDAB 2AEOA 1SXCA 2NNXA 3F7KA 1FUNA 3H2PA 1U3NA 3RE0A 1OZTG 3SODB 1SXBA 2R27A 4U4IA 1SDYA 2LU5A 4OH2A 3KH3A 3L9YA 2E46A 1XTMA 1E9QA 1Q0EA 1L3NA 4A7SA 2WZ6A 1F1AA 1E9OA 1IB5A 3GZPA 1OEZW 4MCNA 3K91A 1COBA 3ECVA 2AQNA 1B4LA 3MNDA 1P1VA 1E9PB 2Q2LA 4MCMA 4A7VA 1BZOA 3CE1A 1IBDA 3T5WA 2AF2A 1N19A 1S4IA 1PTZA 4N3UA 1F1DA 2VR6A 1QUPA 1CBJA 3QQDB 5CU9A 1AZVA 2AQQA 4A7QA 1HL4A 2APSA 2WKOA 1E9OB 3GTTA 2Z7ZA 2C9VA 2JCWA 3KBFA 1SOSA 2GBTA 3HOGA 3KBEA 1SRDA 3KM1A 1XSOA 3CQQA 2V0AA 1SPDA 1YSOA 1N18A 3KH4A 2Z7UA 1IBHA 2XJLA 3GQFA 2AQPA 1F1GA 3GZQA 1SXZA 1DO5A 1CB4A 1SXAA 3F7LA 1MFMA 3L9EA 2GBVA 2Z7YA 5KBMA 2WWOA 4BD4A 3MKGA 2C9UA 1ESOA 1SXSA 1UXLA 2AQRA 2E47A 2WKOF 2ZOWA 4FF9A 3PU7A 1E9QB 3KM2A 2AQSA 5KBLA 2WYTA 1Z9NA 3HW7A 1EJ8A 2AQTA 2SODB
chains in the Genus database with same CATH superfamily
1PX4A 3ARGD 1Y07A 1G7LB 2RCSL 2JF1A 5D7JA 4J27A 2DJSA 3HRPA 2WB1A 5B4MD 2RGSA 1MW3A 5I6XB 1D5RA 1W6WA 4IKJA 4IW4C 3H4FA 3GSUA 4I2XE 1PCSA 2J12B 3KYOA 1K72A 1MY7A 1SY6H 2CO3A 2R2BB 2Y7NA 4MWFA 4QXTA 3FSZA 5EF0A 4ODWB 5E08H 2F5BL 4M8RA 1UKTA 4PH8A 5GRVL 2H6UA 2CLRA 1MW1A 4AMKL 2R8SH 3FN0L 3B2DC 3CAFA 1YO4A 1L7IL 2YZ1A 1QR1B 4U1GB 4M48L 4YHML 4JRXE 3VDCA 3FXIC 5GJSL 2P7TA 1GC1L 3GMRA 3NJJA 4KJYB 4WCYH 2XWTB 1HYRC 2QVKA 3VX0A 4K7PY 3TV3H 1XCTA 4K5LA 3PQYD 3SPVA 1ZLVH 1JXKA 2BW4A 1IJ9A 3GSXA 2MJWA 1AC6A 1SM3L 1SOQA 3D2TA 1I1YB 3BEVB 4OLXL 3VFMB 1JYXA 4J12A 5DD3L 2VW4A 4KC3B 4W68A 3LZRA 1DVUA 1IGIH 4ODUB 1C8PA 2VL5B 3QJHA 4J4PA 5C0EB 5KVEH 5FA4A 3IKKA 3T0EC 1AIZA 3U4KA 4RISH 1U3HB 2VH5H 4ZS6C 3RWEB 1PAMA 1S7QB 3NCYS 1KBBA 4UTBA 3QZBA 2ED6A 3O3BA 4MA8H 3PWLA 2FD6L 5J5EA 1QEWB 4HD9A 2RACA 4P5MA 1NBQA 2P8PA 5EBMB 3TTSA 4DVRL 4FYSA 1KY7A 3ZO0A 2AXJA 3ZDZE 3EFFA 2UUDK 4A37A 4PJ5B 1PAZA 1ZSDB 5CBEA 3NQKA 4G83A 3E38A 4KHTH 1W15A 3NSJA 3MAWA 5FM5M 2BIOA 1JSYA 3I9GL 5DMYA 5KG9A 4XPFH 2ICEC 1XH3B 3NCFB 2NY4B 1J18A 4NQDA 3B56A 5BZZA 2CO6A 3JVGC 3T2NL 3CX2A 3S5LB 3IU3A 4KO9A 1JF5A 2LQRA 1KCVL 4QY8A 1M7XA 2DKSA 3OG6B 1WK0A 3QPXL 2WQRA 4FG4A 5D72H 3LCYA 3UZVB 1BF5A 4PG9A 1HE7A 4XTRD 5JQIB 5ID1A 2AXGA 3GZQA 2HPTA 3KPQB 2HFGH 2BVPB 2DS4A 4EI5D 5CHNB 5LCVL 5I18L 3DGDA 2VLKD 4BSWA 3JBG7 2HCZX 4GLRH 3IXTB 1R5IB 5IQ9B 3U36A 4XNQA 2LTQC 3L3IB 5L2JB 1CI3M 4D0BA 3T4YA 4WUUD 5I8OH 1OQXA 3O0LA 1FZKA 3IDGB 4TV3A 5AB0A 5KWYC 3E80A 1R1CA 1DQQA 4HIIA 3QXUA 1YEIH 1D2OA 4XC1H 4GB9A 1ZVYA 4Q0XL 4RWYH 5HHPB 1JHTA 3RAJL 2DQUL 3W0WE 1WWWX 1R5WB 5FB8B 3WNLA 2WTRA 1FNHA 1I3RB 4F9PC 1CF1A 1AS8A 4M62H 3H2WA 3MO1B 4NO0A 3PHOA 4FQ1L 4GRLC 2EO9A 2DYPB 3JT0A 3MJ7A 5AVSB 1KBPA 1DQKA 2WKLA 2UXGA 1CC3A 3L5XL 3P0GB 5I2IB 1XF2A 1RZJC 5H35B 2A77H 3SO5A 1NGWB 3ZL1A 3CZNA 3PDOB 1T0MA 2AK4E 4MTMA 4PBXA 4OAWA 2C3GA 3G6JF 4GG6A 2CLVB 3WE6A 1G7QB 3NIDB 4I48B 5FW7A 2OL3H 1XXFC 4UTBH 2NQDA 3TM6A 3HMWL 3S88H 1XZ0B 2H1XA 2P4AB 3TO4C 3IS1X 4OB5L 1OGSA 3DETD 4KY2A 2CUIA 1SJHA 4LLDB 3N2JA 3U7YL 5C2BL 1EXUA 2DI8A 3ZTDC 3K4DA 3F7QA 1FNSH 4I0PD 2YPLA 3FQUA 4MD4A 4ZAKD 1DUZB 2F58L 4BJLA 5FR3A 1O7SA 4J3OC 4MJ5B 4OLWH 2R2EA 1ZIAA 3IFNL 4D9QD 1E30A 4HPYL 3Q8EA 1NFDA 3CFUA 3PWVB 3IDXH 3QH3A 5D4HA 4YNYB 1ES0B 5FA3A 4N2LA 4OZFA 5F7YC 1O7DC 4AVJA 4NDMA 4PJ9A 1J5HA 3GXFA 2O72A 3BD3A 3BHBA 3W57A 5D4QA 5EIIA 8FABA 4L1TA 1ROCA 1BCIA 4GUPB 2F08A 3A22A 4LHQB 4YUEL 1QW9A 4N2AA 2IAMB 2OYPA 4F33A 1U8IB 3CLWA 4UMGA 4YGAB 5D1XD 1M1XA 1XEDA 4RMSA 1G7PB 1YSOA 3FMGL 3MV9D 1Q0XH 4WFHD 5AZ2H 3D3VE 3OJ2C 4GAAA 5A1AA 1IEAA 3ZTEA 1W0WA 5SWSA 4G1EA 3D50A 2GJPA 4PRBB 5K9QI 1RHHB 4KH9A 4ZUWA 3D09A 4U2ZA 3DIFA 2QV4A 3MCKB 5JPMB 1UXLA 1J5CA 4FF9A 4PJBA 4WGWB 1JL8A 3G5ZB 1W0VA 1ZVNA 5K9OB 3I6GA 1Q90A 4UQAA 3VXRD 1AXTL 1BQUA 1YMMD 3WELA 1MREH 1XR9A 1C08A 1UATA 1QBML 3IPFA 5CR1A 1PX3A 1YEEL 3O11B 2K8MA 4NHUA 3KMDA 4X6EA 5CCJA 4J8RA 3QW9A 4HWBA 1J86A 4BUQA 4NXSA 2BP0A 2V2WB 1XXDC 1MN4A 1IBGH 3QQ9D 5EZPA 1FN4B 5GGUB 3D69B 1I1FB 3BN3B 3B8YA 4NJ9H 3Q13A 5SV3A 1T7WA 1Z0MA 3KPNB 2C1OB 4Y5VB 2GJZB 4TYUA 2ZG2A 2WZ5A 3OD3A 4X4YA 4P5RA 3L4WA 5MHSE 1K4DB 2W88A 4PI0A 1BWWA 3N42F 1FNLA 4NLAA 4F91B 3BP6A 5I15H 3ZE0E 5GGQL 3RIFF 2J20A 2O5XH 2CG9X 2BIMA 3F6LA 2HH0L 1GOFA 4PRDA 4LGPB 1Z6JT 4XCNA 2FEEL 3AABA 4Z7AA 4NZ8A 4HUUB 3FFDB 4ZG1A 3EGXB 3HRZB 3JZ7A 4XBEL 1Q0EA 3DVIA 3LZPA 4FNLL 4MMZC 1BZ9B 5CJQH 3LKOB 4AYEC 4BCXA 4GJTB 4WI0A 4APQC 2ODIA 4HH9B 1CD9B 4HJ0D 4JCMA 2X9YA 4AJ0A 5ERWB 5JORA 4ACPA 5I8KL 4BH8B 4EAEA 1MCOH 1CICC 1OGAA 1S7XA 4QJ5B 5FYKU 3P1VA 1AKJB 1U8PA 3FU8A 4PV8A 4PJXE 1II4E 3Q8BA 3F7YA 2ARJA 2DD8H 2OXGA 2NT0A 1NIFA 4JKLA 2XFXA 3JV6B 5HJDA 5SX5K 4OTXH 1TYRA 4LNRB 5CZXC 4Y2DA 2DQGH 3NCCB 5E94B 1LWRA 1JMXA 1J0ZA 4KQ3H 4ATWA 2VAAB 1EV2E 2DM7A 2QL1A 5CUSL 2QADD 3V4PL 4GW4B 1ZHBB 3LKQB 4LHUG 2DMGA 3CZFB 4U1KB 2Z93A 5ESAA 1YEDB 1MDAA 1YECH 2FX7L 1QTYT 5EBWB 1NM9A 1GZPA 2MQ3A 1JHKH 1JI1A 1BQLL 1F4YL 5E2VH 3ABMB 4MMYA 2UZYB 3T3ME 1RP9A 5I1GH 4QT5A 4RAHA 1P6WA 5EN2A 3DROA 5I1KH 5DZJA 1K8IA 4PS4L 1BJ1J 2V2XB 4NS0A 1E3FA 4RAVA 4RFNC 4Y2OB 2DTMH 2YMXL 3V7AE 1QUNB 1XSKA 1KG0A 4DAGL 3LXUX 4PJHA 1QEXA 2VR4A 4HWBH 3HHRB 2MPVA 1XF3B 5INCA 5HDQL 2ZAHA 5K59F 5JW4M 3RIKA 5JHMA 2HFFA 4D9RE 1QSFB 2IGFH 4N0FB 4YPGB 3MBEA 3OC5A 4PJ8B 2X70B 1CFVL 1XFPA 3GIVB 2XV2A 2DYSB 1LEGB 4I85A 1LO5B 5DJ6A 1IQDA 3H2QA 4APXA 1I8IB 4MAYD 4Y16C 2IFFH 4JFXA 1F3RB 1Q9OB 3O2VL 5CFHA 4BKLA 2H6OA 4R7VA 1IBBA 2P52A 3ZN6A 1PNDA 2PR9A 4OFYD 4G6KH 5AL0A 1KN4H 4ENEC 1QZNA 2VERN 4O5LL 5L8JB 4AUJA 4Z1PA 2H26B 4L3EB 2NY2B 1E27A 3LRSA 4HMEA 1HKLH 2G5BA 2YGNA 3R4RA 4FMKA 4BDVB 5IIEB 1KYFA 2QHRH 2NX5B 2HVJB 2ENSA 3ZTNH 3VE0B 1VENA 1IARB 2PF6A 2YJLA 5LKNA 1JYNA 4KX9A 3IDNB 3UDWA 4BGLA 1P6AB 3LZNA 3C9NB 3OZKA 4UTAL 3MLYH 1E0OB 5HI5D 3P4NA 3L9YA 3MRCA 4PRNB 4MS6A 5E99H 3FF8A 5DMIL 4CW1A 4EVNB 1MNUL 1KYUA 1RZFL 4NM4H 1RZ8A 4L3CB 3D9AL 2Z34A 4XP4H 1UT2A 3KLQA 1ZT4B 3MUZ1 2VJ8A 3O8XC 4X6BB 3CFBB 3UO1L 5FFLA 5ANMA 4K7FB 1MCDA 1S7UB 1ADQA 2BY0A 2D7OA 1OCZB 3ZQWA 2CPUA 1BAFH 2BRQA 2NY5L 3PGFH 4N0UA 1AGCA 3GPSA 1H6TA 1CS6A 2HJKA 1KELL 3F64A 4NO3B 3RKDC 4D3CL 4YL9A 4FN0A 4R7XA 2G30A 3EOAA 1EVUA 1TR7A 2DKMA 3X2QB 3LSOA 2AQQA 4FEIA 4FFZL 9CGTA 3A5VA 1Z2KA 1S7RB 3UTQA 3FQYA 3S98A 3S5YA 1WWAX 1FZOA 2X4RB 2E86A 1TEFA 1KCUL 3IPEA 1XEUA 3AC0A 1MPAL 3BH4A 3RVXD 1BZEA 5HYIA 1S9KC 4ZTOL 3MUGB 2J1KA 1YYLL 3GUTA 1CZ8L 1IO4C 3CVHL 1ZANL 1CPUA 5D9SA 4LVHC 2VMFA 1MCPL 3PQYE 3AACA 2EE2A 1SDDA 3CHSA 3S37X 3VA2C 5FO8B 1AXSB 3W9EA 5IOKA 3NFSL 1E8WA 2NW2A 1KXTB 2OKMA 3CHOA 4GMTL 4XP5L 1KOAA 3ARFA 2XTJE 3O4LB 3QR0A 4H20H 4JR9H 5ICYA 5LVEA 5TE6L 1JF1A 3S48A 4HOWA 3QHZL 3FU3A 4K0OA 4OSUL 1KLUA 1B4TA 2CBPA 3VFPA 2XA8H 5C0CE 2QMKA 4NFDA 4QTHB 2GCYA 3M17A 4NT6A 1FHGA 5E2TL 1OTTC 1EHNA 1HZHH 1V7NH 3WAKA 4PSPA 1RIHH 2ZUYA 5B39G 4XMLH 1Q9LA 4DQOH 1BDYA 1KB5A 4D0DB 4KFZC 3JTTA 1Z5LA 4QRPD 5HJ3B 4KZ0A 6CGTA 2BOCA 3BLKA 3HI6L 1T66D 2VN3A 5JOPE 3NFPA 5CLWA 3K7UA 2ZXEB 1VFBB 2OSLA 3VFGL 1SEBA 4M7KH 3QR2A 4G7YH 1CDGA 2NR6D 4JO5A 2WWKO 2VXUL 4YDLC 5BV7H 4UM9B 1S7VA 3H56A 3JTSA 4NN7B 4Q74A 3VI3F 1RVFH 4G9FA 3ME0B 1OCOB 1N4XH 5HD8D 5LJYH 3MGAA 4ZUTA 3SGKA 2MOVA 3LKNB 4OFPA 3B1UA 1ADQH 2OR7A 4OI7A 4PJHF 2C9RA 5C0FA 1MF2H 3NPZB 3B5GA 4LPYA 3H9SB 4KKLD 1UENA 3GSVB 5B38A 2XVKA 5HDWA 2CJ3A 1OM3H 4AW4A 3VAEA 1A5FH 1JZ4A 4YHPB 3K0YA 3SPCA 5CD3B 5AKRA 3T2QA 4JO1H 3RWIB 2A99A 4HUWB 5TDNA 2VXTH 1KSRA 2E74C 4RZCA 2R1YA 3EYOB 4GQPH 5LDSA 3FO9A 4PR5A 3DVGB 1WE5A 5HGBB 2YQGA 5CFAA 3OJDB 1QRNE 5F3HB 1OOAA 4J1UB 3BDBA 4Q14A 4Z0BH 5C0BE 1LP9A 5DZNA 3ZGIA 1VFMA 3MNWA 4E42B 2CK0L 2D4FA 4QOKD 2RQ8A 4N22A 3AXHA 5EFIB 3U4BL 1JK8B 3W5NA 4HWZA 4WFFD 4YX2L 4U1LA 3A67L 1NGXB 3OKOB 5CD5C 4BYHA 4PJIE 5MI0C 3RHWK 2Z31A 4WSKA 2AKRB 5AVZB 4HS6A 4KUZL 4RBPH 5DS2A 2A1WH 4PJAA 2V3FA 4NN6C 3DVNA 4GKZB 1T2QH 4HGWA 3DLQR 2HN7A 4U4BA 1W16A 2P42B 4HMCA 3DX9A 2PW2B 3FO1B 3MLZL 4HDIA 4ONGL 4ALAC 2WUCL 2FHFA 5HPMB 2GB2A 1KB5H 5D70H 3B2VH 5IT2L 1R3IH 3QNZA 1QATA 3OJVC 2BHYA 3ABZA 3IJHA 4Z7UE 4N4YB 2VUKA 4Z0XB 4NNYB 4BHUI 1B0GA 2NYZA 5EWIL 3T8VA 2R2HB 2VISA 2EIKB 4YSUA 5FV2A 1UD3A 3MOAH 2PYED 3DX8B 2QZ5A 3KDMA 4WEBH 3NZUA 3S2AA 3B9VA 5C08D 4I18C 3VXUB 4LZKA 1A6ZB 4E41A 2OULB 1ZA6B 1UZ6F 3NOIA 2R59A 4K23H 2RFXB 4ODVH 1XGUA 1INEH 2EDTA 3D2UA 3LNDA 3EO0A 3QDGE 1RUKH 2H6PA 4NUPA 3GRBA 3UXFA 3ARDB 4FTVA 4BFIB 2OJEB 1AHWC 3GMMA 3PG2A 3SE8L 2QLYA 3M46A 5E1HB 3UBFA 3VI4E 4NB7A 4UQ9A 1T7XA 2PR4H 3WEXB 3U0TA 3T3PF 1QWNA 1F3DH 4F80A 2A2QT 3QEQA 1FI8C 4JFPB 1KJ2A 3OF6A 1UVQA 1P7KA 4DK5A 3L3JB 2VLRE 4ONFL 3N9GL 3QJXA 3F85A 1WA1X 2OK0L 1EX0A 3K71A 3O4OB 3BKJH 5K9QG 5LUMA 1IZKA 4Q4EA 1IBDA 2ESVB 3CU1A 1M71A 3OKDA 1WF5A 1Q72L 4HV8B 3WY1A 5BUGA 1UXWA 4EOWH 4DUWA 4LCWA 2FSEB 3U48A 5I1JH 3L3OB 4MB3A 3ZL2A 4ELMF 4FQXC 1M7DA 1PTZA 3LEYL 3TL5A 2ZT9C 5EUOB 3OTTA 5C3LD 3NZHH 4UWQB 3RZCC 3HC0B 4P4RA 3DUSA 4MD5B 1FGNL 4WRLA 3ZQXA 1CMOA 1XGRA 3SZ6A 4NGHH 2HRHA 4L9DA 2W65B 4JUSA 1CL7L 3L4CA 3T0EA 5DVKA 1QKZH 2Q3AA 3ZKXB 1L7TL 4KKAC 4KXAA 2AVGA 4LLMB 3VACA 3LXCA 4E9RA 3VMNA 5A2KH 1RLBA 2VSMB 5HYJD 3TYFB 2OMWA 4KAQH 2DM2A 4X5QA 1YJDH 5IMOA 4LVOC 4FI8A 5TQ0H 3KM2A 1RPKA 5F9AC 1IBZA 1FWXA 2P24B 1Q4NX 3MRRB 4ZPVB 4PP2A 4U6XA 3MLXH 3SKJH 4ABVA 2Z1KA 3L4TA 4WU5A 5KJ4A 3I6KA 2ARJQ 3KS0J 3BZEA 2ICEA 2O30A 2QMJA 2VR8A 2B1AH 2F7PA 2VSCA 5DO2C 2LVCA 3JVGA 3G6AB 4Z7VA 1BBDL 3LB6D 4E36A 1UQSA 1KB3A 3FUNA 1BM3H 1A9EA 3HG1E 5DRNB 3VH8A 4HMDA 2B16A 1LO4L 2CHXA 3D4GA 4LSUL 5EZJB 4OI9A 5AAMC 4PGDA 3D0VB 5KJ7E 1LP9F 1SJVA 4YIQB 4OFQA 4ZZKA 3FFCD 4AQOA 1CR9H 3V0VB 4BZ2H 4F2FA 5SWQA 1W72L 1A4AA 1Z3GH 4G71B 4MASA 1A9VA 4L1DA 3MFFB 1DANU 3CFCL 2FEDC 4WFED 3SJVD 5E00B 1KJ2H 4HJJL 4NFBA 1Y7VA 2XZQH 3EG9B 2OR9L 4NQQA 2KH2B 4G7RB 3WNJA 1EO7A 1HIML 4Y4KC 3TIDA 2CM6A 3MLWH 3RVUD 1FAIL 3QP3A 5J11C 1J88A 3NSDA 1TZ8A 2JKLA 4ICXA 4Q56A 3FCTB 1RV6X 3HZYA 4MNQE 4NPYB 1KCWA 3CSYA 4TLUA 1UCBL 3MNDA 4F9PA 3Q8AA 3CK0H 4LQFL 5LNEA 3B9EA 1A4CA 5DHDA 3EGDB 4UQBA 4GRLA 2IANA 1ZV2A 2VMCA 1HVXA 2K70A 4HLZG 5DR5H 5CEZD 1JRHI 4OCYH 1AR2A 4H1LA 1FPTL 1XX9C 3BO8A 5E4AA 5EOTA 2B9AA 4CVZB 1Q1JH 3IFOB 5D7SL 1QLFB 1YPZE 4QRTA 2HRLA 1E43A 1YN7A 4ZFOA 1OOWA 2XTJC 4HJGB 3QZMA 3ZDXB 3PAZA 3GTTA 1WS8A 1NEPA 4N8CL 4P06A 3MRLB 1EHAA 1F0LA 3EJSA 3PQYB 4WJ5B 3TO4A 1A6VH 3UBGA 5L8LB 4EDWH 2J4WL 4M1CD 5AW6B 4JO4L 3QNYA 2K6ZA 2WINB 3MROB 3MOBH 4WU7B 4ORZC 3EH4B 3M1BA 3SQOH 1OTSC 4WTWA 4HHWA 2NY0D 4AT6B 1NJ9B 1J9QA 2WOYA 1LWHA 4YN3A 3ABGA 1AY1H 3Q6GL 5KSAC 1H15B 2NY7H 5GGVL 3CVDA 2W9EL 4LOUC 1JPTH 3AM8C 3HS9A 1QPXA 5KSBB 3X1GA 3IDIB 4E9YA 5HVHC 1AP2A 4EDXA 4NO5B 5ITFA 2YD4A 4HXBL 4X6DA 2XWXA 5F9WC 1BVLB 4GMSH 1NGZB 3QCVL 4MVBC 5IB1A 1GL4B 1LD9B 1UJ3B 2LVEA 1IE5A 3CPLB 4K3EL 3UTPD 5MEOB 2ZXGA 3PNWA 2CE6A 2FLRT 2KUTA 1FFPA 1V55B 2JJUA 4L37B 1ZV9A 3SY0A 1MY5A 4NYLA 5ALCH 2F7OA 4XHJC 5FYJH 4NP4H 2K4WA 3AZUA 3C5ZB 3DI3B 4JG0L 3WDJA 3W3BA 3JWOL 5DT1H 5MEND 3TCLB 4HKJB 4P23D 3BKCL 2W0FB 3VQMA 4P2RD 4LOVA 3ZIYA 4A67A 2Y2WA 3S36L 3O3EA 4H4NA 3WI9A 5HTSA 2H0EA 4XOBA 5C92A 3FTVA 4EI5B 1FVCB 2ZUQC 5IEHA 3UZQA 4DK6A 2VLKB 1E28B 3ZX1A 2VRQA 2Q8AL 1FHNA 4XPBH 4WJKB 5IB5B 5KVMC 1YMHB 2X0VA 4H1LH 5HGGS 1RZJH 4RRPM 1AZZC 3OR7A 3S3CB 4PJFE 4MCNA 5HHNB 5IMLA 4UYPA 1H19A 4LAQL 3KYKH 4WUUB 4JG9A 2F8OA 3KPRD 5D7LD 3BH8A 1CGSL 3NJNA 1RJCA 4IRZL 1JPFA 3KHOA 4U05A 2OAAA 3BAKA 1EHXA 5LLIC 3IYLW 5J6HA 1U8JB 1U36A 3S3SA 5IQLA 3TESA 4X99B 4QRUA 1PLBA 1CGVA 5T1MB 2YEZA 4KTGA 2YQ3A 3PP4H 4JANA 3BPOB 3MJGX 3CH1B 4CVXA 4P5KB 5DI8B 5ADPH 4NQSA 1G9HA 4WHTA 3QXTA 2UY6B 4NSKA 5C07E 3OR6B 5ALBL 4AL8C 3U1SL 1H3GA 5J9PB 3E8UL 4J3OH 2YPVL 2D4DA 4XCEA 2IH1B 5EC1B 4JY5L 2JXMA 4LK4A 5BS0E 2PPFA 4LESA 4MMZA 3QYMA 2IALB 2CGZA 1BXXA 2YGVA 2YA1A 3HMXA 3HUJE 4FNRA 4HCGA 4EIGB 1RURH 1B4JH 4TLTA 4APQA 1IEHA 5I1HH 4POZD 2R69L 2H8PA 2WC7A 5I19L 1IM3A 4L8BB 1BG9A 5KBMA 1IC5H 1CICA 3VXNA 4IEFA 5F7UA 3MUUA 4WNQA 1MELA 3MRIA 3CZKA 3MLVL 4RGNC 4AGPA 4AQ1B 1TMQA 1MJUL 2P5WE 1EFXD 1N67A 4I0PB 3V5DA 1W8EA 4ZAKB 3TS8A 5GS2D 4Q6KA 3G08A 3FUMA 5JUEL 5F1NA 3E7JA 1ZVHA 2K4AA 2XPGA 2XYCA 3MCYA 4C56A 1NMBH 2CJTA 2A9BA 1KLGB 3GZOA 4PV9B 2GTQA 2KBGA 1N64H 2NNRA 3L3HB 3PXLA 2E75C 1YG9A 4HAKA 5D93B 1FNGB 3FQ2A 3I75B 4HZLA 2P1YA 3IVKA 1RU9L 1X5FA 4AYSA 5DRZB 4JRYE 2CUAA 3D06A 1CF8H 5DD6B 3ENEA 4GOSA 4P3CL 2NSXA 5E9DA 5E0FA 3STLA 1U41A 4Q7DA 4TULL 4NWUH 2YAQA 4A7GF 3T0XA 4NQCE 5EO1A 1R24A 2VR9A 5DA0B 2X4SA 4ZT1A 5F9JB 3S8GB 5EMYA 2YUXA 2CHZA 1YDPA 3BZ4A 5D1XB 1DLFL 4MRCA 3H9HA 2X89D 3IJEA 3MV9B 2H4EA 4YOKA 2I69A 1SXCA 2H7WA 4LLQA 1PZDA 2R0ZL 3FZUD 2XPZA 4DP7X 4DSYA 2QHLA 3M88A 5GRJH 4DERA 5K5YA 3EFOB 1E9QA 4L8CB 2VR3A 3ZK0A 2HJFA 3VW3H 3GSNL 1NC4D 4Y16A 2YGQA 3VXRB 1YMMB 2FGZA 4CMMB 1BFSA 3D4YA 1UM4L 3BIKA 4H2CA 4NUGL 2EDEA 1P1VA 4WHYG 5EOCJ 3FH5A 4X6DF 3EADA 2BHZA 4MS8C 2HUHA 3DX6B 1Z32X 3AROA 1LWJA 4G72B 4HPOL 5L88L 2JK5A 3T71A 2DH2A 4JB9H 4E5XG 3BP7A 4HCFA 5KYXB 2DI7A 3FTWA 1OP3K 4N2IA 3DDGA 1GAFH 2HTKD 3HMXH 4G9DB 4YBQC 1AIFB 4PWEA 1G84A 1FH5L 3RB5A 4LASH 4BRJA 1GGCH 1JTPA 1H3PH 1X6LA 3V9CA 2KDYA 1V7MH 2EH7L 1L5GA 2B2XH 1HZKA 1K2DA 5CCKL 5FV1L 2X4TB 5CF3A 3C6EA 3U9UA 4AZ8A 3VFOA 1T22A 5K69A 4NWTH 1E5YA 3VD5A 3O8XA 1FIEA 2UY7B 4EXPX 4N5EC 5CKGA 2MCPH 2ZIDA 4OD2B 3QSKB 2IC2A 4KHXL 3ZDYB 4U3SA 5TDOA 1A66A 4AX3A 1I8KA 4YFLF 3QXWA 2FJUB 1JGDB 4HISA 3VXPB 1V05A 3HBZA 4MAUL 2I5YL 1JWUA 3DXAE 5DMJB 4OGAC 3BUIA 4UDTA 4PRIE 4F57L 4KZEL 1J0KA 5F7HA 2BIPA 3K6IA 4YXHL 4ADJA 3NP4A 2VYRE 1GS6X 1SJEA 5DUBB 4Z7IA 3O6KH 4E9VA 1X4YA 4WUKH 5C0RL 4XNXL 1N6VA 2SEBA 3ULUE 4R96A 5F7KC 3GGWA 1ZT1A 3P0VH 1JZ2A 4RDBA 4GUOA 5BZWB 4PP1C 1AI1L 4NO2A 1D5XB 1TSRA 2X1WL 3QIUD 2G2PA 1HKFA 4X9GA 4Y1TA 4ZD3L 1Y6NR 2R0LL 1NPJA 1UZGA 2QADB 3F65A 2XKNB 3EYQD 4JFTA 1OSZB 4G8EB 5EEVA 2A73B 2X4QB 4G8IB 4P2CG 1J1OL 1HDMA 1CUOA 3W0WA 2O5YL 5IMKB 1PG7L 3B3IB 3TBTA 3PNRB 2ENQA 4GKNB 2VOTA 4XHQA 1M7UA 2Z6FA 3ORJA 2FBRA 2IPUG 4LCCB 3P9MB 5EC2B 4X8JA 3P73A 7FABH 2ZUWA 3VXQA 4KK9D 5I8EB 5I5JA 1WA2X 2EDKA 4LSVH 4FTDA 4AV5A 2EEAA 2HPOA 3TNMA 5IHLB 5LN8A 4ILDA 5F89B 4N2KA 1A14L 3TN0D 1TQBB 1KXQA 2AK4A 2MNWA 2DEYX 4NEHB 1WISA 1ZK9A 2IDUA 3BZ5A 3LV3B 3T08A 3MGTB 4P46C 4PJDE 1AYOA 2HFTA 1UYWL 4X9IA 1JGUH 4Q89A 2XSKA 5AENA 3ZHNA 5I30L 2R1XB 1I1AC 1GIGL 3NABH 3VFUB 1EUTA 3QCUH 3SCMC 3WFHA 2DLTA 2Y7QB 3QORC 5HI4C 1S5HB 2QPEB 4UILH 4KJQD 1I82A 3MRFA 4MAYB 4Q52A 2B8OT 3IKCB 3OKLA 4QNPE 2F5AL 4O4YL 3IDYC 3PABB 3KJ6H 1VEPA 1NGQH 5IVZA 4UB0H 3SKOB 3T04D 4W93A 4PLJD 3U1PA 5JMOC 1UD8A 1PZ2A 2NQ3A 4ZUUA 5C0GA 3SZKC 3QQXA 2DQIH 6FABH 1MNNA 3UBXA 1CT8B 1WSST 3UEZA 5SX4H 4EUPB 3DARA 1NCDH 2DQEL 4Z7WA 1WH0A 4BFKA 1FVDB 1ZLUK 3GXNA 4AYFB 1SYSA 5J8OA 1V8HA 4P07A 3G7TA 3O41A 4OF6A 3MNVB 5KAQF 3WFCL 4U1IA 2FYYA 1MCWM 4HXAH 3ML9A 1CBVL 2EE9A 4U1HA 4OD3H 3ZR6A 5D1ZI 1FG2B 5DZAA 3WKNA 5CMAB 3D3VA 1OM9A 4JFWA 3SJVE 2NXZC 4H8QA 5DS8A 4QRAA 1DQIA 2LHAA 3MJ9L 2VDMH 3EO9L 3QUYC 1LO2L 3V0WH 2WYTA 3FONB 5TDPB 3MHZA 5CGYC 4OGYL 1ZEAH 2DB8A 1IRAY 2IWKA 1NGPH 2W0PA 3FU7A 3MX0B 4ETQA 5FOBB 5I75B 2VDKB 3D4CA 3WJJC 5HHXH 4YL4A 1S9VA 3IRCA 3QJVB 4XC3L 4F7MA 4YE4H 1BVKB 4L4VD 3TT1L 1J12A 3AQXA 5FM8A 3DBXB 5E1AA 3E1ZA 4ZXBC 1RL1A 4HX1A 4BHUA 1G9MC 3PF2A 3WXVL 5F1IB 4R0LC 1T3FA 5F8QC 4KMLB 2GG1A 2PP7A 1RULH 5FDWB 1U8KA 1TQVA 5H94A 2OZ4L 1H5BC 1B6UA 4JN2B 2WBJD 3S0PA 1ZVSB 1EDHA 2VRKA 4M43H 2XWBB 5JQHC 2JB5H 1IC7H 3ZYJA 2HLFD 3KYMA 4S1RL 3KWTA 3L4ZA 4DP4X 5I1IL 2IH3A 1MLCA 2YD9A 3RDTC 1AYRA 2CRYA 5ABZA 1CDIA 4DUXA 5IR1A 3F84A 5E2WL 4OZIA 5GRYA 1QO3A 4PGJA 3K81A 3AQZA 5K9KA 3ILPB 4NKIH 2ZUTA 2F1BA 5E1QA 3C5JB 3C8DA 4ODTL 5D2LA 1L6XA 2Y06H 5EZLB 3T6XA 1E5ZA 1EDQA 2Y07L 1TTUA 2NY3D 5I5RA 1J11A 4YSQA 3X3FH 1PSKL 3HIZA 3FYIB 4NKMA 5FHBH 4EN3D 2BIIA 1GGIL 3EBHA 4ECNA 4JVPA 4D8PB 3QUMH 3PAYA 4PHZA 5D8JL 3HR5A 4OQTA 2YRBA 4RMRA 3HCVB 4QYAA 4CRPA 1JNJA 2ATPA 2CR3A 2ZOKB 3LPOA 4HIHB 1P7QA 3VVVA 2QPFA 2M2DA 3KCPA 3HEIB 4J2QA 4AG4H 3LQAL 1UGNA 2R4RL 2XQYK 1HWGB 3GHPA 4AGQA 1UWGH 3TJEL 1S9XB 4FHKA 4KFMA 4PJXA 5AW2B 4HAGA 4QRPB 2A3TA 5GRVK 3JV4A 3B9KC 4R7NB 4Z3HA 1AHWA 3HHSB 5IQOA 1FYTD 3UTPE 3SE9L 3BAEH 1P1ZA 2E9JA 4TOYH 1P5UB 3POHA 3QJFA 5BMFL 1AGFA 5AVUB 3U6XS 2AJ3A 2NZ9D 4KKPA 3MRMA 4WDIB 4CADB 3LIZA 2ZCKL 3UZEC 2AEIT 3J8F7 4LMQE 1CD0A 4WV1C 1SF3A 5EIIG 3WMPA 1HH9A 3LZLA 1T5WA 2PWHA 2ZWLT 3HN3A 3QC5X 5AEAA 4W9FC 4M1GL 4LARH 1AE6H 1HXMB 3I9IA 3LDBC 1CDUA 1S78C 1PDKB 3NK4A 3BJLA 5E8PB 5F96L 1YEKH 4FQXA 2A6JB 1NL0H 4J8QA 1LO3L 1P53A 4F7TB 3VVWA 4DF9A 1RKRA 4JZJB 3LN5A 2FUQA 1SOKA 4FAAB 3VXTA 3RZCA 3STBA 4Y4FD 4DW2L 3KGUA 2WVSA 2Z0UA 4FZEL 5ID0A 3FUIA 6PAZA 3JXAA 3QZNA 4WAFA 2VL4A 3EZ8A 4O02L 4F58H 4GW1B 3TT3H 1TZOA 4M5ZL 3VRLE 3ZDWA 4R8WL 2WHVA 4ALAH 1A9BA 1ZXQA 1LNUA 4KBPA 5IOPB 2V8MA 1BD2D 4QOKB 4WEEA 4OIFA 5IFHH 2HT4C 2Y2YA 3TVMC 2Y36L 3F8UB 4JRLA 3OGCA 4UQ2B 3BVWA 3E0GA 1ODAA 4X5XB 5CP7B 3U0WL 5JPNC 3UYRH 3BAJA 3VQ2C 4KI5F 3E9UA 4RQQB 3JT2A 5HY9A 7CGTA 3KEDA 3VWKC 2AXWA 2ZKHH 4OQTH 2K1MA 3V5HA 1EEUA 1X5XA 2A6IB 1I9JH 1CURA 2EVGA 2N1TE 3HC3L 3B9DA 4U1SB 3X12B 1AQKH 4X83A 1EHKB 3AUWB 1JV2A 5FK9A 2CU9A 1L0PA 3CG8A 3BXNA 3W1ZA 1A7QL 3VYPA 2O93L 3A6CH 1NMAH 3V4PB 4UTCA 4PB9H 4XCCH 5DJ2B 3HE6C 3DHJA 3KWWA 1R3LB 1KB9K 3DURB 4LSPH 1WZLA 1T1WB 3M8OL 4PJCE 4JN1L 5AAMA 1T1YB 1DQDL 4ODBD 2E6QA 4G6MH 5DQJB 1AHMA 3DGGA 4EIBA 4Q9BA 3DBSA 2NCMA 1LQBC 3CBKB 3QQ3A 4LF3A 4YO0B 3F05A 4X7TA 2PYEB 1PFCA 4TUJA 3IGLA 4LEXH 3FUJA 3OV6A 3VB8A 3UJIH 2VJXA 3OKKA 4H5SB 5C08B 4ZNEA 2R0KL 4N6RB 1NBZA 4CSTA 3LIZH 4JY4B 2XRAH 2FIRT 4Y4KA 4M7LH 5C70A 1WEJL 4P2QD 1PKQB 1CDHA 4PPTA 3ULUC 2YSSA 3V6ZA 4R97B 2ITEA 3HE7C 3ZHDA 3MXVL 1FCGA 1A3RH 1TZHB 4BRVA 2I25N 3O3DB 4ZDHA 1CB4A 1UD2A 1AS7A 2R1WB 1T83A 3C75A 3EOBA 1DCEA 1DVFD 2Y5EA 1RZQA 5JW4Q 1DZ0A 3OWRA 4NP9A 2Y1VA 2CIIA 3T1FA 3V4UH 5J56B 2EXWC 43CAA 4CDGC 1CYWA 4PVLA 1CGTA 3RWCB 2NTFB 3KPLB 4DCQB 1GOHA 1M42A 1SY6L 4R5XA 1USZA 3I84A 3B5HA 5E08L 1WITA 4YHNA 1I9IH 5CN3A 1G9NC 2R8SL 4JPIB 5DFVC 3TA4D 3EUUA 1LEKB 4YR6A 5C0CA 3FPYA 1QA9B 4OZHA 1K85A 3KD4A 1FRGL 5GS3A 3BRGC 1CYGA 3HAEG 4WW2B 3EFDL 2W92A 1NCNA 3UGEA 5GPRA 1HEZB 3CDZB 2IXQA 1A4KB 4N2NA 5AAWC 5KSAA 1ORQA 2DBLH 4ZPTA 2QPSA 4HLEA 1IGIL 2NLJB 5L7XH 3AM8A 1BQSA 2FQDA 4HIJA 4R83A 4NIKB 5KVEL 2OV0A 3G5XA 5B3JF 2VDPH 2YEQA 3OQ3B 2LU3A 5LHDA 5HYJB 4RISL 5EUOF 2VDOH 4HJTA 4Q9RH 5EO0A 2BFGA 3QWOA 4WTQA 1M2OA 5CIPA 2VH5L 5IBLC 2F7QA 3KZ8A 4YBLC 1KCRH 5HP5A 1SMAA 4MA8L 3ULVE 1VKXA 2Q5BA 2EABA 5DQ9A 2P28B 1JBJA 2ZWZA 2AQ1A 1XGTA 3PGCA 3V9EA 2Y5TA 4GI9A 5E6SB 2VDQL 5FXCH 2XXGA 4E9SA 1KIRA 1GTNA 4JFFA 4KHTL 4O00A 4XRCB 2A74C 3QRGH 4JRFA 1A0QL 1H6UA 3QE5A 5AG8A 3NCXA 1LE9A 3KVPA 3OB0H 3BD4A 4J6RH 2Z8RA 4XPFL 5J6SA 4BWUA 4KGLA 5J13C 3FFOA 1CLZH 3DOIA 3L3GA 4FQLH 2HKHH 4F37F 5KYWA 2BNQE 4YLQT 1P0SE 2VO8A 4LL1A 1XAKA 3FFCB 1A1MB 5D72L 3MMEA 4BQBA 5DJ8A 5LAPA 3TA3D 3UPRA 3C2SA 3WNNA 1QRNA 1MHHA 2J72A 2ZOOA 2HFGL 5JNYA 4M7ZB 1NOLA 4OBSA 2N7AA 5C0BA 3GRWA 4Y1AD 4IDJH 1MIEH 4P9MH 4HVBA 5ANHA 5D2NB 4X5RA 2L7JA 5BJTB 1KWKA 3MVSA 5I8OL 2AEWA 4G70B 4PJIA 4RRPA 2F53B 1TVHB 4YFLI 3FQNB 3EXLA 1ETZA 1ZS2A 1KZYA 2X4OA 5FUOH 4AMWA 2WK2A 4ES9A 5A43C 4B5ZA 3K2IA 1YEIL 1DSWA 3C60B 4GAGL 3N04A 4NZUH 1F6LL 4XC1L 2DQDL 3K2UH 3LPPA 4YDVB 4RWYL 4HUCA 3MRHB 1R3JB 2JCCB 1U8MA 2YMTA 4M62L 5DS1A 5FCSH 3DECA 5ACMA 5C8JA 5IEKA 4R6UA 1JE6A 5KS9B 5C6TL 3BZDA 2AW2A 2Y7MA 2M1KA 4Z7UA 1NCTA 3GK8L 1NANI 4U7KA 5D7IE 1QLEH 2A77L 2ATKA 5PAZA 4HUNB 2AK1H 4JFQA 4HIPA 4I77L 1NWOA 2EDFA 5ACZB 1W91A 3FO0L 1HAUA 2VW6A 1RZIB 5B1JC 1KTLB 3KG5A 1P5VB 1W2KT 4AVIA 3LZFH 4YJZL 3QUZD 1LJMA 4LPWA 5CIPH 3DTXB 4ETYA 4LO9A 3CVCA 3WHXA 4L29B 4YBHA 4UTBL 2FE0A 2CSPA 2BSTB 3S88L 3THMH 3PJLA 4RAUA 2IPTH 3B83A 2EYRB 3FAXA 4GRMA 2D2CC 2NY0B 2OP4H 1AZNA 1U8HB 1I1RA 1KEMH 1WP6A 3C8KA 3OL2A 4NLHA 3QDGA 1U8QB 3SDAC 3ZDXF 4NZFA 4BSVB 2VLJD 1FNSL 4GW5A 1JNLH 3WN5B 1D7BA 1F1AA 4OCXH 4G80B 4CC4C 3VI4A 1EWHA 5IV2B 3L7EA 1HSBB 2AQNA 4DEWA 5ICXA 1TENA 3VFWB 5EBGA 2E6PA 4DJMA 1YY8A 2ERJB 3Q2LA 3C2AH 3K0WA 1MWAA 1JWSA 2VLRA 4F7EB 5JW5A 4MFHA 2N7BA 1CXLA 2PXYC 1A7RH 2Y5QA 3RJQB 1GGBH 4Q2ZA 2WWKT 1ACYH 2IOOA 2NY2C 3EHBD 3DYOA 2WIIA 3R18A 3X1FA 3GRWH 1WDAA 2FQEA 3TZVC 2Z64C 1BX2B 4UBDD 3VRIB 2UWEA 5B38G 4QXUH 1CDYA 1WAAE 5AZ2L 5MENB 1Q0XL 4P23B 1MRFH 3HZVB 1FNEA 4WI6A 5ICZA 3W5MA 3VXMA 2EC9T 4P2RB 3FRPB 3D39D 5KN5B 3UERA 1FZJA 4CILA 4PJEB 3RY6C 4XB3A 3VJ6B 3IMUA 1EAPA 3RNKB 4QXWA 3DO7A 5KSUA 1MZZA 1DVYA 4AL8H 5E8OA 3WU1A 2HJLA 2YD0A 3F5WA 3NA4A 3KPRB 3PL6D 5D7LB 4MJIA 1TU2B 3NZSA 4GP8B 1A25A 5B8CB 1DVSA 2BVQB 4ZO7A 2VN6A 5J6GA 2H2SD 3WTSA 3QZOA 1NDGA 1IBGL 3CDCA 4MHHG 4NJ9L 4C4BA 1PZSA 5LB1A 1EEQA 4GSUA 3UJJH 4BK4A 1FL5A 2DQCH 2DQJL 3NJKA 4DESA 3BDYL 5HI3C 1XGPA 2QEJA 2FWLB 4EJ1C 1GYVA 3BZFA 1Y18B 3L5WB 1YNTF 3PHQA 3WJMB 2O5XL 2OZNA 3HG1A 4PV1C 3WO4B 3ATFA 3U2IA 3RY5A 1TG8A 3BPLC 3R8QA 3EF7A 4M6MH 2KL6A 4ZFFA 4HG4K 3EYUH 2WXRA 3FU9A 1HHHA 1HZLA 2KZWA 4ZQKB 5H2BB 5IMMB 1M7IB 4PWHA 1FLRH 5CJQL 1C8QA 4I7ZC 4NQXB 1PGRB 3OAZK 1TKWB 1MWAH 3OXRA 4PJIF 3VGAB 1ZHLB 1TJHH 2X5PA 3N50A 3TCXA 5I6NA 2EO7A 1MCOL 5DK2A 1EFXB 1OANA 1KTDB 1IAII 5C0AB 1XB3A 1XR8A 1F58H 5LXGH 2BCKA 3KL0A 2DD8L 3WKYA 2VDRH 1BYOA 2GJ6E 1NDMB 4GBXD 3VGHA 2RB8A 4MNQA 4KQ3L 3FTGA 4P4KC 4N8UA 4QTIH 3WMQA 4IBTA 5FGBA 1REIA 4Z7UF 3V2AR 1CYXA 4TUOB 4I3GA 2YAFA 3DWTA 5B21A 4WKZB 5AW3B 1JHKL 1AZRA 1ID5I 4XVTH 1HI6B 1T6VN 3CWGA 1UA6H 3FZUC 2F54A 5LGJA 1U9KA 5I1GL 2C9QA 1YPZA 1DN2A 4KWUA 1UB6B 4P46A 3ARED 1AQDB 3HOGA 4IOIB 5I1KL 2I07A 3EZJB 4NPKA 5EU3B 4PYGA 1CDCA 4JQVC 4Y19D 3QXDA 1U92A 4L4TE 3PXJA 3IJSB 2XUWA 3HR6A 4B7LA 2DTML 4NRZB 4HK0A 1I1AA 2E0PA 4AIXA 1BD2E 4HAFA 4F7PA 4HWBL 3BD5A 3SCMA 3IWUA 1AO7D 2H45A 2Z92B 3LY6A 4OUUB 4S1SL 3VMOA 3VXSE 3WL9B 4IJ3B 2C9UA 4OGXH 1Q94A 2IGFL 3QORA 3GJFB 1NC4B 1K6QH 3VI4F 2AQSA 4GXUN 5T5NF 3FB8A 2VSKB 3BW9B 3EO1B 4XVOA 2A6DB 4I89A 5IUSA 1W72B 3FN0H 1TETH 3KLLA 4LHUB 4BD4A 1FL6A 4Z7QB 1JVKA 4MCZB 5D7JD 3VSUA 1J0YA 3Q2NA 3VUAA 1ZLDA 4G6KL 1MEXL 2PCPB 3MRKA 1KN4L 3GLEA 4PRAB 3HFML 3K4ZA 4TTDC 3P3RA 1TPXC 3QPKA 4YH6A 2GFBB 1SM3H 2CDFB 3H9YA 2X3BA 1HKLL 4E9TA 3K46A 3NK3A 1WLHA 1T4KA 3MR9A 1DO6A 3EJUA 4KU1A 3S5LG 2XIIA 3QARA 5DD3H 3ULVC 3ZTNL 4R2GC 4YVUA 5ESQA 1XD0A 3QO1A 4AJWA 1KTCA 4L2LA 3Q06A 2KKQA 3FB6B 4BUGA 4QGTA 3MLYL 3D8MA 2NDFA 2F7IA 3QUYA 3L9RA 5E99L 2GBAA 4ZX6A 5T8IA 1VA9A 2Q20A 4NM4L 2VLMD 5EO9A 4XP4L 4P2QE 5IY5B 3TH3T 4EI6A 1S7TB 2X4UA 1C5CH 2J2ZA 2AXFA 5IVXB 1U3YA 3UGUA 3QO0B 2IDQA 5B1BB 3DVFA 2D3NA 1WBZA 4NAJA 2J7LA 4XWOC 4ZXBA 3QIWD 4FXGB 4J4PD 2UUDH 1COBA 2G3NA 32C2B 4R0LA 3O9WC 4U3XA 3PGFL 4NZTH 3TBYA 1F86A 2V7NA 5CSZA 4XMTA 4PJFA 3DUHA 4IMLA 3WJLC 3U9WA 1H5BA 1A8JH 4U1MB 1L6ZA 2Q76A 3HKFA 3QG6A 1NCOA 3QIUB 2MKWA 3RDTA 4MNGA 3VTAA 4IU3A 1AGEA 2WLLB 5AVTB 2X2YA 3L6FB 5D7KE 3V4VL 1ADWA 1CLYH 3MV01 4X7SL 1GSKA 4IK7A 2HWZH 4XAKE 5AZEH 5J7CC 1TJGH 1ED3B 1G7LA 5IK3B 2D03H 5DUMH 5C07A 2N01B 4F8LA 1KZQA 1WRFA 4NQDD 1MUJA 2CXGA 4H1LG 4DTGH 3HJ0A 4X8GA 3TN0B 4CMHC 2PYFA 5BS0A 2TAAA 3ARUA 1JZGA 1MCEA 2EIBA 3HUJA 2EJ1A 4H20L 4JR9L 4ODWA 1Q1PA 3FT0A 4JKKA 1MHCB 1S9WB 3SDXE 5E5MA 4HK3N 5HDLA 4Q0XH 2APWA 3WFDH 2DWSA 1KB9J 2R9HD 2XA8L 2DQUH 3SBQA 3V8OA 4W4OC 4QRFA 3AWFA 3JUYA 4WIQA 4RCAA 1R5VB 5DJYB 3P54A 1HZHL 4YHYC 1V7NL 1R33A 2P5WA 4DEPC 1J1XL 3B9KA 4Y9EA 2XCMC 3QZLA 5GJTH 4XMLL 3NACL 4DQOL 2H2PC 4OZGE 3VFMA 1GS8A 5AD0A 1QFWI 4I5BA 1SFDA 1HH6B 2NYYD 3C12A 3ATAA 3K72B 1TJMA 1FCCA 3W11D 2XT1B 3IGUA 1T5XB 3P77B 2WQSA 4JFZH 4QRQB 5BV7L 1TDQA 1V3JA 3P4LA 1YPZF 1TQWA 4CC1A 2UYLB 1RVFL 3ZE1B 4JRYA 4ZMOA 3EH5B 4NO0D 4WV1A 2D3LA 1AMYA 1W8OA 5AOKA 1YQVL 1E4XL 3U7YH 5C2BH 2A5UA 2H9GB 4F9LC 1ADQL 1XMWA 4NQCA 4CBPA 2AEPH 2EICA 5I66B 1G9MH 2QVMA 2WTPA 3FT2B 2R56H 1YQ2A 5IB2B 3MRJA 5IB3B 2OBGA 3U4EA 1ZSDA 1F4AA 2OTWB 1N0LA 4B9KC 2FK9A 3A0OA 1OM3L 3BMVA 1XBDA 2WBWB 3OXSB 4PJ7B 4JDEA 5DGRA 5FO2A 1A5FL 5B39B 2FBOJ 2AJVH 1N6QH 1B4LA 1C12A 1CGXA 4JO1L 3MCLH 4YAQB 5MEQB 5C9JB 2X2IA 2VXTL 5AUMB 2YPLD 4YUEH 4L4VB 1MFCH 1Y1UA 1LDSA 1WCBA 4QRSA 2V9UA 1G43A 1CE1H 4UQ3B 2X6UA 1EEZB 3TVMA 2PN5A 4Z0BL 5I6OA 3B34A 5DLMH 4M61B 3JZYA 1U8OB 1R3HB 3GJFK 1YYCA 2WBJB 4KY1H 4MKTA 1KJVA 5GRWA 2E7CA 4PJ9D 4B95C 4XVJH 3IT8D 2J5WA 1D7DA 2ZXAA 3KLDA 4HQQL 5JHAA 2OPCA 1XCQB 3W9DA 1AVAA 5T3ZL 4TMPA 4KRLB 2CNYA 5M7QA 2A1WL 3CZSA 2WXQA 4CU6A 2NY3B 5AOJA 1T2QL 4I13B 4LDCA 2BWIA 1WZ1H 1PZ5B 3NIFE 4EN3B 4YSDA 1EO5A 2MQ0A 5D70L 1KB5L 2CHNA 3B2VL 3SKNB 2J3SA 1WWCA 2I9LB 5I2IA 1OLZA 2CMRH 3VD1A 3DXAA 4OKVA 2FO4A 1BIHA 5DZOA 4N1CA 4H8WC 2WWMD 2VLLA 4PRIA 3DRTA 3MOAL 3RBSA 3MDJA 1ZHNA 1Z9PA 2CLVA 3ZKNC 5JOFB 2C3HA 3E2HB 4WEBL 5KVFL 3SGJC 1AOZA 3RTQC 2DN7A 4BQ9A 2AHIA 2VITB 4L9LC 2GQHA 3FDWA 3LN4B 3HE7A 4K23L 2HH0H 4ODVL 2CCLA 1INEL 4EN2A 3Q0HA 1RUKL 4AQEB 2ZYIA 1FYTB 1ET8A 3GSNB 3QULB 3P3TA 3FQRB 1K4CB 1DJZA 2E4FA 4FNLH 4MJ5A 4JGUA 3TU6A 5ETUB 4PJ6A 1PZBA 2X05A 1H3WM 1GZHC 2NMSA 2NNXA 2VM3A 4MA1C 2PR4L 4NQEA 4KO5A 2NQCA 3HB3D 1FFOA 3KPPA 1PY9A 1UFGA 4HUXB 5J1AB 4YNYA 3EJZC 5I8KH 1ES0A 2CKNA 1I3GH 1O75A 2JJWA 1OAKH 4LCUB 5B7FA 2GY7B 2G2RA 4KXDA 5F72S 2BSSA 2XVLA 1TVBA 3MLUH 3UMTA 4CN4A 5DTFA 2RTTA 3WN6A 4WWOA 3BKJL 5CN2A 4CAGA 3ARPA 3DHUA 3MV11 4PJDA 5HSFA 3T8XA 5LXVA 2JFCA 3LKSB 4EOWL 2LAAA 5DC0A 4XO5A 4PU2A 3UAJC 5FECB 1U2HA 4UQDA 4Y4FB 5I1JL 1AGDA 4C8XA 5KAQG 2XG4A 5CKAA 1VACA 4DK3A 2ZSVA 2WJ5A 1OGAD 2DQHH 1BQLH 1F3JA 3T5WA 4PRBA 5AAWA 2TSAA 3JYBA 3CQFA 4FEMA 2J21A 4P99A 3GMOB 1JZFA 3MCKA 4M1DH 1VFAA 2YC1B 3BVDB 4PS4H 4Y2DD 1ZAGA 4ODXB 1QKZL 1UWXK 4ZUVB 2DBJA 4U6TA 4JKWA 5B3SB 4A2DA 1WFJA 2VXSL 5FYKL 4L8SC 2W60B 3HPLB 4HOMA 1SPDA 4KAQL 4FFTA 1CFSB 3DYPA 1G87A 2XJLA 15C8L 3NJHA 5TQ0L 3DRQA 3TX4A 1CD1B 4YXLH 4W9JC 1ZDQA 5I9QC 1I1FA 3GWJA 2E3VA 3MLXL 3BUDA 4YLCA 3SKJL 2C1OA 4TUKH 2A74A 3Q8FA 1K8DB 5ISZE 4ZODA 2KQMA 3I74A 1PCXA 4FI6A 3ULUH 5IKCB 2O5NA 2AP2A 4YSOA 5FC9A 3TP4A 1MJJB 2GBUA 3HI1B 4Z76A 5PCYA 2B1AL 1DJIA 2X87A 5E6YA 4O5LH 3QNFA 1BZ7B 4YFDB 1V3KA 1N3NB 2PCXA 3MBED 4ODSH 3HG0A 3MRNB 4EKJA 2JB6B 3U0PA 1YAIA 2FWOB 4AM0A 2YQ2A 1VFOA 4KROC 4KJPD 4ZBJA 1WJ3A 4R3SB 4ABWA 1CR9L 2CNZA 1A7BA 2B5IB 5FAAA 3D33A 1Z3GL 2EILB 4K7PL 2UZIH 4XMKH 5BCAA 4O58H 1UHVA 5C9KA 1KJ2L 5B7MA 3ZSTA 1U58B 2E9WA 2XZQL 1TITA 5DEGA 5DMIH 2YD6A 2JQAA 4LCVA 3CHQA 1G9NH 2ZKWA 2BSRB 2F74A 4IBQA 2YA0A 4LEOB 1J5OL 3T65B 3V79C 4PTTA 4LKCA 1C16B 3UO1H 4A66A 1DVFB 1U8NB 4MJHA 1TQCC 4N0CD 4Y19E 5DRXA 1MZYA 3T09A 2IVFC 3SYCA 3CK0L 3QQ4A 5JQ6H 1CGYA 2VZ3A 1DEEB 5DR5L 5D93C 3B5TA 4OCYL 5HBBA 2R29L 3H6JA 4XB7A 4L1BA 4ZO6A 3LHPH 3L3KB 5B1JA 3CJJA 2HKAA 2HVKB 2NNCA 3KJ4B 2D9CA 4FFWC 2DJMA 3SGEH 3VM5A 4NBZB 2UV3A 1IEBB 3NCBB 3FH8A 5DJZA 4WLCA 3ESVF 1A6VL 4ZTOH 1URIA 3CVHH 1QHPA 4D0CB 2VN5A 1Z66A 1E40A 3MOBL 3MYZA 4EZMA 4HG4J 3SDAA 1YNLL 4N0FA 2OMUB 3SQOL 3RPIB 4U6HB 4UOQA 3NFSH 2NY1D 3CFMA 1EDYA 5IJBC 1QASA 2OMZA 4CC4A 1AY1L 2ZOLA 2NY7L 1JPTL 1M6OA 3BQUC 2Q1EA 1KIPB 1ZGLM 2DLFH 4G8GB 4U1NB 2C3WA 4IBWA 3QYNA 5A6IA 1BFOA 1NEZB 5LN4A 1MCQA 4LSDA 2VLME 3P69A 2A9AA 3CE1A 5A3IC 3ULSA 3CDGA 4GMSL 3CXFA 4UQIM 4YVNA 3F04A 4BDVA 4V2CB 2BNRE 3IMRA 3ARFD 3TZVA 2A0LD 3MACH 1YY9D 3VE0A 4LPUA 4HUVB 2APVA 1TCRA 2EVHA 2WWNA 4UIKL 5ALCL 3RWFB 3CX5K 1O6VA 4MX7A 3SPIA 3TBWA 1AZUA 5GQBA 2DMBA 2VXUH 1V54B 3SQBB 2GTZB 2VMEA 3RX9A 4GRWH 1BFTA 2PCYA 4IK6A 5KJRH 5B1AB 5HHQA 5GS1B 3DX2A 2DMKA 1THAA 2L7QA 3TA3B 3BVNA 3LQAC 1HNGA 4Z7OE 3CFBA 4BFFA 4E9WA 5T33H 5DU7A 4AV4A 3GSOB 4RIRA 1VEOA 3ECBA 4Y1AB 4QPEA 3S35X 2JKRM 3RU8H 4DKDC 4MDRA 1EFQA 2VQ1A 2GUOB 2JQZA 3KCWA 4QLWA 4J39A 4G9FD 4HKBA 4OH2A 4J3WA 2XX0A 3I85A 1X5JA 3KYKL 4S2SA 4N0RA 3WGVB 5A7EA 5A2CA 1FIGH 1KPRA 2X9XA 5I1EH 1VHPA 1ZK5A 3BUYA 4LSQH 4MDJA 4ZFOL 2FRGP 4KKRA 1S7RA 5EDSA 4JFDE 3U30B 1JZ6A 4BQ8A 3TJHD 4J7RA 2QV2A 4YSCA 1NMCC 1WGVA 4KJWC 3RP1A 4RMVA 3AG3B 4JPVL 1G6VK 5ADPL 4M5YL 3ZL4H 2GVYA 2MCAA 1J05B 2J56A 4LXFA 2R15A 4UMSA 3MUGA 4PJCA 2MHAA 4E0RA 2WANA 4AGOA 4OI8A 3U4BH 2XG5B 4QHLB 2D0HA 4GKLA 4AEHH 1N7MH 4ABQA 2X7LB 4WO4C 1E4HA 3CIQA 4NKDB 2EEDA 3RFZC 4KVCL 1F1DA 3LNEA 4PB0H 1KYDA 2UZPA 2J1WA 4FCAA 1VZHA 3O4LA 3QUZB 3R7RA 1TNNA 3QNXA 1B4JL 4XCFH 2JCCF 1MIMH 3L4VA 4G3YL 3B7TA 1NCAL 2I85A 4XNZC 4XP9H 4YDNA 1IC5L 3GC3A 4HGKC 4ZTPL 3WYRA 4B9JA 5KS9F 4MB1A 3MLZH 4PGEA 4Q58C 3D0LA 4LBEB 1K3IA 3RX5A 1F8TL 4QHNB 5C0IA 5GS0C 2OI9B 2VLJB 1XSJA 3L2NA 1D5MA 4X98B 1SMDA 4O02B 5JXEC 2Z31D 3U83A 4P4KA 1OT1A 4KVNH 4LCYB 1NMBL 4IS6A 5EWIH 4QXGH 3TCTA 2DLGA 2EXYD 2E5EA 3MU3A 1N64L 3BWAB 2ETWA 2RAMA 5DRWA 2YHGA 4U0QB 3BGFB 5HHMD 4F58L 1E5CA 3QXVA 5I73C 4C47A 3MLTB 4N25A 2A4ZA 5TK4A 4IKKA 1RIUH 1CF8L 3NPSB 4YWGH 4AQAA 2ODHA 3D08A 3QWRA 4J3SA 4XI5D 3EHBB 3K80A 3Q1SH 4NWUL 4JQVA 5FUZH 4KZDH 1CN4A 2DIJA 4G6AD 1P4LA 1I8UA 2W07B 2ZJSH 2YPLE 2D31B 1J0JA 2W91A 2Y23A 3D18B 5TGBB 3FTZA 2C9SA 2NXYC 1XIWC 1KXVC 3VG9B 1WC7B 1XL4A 1JK9B 3SDDC 2J8UE 1NFDE 4X9YA 3D39B 1Z9SA 1G1OA 2NNAB 4MQSB 4C83A 4E41D 5CJOH 3G9VA 3FB5B 3HFFA 3BGAA 4XNMB 3D2UD 3RWIA 3VW3L 4KO6A 4UV4H 2DLIA 1HHJA 3FQWB 5BZDB 4FTVD 5AKTA 2BSEA 5C71A 2A6KA 2MCMA 1VERA 3ERXA 1FE8H 1C5BH 4J1UA 1E4KC 4TQEH 3PL6B 1FBIH 1BIIA 2IV9A 4MCYB 2P8MB 1E50A 1NINA 3WY4A 4U0RB 1KIUB 1UFUA 1BW8A 4PJEF 3QEQD 3QJZA 2B15A 3OF6D 3LRKA 4JDVB 3U25A 5SWSE 1IL1B 4LE8A 3RWDA 4G6FD 1GAFL 2X53A 1FYHB 4BH7A 3ARTA 3HMXL 1NCJA 3HLAA 3OKOA 4ZUSB 4LASL 2OSWA 1GGCL 4FA6A 4PJBE 1H3PL 3CZJA 4RMWA 5BRZE 2B2XL 3N43B 4F8PA 1T04B 3EXJA 4J5VA 3T4AC 1R6VA 4L1LA 4LCWD 2VKXA 3GMQA 4XXCC 2F6AA 4JMNA 3WXWL 3VRLF 4U49A 3GBEA 5D4JA 4G1MB 3BH9B 2OW7A 3GB7B 3EYVA 3CNKA 3WUZA 5GSRB 2MCPL 2ICCA 2BNQA 3Q6FB 1T1XA 4LDLB 3GBLA 2PABA 4BE6A 5JYMA 1A4JB 3TFKC 2XV3A 2Z8SA 3I2CH 5BO0D 4MXVE 4ORGA 5DK0B 1GH7A 5I24A 4WK4B 3EJTA 1EJOL 1T0NA 4NNPH 3VWJC 5BQ7B 5KVGH 3O9WA 3Q5YA 4XXDB 1XF1A 3T0ED 3RWJA 3N1MC 5T1KB 2LFGA 2AJYH 3O6FC 3H55A 4E5XB 1CFNB 3DX8A 4ZS6D 2OMVB 4HPHA 2GITB 3O6KL 3VXUA 2JVUA 2P45B 3OB8A 4QIRA 1TLKA 1A6ZA 4WUKL 4BQCA 4Y5YB 2YD1A 4NZJA 1FO0A 3P0VL 3IETA 3QJSB 1PJWA 1LO4H 4HSCX 1E9PA 1EMTH 4P57A 4GBXB 1JV5A 1XAUA 4WWNA 3MGOA 4R5VA 1G7JB 4FD0A 3IK2A 1M3IA 1AD9B 2GPZA 5TFSH 3AREC 2K6YA 4FGMA 2OJEA 3AU1B 2L4OA 3BVVA 5JIMA 1HHKA 4P59H 4UYQA 1S7WA 5F44A 4I3RH 2X4PB 5AB9A 3EGSA 3Q3GA 3V0IA 7FABL 4K2UH 1GKEA 1OGAE 2Q8BH 3K6OA 4LSVL 5D7IA 4AH2A 4CSSA 3U6RB 1INDH 4V11A 2Q2EB 2Q86B 4Y19B 4ONHB 2EDLA 5GZNC 1YC8A 1KENH 2EE6A 1F41A 5DEZA 1B0WA 2BY3A 1KF9B 3ALWA 3DIVA 3H2PA 2KPNA 4W4OA 5AW1B 4JE0A 4LB8A 5AQ0A 1F11A 5GGSA 3PIQB 1G7MB 2FYVA 3R19A 1AO7B 4AGNA 4MD0A 4GSRA 3G6JB 3L3OA 1IT9H 5FYJD 3ULVH 2DPKA 3V5KA 5IBTL 3NABL 2XY1A 3QCUL 2NOYA 3HC0A 1HCZA 1H8SA 4M6NL 2J5LC 3P4OA 4AXWA 5D7SH 4UILL 4IRZA 2PP9A 3MRQB 4P3DA 2H3KA 4QRRE 4TVSa 5D7JB 4AM0Q 3KJ6L 1NGQL 4N8CH 4UB0L 4DFHA 1UA3A 3ZZQA 1FLTX 4LKXA 2PCFB 2PTTA 5ENWA 2HKFH 2P5EE 2IAND 4GRLD 3FNKA 3FT4A 4MQXC 3GSUB 4JO4H 3BRDA 3PGDA 4F9LA 2N0MA 1FAKT 1NCDL 1NIAA 3IRPX 4GKOA 1DP0A 4MWFB 3VNYA 4UAOC 1GMIA 2P24A 3NZ8A 2CLRB 4ZPVA 1MI5E 4QO1A 3QFDA 1IGTA 3Q6GH 3CU7A 4HXAL 2XIBA 3QAZB 5JW4N 1KCLA 2VDNH 2W9EH 5T1LA 1DBJH 2P7TB 3GMRB 3C8HA 2N7SA 4OZ4A 1WAAA 3ZGHA 4F24A 5GISH 3MRBA 4N0YH 4JM0A 3SPVB 3TO4D 2Y0SA 3GSXB 1FO0H 2ROXA 1O6SA 4NC1E 1DR9A 3G6AA 3V0WL 3VD2A 1X5YA 1BZ8A 2FEEI 4W6YB 2FO1A 3FN9A 4JPQA 3VQLA 1ZEAL 2Q3ZA 1XB8A 4J3OD 4LLVA 3QJHB 3QIWB 3QCVH 4GO6B 5HHXL 4IBZA 1DEDA 4JO2H 4XH2B 5FA4B 4YE4L 1VGEH 4MJ6A 5JIPA 1DDHA 3MKKA 4U6VH 4GQQA 5IJCC 2EDJA 3J7HA 4JAMA 5C6WH 1SEQH 3MFFA 3S37H 5DD1H 3ULVF 5T5FA 2GSGA 4JG0H 1YAZA 3WUWA 3KYNA 2IH8A 2OL3B 4Z7OB 1UXSB 3TV8A 1RULL 3EG9A 2Z4TA 5IWLC 3S8WA 3PWLB 3BKCH 4TRPH 4KDWA 4P5MB 4M93C 2P8PB 5I1AA 4M43L 1A02N 4PGBA 5KBPA 3US1A 2JB5L 1IC7L 3OX8B 4XOAA 3C5SA 4Y1SA 3OHXB 3ET9F 1ZLWK 4DZBB 5CBEB 2AGJH 3Q5OA 3ROLA 3AAZA 4NKIL 5KG9B 3K5RA 4W9CC 3AS2A 4NQDB 2KDGA 2Y06L 2JKNA 5IGXH 3X3FL 1GZQA 1X5LA 1SFHA 2WBKA 4QY8B 4CBZA 1NCHA 1OXYA 4JGNA 5FHBL 1HN1A 3LEVH 4IRZH 4CVZA 4PG9B 1G0XA 1HCYA 2YN5A 3BYTA 5ID1B 1MFUA 2AXGB 4ZSOE 3FU6A 3ASWA 2CGYA 1WFIA 2GY5A 2YWYA 2J55A 2QFRA 4BSWB 4OCRH 3SGJA 1JDDA 1A65A 2JKXA 1INQA 4AG4L 2QDWA 3MRLA 1UEYA 4NC2B 4WJ5A 3U36B 4XNQB 2OSXA 3HS0B 4FULA 4D0BB 1JD7A 3T4YB 3U1SH 2WINA 2RALA 3W56A 3NJIA 2F61A 4JY5H 2Y6SC 3D48R 4AQ8C 4B9GA 1DQQB 2GJ6A 1AACA 1I31A 4HIIB 1U4EA 4F15C 2D9QB 3LRLA 3PP3K 3GSQA 1JHTB 2BNUA 3BAEL 1H15A 1GZHA 2PPDA 3V0DA 4TOYL 4C4KT 5T3ZE 5I19H 4ZMAT 5T5NG 3H53A 3GXUB 4NO0B 3PHOB 5L0QB 4LVNB 3MJ7B 3CFKB 1XF2B 5I5IA 3UO8B 1RK1B 4Z77A 1MJUH 35C8H 3BPNC 1PQZA 4OAWB 3OQRA 1DUYA 4GG6B 4LARL 5DDHA 4L4TA 5HYQB 1SXAA 3CD4A 3CPLA 3WTXA 5T5FH 4NAMA 3WE6B 1DBMH 2GTWB 4LT7A 3UAJA 4TNGA 4APQD 1YEKL 3ZE1F 1NL0L 2XWRA 2BFVH 3LH9A 3C5ZA 1AQHA 1CICD 3FQ1A 4TNEA 1LXMA 1BLNA 3GXMA 3UFIA 1SJHB 5JDJA 3VXSA 1EXUB 1EANA 4B9YA 4OJAA 5KVFE 3AS3A 3CQPA 2YPLB 3FQUB 4MD4B 4PRPE 5CZXD 1YYMH 4TULH 4XB8A 5DLLA 1BBJA 2VC2H 4JHVA 3TT3L 2F0CA 2R2EB 3HVNA 4Z3GA 3UACA 4NIYE 5IF0B 4C56D 1ZRUA 2GW5A 1FVCA 3BT0A 4ALAL 3QH3B 3K1DA 4JRWA 3BVUA 5TE7H 3KLAA 4ATTA 3IXAA 3L81A 5FA3B 3IJYA 2OTUB 4JFSA 4NDMB 4PJ9B 3FO2A 4FYQA 3BHBB 4FG6C 3UYRL 4H8WH 5EIIB 4OM0H 1AQ8A 8FABB 1EJ6A 2IBGA 3FSVA 2ZKHL 4OQTL 2WQUA 2NW3A 1I9JL 1U8JA 4NUJA 4BKTC 1DJXA 4C55A 3APNA 1AQKL 2IPUK 2XN9E 5D5ME 3RGHA 1UM4H 5I71B 4GXVL 5C09B 2ZICA 3JVFC 3BT2H 4JRXD 3A6CL 1NMAL 4JCLA 3ZJAA 3EOTH 4PB9L 4XCCL 5L88H 3F01A 3M1CA 1W0WB 1ZY9A 4K3DH 4G1EB 1T89A 4LSPL 3MLPA 4L23A 1GPOH 2P46B 3OR6A 2F8XC 1QRKA 1A2YB 3DIFB 3RUGE 5FWRA 2HP4A 1QHOA 3ZMNA 3H1ZA 1FH5H 5KVDH 3KLHC 1W0VB 4WSJA 3CMOH 4Y16D 3I6GB 3S3DB 1M9SA 3K8KA 2IALA 3CX5J 5E6IC 2YK1H 1F45A 1M9WA 1ZS8A 4LEXL 3UJIL 2PW1A 5K33A 4NHUB 2GIXA 3L3DB 4ENED 4X6EB 3LIZL 2XRAL 2V2TA 4M7LL 4D9LL 2WPGA 2BP0B 2FWUA 3MV8E 3LOWA 3FOLB 2BP8A 4EIZC 5FYKE 3BKMH 3HJEA 3RA7H 1E9OB 2W59A 4X4YB 1A3RL 2FBJL 5DVMA 1GY1A 4GAJL 4ZMNA 4WZ9A 5BOZG 1SRDA 2BHUA 3BAWA 4F57H 4PBWD 3BP6B 3HB3B 5E03A 3APCA 1FNGA 1IBHA 3DTUB 3U6XA 3BESR 1SHSA 1K9TA 1SN0A 4PRDB 4GQZA 5AW4B 3QFJE 4W9KC 1JPSH 3O8XD 4XNXH 3V4UL 2FIKA 2ZXDA 4XCNB 1PG7W 2W9DL 3OKNB 4HSQA 4K9EC 1MJ7H 5IROC 3N85H 3O2WL 1TTRA 4ZO9A 1L6PA 5KBLA 1J9SA 4NXKA 4JY6A 2UXVA 2R0LH 5F9JA 1I9IL 3SDXA 1X44A 2Z8WC 3QFGA 3JWNE 4WI0B 5F7BA 3RKDD 5AWNH 5JORB 1AH1A 2DL2A 4HA1A 2IV8A 1S7XB 3U79A 1B0RA 3FB7A 1U8PB 3RIFK 4PV8B 5HGHA 4HJ1A 3QEQE 4HCRA 3T77A 1CDJA 2ARJB 2OXGB 1YLBB 2XFXB 2BINA 3AW5A 4OZGA 3LD8C 2ICWA 3K6NA 4Z8FL 3N1FC 3VSTA 3QUXC 4Y2DB 4EUPG 2DBLL 3N41B 3PWNA 4GFXA 5L7XL 1HCVA 3GI8H 2CRMA 3BQUA 3TIEA 2ED9A 1FFNA 3P3YA 5ESAB 2Z93B 4PM1A 3W0WD 2VDPL 1NSNH 2G3XA 4F93B 4A7TA 2VDOL 2YRZA 2VE6A 3FSWA 4Q9RL 1G4MA 4MMYB 2WVUA 2WB7A 1KC5H 2G75B 4NQVA 4QT5B 5D1QE 5KYXA 3D85A 5EN2B 1J9RA 1KCRL 3DROB 2CR0A 5DVLA 3X1BA 1ZGLA 2CDGA 4RDQF 3L1OH 3SHSA 2AK4D 1NUFA 4UQEA 3MOQA 1D9KC 4RAVB 3NESA 4DOHB 3LAFA 2H0PA 3CFJA 2ZE0A 5HDBE 1KG0B 2QSTA 3B2MA 4JHBA 4GAFB 3T0EE 4PJHB 4FNSA 3F58H 5FO7A 1OTTD 2BX5A 3GMNA 4H2AA 3VSQA 1QOKA 3D5OF 4J6RL 1ZPLA 4ZYKA 5D55A 2HFFB 4MCMA 1HHGA 2MKLC 5JHDE 3S97C 1CLZL 4HFWA 4NC1C 2VIRB 4G5ZH 4KOCA 2HKHL 4LRIC 1G6RA 2XQYA 3OPZH 4M8UA 4PJGE 1MXDA 2YZ8A 5DJ6B 1ZLUH 1IQDB 5L2KE 3KXFE 4HBCH 4APXB 1CFQA 1JGDA 3WFCH 4JFXB 4QJ4B 4BKLB 5DYOA 5AW0B 1CBVH 4OCMC 4KQ4L 4QI3A 3G5VA 1F4XH 1NUDA 4I1RA 4IDJL 1MIEL 4P9ML 4B0MB 1E27B 3T0WA 3EO9H 3LRSB 4WI4A 4Z7VE 2DMCA 2G5BB 2CHWA 3NAAH 4NQTA 3RB7A 5F3FA 3VGEA 3UTTA 3ETBJ 2Z7UA 5F70A 4JREB 4ELKA 2F1EA 2OS7A 2GBVA 2FHBA 1ORSA 1UOKA 4XC3H 5FUOL 5DA4A 3CSTA 2ZWKA 4G6JH 2FGWL 3P4NB 2GJRA 3MRCB 3K2UL 3QDJE 4JMXA 4OF3A 2A73A 4G8IA 1HTYA 4CW1B 5IMKA 3B3IA 1AR1C 3WXVH 2ITCA 4TLSA 5BV7B 1I7TA 1RZ8B 2HT2C 3D3VD 4HCRH 3AXLB 1KJMA 2FAUA 3L4XA 4YSSA 2ZUXA 3RFZA 2Z7WA 2FX8H 4DZ8A 3T6QC 5GGRY 5D6CA 1WGOA 5ANMB 2XOTA 4OLVH 1QLEL 3BEWA 1DQMH 2AK1L 3LRHA 4N3TA 4Y2NA 1SMOA 2K7QA 1ILSA 1QSZA 4N0UB 3UC2A 4YDIL 1AGCB 5F7DA 4OVVA 3RTLA 3HG5A 1URLA 4JG1H 1OSPL 1FZMA 4L5FE 3LSOB 3IB4A 4UF7C 3THML 2R51A 1MLBA 2IPTL 5CD5D 4B6ZA 2OP4L 2NY1B 4WY7H 4YC2B 3UTQB 1TNMA 3KEHA 3NN8A 5JXEA 1A1OA 3ZE2E 4POYA 5IJDC 1CL7I 3ESMA 4AWJC 4NAQA 1FZOB 2JLPA 5ECGA 3ETBF 1JNLL 3CPUA 2BMKA 3QDME 2OYKA 4C59B 3IKCA 2WP3T 2I9TA 4OCXL 4AMXA 5MHSD 3PABA 5I74C 3GUTB 2Y7OA 3Q9QA 4DQAA 3LQAH 1KXHA 5H8DA 4H25A 4HEPG 5D9SB 3WV0A 4AEEA 5DVOA 1G6RH 1M1SA 3IAPA 1SDDB 3C2AL 4N26A 4N2MA 4FQCH 5IM7B 4M5SA 3SDXF 4PY7A 3W9EB 3B8SA 2NW2B 3T3PB 1A7RL 1I8LC 1GGBL 2RIKA 3ARFB 4JM2C 5ICYB 4N85A 1ACYL 4AYFA 3KYAA 1JF1B 2G4GA 4ZOEA 3KWVA 1KLUB 1VZGA 1XIWA 3VFPB 3TEYA 1MJ8H 2VTFA 1WYJA 3GRWL 1KXVA 4OT1H 3SE9H 5EUKA 1P7QD 3EJYD 1UOWA 3SDDA 3SGDH 2GCYB 4K3HA 4PMEA 4QXUL 2DWXA 2WXKA 3ARVA 3S3PA 3TF7C 1Q9LB 2ZCKH 1KB5B 5E0QA 2G9KA 3GZKA 1NOFA 1Z5LB 2KYIA 2WKOA 3JTTB 4GXFA 5CGMA 2BOCB 3PUUA 1BEYH 5DD0H 4UU9A 1B2YA 3NFPB 2OSLB 1JUFA 1E4KA 1SEBB 5FYLE 3KM1A 1UGKA 3D0AA 2VGLM 4WHDA 4AL8L 4BWWA 3Q01A 4WJG3 1S7VB 2B14A 4OF0A 2JJTC 1LO3H 3Q1EA 4G9FB 4X6FA 1GXEA 1DFBH 1OV8A 3FBQA 4ZUTB 5EU4A 1I8MB 3GSRA 1CGUA 5EIVA 1CU4H 1S9YA 4X6CE 1UM5H 2WZPA 3ZIMA 5FDWA 1MH5B 4OCNC 4O2CA 4IU2B 1ZVSA 1I85C 5C0FB 1JWMA 2Y3AA 3BCDA 2AXHA 4AKPA 3RIAF 3UJJL 4XXWC 3T4AA 3IS0X 5ISZA 4QF1A 4HZAA 1QW8A 5B38B 4UUJA 3KW8A 4FQXD 1DYZA 3IFLH 4P8QA 3C5JA 1RCYA 5GS0H 4KVPA 3NGBB 3RZCD 2Y36H 1IGML 5FX3A 4Z7NB 3U0WH 4D9RD 3MTXA 4HCIA 4M6ML 3KNBA 3FO9B 4PR5B 2QQKL 4OJDH 3VWJA 3EYUL 3FT3B 1XD1A 3SB3A 4B5EA 3HN5A 1AANA 5BXFA 3DJ9A 1LLAA 3ECUA 4Y5XC 2GAZB 4KKAD 3AY2A 2W38A 3O6FA 5E5UB 2ZOKA 1FLRL 1LP9B 4PLNC 1DBBL 3MNWB 1A7QH 5GGVY 2Z35A 1JNHA 1MWAL 1DVQA 2FJGA 1TJHL 4HWZB 2MTAA 3F7RA 5AB2A 1FQ9C 3PPSA 1MAMH 2BS8A 4KI1A 4PVMA 1BQHA 1S9XA 1UD5A 2LFEA 4F20A 4DP1X 4IMKC 2Z31B 3ISYA 3T0AA 5LXGL 2ZKMX 2VDRL 1WZKA 3FH7A 4HS6B 1WFTA 1KBKA 4PJAB 4M8QA 3DVNB 4HGWB 5HHMB 3H4HA 3X11A 4QTIL 5DO2D 2EECA 2OQJA 3BAYA 2R0KH 3DX9B 1AJ7H 3P0YH 4HDIB 4YK4C 3IDJA 4XN2A 5INDB 3KGTA 4IGBC 4LGRB 5CJXC 2FR4A 3QNZB 4XVTL 4M02A 5BUPA 3IJHB 1EEYA 1UA6L 2OMYA 4HF5H 5KBDA 1IAOA 3REVA 5GZNA 4MXQC 1B0GB 5F0JB 4G43A 1RSYA 1GGYA 1NKRA 2VDLL 2K9UA 1HXMA 2FEDD 4C56E 4I4WA 4XP6H 3KDMB 2XIDA 3P9LA 3CVBA 5EU7C 3ZT7A 5E8PA 3JWNC 1KYOK 2GBTA 2BVOB 1XGQA 4E41B 3WY3A 3LQZB 1N59A 2R7EB 4Y4HC 4JZJA 3TWYA 4AW7A 4Y4KD 5LBVA 1XGUB 1BSIA 3D2UB 3QA3A 1KIQA 4CGTA 3K2KA 4OGXL 2H6PB 1K6QL 2WQXA 4ZRGA 3APDA 2VRAA 3AJ7A 4FTVB 5E9DE 1ZTXE 1JPGA 3BP5B 4UOJA 3OAYH 3GMMB 4N2GA 4FLOA 1TQSA 3HPJA 1TETL 5AYUH 3A3YB 3U0TB 5IOPA 3QS2A 5H4YA 1KJ2B 1T21B 5F6HJ 1D5BA 1FRGH 1UVQB 3ZTJH 1P7KB 1GMEA 4G6FB 4UQ2A 2Q7YB 3EFDH 2JV6A 3FHAA 5D1QC 3BWZA 2WXMA 5JZ7C 3K71B 1NGYB 2BNRA 1NFKA 2XTJD 4JFEA 2CZNA 3OKDB 2V9TA 3LRMA 4W70A 5EU6E 5FWQA 3DO3A 4LCWB 5F7LB 4O51A 1RIVL 5C0CD 2APFA 1M7DB 2CUHA 4XN1A 1PEWA 5DGQA 3DPDA 5BVJA 1X7TA 2XACC 3DUSB 4P4RB 3DURA 1XGRB 1OTSD 3NRPA 1QSEE 4TVPE 4YQXH 2EZ0C 3D30A 4GUCA 3N0AA 2J6WA 1C5CL 3CLEH 5KSAD 5J06A 1WICA 3N43F 3BYYA 4LOUD 4XGZA 3JV0A 2FSDA 3CGTA 5JOPD 1A64A 4YO0A 2VDQH 3CCHA 3T0VA 1XTMA 2YD3A 3KPOB 4JKPH 4NZTL 4H5SA 4N6RA 4PAZA 1A0QH 5IWLA 2OMWB 4HP5A 2B1OA 3F12A 1F4WH 2DMHA 4MGXA 4CNIB 5IMOB 1H8OA 5JO5A 1PNCA 3DV4A 3BWUC 1SVZA 1PKQA 3S4SA 3PWJB 4YDMA 3I3DA 4MVBD 1KCBA 4DGYH 1WZMA 2ORBH 4PP2B 3C6SA 5EG6C 4IQHA 3EYFA 5F9OH 4JFDA 4WU5B 3I6KB 1TZHA 5JIQA 4XHJD 3BZEB 1A3QA 1B3JA 3M7OA 2ICEB 1CLYL 3G3LA 1VEMA 4JFFD 1UOLA 4PW4A 4RGMC 2HWZL 5AZEL 1RXLA 1TJGL 5B1KA 4XZUA 4N87A 1UQSB 2D03L 5DUML 1L3WA 2FL5A 1A9EB 3VH8B 4DTGL 1VDGA 3AG1B 1X6NA 2Z7ZA 3K8LA 4PGDB 4RNRA 3RY4A 2BXYA 3RWCA 1AKPA 4RMBA 5SWQB 5IB4A 1EBPA 4X0KA 2ZG3A 3EUDA 1QRND 2ZONA 5GRUH 4GAGH 4JPIA 2DQDH 4CJ1A 5C6PB 5C0BD 2K8QA 2LTQB 3WFDL 1LEKA 3WTWA 4V1DE 1MRCH 5DJXB 3QJUB 3TIDB 1TT6A 4IDLA 4WW2A 4KMQA 5J3HC 3QYCA 1F5WA 4AQ8A 5T1DH 5GJTL 3WE1A 4YSTA 3MI6A 5C6TH 4ZMZA 2IDFA 3GK8H 1E6OH 2B77A 3IF1B 3HZYB 3LEXA 1KXQE 1P4BH 1KDJA 2NLJA 3CSYB 4GT7A 4I77H 1XH2A 3FO0H 3ZT5A 5C1MB 5JIDA 3NCEB 2H32A 3FUDA 3GTNA 4JFZL 3WFZA 4GRLB 2IANB 4FADA 4Q4IA 3WHE0 5CEXA 4Z23A 4H1LB 4HJUA 3BO8B 5EOTB 1XSIA 4YHZH 3VFSA 3WAJA 5DHYA 3LPGA 4JO3H 4FZ8H 2JI2A 1UT9A 4M7JH 4RX4A 4B41A 3VDBA 4LFHG 3FRPG 1YN7B 4ZFOB 1OPOA 3DUUA 2QQLH 1N5YH 2AEPL 1G9ML 3GMLA 3OVUB 4LP5A 2R56L 3SPHA 2EEXA 6PCYA 2BM3A 1HOCA