The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
197
|
structure length |
181
|
Chain Sequence |
ADWDFSAISRKATALYGPLGAGQQRIDAWQNLLATQKQVSEMEKLKVVNLFFNKQMRYVEDIDLWHEVDYWETPIEALWKGAGDCEDYAIAKYFSLRHLGVASDKLRITYVKALRQNRAHMVLTYYSSPDAMPLVLDSLIDPIKPAAERTDLLPVYSFNAEGLLSRWQDVLKKMQAEGFPV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase/hydrolase
|
molecule keywords |
Two component histidine kinase, GGDEF domain protein/EAL dom
|
publication title |
Mechanistic insight into the conserved allosteric regulation of periplasmic proteolysis by the signaling molecule cyclic-di-GMP.
pubmed doi rcsb |
source organism |
Legionella pneumophila subsp. pneumophila
|
total genus |
57
|
structure length |
181
|
sequence length |
197
|
chains with identical sequence |
F
|
ec nomenclature | |
pdb deposition date | 2014-07-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
E | PF06035 | Peptidase_C93 | Bacterial transglutaminase-like cysteine proteinase BTLCP |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | C8orf32 fold | C8orf32 fold |
#chains in the Genus database with same CATH superfamily 3ISR A; 3A55 A; 2F4O A; 3KD4 A; 3A56 A; 4FGP A; 4FGQ A; 4FGO A; 4U65 E; 3ESW A; 3A54 A; 2KSV A; 2F4M A; 2ZK9 X; #chains in the Genus database with same CATH topology 3ISR A; 3C9Q A; 4W79 A; 3A55 A; 2F4O A; 3KD4 A; 3A56 A; 4FGP A; 4FGQ A; 4FGO A; 4U65 E; 3ESW A; 3A54 A; 2KSV A; 2F4M A; 2ZK9 X; #chains in the Genus database with same CATH homology 3ISR A; 3A55 A; 2F4O A; 3KD4 A; 3A56 A; 4FGP A; 4FGQ A; 4FGO A; 4U65 E; 3ESW A; 3A54 A; 2KSV A; 2F4M A; 2ZK9 X;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...