4U67J

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
136
structure length
136
Chain Sequence
b'KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 4u67J01
5DM7J 1VQKH 3CCJH 3CD6H 1JJ2H 1YJWH 3CCLH 1Y69K 4U67J 3CF5J 3G6EH 1Q86J 4WFBJ 1VQ4H 2QEXH 4IOCJ 1YJNH 1VQNH 1S72H 3CCQH 3CCRH 1N8RJ 5AN9F 1VQ7H 3J7ZM 5DM6J 1M90J 4WF9J 1W2BH 4IO9J 1KC8J 2OTLH 3CPWH 1VQ9H 1K8AJ 1YHQH 4WCEJ 5H1SO 1QVFH 5GADN 5MLCO 5GAHN 1VQPH 3I56H 1VQOH 1VQ5H 3DLLJ 3G71H 3CCEH 2PA2A 4IOAJ 3PIOJ 1Q82J 5JVGJ 1VQ6H 3CMAH 4UY8M 5GAGN 3OW2H 2QA4H 1K9MJ 1YI2H 2ZJRJ 1WKIA 5GAEN 2ZJPJ 4WFNJ 5HL7J 1YITH 1M1KJ 3CCVH 1Q81J 1QVGH 3CCUH 5JVHJ 1NJIJ 1KQSH 3CCSH 3G4SH 3CC2H 1YJ9H 1YIJH 2ZJQJ 3CCMH 1VQMH 3CXCH 3CC7H 3PIPJ 3CC4H 1Q7YJ 1KD1J 3I55H 1K73J 3CMEH 1VQ8H 4WFAJ 2OTJH 1VQLH
chains in the Genus database with same CATH superfamily
1SIJA 4EAFA 2OMDA 3C2EA 5DM7J 1N5WB 5AYYA 1N61B 4I9AA 4AP8A 1N60B 4US9A 1VQKH 3CCJH 3CD6H 3AM9A 2JBMA 2B7PA 3NVWC 3L4PA 4US8A 1JJ2H 1YJWH 3CCLH 1UOUA 1Y69K 3NVYC 3WO0A 3B9JC 1YTKA 4U67J 5EP8A 5EY3A 3G6EH 3ETRC 3CF5J 1V97A 1Q86J 4WFBJ 3VMMA 2E3TA 3C2OA 1VQ4H 2QEXH 2DSJA 4IOCJ 1YJNH 5HULA 1VQNH 2J0FA 3FAHA 1S72H 3CCQH 3CCRH 5AYXA 5MPOC 3FC4A 3NVZC 1N8RJ 5AN9F 3C2VA 1VDVA 5HUPA 3WNZA 1VQ7H 3J7ZM 5DM6J 3TQVA 5HUOA 1M90J 4WF9J 1W2BH 4IO9J 1KC8J 2OTLH 1FM0E 1RM6A 3CPWH 1VQ9H 1K8AJ 1YHQH 4YEKA 4WCEJ 5H1SO 1QVFH 5GADN 4USAA 5MLCO 2W55B 5GAHN 4C80A 1X1OA 3NVVC 3I56H 1VQPH 1VQOH 1VQ5H 3DLLJ 4ZOHA 5AYZA 1NVJA 2I14A 3G71H 4LHMA 3CCEH 2PA2A 4IOAJ 3PIOJ 1N63B 1Q82J 1OTPA 1QPOA 2QIEA 1JRPB 3PAJA 5JVGJ 1VQ6H 1AZYA 3CMAH 4UY8M 2W3SB 5GAGN 3OW2H 1DGJA 1FIQC 3C2FA 1YTDA 2QA4H 2I1OA 3SR6C 1FMAE 3AN1A 2TPTA 1NVIE 4GA5A 3C2RA 1FFVB 4KWWA 1K9MJ 1FFUB 2B7NA 1WKIA 1YI2H 2ZJRJ 4XR5A 3RPFA 4EADA 5GAEN 1O4UA 3NRZC 1QPQA 2W54B 2ZJPJ 4GA4A 5HL7J 4WFNJ 1YITH 1BRWA 4GA6A 2WK6A 1M1KJ 3CCVH 2WK5A 1Q81J 1N5XA 1QVGH 3EUB4 1QPRA 3BIIE 3CCUH 5JVHJ 2B7QA 2W3RB 1N62B 3AMZA 1ZXIB 1NJIJ 1KQSH 4KWVA 1QPNA 3CCSH 3G4SH 2WP4A 3GNNA 4C7YA 3CC2H 3H5QA 1WYGA 1SB3A 1YIJH 1YJ9H 2Q5WE 3NS1C 2ZJQJ 4YYYA 3CCMH 1VQMH 1YTEA 3CXCH 1QAPA 3CC7H 3L0GA 3WO1A 3PIPJ 1JROB 4C7ZA 3CC4H 1Q7YJ 1KD1J 3I55H 1K73J 3CMEH 1VQ8H 4WFAJ 1FO4A 1VLBA 4X46A 2OTJH 1VQLH
chains in the Genus database with same CATH topology
5DM7J 1VQKH 3CCJH 3CD6H 1JJ2H 1YJWH 3CCLH 1Y69K 4U67J 3CF5J 3G6EH 1Q86J 4WFBJ 1VQ4H 2QEXH 4IOCJ 1YJNH 1VQNH 1S72H 3CCQH 3CCRH 1N8RJ 5AN9F 1VQ7H 3J7ZM 5DM6J 1M90J 4WF9J 1W2BH 4IO9J 1KC8J 2OTLH 3CPWH 1VQ9H 1K8AJ 1YHQH 4WCEJ 5H1SO 1QVFH 5GADN 5MLCO 5GAHN 1VQPH 3I56H 1VQOH 1VQ5H 3DLLJ 3G71H 3CCEH 2PA2A 4IOAJ 3PIOJ 1Q82J 5JVGJ 1VQ6H 3CMAH 4UY8M 5GAGN 3OW2H 2QA4H 1K9MJ 1YI2H 2ZJRJ 1WKIA 5GAEN 2ZJPJ 4WFNJ 5HL7J 1YITH 1M1KJ 3CCVH 1Q81J 1QVGH 3CCUH 5JVHJ 1NJIJ 1KQSH 3CCSH 3G4SH 3CC2H 1YJ9H 1YIJH 2ZJQJ 3CCMH 1VQMH 3CXCH 3CC7H 3PIPJ 3CC4H 1Q7YJ 1KD1J 3I55H 1K73J 3CMEH 1VQ8H 4WFAJ 2OTJH 1VQLH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 J;  1VQK H;  3CCJ H;  3CD6 H;  1JJ2 H;  1YJW H;  3CCL H;  1Y69 K;  4U67 J;  3CF5 J;  3G6E H;  1Q86 J;  4WFB J;  1VQ4 H;  2QEX H;  4IOC J;  1YJN H;  1VQN H;  1S72 H;  3CCQ H;  3CCR H;  1N8R J;  5AN9 F;  1VQ7 H;  3J7Z M;  5DM6 J;  1M90 J;  4WF9 J;  1W2B H;  4IO9 J;  1KC8 J;  2OTL H;  3CPW H;  1VQ9 H;  1K8A J;  1YHQ H;  4WCE J;  5H1S O;  1QVF H;  5GAD N;  5MLC O;  5GAH N;  1VQP H;  3I56 H;  1VQO H;  1VQ5 H;  3DLL J;  3G71 H;  3CCE H;  2PA2 A;  4IOA J;  3PIO J;  1Q82 J;  5JVG J;  1VQ6 H;  3CMA H;  4UY8 M;  5GAG N;  3OW2 H;  2QA4 H;  1K9M J;  1YI2 H;  2ZJR J;  1WKI A;  5GAE N;  2ZJP J;  4WFN J;  5HL7 J;  1YIT H;  1M1K J;  3CCV H;  1Q81 J;  1QVG H;  3CCU H;  5JVH J;  1NJI J;  1KQS H;  3CCS H;  3G4S H;  3CC2 H;  1YJ9 H;  1YIJ H;  2ZJQ J;  3CCM H;  1VQM H;  3CXC H;  3CC7 H;  3PIP J;  3CC4 H;  1Q7Y J;  1KD1 J;  3I55 H;  1K73 J;  3CME H;  1VQ8 H;  4WFA J;  2OTJ H;  1VQL H; 
#chains in the Genus database with same CATH topology
 1SIJ A;  4EAF A;  2OMD A;  3C2E A;  5DM7 J;  1N5W B;  5AYY A;  1N61 B;  4I9A A;  4AP8 A;  1N60 B;  4US9 A;  1VQK H;  3CCJ H;  3CD6 H;  3AM9 A;  2JBM A;  2B7P A;  3NVW C;  3L4P A;  4US8 A;  1JJ2 H;  1YJW H;  3CCL H;  1UOU A;  1Y69 K;  3NVY C;  3WO0 A;  3B9J C;  1YTK A;  4U67 J;  5EP8 A;  5EY3 A;  3G6E H;  3ETR C;  3CF5 J;  1V97 A;  1Q86 J;  4WFB J;  3VMM A;  2E3T A;  3C2O A;  1VQ4 H;  2QEX H;  2DSJ A;  4IOC J;  1YJN H;  5HUL A;  1VQN H;  2J0F A;  3FAH A;  1S72 H;  3CCQ H;  3CCR H;  5AYX A;  5MPO C;  3FC4 A;  3NVZ C;  1N8R J;  5AN9 F;  3C2V A;  1VDV A;  5HUP A;  3WNZ A;  1VQ7 H;  3J7Z M;  5DM6 J;  3TQV A;  5HUO A;  1M90 J;  4WF9 J;  1W2B H;  4IO9 J;  1KC8 J;  2OTL H;  1FM0 E;  1RM6 A;  3CPW H;  1VQ9 H;  1K8A J;  1YHQ H;  4YEK A;  4WCE J;  5H1S O;  1QVF H;  5GAD N;  4USA A;  5MLC O;  2W55 B;  5GAH N;  4C80 A;  1X1O A;  3NVV C;  3I56 H;  1VQP H;  1VQO H;  1VQ5 H;  3DLL J;  4ZOH A;  5AYZ A;  1NVJ A;  2I14 A;  3G71 H;  4LHM A;  3CCE H;  2PA2 A;  4IOA J;  3PIO J;  1N63 B;  1Q82 J;  1OTP A;  1QPO A;  2QIE A;  1JRP B;  3PAJ A;  5JVG J;  1VQ6 H;  1AZY A;  3CMA H;  4UY8 M;  2W3S B;  5GAG N;  3OW2 H;  1DGJ A;  1FIQ C;  3C2F A;  1YTD A;  2QA4 H;  2I1O A;  3SR6 C;  1FMA E;  3AN1 A;  2TPT A;  1NVI E;  4GA5 A;  3C2R A;  1FFV B;  4KWW A;  1K9M J;  1FFU B;  2B7N A;  1WKI A;  1YI2 H;  2ZJR J;  4XR5 A;  3RPF A;  4EAD A;  5GAE N;  1O4U A;  3NRZ C;  1QPQ A;  2W54 B;  2ZJP J;  4GA4 A;  5HL7 J;  4WFN J;  1YIT H;  1BRW A;  4GA6 A;  2WK6 A;  1M1K J;  3CCV H;  2WK5 A;  1Q81 J;  1N5X A;  1QVG H;  3EUB 4;  1QPR A;  3BII E;  3CCU H;  5JVH J;  2B7Q A;  2W3R B;  1N62 B;  3AMZ A;  1ZXI B;  1NJI J;  1KQS H;  4KWV A;  1QPN A;  3CCS H;  3G4S H;  2WP4 A;  3GNN A;  4C7Y A;  3CC2 H;  3H5Q A;  1WYG A;  1SB3 A;  1YIJ H;  1YJ9 H;  2Q5W E;  3NS1 C;  2ZJQ J;  4YYY A;  3CCM H;  1VQM H;  1YTE A;  3CXC H;  1QAP A;  3CC7 H;  3L0G A;  3WO1 A;  3PIP J;  1JRO B;  4C7Z A;  3CC4 H;  1Q7Y J;  1KD1 J;  3I55 H;  1K73 J;  3CME H;  1VQ8 H;  4WFA J;  1FO4 A;  1VLB A;  4X46 A;  2OTJ H;  1VQL H; 
#chains in the Genus database with same CATH homology
 5DM7 J;  1VQK H;  3CCJ H;  3CD6 H;  1JJ2 H;  1YJW H;  3CCL H;  1Y69 K;  4U67 J;  3CF5 J;  3G6E H;  1Q86 J;  4WFB J;  1VQ4 H;  2QEX H;  4IOC J;  1YJN H;  1VQN H;  1S72 H;  3CCQ H;  3CCR H;  1N8R J;  5AN9 F;  1VQ7 H;  3J7Z M;  5DM6 J;  1M90 J;  4WF9 J;  1W2B H;  4IO9 J;  1KC8 J;  2OTL H;  3CPW H;  1VQ9 H;  1K8A J;  1YHQ H;  4WCE J;  5H1S O;  1QVF H;  5GAD N;  5MLC O;  5GAH N;  1VQP H;  3I56 H;  1VQO H;  1VQ5 H;  3DLL J;  3G71 H;  3CCE H;  2PA2 A;  4IOA J;  3PIO J;  1Q82 J;  5JVG J;  1VQ6 H;  3CMA H;  4UY8 M;  5GAG N;  3OW2 H;  2QA4 H;  1K9M J;  1YI2 H;  2ZJR J;  1WKI A;  5GAE N;  2ZJP J;  4WFN J;  5HL7 J;  1YIT H;  1M1K J;  3CCV H;  1Q81 J;  1QVG H;  3CCU H;  5JVH J;  1NJI J;  1KQS H;  3CCS H;  3G4S H;  3CC2 H;  1YJ9 H;  1YIJ H;  2ZJQ J;  3CCM H;  1VQM H;  3CXC H;  3CC7 H;  3PIP J;  3CC4 H;  1Q7Y J;  1KD1 J;  3I55 H;  1K73 J;  3CME H;  1VQ8 H;  4WFA J;  2OTJ H;  1VQL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...