4U6CA

Hsmetap in complex with [(1r)-1-amino-3-cyclopentylpropyl]phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6cA00
2BWVA 2GGBA 3BIPA 2V3ZA 1N51A 3MX6A 2Q96A 2OKNA 2GTXA 4IU6A 1JAWA 4FLJA 4ZWUA 2B3KA 1YW9A 4IKSA 2OAZA 2EA4A 4U1BA 2GU7A 3L7GA 1WY2A 2P98A 4A6VA 3FMRA 2BWUA 3MR1A 1R5GA 4FLLA 4IPAA 1WLRA 4U70A 4FUKA 1XGNA 4KM3A 2ADUA 4IDYA 4IECA 4ZWPA 4S2TP 3CB5A 1QXWA 2GG8A 1C23A 1WL6A 3IG4A 3PKEA 2BHCA 4RGZ1 2DFIA 3L24A 1YJ3A 5FCFA 5D6FA 3PKCA 4Z7MA 1PV9A 5CDEA 4U6JA 2EA2A 4IKTA 1C21A 1QXZA 2GGCA 2GG0A 3MATA 1CHMA 2BN7A 5E5BA 3TB5A 1WKMA 2GG9A 1R5HA 5JFRA 4U6ZA 2EVMA 4PNCA 4EGEA 1BOAA 1WN1A 1R58A 2EVOA 2Q95A 3CB6A 2EVCA 5FCHA 5JHUA 5CE6A 2BWSA 3D27A 4U6WA 4FLIA 3PKBA 1C27A 2GU6A 4A6WA 2BHDA 4U69A 1B6AA 3BITA 4ZNGA 3BIQA 4HXXA 4RZYA 4S01A 1MATA 3IU7A 2BH3A 2BWYA 2ZSGA 4S2RP 4QR8A 3TAVA 4U75A 1KQ0A 2Q93A 5CLSA 1QXYA 2Q94A 2GG5A 1O0XA 4S00A 2V3YA 1KQ9A 1B59A 3PKDA 4FO7A 1YW8A 1WBQA 1W7VA 2MATA 1A16A 2G6PA 2BB7A 2GA2A 2P99A 3IU9A 1YW7A 1Y1NA 5CNXA 4IKRA 5CDVA 1M35A 4JUQA 5JI6A 2B3LA 4U73A 3RVAA 1W2MA 4U71A 2BHBA 1XGMA 3FM3A 1XGSA 2BWXA 3IU8A 3CTZA 2GG3A 2P9AA 3PKAA 2B3HA 4FO8A 2BHAA 2Q92A 4FKCA 4B28A 4U76A 4ZWOA 4U6EA 1XGOA 2GG2A 1KP0A 2NQ6A 4IKUA 1XNZA 2IW2A 4OOKA 2V3XA 4R60A 2V6CA 4IF7A 2BWTA 2Q8KA 5D6EA 3RORA 3S6BA 3FMQA 2GZ5A 1QZYA 1YVMA 2HOWA 4U6CA 1WL9A 5CIKA 2BWWA 4PV4A 2GG7A 4MATA 2GU4A 4RZZA 1BN5A 2NQ7A 3Q6DA 5CDLA 1C24A 4FLKA 2GU5A 1C22A
chains in the Genus database with same CATH superfamily
2BWVA 2GGBA 3BIPA 2V3ZA 1N51A 3MX6A 2Q96A 2OKNA 2GTXA 4IU6A 1JAWA 4FLJA 4ZWUA 2B3KA 1YW9A 4IKSA 2OAZA 2EA4A 4U1BA 2GU7A 3L7GA 1WY2A 2P98A 4A6VA 3FMRA 2BWUA 3MR1A 1R5GA 4FLLA 4IPAA 1WLRA 4U70A 4FUKA 1XGNA 4KM3A 2ADUA 4IDYA 4IECA 4ZWPA 4S2TP 3CB5A 1QXWA 2GG8A 1C23A 1WL6A 3IG4A 3PKEA 2BHCA 4RGZ1 2DFIA 3L24A 1YJ3A 5FCFA 5D6FA 3PKCA 4Z7MA 1PV9A 5CDEA 4U6JA 2EA2A 4IKTA 1C21A 1QXZA 2GGCA 2GG0A 3MATA 1CHMA 2BN7A 5E5BA 3TB5A 1WKMA 2GG9A 1R5HA 5JFRA 4U6ZA 2EVMA 4PNCA 4EGEA 1BOAA 1WN1A 1R58A 2EVOA 2Q95A 3CB6A 2EVCA 5FCHA 5JHUA 5CE6A 2BWSA 3D27A 4U6WA 4FLIA 3PKBA 1C27A 2GU6A 4A6WA 2BHDA 4U69A 1B6AA 3BITA 4ZNGA 3BIQA 4HXXA 4RZYA 4S01A 1MATA 3IU7A 2BH3A 2BWYA 2ZSGA 4S2RP 4QR8A 3TAVA 4U75A 1KQ0A 2Q93A 5CLSA 1QXYA 2Q94A 2GG5A 1O0XA 4S00A 2V3YA 1KQ9A 1B59A 3PKDA 4FO7A 1YW8A 1WBQA 1W7VA 2MATA 1A16A 2G6PA 2BB7A 2GA2A 2P99A 3IU9A 1YW7A 1Y1NA 5CNXA 4IKRA 5CDVA 1M35A 4JUQA 5JI6A 2B3LA 4U73A 3RVAA 1W2MA 4U71A 2BHBA 1XGMA 3FM3A 1XGSA 2BWXA 3IU8A 3CTZA 2GG3A 2P9AA 3PKAA 2B3HA 4FO8A 2BHAA 2Q92A 4FKCA 4B28A 4U76A 4ZWOA 4U6EA 1XGOA 2GG2A 1KP0A 2NQ6A 4IKUA 1XNZA 2IW2A 4OOKA 2V3XA 4R60A 2V6CA 4IF7A 2BWTA 2Q8KA 5D6EA 3RORA 3S6BA 3FMQA 2GZ5A 1QZYA 1YVMA 2HOWA 4U6CA 1WL9A 5CIKA 2BWWA 4PV4A 2GG7A 4MATA 2GU4A 4RZZA 1BN5A 2NQ7A 3Q6DA 5CDLA 1C24A 4FLKA 2GU5A 1C22A
chains in the Genus database with same CATH topology
2BWVA 2GGBA 3BIPA 2V3ZA 1N51A 3MX6A 2Q96A 2OKNA 2GTXA 4IU6A 1JAWA 4FLJA 4ZWUA 2B3KA 1YW9A 4IKSA 2OAZA 2EA4A 4U1BA 2GU7A 3L7GA 1WY2A 2P98A 4A6VA 3FMRA 2BWUA 3MR1A 1R5GA 4FLLA 4IPAA 1WLRA 4U70A 4FUKA 1XGNA 4KM3A 2ADUA 4IDYA 4IECA 4ZWPA 4S2TP 3CB5A 1QXWA 2GG8A 1C23A 1WL6A 3IG4A 3PKEA 2BHCA 4RGZ1 2DFIA 3L24A 1YJ3A 5FCFA 5D6FA 3PKCA 4Z7MA 1PV9A 5CDEA 4U6JA 2EA2A 4IKTA 1C21A 1QXZA 2GGCA 2GG0A 3MATA 1CHMA 2BN7A 5E5BA 3TB5A 1WKMA 2GG9A 1R5HA 5JFRA 4U6ZA 2EVMA 4PNCA 4EGEA 1BOAA 1WN1A 1R58A 2EVOA 2Q95A 3CB6A 2EVCA 5FCHA 5JHUA 5CE6A 2BWSA 3D27A 4U6WA 4FLIA 3PKBA 1C27A 2GU6A 4A6WA 2BHDA 4U69A 1B6AA 3BITA 4ZNGA 3BIQA 4HXXA 4RZYA 4S01A 1MATA 3IU7A 2BH3A 2BWYA 2ZSGA 4S2RP 4QR8A 3TAVA 4U75A 1KQ0A 2Q93A 5CLSA 1QXYA 2Q94A 2GG5A 1O0XA 4S00A 2V3YA 1KQ9A 1B59A 3PKDA 4FO7A 1YW8A 1WBQA 1W7VA 2MATA 1A16A 2G6PA 2BB7A 2GA2A 2P99A 3IU9A 1YW7A 1Y1NA 5CNXA 4IKRA 5CDVA 1M35A 4JUQA 5JI6A 2B3LA 4U73A 3RVAA 1W2MA 4U71A 2BHBA 1XGMA 3FM3A 1XGSA 2BWXA 3IU8A 3CTZA 2GG3A 2P9AA 3PKAA 2B3HA 4FO8A 2BHAA 2Q92A 4FKCA 4B28A 4U76A 4ZWOA 4U6EA 1XGOA 2GG2A 1KP0A 2NQ6A 4IKUA 1XNZA 2IW2A 4OOKA 2V3XA 4R60A 2V6CA 4IF7A 2BWTA 2Q8KA 5D6EA 3RORA 3S6BA 3FMQA 2GZ5A 1QZYA 1YVMA 2HOWA 4U6CA 1WL9A 5CIKA 2BWWA 4PV4A 2GG7A 4MATA 2GU4A 4RZZA 1BN5A 2NQ7A 3Q6DA 5CDLA 1C24A 4FLKA 2GU5A 1C22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWV A;  2GGB A;  3BIP A;  2V3Z A;  1N51 A;  3MX6 A;  2Q96 A;  2OKN A;  2GTX A;  4IU6 A;  1JAW A;  4FLJ A;  4ZWU A;  2B3K A;  1YW9 A;  4IKS A;  2OAZ A;  2EA4 A;  4U1B A;  2GU7 A;  3L7G A;  1WY2 A;  2P98 A;  4A6V A;  3FMR A;  2BWU A;  3MR1 A;  1R5G A;  4FLL A;  4IPA A;  1WLR A;  4U70 A;  4FUK A;  1XGN A;  4KM3 A;  2ADU A;  4IDY A;  4IEC A;  4ZWP A;  4S2T P;  3CB5 A;  1QXW A;  2GG8 A;  1C23 A;  1WL6 A;  3IG4 A;  3PKE A;  2BHC A;  4RGZ 1;  2DFI A;  3L24 A;  1YJ3 A;  5FCF A;  5D6F A;  3PKC A;  4Z7M A;  1PV9 A;  5CDE A;  4U6J A;  2EA2 A;  4IKT A;  1C21 A;  1QXZ A;  2GGC A;  2GG0 A;  3MAT A;  1CHM A;  2BN7 A;  5E5B A;  3TB5 A;  1WKM A;  2GG9 A;  1R5H A;  5JFR A;  4U6Z A;  2EVM A;  4PNC A;  4EGE A;  1BOA A;  1WN1 A;  1R58 A;  2EVO A;  2Q95 A;  3CB6 A;  2EVC A;  5FCH A;  5JHU A;  5CE6 A;  2BWS A;  3D27 A;  4U6W A;  4FLI A;  3PKB A;  1C27 A;  2GU6 A;  4A6W A;  2BHD A;  4U69 A;  1B6A A;  3BIT A;  4ZNG A;  3BIQ A;  4HXX A;  4RZY A;  4S01 A;  1MAT A;  3IU7 A;  2BH3 A;  2BWY A;  2ZSG A;  4S2R P;  4QR8 A;  3TAV A;  4U75 A;  1KQ0 A;  2Q93 A;  5CLS A;  1QXY A;  2Q94 A;  2GG5 A;  1O0X A;  4S00 A;  2V3Y A;  1KQ9 A;  1B59 A;  3PKD A;  4FO7 A;  1YW8 A;  1WBQ A;  1W7V A;  2MAT A;  1A16 A;  2G6P A;  2BB7 A;  2GA2 A;  2P99 A;  3IU9 A;  1YW7 A;  1Y1N A;  5CNX A;  4IKR A;  5CDV A;  1M35 A;  4JUQ A;  5JI6 A;  2B3L A;  4U73 A;  3RVA A;  1W2M A;  4U71 A;  2BHB A;  1XGM A;  3FM3 A;  1XGS A;  2BWX A;  3IU8 A;  3CTZ A;  2GG3 A;  2P9A A;  3PKA A;  2B3H A;  4FO8 A;  2BHA A;  2Q92 A;  4FKC A;  4B28 A;  4U76 A;  4ZWO A;  4U6E A;  1XGO A;  2GG2 A;  1KP0 A;  2NQ6 A;  4IKU A;  1XNZ A;  2IW2 A;  4OOK A;  2V3X A;  4R60 A;  2V6C A;  4IF7 A;  2BWT A;  2Q8K A;  5D6E A;  3ROR A;  3S6B A;  3FMQ A;  2GZ5 A;  1QZY A;  1YVM A;  2HOW A;  4U6C A;  1WL9 A;  5CIK A;  2BWW A;  4PV4 A;  2GG7 A;  4MAT A;  2GU4 A;  4RZZ A;  1BN5 A;  2NQ7 A;  3Q6D A;  5CDL A;  1C24 A;  4FLK A;  2GU5 A;  1C22 A; 
#chains in the Genus database with same CATH topology
 2BWV A;  2GGB A;  3BIP A;  2V3Z A;  1N51 A;  3MX6 A;  2Q96 A;  2OKN A;  2GTX A;  4IU6 A;  1JAW A;  4FLJ A;  4ZWU A;  2B3K A;  1YW9 A;  4IKS A;  2OAZ A;  2EA4 A;  4U1B A;  2GU7 A;  3L7G A;  1WY2 A;  2P98 A;  4A6V A;  3FMR A;  2BWU A;  3MR1 A;  1R5G A;  4FLL A;  4IPA A;  1WLR A;  4U70 A;  4FUK A;  1XGN A;  4KM3 A;  2ADU A;  4IDY A;  4IEC A;  4ZWP A;  4S2T P;  3CB5 A;  1QXW A;  2GG8 A;  1C23 A;  1WL6 A;  3IG4 A;  3PKE A;  2BHC A;  4RGZ 1;  2DFI A;  3L24 A;  1YJ3 A;  5FCF A;  5D6F A;  3PKC A;  4Z7M A;  1PV9 A;  5CDE A;  4U6J A;  2EA2 A;  4IKT A;  1C21 A;  1QXZ A;  2GGC A;  2GG0 A;  3MAT A;  1CHM A;  2BN7 A;  5E5B A;  3TB5 A;  1WKM A;  2GG9 A;  1R5H A;  5JFR A;  4U6Z A;  2EVM A;  4PNC A;  4EGE A;  1BOA A;  1WN1 A;  1R58 A;  2EVO A;  2Q95 A;  3CB6 A;  2EVC A;  5FCH A;  5JHU A;  5CE6 A;  2BWS A;  3D27 A;  4U6W A;  4FLI A;  3PKB A;  1C27 A;  2GU6 A;  4A6W A;  2BHD A;  4U69 A;  1B6A A;  3BIT A;  4ZNG A;  3BIQ A;  4HXX A;  4RZY A;  4S01 A;  1MAT A;  3IU7 A;  2BH3 A;  2BWY A;  2ZSG A;  4S2R P;  4QR8 A;  3TAV A;  4U75 A;  1KQ0 A;  2Q93 A;  5CLS A;  1QXY A;  2Q94 A;  2GG5 A;  1O0X A;  4S00 A;  2V3Y A;  1KQ9 A;  1B59 A;  3PKD A;  4FO7 A;  1YW8 A;  1WBQ A;  1W7V A;  2MAT A;  1A16 A;  2G6P A;  2BB7 A;  2GA2 A;  2P99 A;  3IU9 A;  1YW7 A;  1Y1N A;  5CNX A;  4IKR A;  5CDV A;  1M35 A;  4JUQ A;  5JI6 A;  2B3L A;  4U73 A;  3RVA A;  1W2M A;  4U71 A;  2BHB A;  1XGM A;  3FM3 A;  1XGS A;  2BWX A;  3IU8 A;  3CTZ A;  2GG3 A;  2P9A A;  3PKA A;  2B3H A;  4FO8 A;  2BHA A;  2Q92 A;  4FKC A;  4B28 A;  4U76 A;  4ZWO A;  4U6E A;  1XGO A;  2GG2 A;  1KP0 A;  2NQ6 A;  4IKU A;  1XNZ A;  2IW2 A;  4OOK A;  2V3X A;  4R60 A;  2V6C A;  4IF7 A;  2BWT A;  2Q8K A;  5D6E A;  3ROR A;  3S6B A;  3FMQ A;  2GZ5 A;  1QZY A;  1YVM A;  2HOW A;  4U6C A;  1WL9 A;  5CIK A;  2BWW A;  4PV4 A;  2GG7 A;  4MAT A;  2GU4 A;  4RZZ A;  1BN5 A;  2NQ7 A;  3Q6D A;  5CDL A;  1C24 A;  4FLK A;  2GU5 A;  1C22 A; 
#chains in the Genus database with same CATH homology
 2BWV A;  2GGB A;  3BIP A;  2V3Z A;  1N51 A;  3MX6 A;  2Q96 A;  2OKN A;  2GTX A;  4IU6 A;  1JAW A;  4FLJ A;  4ZWU A;  2B3K A;  1YW9 A;  4IKS A;  2OAZ A;  2EA4 A;  4U1B A;  2GU7 A;  3L7G A;  1WY2 A;  2P98 A;  4A6V A;  3FMR A;  2BWU A;  3MR1 A;  1R5G A;  4FLL A;  4IPA A;  1WLR A;  4U70 A;  4FUK A;  1XGN A;  4KM3 A;  2ADU A;  4IDY A;  4IEC A;  4ZWP A;  4S2T P;  3CB5 A;  1QXW A;  2GG8 A;  1C23 A;  1WL6 A;  3IG4 A;  3PKE A;  2BHC A;  4RGZ 1;  2DFI A;  3L24 A;  1YJ3 A;  5FCF A;  5D6F A;  3PKC A;  4Z7M A;  1PV9 A;  5CDE A;  4U6J A;  2EA2 A;  4IKT A;  1C21 A;  1QXZ A;  2GGC A;  2GG0 A;  3MAT A;  1CHM A;  2BN7 A;  5E5B A;  3TB5 A;  1WKM A;  2GG9 A;  1R5H A;  5JFR A;  4U6Z A;  2EVM A;  4PNC A;  4EGE A;  1BOA A;  1WN1 A;  1R58 A;  2EVO A;  2Q95 A;  3CB6 A;  2EVC A;  5FCH A;  5JHU A;  5CE6 A;  2BWS A;  3D27 A;  4U6W A;  4FLI A;  3PKB A;  1C27 A;  2GU6 A;  4A6W A;  2BHD A;  4U69 A;  1B6A A;  3BIT A;  4ZNG A;  3BIQ A;  4HXX A;  4RZY A;  4S01 A;  1MAT A;  3IU7 A;  2BH3 A;  2BWY A;  2ZSG A;  4S2R P;  4QR8 A;  3TAV A;  4U75 A;  1KQ0 A;  2Q93 A;  5CLS A;  1QXY A;  2Q94 A;  2GG5 A;  1O0X A;  4S00 A;  2V3Y A;  1KQ9 A;  1B59 A;  3PKD A;  4FO7 A;  1YW8 A;  1WBQ A;  1W7V A;  2MAT A;  1A16 A;  2G6P A;  2BB7 A;  2GA2 A;  2P99 A;  3IU9 A;  1YW7 A;  1Y1N A;  5CNX A;  4IKR A;  5CDV A;  1M35 A;  4JUQ A;  5JI6 A;  2B3L A;  4U73 A;  3RVA A;  1W2M A;  4U71 A;  2BHB A;  1XGM A;  3FM3 A;  1XGS A;  2BWX A;  3IU8 A;  3CTZ A;  2GG3 A;  2P9A A;  3PKA A;  2B3H A;  4FO8 A;  2BHA A;  2Q92 A;  4FKC A;  4B28 A;  4U76 A;  4ZWO A;  4U6E A;  1XGO A;  2GG2 A;  1KP0 A;  2NQ6 A;  4IKU A;  1XNZ A;  2IW2 A;  4OOK A;  2V3X A;  4R60 A;  2V6C A;  4IF7 A;  2BWT A;  2Q8K A;  5D6E A;  3ROR A;  3S6B A;  3FMQ A;  2GZ5 A;  1QZY A;  1YVM A;  2HOW A;  4U6C A;  1WL9 A;  5CIK A;  2BWW A;  4PV4 A;  2GG7 A;  4MAT A;  2GU4 A;  4RZZ A;  1BN5 A;  2NQ7 A;  3Q6D A;  5CDL A;  1C24 A;  4FLK A;  2GU5 A;  1C22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...