4U6CA

Hsmetap in complex with [(1r)-1-amino-3-cyclopentylpropyl]phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6cA00
4RZZA 2BHAA 4ZNGA 4U76A 3RVAA 1KQ0A 1XNZA 2G6PA 4RGZ1 4U6CA 4A6WA 3D27A 2B3KA 3IU8A 4IDYA 4U6WA 3FM3A 4FLLA 3L24A 4IPAA 2Q95A 2BHCA 4IKTA 4B28A 1QXZA 3FMRA 1N51A 4U6ZA 4U73A 1A16A 3IU9A 2BWWA 3TAVA 2V3ZA 2GZ5A 1XGOA 4ZWPA 2GG5A 4IKUA 5JHUA 4PNCA 4FLIA 1WL6A 5CNXA 2HOWA 5FCFA 2Q93A 4U6JA 2P98A 2EVOA 4FKCA 2GGCA 1QXYA 2Q96A 4S2RP 3S6BA 2Q92A 4S00A 4U75A 1C21A 3CB6A 4QR8A 1XGMA 4IU6A 1W2MA 4S01A 2GGBA 1WY2A 1MATA 1M35A 5CDVA 2OAZA 3PKEA 4U1BA 2GU6A 3MATA 2BHBA 4IECA 5CE6A 3BITA 2BWYA 4JUQA 4S2TP 1BOAA 2GTXA 4FLJA 1B6AA 3FMQA 3PKDA 5CLSA 2ADUA 5CDEA 2IW2A 1WKMA 2GG2A 2GU4A 3PKCA 5CIKA 2GG0A 4FUKA 3CTZA 5JFRA 2EVCA 4IKSA 2EVMA 1O0XA 4ZWOA 1YW7A 5FCHA 3IU7A 3MR1A 2BWUA 4U71A 1WL9A 1YW8A 2DFIA 2GG7A 3L7GA 4U70A 2B3LA 2GA2A 2NQ7A 4FO8A 1YVMA 4ZWUA 2V6CA 3Q6DA 2BWXA 2V3XA 4Z7MA 3CB5A 2P99A 2BWSA 4HXXA 4FO7A 4RZYA 4R60A 3MX6A 2BB7A 1KQ9A 2EA4A 1YJ3A 1R5GA 4FLKA 5CDLA 4IF7A 2BWVA 4PV4A 4A6VA 2GU5A 2BN7A 4MATA 5D6EA 2Q8KA 2BH3A 1C22A 3IG4A 1C24A 5D6FA 4EGEA 1BN5A 3BIPA 4OOKA 2MATA 3BIQA 1YW9A 1QXWA 2EA2A 4KM3A 2GG3A 1QZYA 1W7VA 1KP0A 1Y1NA 2P9AA 2BWTA 5E5BA 1C23A 2GU7A 2BHDA 2GG9A 4IKRA 3PKAA 1C27A 1WBQA 2Q94A 1JAWA 3TB5A 1R5HA 1R58A 1XGNA 2V3YA 3PKBA 1XGSA 2GG8A 4U6EA 1WLRA 1B59A 1WN1A 3RORA 1PV9A 2OKNA 4U69A 5JI6A 2ZSGA 2B3HA 1CHMA 2NQ6A
chains in the Genus database with same CATH superfamily
4RZZA 2BHAA 4ZNGA 4U76A 3RVAA 1KQ0A 1XNZA 2G6PA 4RGZ1 4U6CA 4A6WA 3D27A 2B3KA 3IU8A 4IDYA 4U6WA 3FM3A 4FLLA 3L24A 4IPAA 2Q95A 2BHCA 4IKTA 4B28A 1QXZA 3FMRA 1N51A 4U6ZA 4U73A 1A16A 3IU9A 2BWWA 3TAVA 2V3ZA 2GZ5A 1XGOA 4ZWPA 2GG5A 4IKUA 5JHUA 4PNCA 4FLIA 1WL6A 5CNXA 2HOWA 5FCFA 2Q93A 4U6JA 2P98A 2EVOA 4FKCA 2GGCA 1QXYA 2Q96A 4S2RP 3S6BA 2Q92A 4S00A 4U75A 1C21A 3CB6A 4QR8A 1XGMA 4IU6A 1W2MA 4S01A 2GGBA 1WY2A 1MATA 1M35A 5CDVA 2OAZA 3PKEA 4U1BA 2GU6A 3MATA 2BHBA 4IECA 5CE6A 3BITA 2BWYA 4JUQA 4S2TP 1BOAA 2GTXA 4FLJA 1B6AA 3FMQA 3PKDA 5CLSA 2ADUA 5CDEA 2IW2A 1WKMA 2GG2A 2GU4A 3PKCA 5CIKA 2GG0A 4FUKA 3CTZA 5JFRA 2EVCA 4IKSA 2EVMA 1O0XA 4ZWOA 1YW7A 5FCHA 3IU7A 3MR1A 2BWUA 4U71A 1WL9A 1YW8A 2DFIA 2GG7A 3L7GA 4U70A 2B3LA 2GA2A 2NQ7A 4FO8A 1YVMA 4ZWUA 2V6CA 3Q6DA 2BWXA 2V3XA 4Z7MA 3CB5A 2P99A 2BWSA 4HXXA 4FO7A 4RZYA 4R60A 3MX6A 2BB7A 1KQ9A 2EA4A 1YJ3A 1R5GA 4FLKA 5CDLA 4IF7A 2BWVA 4PV4A 4A6VA 2GU5A 2BN7A 4MATA 5D6EA 2Q8KA 2BH3A 1C22A 3IG4A 1C24A 5D6FA 4EGEA 1BN5A 3BIPA 4OOKA 2MATA 3BIQA 1YW9A 1QXWA 2EA2A 4KM3A 2GG3A 1QZYA 1W7VA 1KP0A 1Y1NA 2P9AA 2BWTA 5E5BA 1C23A 2GU7A 2BHDA 2GG9A 4IKRA 3PKAA 1C27A 1WBQA 2Q94A 1JAWA 3TB5A 1R5HA 1R58A 1XGNA 2V3YA 3PKBA 1XGSA 2GG8A 4U6EA 1WLRA 1B59A 1WN1A 3RORA 1PV9A 2OKNA 4U69A 5JI6A 2ZSGA 2B3HA 1CHMA 2NQ6A
chains in the Genus database with same CATH topology
4RZZA 2BHAA 4ZNGA 4U76A 3RVAA 1KQ0A 1XNZA 2G6PA 4RGZ1 4U6CA 4A6WA 3D27A 2B3KA 3IU8A 4IDYA 4U6WA 3FM3A 4FLLA 3L24A 4IPAA 2Q95A 2BHCA 4IKTA 4B28A 1QXZA 3FMRA 1N51A 4U6ZA 4U73A 1A16A 3IU9A 2BWWA 3TAVA 2V3ZA 2GZ5A 1XGOA 4ZWPA 2GG5A 4IKUA 5JHUA 4PNCA 4FLIA 1WL6A 5CNXA 2HOWA 5FCFA 2Q93A 4U6JA 2P98A 2EVOA 4FKCA 2GGCA 1QXYA 2Q96A 4S2RP 3S6BA 2Q92A 4S00A 4U75A 1C21A 3CB6A 4QR8A 1XGMA 4IU6A 1W2MA 4S01A 2GGBA 1WY2A 1MATA 1M35A 5CDVA 2OAZA 3PKEA 4U1BA 2GU6A 3MATA 2BHBA 4IECA 5CE6A 3BITA 2BWYA 4JUQA 4S2TP 1BOAA 2GTXA 4FLJA 1B6AA 3FMQA 3PKDA 5CLSA 2ADUA 5CDEA 2IW2A 1WKMA 2GG2A 2GU4A 3PKCA 5CIKA 2GG0A 4FUKA 3CTZA 5JFRA 2EVCA 4IKSA 2EVMA 1O0XA 4ZWOA 1YW7A 5FCHA 3IU7A 3MR1A 2BWUA 4U71A 1WL9A 1YW8A 2DFIA 2GG7A 3L7GA 4U70A 2B3LA 2GA2A 2NQ7A 4FO8A 1YVMA 4ZWUA 2V6CA 3Q6DA 2BWXA 2V3XA 4Z7MA 3CB5A 2P99A 2BWSA 4HXXA 4FO7A 4RZYA 4R60A 3MX6A 2BB7A 1KQ9A 2EA4A 1YJ3A 1R5GA 4FLKA 5CDLA 4IF7A 2BWVA 4PV4A 4A6VA 2GU5A 2BN7A 4MATA 5D6EA 2Q8KA 2BH3A 1C22A 3IG4A 1C24A 5D6FA 4EGEA 1BN5A 3BIPA 4OOKA 2MATA 3BIQA 1YW9A 1QXWA 2EA2A 4KM3A 2GG3A 1QZYA 1W7VA 1KP0A 1Y1NA 2P9AA 2BWTA 5E5BA 1C23A 2GU7A 2BHDA 2GG9A 4IKRA 3PKAA 1C27A 1WBQA 2Q94A 1JAWA 3TB5A 1R5HA 1R58A 1XGNA 2V3YA 3PKBA 1XGSA 2GG8A 4U6EA 1WLRA 1B59A 1WN1A 3RORA 1PV9A 2OKNA 4U69A 5JI6A 2ZSGA 2B3HA 1CHMA 2NQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZZ A;  2BHA A;  4ZNG A;  4U76 A;  3RVA A;  1KQ0 A;  1XNZ A;  2G6P A;  4RGZ 1;  4U6C A;  4A6W A;  3D27 A;  2B3K A;  3IU8 A;  4IDY A;  4U6W A;  3FM3 A;  4FLL A;  3L24 A;  4IPA A;  2Q95 A;  2BHC A;  4IKT A;  4B28 A;  1QXZ A;  3FMR A;  1N51 A;  4U6Z A;  4U73 A;  1A16 A;  3IU9 A;  2BWW A;  3TAV A;  2V3Z A;  2GZ5 A;  1XGO A;  4ZWP A;  2GG5 A;  4IKU A;  5JHU A;  4PNC A;  4FLI A;  1WL6 A;  5CNX A;  2HOW A;  5FCF A;  2Q93 A;  4U6J A;  2P98 A;  2EVO A;  4FKC A;  2GGC A;  1QXY A;  2Q96 A;  4S2R P;  3S6B A;  2Q92 A;  4S00 A;  4U75 A;  1C21 A;  3CB6 A;  4QR8 A;  1XGM A;  4IU6 A;  1W2M A;  4S01 A;  2GGB A;  1WY2 A;  1MAT A;  1M35 A;  5CDV A;  2OAZ A;  3PKE A;  4U1B A;  2GU6 A;  3MAT A;  2BHB A;  4IEC A;  5CE6 A;  3BIT A;  2BWY A;  4JUQ A;  4S2T P;  1BOA A;  2GTX A;  4FLJ A;  1B6A A;  3FMQ A;  3PKD A;  5CLS A;  2ADU A;  5CDE A;  2IW2 A;  1WKM A;  2GG2 A;  2GU4 A;  3PKC A;  5CIK A;  2GG0 A;  4FUK A;  3CTZ A;  5JFR A;  2EVC A;  4IKS A;  2EVM A;  1O0X A;  4ZWO A;  1YW7 A;  5FCH A;  3IU7 A;  3MR1 A;  2BWU A;  4U71 A;  1WL9 A;  1YW8 A;  2DFI A;  2GG7 A;  3L7G A;  4U70 A;  2B3L A;  2GA2 A;  2NQ7 A;  4FO8 A;  1YVM A;  4ZWU A;  2V6C A;  3Q6D A;  2BWX A;  2V3X A;  4Z7M A;  3CB5 A;  2P99 A;  2BWS A;  4HXX A;  4FO7 A;  4RZY A;  4R60 A;  3MX6 A;  2BB7 A;  1KQ9 A;  2EA4 A;  1YJ3 A;  1R5G A;  4FLK A;  5CDL A;  4IF7 A;  2BWV A;  4PV4 A;  4A6V A;  2GU5 A;  2BN7 A;  4MAT A;  5D6E A;  2Q8K A;  2BH3 A;  1C22 A;  3IG4 A;  1C24 A;  5D6F A;  4EGE A;  1BN5 A;  3BIP A;  4OOK A;  2MAT A;  3BIQ A;  1YW9 A;  1QXW A;  2EA2 A;  4KM3 A;  2GG3 A;  1QZY A;  1W7V A;  1KP0 A;  1Y1N A;  2P9A A;  2BWT A;  5E5B A;  1C23 A;  2GU7 A;  2BHD A;  2GG9 A;  4IKR A;  3PKA A;  1C27 A;  1WBQ A;  2Q94 A;  1JAW A;  3TB5 A;  1R5H A;  1R58 A;  1XGN A;  2V3Y A;  3PKB A;  1XGS A;  2GG8 A;  4U6E A;  1WLR A;  1B59 A;  1WN1 A;  3ROR A;  1PV9 A;  2OKN A;  4U69 A;  5JI6 A;  2ZSG A;  2B3H A;  1CHM A;  2NQ6 A; 
#chains in the Genus database with same CATH topology
 4RZZ A;  2BHA A;  4ZNG A;  4U76 A;  3RVA A;  1KQ0 A;  1XNZ A;  2G6P A;  4RGZ 1;  4U6C A;  4A6W A;  3D27 A;  2B3K A;  3IU8 A;  4IDY A;  4U6W A;  3FM3 A;  4FLL A;  3L24 A;  4IPA A;  2Q95 A;  2BHC A;  4IKT A;  4B28 A;  1QXZ A;  3FMR A;  1N51 A;  4U6Z A;  4U73 A;  1A16 A;  3IU9 A;  2BWW A;  3TAV A;  2V3Z A;  2GZ5 A;  1XGO A;  4ZWP A;  2GG5 A;  4IKU A;  5JHU A;  4PNC A;  4FLI A;  1WL6 A;  5CNX A;  2HOW A;  5FCF A;  2Q93 A;  4U6J A;  2P98 A;  2EVO A;  4FKC A;  2GGC A;  1QXY A;  2Q96 A;  4S2R P;  3S6B A;  2Q92 A;  4S00 A;  4U75 A;  1C21 A;  3CB6 A;  4QR8 A;  1XGM A;  4IU6 A;  1W2M A;  4S01 A;  2GGB A;  1WY2 A;  1MAT A;  1M35 A;  5CDV A;  2OAZ A;  3PKE A;  4U1B A;  2GU6 A;  3MAT A;  2BHB A;  4IEC A;  5CE6 A;  3BIT A;  2BWY A;  4JUQ A;  4S2T P;  1BOA A;  2GTX A;  4FLJ A;  1B6A A;  3FMQ A;  3PKD A;  5CLS A;  2ADU A;  5CDE A;  2IW2 A;  1WKM A;  2GG2 A;  2GU4 A;  3PKC A;  5CIK A;  2GG0 A;  4FUK A;  3CTZ A;  5JFR A;  2EVC A;  4IKS A;  2EVM A;  1O0X A;  4ZWO A;  1YW7 A;  5FCH A;  3IU7 A;  3MR1 A;  2BWU A;  4U71 A;  1WL9 A;  1YW8 A;  2DFI A;  2GG7 A;  3L7G A;  4U70 A;  2B3L A;  2GA2 A;  2NQ7 A;  4FO8 A;  1YVM A;  4ZWU A;  2V6C A;  3Q6D A;  2BWX A;  2V3X A;  4Z7M A;  3CB5 A;  2P99 A;  2BWS A;  4HXX A;  4FO7 A;  4RZY A;  4R60 A;  3MX6 A;  2BB7 A;  1KQ9 A;  2EA4 A;  1YJ3 A;  1R5G A;  4FLK A;  5CDL A;  4IF7 A;  2BWV A;  4PV4 A;  4A6V A;  2GU5 A;  2BN7 A;  4MAT A;  5D6E A;  2Q8K A;  2BH3 A;  1C22 A;  3IG4 A;  1C24 A;  5D6F A;  4EGE A;  1BN5 A;  3BIP A;  4OOK A;  2MAT A;  3BIQ A;  1YW9 A;  1QXW A;  2EA2 A;  4KM3 A;  2GG3 A;  1QZY A;  1W7V A;  1KP0 A;  1Y1N A;  2P9A A;  2BWT A;  5E5B A;  1C23 A;  2GU7 A;  2BHD A;  2GG9 A;  4IKR A;  3PKA A;  1C27 A;  1WBQ A;  2Q94 A;  1JAW A;  3TB5 A;  1R5H A;  1R58 A;  1XGN A;  2V3Y A;  3PKB A;  1XGS A;  2GG8 A;  4U6E A;  1WLR A;  1B59 A;  1WN1 A;  3ROR A;  1PV9 A;  2OKN A;  4U69 A;  5JI6 A;  2ZSG A;  2B3H A;  1CHM A;  2NQ6 A; 
#chains in the Genus database with same CATH homology
 4RZZ A;  2BHA A;  4ZNG A;  4U76 A;  3RVA A;  1KQ0 A;  1XNZ A;  2G6P A;  4RGZ 1;  4U6C A;  4A6W A;  3D27 A;  2B3K A;  3IU8 A;  4IDY A;  4U6W A;  3FM3 A;  4FLL A;  3L24 A;  4IPA A;  2Q95 A;  2BHC A;  4IKT A;  4B28 A;  1QXZ A;  3FMR A;  1N51 A;  4U6Z A;  4U73 A;  1A16 A;  3IU9 A;  2BWW A;  3TAV A;  2V3Z A;  2GZ5 A;  1XGO A;  4ZWP A;  2GG5 A;  4IKU A;  5JHU A;  4PNC A;  4FLI A;  1WL6 A;  5CNX A;  2HOW A;  5FCF A;  2Q93 A;  4U6J A;  2P98 A;  2EVO A;  4FKC A;  2GGC A;  1QXY A;  2Q96 A;  4S2R P;  3S6B A;  2Q92 A;  4S00 A;  4U75 A;  1C21 A;  3CB6 A;  4QR8 A;  1XGM A;  4IU6 A;  1W2M A;  4S01 A;  2GGB A;  1WY2 A;  1MAT A;  1M35 A;  5CDV A;  2OAZ A;  3PKE A;  4U1B A;  2GU6 A;  3MAT A;  2BHB A;  4IEC A;  5CE6 A;  3BIT A;  2BWY A;  4JUQ A;  4S2T P;  1BOA A;  2GTX A;  4FLJ A;  1B6A A;  3FMQ A;  3PKD A;  5CLS A;  2ADU A;  5CDE A;  2IW2 A;  1WKM A;  2GG2 A;  2GU4 A;  3PKC A;  5CIK A;  2GG0 A;  4FUK A;  3CTZ A;  5JFR A;  2EVC A;  4IKS A;  2EVM A;  1O0X A;  4ZWO A;  1YW7 A;  5FCH A;  3IU7 A;  3MR1 A;  2BWU A;  4U71 A;  1WL9 A;  1YW8 A;  2DFI A;  2GG7 A;  3L7G A;  4U70 A;  2B3L A;  2GA2 A;  2NQ7 A;  4FO8 A;  1YVM A;  4ZWU A;  2V6C A;  3Q6D A;  2BWX A;  2V3X A;  4Z7M A;  3CB5 A;  2P99 A;  2BWS A;  4HXX A;  4FO7 A;  4RZY A;  4R60 A;  3MX6 A;  2BB7 A;  1KQ9 A;  2EA4 A;  1YJ3 A;  1R5G A;  4FLK A;  5CDL A;  4IF7 A;  2BWV A;  4PV4 A;  4A6V A;  2GU5 A;  2BN7 A;  4MAT A;  5D6E A;  2Q8K A;  2BH3 A;  1C22 A;  3IG4 A;  1C24 A;  5D6F A;  4EGE A;  1BN5 A;  3BIP A;  4OOK A;  2MAT A;  3BIQ A;  1YW9 A;  1QXW A;  2EA2 A;  4KM3 A;  2GG3 A;  1QZY A;  1W7V A;  1KP0 A;  1Y1N A;  2P9A A;  2BWT A;  5E5B A;  1C23 A;  2GU7 A;  2BHD A;  2GG9 A;  4IKR A;  3PKA A;  1C27 A;  1WBQ A;  2Q94 A;  1JAW A;  3TB5 A;  1R5H A;  1R58 A;  1XGN A;  2V3Y A;  3PKB A;  1XGS A;  2GG8 A;  4U6E A;  1WLR A;  1B59 A;  1WN1 A;  3ROR A;  1PV9 A;  2OKN A;  4U69 A;  5JI6 A;  2ZSG A;  2B3H A;  1CHM A;  2NQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...