4U6CA

Hsmetap in complex with [(1r)-1-amino-3-cyclopentylpropyl]phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6cA00
4S01A 3L24A 3IU9A 4B28A 1XGSA 5CIKA 4PV4A 3TAVA 3MATA 2BWSA 4IECA 4IPAA 3IU8A 4A6WA 2GG9A 5CLSA 4FKCA 2P9AA 1QZYA 1Y1NA 2BHAA 4IKSA 1XGNA 4FUKA 5FCFA 5CNXA 3FM3A 1N51A 4ZWPA 2GU5A 2HOWA 4IKUA 2GU4A 3BIQA 4EGEA 1YW7A 2B3LA 2GG7A 4KM3A 1WY2A 5JI6A 4IU6A 1XGOA 2EVCA 1C22A 2NQ7A 4S2RP 2GG3A 4U1BA 2B3HA 3BIPA 4S00A 5CDVA 2Q92A 4S2TP 2GG0A 4U75A 3TB5A 1XGMA 2BHBA 3RVAA 2BWXA 1WL9A 5JFRA 2GU6A 2GGBA 4U73A 4ZWOA 1KQ0A 1A16A 3PKDA 4Z7MA 3IU7A 1QXWA 1B59A 2BWTA 1WLRA 2V3ZA 4A6VA 5CE6A 2ZSGA 2G6PA 1C23A 1BOAA 1QXYA 3PKCA 3L7GA 4JUQA 1C21A 1QXZA 2Q93A 4IF7A 1YW8A 2Q94A 1PV9A 2NQ6A 3IG4A 3PKEA 1M35A 4QR8A 2BH3A 2EVMA 2Q96A 4HXXA 1BN5A 5D6FA 4ZWUA 2B3KA 2DFIA 1KP0A 1WN1A 5FCHA 2BHDA 2ADUA 3Q6DA 1W2MA 1O0XA 2GTXA 1XNZA 3FMRA 4FLJA 2EA4A 4U6CA 4OOKA 4FO7A 4FLKA 1WBQA 5JHUA 3CB6A 4IDYA 1B6AA 4R60A 1W7VA 4FLLA 1JAWA 2BWVA 2V6CA 3FMQA 3CTZA 1MATA 2BHCA 3PKAA 4RGZ1 2P99A 1C27A 1R5GA 4FLIA 2GU7A 1CHMA 1YVMA 2BWYA 2P98A 2GG5A 5CDEA 2OKNA 3CB5A 2BWUA 3PKBA 2BN7A 3MR1A 4MATA 4PNCA 1KQ9A 2V3XA 3D27A 4FO8A 1YW9A 2GGCA 2GG2A 1R5HA 5D6EA 2Q8KA 2V3YA 4RZYA 1WKMA 4U6JA 4ZNGA 1C24A 1R58A 5CDLA 2OAZA 3BITA 2GZ5A 3RORA 3S6BA 2MATA 2GA2A 4U6EA 1YJ3A 2EVOA 4IKTA 4U6ZA 1WL6A 2BWWA 4U76A 2GG8A 2Q95A 2IW2A 4RZZA 4U69A 3MX6A 4U6WA 4IKRA 4U71A 2EA2A 5E5BA 2BB7A 4U70A
chains in the Genus database with same CATH superfamily
4S01A 3L24A 3IU9A 4B28A 1XGSA 5CIKA 4PV4A 3TAVA 3MATA 2BWSA 4IECA 4IPAA 3IU8A 4A6WA 2GG9A 5CLSA 4FKCA 2P9AA 1QZYA 1Y1NA 2BHAA 4IKSA 1XGNA 4FUKA 5FCFA 5CNXA 3FM3A 1N51A 4ZWPA 2GU5A 2HOWA 4IKUA 2GU4A 3BIQA 4EGEA 1YW7A 2B3LA 2GG7A 4KM3A 1WY2A 5JI6A 4IU6A 1XGOA 2EVCA 1C22A 2NQ7A 4S2RP 2GG3A 4U1BA 2B3HA 3BIPA 4S00A 5CDVA 2Q92A 4S2TP 2GG0A 4U75A 3TB5A 1XGMA 2BHBA 3RVAA 2BWXA 1WL9A 5JFRA 2GU6A 2GGBA 4U73A 4ZWOA 1KQ0A 1A16A 3PKDA 4Z7MA 3IU7A 1QXWA 1B59A 2BWTA 1WLRA 2V3ZA 4A6VA 5CE6A 2ZSGA 2G6PA 1C23A 1BOAA 1QXYA 3PKCA 3L7GA 4JUQA 1C21A 1QXZA 2Q93A 4IF7A 1YW8A 2Q94A 1PV9A 2NQ6A 3IG4A 3PKEA 1M35A 4QR8A 2BH3A 2EVMA 2Q96A 4HXXA 1BN5A 5D6FA 4ZWUA 2B3KA 2DFIA 1KP0A 1WN1A 5FCHA 2BHDA 2ADUA 3Q6DA 1W2MA 1O0XA 2GTXA 1XNZA 3FMRA 4FLJA 2EA4A 4U6CA 4OOKA 4FO7A 4FLKA 1WBQA 5JHUA 3CB6A 4IDYA 1B6AA 4R60A 1W7VA 4FLLA 1JAWA 2BWVA 2V6CA 3FMQA 3CTZA 1MATA 2BHCA 3PKAA 4RGZ1 2P99A 1C27A 1R5GA 4FLIA 2GU7A 1CHMA 1YVMA 2BWYA 2P98A 2GG5A 5CDEA 2OKNA 3CB5A 2BWUA 3PKBA 2BN7A 3MR1A 4MATA 4PNCA 1KQ9A 2V3XA 3D27A 4FO8A 1YW9A 2GGCA 2GG2A 1R5HA 5D6EA 2Q8KA 2V3YA 4RZYA 1WKMA 4U6JA 4ZNGA 1C24A 1R58A 5CDLA 2OAZA 3BITA 2GZ5A 3RORA 3S6BA 2MATA 2GA2A 4U6EA 1YJ3A 2EVOA 4IKTA 4U6ZA 1WL6A 2BWWA 4U76A 2GG8A 2Q95A 2IW2A 4RZZA 4U69A 3MX6A 4U6WA 4IKRA 4U71A 2EA2A 5E5BA 2BB7A 4U70A
chains in the Genus database with same CATH topology
4S01A 3L24A 3IU9A 4B28A 1XGSA 5CIKA 4PV4A 3TAVA 3MATA 2BWSA 4IECA 4IPAA 3IU8A 4A6WA 2GG9A 5CLSA 4FKCA 2P9AA 1QZYA 1Y1NA 2BHAA 4IKSA 1XGNA 4FUKA 5FCFA 5CNXA 3FM3A 1N51A 4ZWPA 2GU5A 2HOWA 4IKUA 2GU4A 3BIQA 4EGEA 1YW7A 2B3LA 2GG7A 4KM3A 1WY2A 5JI6A 4IU6A 1XGOA 2EVCA 1C22A 2NQ7A 4S2RP 2GG3A 4U1BA 2B3HA 3BIPA 4S00A 5CDVA 2Q92A 4S2TP 2GG0A 4U75A 3TB5A 1XGMA 2BHBA 3RVAA 2BWXA 1WL9A 5JFRA 2GU6A 2GGBA 4U73A 4ZWOA 1KQ0A 1A16A 3PKDA 4Z7MA 3IU7A 1QXWA 1B59A 2BWTA 1WLRA 2V3ZA 4A6VA 5CE6A 2ZSGA 2G6PA 1C23A 1BOAA 1QXYA 3PKCA 3L7GA 4JUQA 1C21A 1QXZA 2Q93A 4IF7A 1YW8A 2Q94A 1PV9A 2NQ6A 3IG4A 3PKEA 1M35A 4QR8A 2BH3A 2EVMA 2Q96A 4HXXA 1BN5A 5D6FA 4ZWUA 2B3KA 2DFIA 1KP0A 1WN1A 5FCHA 2BHDA 2ADUA 3Q6DA 1W2MA 1O0XA 2GTXA 1XNZA 3FMRA 4FLJA 2EA4A 4U6CA 4OOKA 4FO7A 4FLKA 1WBQA 5JHUA 3CB6A 4IDYA 1B6AA 4R60A 1W7VA 4FLLA 1JAWA 2BWVA 2V6CA 3FMQA 3CTZA 1MATA 2BHCA 3PKAA 4RGZ1 2P99A 1C27A 1R5GA 4FLIA 2GU7A 1CHMA 1YVMA 2BWYA 2P98A 2GG5A 5CDEA 2OKNA 3CB5A 2BWUA 3PKBA 2BN7A 3MR1A 4MATA 4PNCA 1KQ9A 2V3XA 3D27A 4FO8A 1YW9A 2GGCA 2GG2A 1R5HA 5D6EA 2Q8KA 2V3YA 4RZYA 1WKMA 4U6JA 4ZNGA 1C24A 1R58A 5CDLA 2OAZA 3BITA 2GZ5A 3RORA 3S6BA 2MATA 2GA2A 4U6EA 1YJ3A 2EVOA 4IKTA 4U6ZA 1WL6A 2BWWA 4U76A 2GG8A 2Q95A 2IW2A 4RZZA 4U69A 3MX6A 4U6WA 4IKRA 4U71A 2EA2A 5E5BA 2BB7A 4U70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S01 A;  3L24 A;  3IU9 A;  4B28 A;  1XGS A;  5CIK A;  4PV4 A;  3TAV A;  3MAT A;  2BWS A;  4IEC A;  4IPA A;  3IU8 A;  4A6W A;  2GG9 A;  5CLS A;  4FKC A;  2P9A A;  1QZY A;  1Y1N A;  2BHA A;  4IKS A;  1XGN A;  4FUK A;  5FCF A;  5CNX A;  3FM3 A;  1N51 A;  4ZWP A;  2GU5 A;  2HOW A;  4IKU A;  2GU4 A;  3BIQ A;  4EGE A;  1YW7 A;  2B3L A;  2GG7 A;  4KM3 A;  1WY2 A;  5JI6 A;  4IU6 A;  1XGO A;  2EVC A;  1C22 A;  2NQ7 A;  4S2R P;  2GG3 A;  4U1B A;  2B3H A;  3BIP A;  4S00 A;  5CDV A;  2Q92 A;  4S2T P;  2GG0 A;  4U75 A;  3TB5 A;  1XGM A;  2BHB A;  3RVA A;  2BWX A;  1WL9 A;  5JFR A;  2GU6 A;  2GGB A;  4U73 A;  4ZWO A;  1KQ0 A;  1A16 A;  3PKD A;  4Z7M A;  3IU7 A;  1QXW A;  1B59 A;  2BWT A;  1WLR A;  2V3Z A;  4A6V A;  5CE6 A;  2ZSG A;  2G6P A;  1C23 A;  1BOA A;  1QXY A;  3PKC A;  3L7G A;  4JUQ A;  1C21 A;  1QXZ A;  2Q93 A;  4IF7 A;  1YW8 A;  2Q94 A;  1PV9 A;  2NQ6 A;  3IG4 A;  3PKE A;  1M35 A;  4QR8 A;  2BH3 A;  2EVM A;  2Q96 A;  4HXX A;  1BN5 A;  5D6F A;  4ZWU A;  2B3K A;  2DFI A;  1KP0 A;  1WN1 A;  5FCH A;  2BHD A;  2ADU A;  3Q6D A;  1W2M A;  1O0X A;  2GTX A;  1XNZ A;  3FMR A;  4FLJ A;  2EA4 A;  4U6C A;  4OOK A;  4FO7 A;  4FLK A;  1WBQ A;  5JHU A;  3CB6 A;  4IDY A;  1B6A A;  4R60 A;  1W7V A;  4FLL A;  1JAW A;  2BWV A;  2V6C A;  3FMQ A;  3CTZ A;  1MAT A;  2BHC A;  3PKA A;  4RGZ 1;  2P99 A;  1C27 A;  1R5G A;  4FLI A;  2GU7 A;  1CHM A;  1YVM A;  2BWY A;  2P98 A;  2GG5 A;  5CDE A;  2OKN A;  3CB5 A;  2BWU A;  3PKB A;  2BN7 A;  3MR1 A;  4MAT A;  4PNC A;  1KQ9 A;  2V3X A;  3D27 A;  4FO8 A;  1YW9 A;  2GGC A;  2GG2 A;  1R5H A;  5D6E A;  2Q8K A;  2V3Y A;  4RZY A;  1WKM A;  4U6J A;  4ZNG A;  1C24 A;  1R58 A;  5CDL A;  2OAZ A;  3BIT A;  2GZ5 A;  3ROR A;  3S6B A;  2MAT A;  2GA2 A;  4U6E A;  1YJ3 A;  2EVO A;  4IKT A;  4U6Z A;  1WL6 A;  2BWW A;  4U76 A;  2GG8 A;  2Q95 A;  2IW2 A;  4RZZ A;  4U69 A;  3MX6 A;  4U6W A;  4IKR A;  4U71 A;  2EA2 A;  5E5B A;  2BB7 A;  4U70 A; 
#chains in the Genus database with same CATH topology
 4S01 A;  3L24 A;  3IU9 A;  4B28 A;  1XGS A;  5CIK A;  4PV4 A;  3TAV A;  3MAT A;  2BWS A;  4IEC A;  4IPA A;  3IU8 A;  4A6W A;  2GG9 A;  5CLS A;  4FKC A;  2P9A A;  1QZY A;  1Y1N A;  2BHA A;  4IKS A;  1XGN A;  4FUK A;  5FCF A;  5CNX A;  3FM3 A;  1N51 A;  4ZWP A;  2GU5 A;  2HOW A;  4IKU A;  2GU4 A;  3BIQ A;  4EGE A;  1YW7 A;  2B3L A;  2GG7 A;  4KM3 A;  1WY2 A;  5JI6 A;  4IU6 A;  1XGO A;  2EVC A;  1C22 A;  2NQ7 A;  4S2R P;  2GG3 A;  4U1B A;  2B3H A;  3BIP A;  4S00 A;  5CDV A;  2Q92 A;  4S2T P;  2GG0 A;  4U75 A;  3TB5 A;  1XGM A;  2BHB A;  3RVA A;  2BWX A;  1WL9 A;  5JFR A;  2GU6 A;  2GGB A;  4U73 A;  4ZWO A;  1KQ0 A;  1A16 A;  3PKD A;  4Z7M A;  3IU7 A;  1QXW A;  1B59 A;  2BWT A;  1WLR A;  2V3Z A;  4A6V A;  5CE6 A;  2ZSG A;  2G6P A;  1C23 A;  1BOA A;  1QXY A;  3PKC A;  3L7G A;  4JUQ A;  1C21 A;  1QXZ A;  2Q93 A;  4IF7 A;  1YW8 A;  2Q94 A;  1PV9 A;  2NQ6 A;  3IG4 A;  3PKE A;  1M35 A;  4QR8 A;  2BH3 A;  2EVM A;  2Q96 A;  4HXX A;  1BN5 A;  5D6F A;  4ZWU A;  2B3K A;  2DFI A;  1KP0 A;  1WN1 A;  5FCH A;  2BHD A;  2ADU A;  3Q6D A;  1W2M A;  1O0X A;  2GTX A;  1XNZ A;  3FMR A;  4FLJ A;  2EA4 A;  4U6C A;  4OOK A;  4FO7 A;  4FLK A;  1WBQ A;  5JHU A;  3CB6 A;  4IDY A;  1B6A A;  4R60 A;  1W7V A;  4FLL A;  1JAW A;  2BWV A;  2V6C A;  3FMQ A;  3CTZ A;  1MAT A;  2BHC A;  3PKA A;  4RGZ 1;  2P99 A;  1C27 A;  1R5G A;  4FLI A;  2GU7 A;  1CHM A;  1YVM A;  2BWY A;  2P98 A;  2GG5 A;  5CDE A;  2OKN A;  3CB5 A;  2BWU A;  3PKB A;  2BN7 A;  3MR1 A;  4MAT A;  4PNC A;  1KQ9 A;  2V3X A;  3D27 A;  4FO8 A;  1YW9 A;  2GGC A;  2GG2 A;  1R5H A;  5D6E A;  2Q8K A;  2V3Y A;  4RZY A;  1WKM A;  4U6J A;  4ZNG A;  1C24 A;  1R58 A;  5CDL A;  2OAZ A;  3BIT A;  2GZ5 A;  3ROR A;  3S6B A;  2MAT A;  2GA2 A;  4U6E A;  1YJ3 A;  2EVO A;  4IKT A;  4U6Z A;  1WL6 A;  2BWW A;  4U76 A;  2GG8 A;  2Q95 A;  2IW2 A;  4RZZ A;  4U69 A;  3MX6 A;  4U6W A;  4IKR A;  4U71 A;  2EA2 A;  5E5B A;  2BB7 A;  4U70 A; 
#chains in the Genus database with same CATH homology
 4S01 A;  3L24 A;  3IU9 A;  4B28 A;  1XGS A;  5CIK A;  4PV4 A;  3TAV A;  3MAT A;  2BWS A;  4IEC A;  4IPA A;  3IU8 A;  4A6W A;  2GG9 A;  5CLS A;  4FKC A;  2P9A A;  1QZY A;  1Y1N A;  2BHA A;  4IKS A;  1XGN A;  4FUK A;  5FCF A;  5CNX A;  3FM3 A;  1N51 A;  4ZWP A;  2GU5 A;  2HOW A;  4IKU A;  2GU4 A;  3BIQ A;  4EGE A;  1YW7 A;  2B3L A;  2GG7 A;  4KM3 A;  1WY2 A;  5JI6 A;  4IU6 A;  1XGO A;  2EVC A;  1C22 A;  2NQ7 A;  4S2R P;  2GG3 A;  4U1B A;  2B3H A;  3BIP A;  4S00 A;  5CDV A;  2Q92 A;  4S2T P;  2GG0 A;  4U75 A;  3TB5 A;  1XGM A;  2BHB A;  3RVA A;  2BWX A;  1WL9 A;  5JFR A;  2GU6 A;  2GGB A;  4U73 A;  4ZWO A;  1KQ0 A;  1A16 A;  3PKD A;  4Z7M A;  3IU7 A;  1QXW A;  1B59 A;  2BWT A;  1WLR A;  2V3Z A;  4A6V A;  5CE6 A;  2ZSG A;  2G6P A;  1C23 A;  1BOA A;  1QXY A;  3PKC A;  3L7G A;  4JUQ A;  1C21 A;  1QXZ A;  2Q93 A;  4IF7 A;  1YW8 A;  2Q94 A;  1PV9 A;  2NQ6 A;  3IG4 A;  3PKE A;  1M35 A;  4QR8 A;  2BH3 A;  2EVM A;  2Q96 A;  4HXX A;  1BN5 A;  5D6F A;  4ZWU A;  2B3K A;  2DFI A;  1KP0 A;  1WN1 A;  5FCH A;  2BHD A;  2ADU A;  3Q6D A;  1W2M A;  1O0X A;  2GTX A;  1XNZ A;  3FMR A;  4FLJ A;  2EA4 A;  4U6C A;  4OOK A;  4FO7 A;  4FLK A;  1WBQ A;  5JHU A;  3CB6 A;  4IDY A;  1B6A A;  4R60 A;  1W7V A;  4FLL A;  1JAW A;  2BWV A;  2V6C A;  3FMQ A;  3CTZ A;  1MAT A;  2BHC A;  3PKA A;  4RGZ 1;  2P99 A;  1C27 A;  1R5G A;  4FLI A;  2GU7 A;  1CHM A;  1YVM A;  2BWY A;  2P98 A;  2GG5 A;  5CDE A;  2OKN A;  3CB5 A;  2BWU A;  3PKB A;  2BN7 A;  3MR1 A;  4MAT A;  4PNC A;  1KQ9 A;  2V3X A;  3D27 A;  4FO8 A;  1YW9 A;  2GGC A;  2GG2 A;  1R5H A;  5D6E A;  2Q8K A;  2V3Y A;  4RZY A;  1WKM A;  4U6J A;  4ZNG A;  1C24 A;  1R58 A;  5CDL A;  2OAZ A;  3BIT A;  2GZ5 A;  3ROR A;  3S6B A;  2MAT A;  2GA2 A;  4U6E A;  1YJ3 A;  2EVO A;  4IKT A;  4U6Z A;  1WL6 A;  2BWW A;  4U76 A;  2GG8 A;  2Q95 A;  2IW2 A;  4RZZ A;  4U69 A;  3MX6 A;  4U6W A;  4IKR A;  4U71 A;  2EA2 A;  5E5B A;  2BB7 A;  4U70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...