4U6CA

Hsmetap in complex with [(1r)-1-amino-3-cyclopentylpropyl]phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6cA00
1A16A 3S6BA 4A6WA 4RZYA 1R5HA 4IF7A 4S00A 3FM3A 3CTZA 3PKEA 2Q93A 5CLSA 1BOAA 2EA2A 1KP0A 4IPAA 5CDLA 2NQ7A 2GA2A 4RGZ1 1CHMA 2GG7A 1C27A 1C21A 4JUQA 2EVMA 1XGSA 3D27A 4FUKA 4U6ZA 3MR1A 2V3ZA 3PKBA 1WL9A 2BN7A 2BWYA 1PV9A 1XGMA 2BHBA 5CNXA 3MATA 1WKMA 4S2TP 3PKDA 3L24A 4IKTA 2GU6A 2BH3A 2NQ6A 1B6AA 5FCFA 1R58A 1YVMA 1JAWA 3IU8A 4IDYA 4PV4A 4U6CA 2ZSGA 3IG4A 1WN1A 3FMRA 1C22A 4RZZA 5D6EA 4OOKA 2GG8A 4FLKA 2B3LA 2BWTA 3BITA 1WLRA 5FCHA 4FLIA 4S2RP 4R60A 4ZWPA 1O0XA 1M35A 2P9AA 4ZWOA 5CDEA 2GG2A 4S01A 1XNZA 3FMQA 3L7GA 5JHUA 4HXXA 1QZYA 1C23A 4IKRA 2BWSA 4EGEA 4MATA 4QR8A 2Q92A 5D6FA 3TAVA 2GTXA 4FLJA 4U6WA 1XGNA 2EVOA 2DFIA 2Q94A 1BN5A 2BWUA 2Q95A 3IU7A 2V3YA 3IU9A 5CIKA 1KQ0A 4U6EA 4ZWUA 2GGCA 2BHAA 4FLLA 3Q6DA 2Q8KA 1MATA 2P99A 2OKNA 5JFRA 3PKCA 2GU4A 2HOWA 2P98A 1QXWA 2IW2A 3BIQA 2V3XA 3TB5A 4ZNGA 1YW7A 1WY2A 1W7VA 1B59A 2EVCA 2Q96A 2BHDA 2BWWA 1Y1NA 5CDVA 2V6CA 3MX6A 1YW8A 4IKUA 5E5BA 2BWXA 5CE6A 3PKAA 4KM3A 4IU6A 2GU7A 2MATA 4U76A 2B3KA 4U75A 1WBQA 4FO7A 4U71A 4B28A 4Z7MA 3CB6A 4IKSA 4U69A 2GZ5A 5JI6A 1QXZA 2GU5A 4A6VA 2GG3A 2BHCA 1QXYA 1XGOA 1YW9A 4U6JA 3RVAA 4U1BA 2GGBA 4FKCA 2GG0A 2EA4A 4PNCA 1YJ3A 4U73A 2BWVA 1WL6A 3BIPA 4FO8A 3RORA 1C24A 1N51A 2GG5A 2ADUA 2B3HA 2G6PA 1KQ9A 2BB7A 4U70A 3CB5A 1W2MA 2GG9A 4IECA 2OAZA 1R5GA
chains in the Genus database with same CATH superfamily
1A16A 3S6BA 4A6WA 4RZYA 1R5HA 4IF7A 4S00A 3FM3A 3CTZA 3PKEA 2Q93A 5CLSA 1BOAA 2EA2A 1KP0A 4IPAA 5CDLA 2NQ7A 2GA2A 4RGZ1 1CHMA 2GG7A 1C27A 1C21A 4JUQA 2EVMA 1XGSA 3D27A 4FUKA 4U6ZA 3MR1A 2V3ZA 3PKBA 1WL9A 2BN7A 2BWYA 1PV9A 1XGMA 2BHBA 5CNXA 3MATA 1WKMA 4S2TP 3PKDA 3L24A 4IKTA 2GU6A 2BH3A 2NQ6A 1B6AA 5FCFA 1R58A 1YVMA 1JAWA 3IU8A 4IDYA 4PV4A 4U6CA 2ZSGA 3IG4A 1WN1A 3FMRA 1C22A 4RZZA 5D6EA 4OOKA 2GG8A 4FLKA 2B3LA 2BWTA 3BITA 1WLRA 5FCHA 4FLIA 4S2RP 4R60A 4ZWPA 1O0XA 1M35A 2P9AA 4ZWOA 5CDEA 2GG2A 4S01A 1XNZA 3FMQA 3L7GA 5JHUA 4HXXA 1QZYA 1C23A 4IKRA 2BWSA 4EGEA 4MATA 4QR8A 2Q92A 5D6FA 3TAVA 2GTXA 4FLJA 4U6WA 1XGNA 2EVOA 2DFIA 2Q94A 1BN5A 2BWUA 2Q95A 3IU7A 2V3YA 3IU9A 5CIKA 1KQ0A 4U6EA 4ZWUA 2GGCA 2BHAA 4FLLA 3Q6DA 2Q8KA 1MATA 2P99A 2OKNA 5JFRA 3PKCA 2GU4A 2HOWA 2P98A 1QXWA 2IW2A 3BIQA 2V3XA 3TB5A 4ZNGA 1YW7A 1WY2A 1W7VA 1B59A 2EVCA 2Q96A 2BHDA 2BWWA 1Y1NA 5CDVA 2V6CA 3MX6A 1YW8A 4IKUA 5E5BA 2BWXA 5CE6A 3PKAA 4KM3A 4IU6A 2GU7A 2MATA 4U76A 2B3KA 4U75A 1WBQA 4FO7A 4U71A 4B28A 4Z7MA 3CB6A 4IKSA 4U69A 2GZ5A 5JI6A 1QXZA 2GU5A 4A6VA 2GG3A 2BHCA 1QXYA 1XGOA 1YW9A 4U6JA 3RVAA 4U1BA 2GGBA 4FKCA 2GG0A 2EA4A 4PNCA 1YJ3A 4U73A 2BWVA 1WL6A 3BIPA 4FO8A 3RORA 1C24A 1N51A 2GG5A 2ADUA 2B3HA 2G6PA 1KQ9A 2BB7A 4U70A 3CB5A 1W2MA 2GG9A 4IECA 2OAZA 1R5GA
chains in the Genus database with same CATH topology
1A16A 3S6BA 4A6WA 4RZYA 1R5HA 4IF7A 4S00A 3FM3A 3CTZA 3PKEA 2Q93A 5CLSA 1BOAA 2EA2A 1KP0A 4IPAA 5CDLA 2NQ7A 2GA2A 4RGZ1 1CHMA 2GG7A 1C27A 1C21A 4JUQA 2EVMA 1XGSA 3D27A 4FUKA 4U6ZA 3MR1A 2V3ZA 3PKBA 1WL9A 2BN7A 2BWYA 1PV9A 1XGMA 2BHBA 5CNXA 3MATA 1WKMA 4S2TP 3PKDA 3L24A 4IKTA 2GU6A 2BH3A 2NQ6A 1B6AA 5FCFA 1R58A 1YVMA 1JAWA 3IU8A 4IDYA 4PV4A 4U6CA 2ZSGA 3IG4A 1WN1A 3FMRA 1C22A 4RZZA 5D6EA 4OOKA 2GG8A 4FLKA 2B3LA 2BWTA 3BITA 1WLRA 5FCHA 4FLIA 4S2RP 4R60A 4ZWPA 1O0XA 1M35A 2P9AA 4ZWOA 5CDEA 2GG2A 4S01A 1XNZA 3FMQA 3L7GA 5JHUA 4HXXA 1QZYA 1C23A 4IKRA 2BWSA 4EGEA 4MATA 4QR8A 2Q92A 5D6FA 3TAVA 2GTXA 4FLJA 4U6WA 1XGNA 2EVOA 2DFIA 2Q94A 1BN5A 2BWUA 2Q95A 3IU7A 2V3YA 3IU9A 5CIKA 1KQ0A 4U6EA 4ZWUA 2GGCA 2BHAA 4FLLA 3Q6DA 2Q8KA 1MATA 2P99A 2OKNA 5JFRA 3PKCA 2GU4A 2HOWA 2P98A 1QXWA 2IW2A 3BIQA 2V3XA 3TB5A 4ZNGA 1YW7A 1WY2A 1W7VA 1B59A 2EVCA 2Q96A 2BHDA 2BWWA 1Y1NA 5CDVA 2V6CA 3MX6A 1YW8A 4IKUA 5E5BA 2BWXA 5CE6A 3PKAA 4KM3A 4IU6A 2GU7A 2MATA 4U76A 2B3KA 4U75A 1WBQA 4FO7A 4U71A 4B28A 4Z7MA 3CB6A 4IKSA 4U69A 2GZ5A 5JI6A 1QXZA 2GU5A 4A6VA 2GG3A 2BHCA 1QXYA 1XGOA 1YW9A 4U6JA 3RVAA 4U1BA 2GGBA 4FKCA 2GG0A 2EA4A 4PNCA 1YJ3A 4U73A 2BWVA 1WL6A 3BIPA 4FO8A 3RORA 1C24A 1N51A 2GG5A 2ADUA 2B3HA 2G6PA 1KQ9A 2BB7A 4U70A 3CB5A 1W2MA 2GG9A 4IECA 2OAZA 1R5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A16 A;  3S6B A;  4A6W A;  4RZY A;  1R5H A;  4IF7 A;  4S00 A;  3FM3 A;  3CTZ A;  3PKE A;  2Q93 A;  5CLS A;  1BOA A;  2EA2 A;  1KP0 A;  4IPA A;  5CDL A;  2NQ7 A;  2GA2 A;  4RGZ 1;  1CHM A;  2GG7 A;  1C27 A;  1C21 A;  4JUQ A;  2EVM A;  1XGS A;  3D27 A;  4FUK A;  4U6Z A;  3MR1 A;  2V3Z A;  3PKB A;  1WL9 A;  2BN7 A;  2BWY A;  1PV9 A;  1XGM A;  2BHB A;  5CNX A;  3MAT A;  1WKM A;  4S2T P;  3PKD A;  3L24 A;  4IKT A;  2GU6 A;  2BH3 A;  2NQ6 A;  1B6A A;  5FCF A;  1R58 A;  1YVM A;  1JAW A;  3IU8 A;  4IDY A;  4PV4 A;  4U6C A;  2ZSG A;  3IG4 A;  1WN1 A;  3FMR A;  1C22 A;  4RZZ A;  5D6E A;  4OOK A;  2GG8 A;  4FLK A;  2B3L A;  2BWT A;  3BIT A;  1WLR A;  5FCH A;  4FLI A;  4S2R P;  4R60 A;  4ZWP A;  1O0X A;  1M35 A;  2P9A A;  4ZWO A;  5CDE A;  2GG2 A;  4S01 A;  1XNZ A;  3FMQ A;  3L7G A;  5JHU A;  4HXX A;  1QZY A;  1C23 A;  4IKR A;  2BWS A;  4EGE A;  4MAT A;  4QR8 A;  2Q92 A;  5D6F A;  3TAV A;  2GTX A;  4FLJ A;  4U6W A;  1XGN A;  2EVO A;  2DFI A;  2Q94 A;  1BN5 A;  2BWU A;  2Q95 A;  3IU7 A;  2V3Y A;  3IU9 A;  5CIK A;  1KQ0 A;  4U6E A;  4ZWU A;  2GGC A;  2BHA A;  4FLL A;  3Q6D A;  2Q8K A;  1MAT A;  2P99 A;  2OKN A;  5JFR A;  3PKC A;  2GU4 A;  2HOW A;  2P98 A;  1QXW A;  2IW2 A;  3BIQ A;  2V3X A;  3TB5 A;  4ZNG A;  1YW7 A;  1WY2 A;  1W7V A;  1B59 A;  2EVC A;  2Q96 A;  2BHD A;  2BWW A;  1Y1N A;  5CDV A;  2V6C A;  3MX6 A;  1YW8 A;  4IKU A;  5E5B A;  2BWX A;  5CE6 A;  3PKA A;  4KM3 A;  4IU6 A;  2GU7 A;  2MAT A;  4U76 A;  2B3K A;  4U75 A;  1WBQ A;  4FO7 A;  4U71 A;  4B28 A;  4Z7M A;  3CB6 A;  4IKS A;  4U69 A;  2GZ5 A;  5JI6 A;  1QXZ A;  2GU5 A;  4A6V A;  2GG3 A;  2BHC A;  1QXY A;  1XGO A;  1YW9 A;  4U6J A;  3RVA A;  4U1B A;  2GGB A;  4FKC A;  2GG0 A;  2EA4 A;  4PNC A;  1YJ3 A;  4U73 A;  2BWV A;  1WL6 A;  3BIP A;  4FO8 A;  3ROR A;  1C24 A;  1N51 A;  2GG5 A;  2ADU A;  2B3H A;  2G6P A;  1KQ9 A;  2BB7 A;  4U70 A;  3CB5 A;  1W2M A;  2GG9 A;  4IEC A;  2OAZ A;  1R5G A; 
#chains in the Genus database with same CATH topology
 1A16 A;  3S6B A;  4A6W A;  4RZY A;  1R5H A;  4IF7 A;  4S00 A;  3FM3 A;  3CTZ A;  3PKE A;  2Q93 A;  5CLS A;  1BOA A;  2EA2 A;  1KP0 A;  4IPA A;  5CDL A;  2NQ7 A;  2GA2 A;  4RGZ 1;  1CHM A;  2GG7 A;  1C27 A;  1C21 A;  4JUQ A;  2EVM A;  1XGS A;  3D27 A;  4FUK A;  4U6Z A;  3MR1 A;  2V3Z A;  3PKB A;  1WL9 A;  2BN7 A;  2BWY A;  1PV9 A;  1XGM A;  2BHB A;  5CNX A;  3MAT A;  1WKM A;  4S2T P;  3PKD A;  3L24 A;  4IKT A;  2GU6 A;  2BH3 A;  2NQ6 A;  1B6A A;  5FCF A;  1R58 A;  1YVM A;  1JAW A;  3IU8 A;  4IDY A;  4PV4 A;  4U6C A;  2ZSG A;  3IG4 A;  1WN1 A;  3FMR A;  1C22 A;  4RZZ A;  5D6E A;  4OOK A;  2GG8 A;  4FLK A;  2B3L A;  2BWT A;  3BIT A;  1WLR A;  5FCH A;  4FLI A;  4S2R P;  4R60 A;  4ZWP A;  1O0X A;  1M35 A;  2P9A A;  4ZWO A;  5CDE A;  2GG2 A;  4S01 A;  1XNZ A;  3FMQ A;  3L7G A;  5JHU A;  4HXX A;  1QZY A;  1C23 A;  4IKR A;  2BWS A;  4EGE A;  4MAT A;  4QR8 A;  2Q92 A;  5D6F A;  3TAV A;  2GTX A;  4FLJ A;  4U6W A;  1XGN A;  2EVO A;  2DFI A;  2Q94 A;  1BN5 A;  2BWU A;  2Q95 A;  3IU7 A;  2V3Y A;  3IU9 A;  5CIK A;  1KQ0 A;  4U6E A;  4ZWU A;  2GGC A;  2BHA A;  4FLL A;  3Q6D A;  2Q8K A;  1MAT A;  2P99 A;  2OKN A;  5JFR A;  3PKC A;  2GU4 A;  2HOW A;  2P98 A;  1QXW A;  2IW2 A;  3BIQ A;  2V3X A;  3TB5 A;  4ZNG A;  1YW7 A;  1WY2 A;  1W7V A;  1B59 A;  2EVC A;  2Q96 A;  2BHD A;  2BWW A;  1Y1N A;  5CDV A;  2V6C A;  3MX6 A;  1YW8 A;  4IKU A;  5E5B A;  2BWX A;  5CE6 A;  3PKA A;  4KM3 A;  4IU6 A;  2GU7 A;  2MAT A;  4U76 A;  2B3K A;  4U75 A;  1WBQ A;  4FO7 A;  4U71 A;  4B28 A;  4Z7M A;  3CB6 A;  4IKS A;  4U69 A;  2GZ5 A;  5JI6 A;  1QXZ A;  2GU5 A;  4A6V A;  2GG3 A;  2BHC A;  1QXY A;  1XGO A;  1YW9 A;  4U6J A;  3RVA A;  4U1B A;  2GGB A;  4FKC A;  2GG0 A;  2EA4 A;  4PNC A;  1YJ3 A;  4U73 A;  2BWV A;  1WL6 A;  3BIP A;  4FO8 A;  3ROR A;  1C24 A;  1N51 A;  2GG5 A;  2ADU A;  2B3H A;  2G6P A;  1KQ9 A;  2BB7 A;  4U70 A;  3CB5 A;  1W2M A;  2GG9 A;  4IEC A;  2OAZ A;  1R5G A; 
#chains in the Genus database with same CATH homology
 1A16 A;  3S6B A;  4A6W A;  4RZY A;  1R5H A;  4IF7 A;  4S00 A;  3FM3 A;  3CTZ A;  3PKE A;  2Q93 A;  5CLS A;  1BOA A;  2EA2 A;  1KP0 A;  4IPA A;  5CDL A;  2NQ7 A;  2GA2 A;  4RGZ 1;  1CHM A;  2GG7 A;  1C27 A;  1C21 A;  4JUQ A;  2EVM A;  1XGS A;  3D27 A;  4FUK A;  4U6Z A;  3MR1 A;  2V3Z A;  3PKB A;  1WL9 A;  2BN7 A;  2BWY A;  1PV9 A;  1XGM A;  2BHB A;  5CNX A;  3MAT A;  1WKM A;  4S2T P;  3PKD A;  3L24 A;  4IKT A;  2GU6 A;  2BH3 A;  2NQ6 A;  1B6A A;  5FCF A;  1R58 A;  1YVM A;  1JAW A;  3IU8 A;  4IDY A;  4PV4 A;  4U6C A;  2ZSG A;  3IG4 A;  1WN1 A;  3FMR A;  1C22 A;  4RZZ A;  5D6E A;  4OOK A;  2GG8 A;  4FLK A;  2B3L A;  2BWT A;  3BIT A;  1WLR A;  5FCH A;  4FLI A;  4S2R P;  4R60 A;  4ZWP A;  1O0X A;  1M35 A;  2P9A A;  4ZWO A;  5CDE A;  2GG2 A;  4S01 A;  1XNZ A;  3FMQ A;  3L7G A;  5JHU A;  4HXX A;  1QZY A;  1C23 A;  4IKR A;  2BWS A;  4EGE A;  4MAT A;  4QR8 A;  2Q92 A;  5D6F A;  3TAV A;  2GTX A;  4FLJ A;  4U6W A;  1XGN A;  2EVO A;  2DFI A;  2Q94 A;  1BN5 A;  2BWU A;  2Q95 A;  3IU7 A;  2V3Y A;  3IU9 A;  5CIK A;  1KQ0 A;  4U6E A;  4ZWU A;  2GGC A;  2BHA A;  4FLL A;  3Q6D A;  2Q8K A;  1MAT A;  2P99 A;  2OKN A;  5JFR A;  3PKC A;  2GU4 A;  2HOW A;  2P98 A;  1QXW A;  2IW2 A;  3BIQ A;  2V3X A;  3TB5 A;  4ZNG A;  1YW7 A;  1WY2 A;  1W7V A;  1B59 A;  2EVC A;  2Q96 A;  2BHD A;  2BWW A;  1Y1N A;  5CDV A;  2V6C A;  3MX6 A;  1YW8 A;  4IKU A;  5E5B A;  2BWX A;  5CE6 A;  3PKA A;  4KM3 A;  4IU6 A;  2GU7 A;  2MAT A;  4U76 A;  2B3K A;  4U75 A;  1WBQ A;  4FO7 A;  4U71 A;  4B28 A;  4Z7M A;  3CB6 A;  4IKS A;  4U69 A;  2GZ5 A;  5JI6 A;  1QXZ A;  2GU5 A;  4A6V A;  2GG3 A;  2BHC A;  1QXY A;  1XGO A;  1YW9 A;  4U6J A;  3RVA A;  4U1B A;  2GGB A;  4FKC A;  2GG0 A;  2EA4 A;  4PNC A;  1YJ3 A;  4U73 A;  2BWV A;  1WL6 A;  3BIP A;  4FO8 A;  3ROR A;  1C24 A;  1N51 A;  2GG5 A;  2ADU A;  2B3H A;  2G6P A;  1KQ9 A;  2BB7 A;  4U70 A;  3CB5 A;  1W2M A;  2GG9 A;  4IEC A;  2OAZ A;  1R5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...