4U6HB

Vaccinia l1/m12b9-fab complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
DVVMTQIPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWSLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHDPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
publication title Potent neutralization of vaccinia virus by divergent murine antibodies targeting a common site of vulnerability in l1 protein.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
total genus 50
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB01
4UILH 1SBBA 3CZJA 3QFJB 2QHRH 1IM3A 2HYMA 3BMWA 2X70A 4QXGH 1SBSH 4OF6A 1VACA 4R7NA 1ODAA 2C9AA 4LEXH 1BIIB 1X5FA 1LILA 5HDOA 1QFHA 3UTPE 4F2MB 2BNUA 4UIKH 1KCRH 5IHZB 4XPBL 1CWVA 5AUMB 5DJAB 4NKIH 3U30B 4Q2ZA 2FWOA 3VWJB 3K80A 2WBJD 1ZGLA 5E99H 4QY8B 1QFWH 4PUBH 1XF5A 4LPXA 4JJ5A 1X5LA 1ETZA 2OXGA 3A67L 1U91B 5BZWA 5C0RL 1XT5A 3IRZA 3MA7A 4RGMB 4Z0BH 1CICB 3VGAC 4OM1L 4KKAC 3WDJA 2DKUA 1BQHG 1SJXA 2FJHB 1JHLH 3WV0A 2VXQH 3QCTL 5C07E 3CLFL 3CFKB 4NOFA 5D1ZA 5GS0L 3TO2A 2AJZB 3KPRB 5L2JB 1GYAA 1BFOB 4UZGA 5BOPA 4PS4H 3ET9F 1JNLL 2DL9A 3NAAH 4PJHB 4R4NC 5DC9B 4WHDA 3IFPB 1HN1A 2GCYA 3QQNA 3SKJL 4F8TA 4M7LH 3EJZC 5ESQA 2G5BB 1P4BL 2JJSA 2FL5B 4PY8I 5CEZD 5M94B 3LN4B 3GIVA 2APXA 3OR7B 3VXMB 1KIPA 3VCLA 5SWQB 3RUGA 4WTWA 2VAJA 3UDWC 1P7QB 4WHCA 3L6FA 5FDWB 4JFEB 3GMQA 4CJ0A 1ZLUH 1WQVT 5ALCL 4ZUWB 2F54B 3S35H 4I3SL 5IMKA 2R2HA 3NIDF 1T22B 5CJOH 1T4KA 4X7DC 4C55A 5T3ZE 1OARL 1MQKL 4XNXH 3S34L 2BSTA 4GAYB 4MJIE 4Q9QL 1QYGL 2VQ1A 3O6FA 5B38G 3HE6D 1OAUH 5DUBA 5C92A 1RI8A 5KN5B 3GKZA 1DZBA 4U1IA 4B41A 3AREB 3VFRB 3PDOB 4OTXH 4MDJB 3U0TA 3GSNL 3OR6B 1AHWB 1NSNH 4I13B 1S7WA 5HI4C 2VXSH 3LEYH 2VUOA 4G8GD 3RGHA 1G7LA 4N0YH 3SGJC 4AZ8A 3FONB 3P9LB 5INCB 2XT1B 3LV3B 1KNOB 3MJ9L 5AYQA 3VD4A 1CZ8H 3GHBL 1F3JA 1GGCH 3SGDH 1A1NB 4X8JA 1I75A 2WIMA 3MGTB 1NDMB 3W5MA 3OWEA 5J9PB 1KCSH 1P5VA 4GRMA 2AJVL 4HH9A 4KI5F 5ICXB 4IIQC 3MXWH 4MD0B 4ZTPH 4WHTB 1J05A 5C08A 4GG6F 5L7XH 3HG1B 4YHPA 1JZ6A 3MRLA 4JN2A 2CDEB 1XCTB 3HZMA 1ZLSL 1MCDA 5E4EC 1LP9A 3CXHJ 3CIQA 4KGJA 5FA4B 3S37H 1NGQL 3PWLA 5FO9A 2PXYC 3RPKA 1SYSB 4XVJL 1A7OL 2XG5A 4LRIA 3ARVA 1KJ3H 4ZSOE 3VXNA 1A3LH 3P30H 2JELH 4YLQT 1ZVHA 3M1BA 2DN7A 1QACA 2DM3A 1YEDB 1T03L 4PJ9B 3FQXA 1OAZL 4F33A 3BP7B 5I1KL 1BOGA 1Y0LB 5JIHA 1OCWL 3ULVF 5EU7C 2A6DA 3BKMH 1XGTA 4WHYG 1LEIA 4M3KB 4HJGA 4JPWH 1LD9B 1BFTA 4XWGH 2PO6D 4IRSD 4AL8L 4HV8B 2FJFB 3NABL 3IFLL 3QHFL 2X4UA 1FRGL 4X4XA 4LKCA 2F53D 5CGYC 4AY0A 1OD9A 1T1YB 1PW3A 4LLQB 3ZDXF 5FYJE 4OI8A 1YEJL 4MZ3A 2CMRH 3V52H 1IM3B 4H26A 1AJ7L 1GSMA 3WXWH 4G6AC 2X70B 3SDYH 3LRSA 3FRPA 4DCQA 2J12B 1FYTE 1VACB 4R7NB 4NQCA 2EE2A 4U1GB 4LF3A 4NN6C 3ZSSA 1XIWD 3RKPA 5BW7A 4QGYA 5HYQB 2BNUB 4OLZL 5TGBB 1MWAL 3HB3D 3VFOA 2Q7YA 3BSZL 1KPVA 2OTWB 1G6RA 3Q1SL 4Q2ZB 2FWOB 1ZGLB 1JN6A 1T0MA 4PREA 3BT2L 2C3VA 3ZTJG 1XF5B 1IKNA 2PTVA 1DVFC 4WFHD 5BQ7B 1ETZB 1K6QH 3W2DH 4HX1A 1RUQH 4YHML 3QZWA 5BZWB 3C09B 3K0WA 3MA7B 3FL7A 1QNZL 3VFNA 3QDJD 4XNMA 2QL1A 4FQ1H 5SX5K 2KQMA 3MUY1 1O5DT 4XP5H 3HMWH 5DJYA 2FX8L 1NBYA 3VWKD 5F6IC 4L3CA 5D1ZB 4K55A 3TO2B 5EOCJ 5E70A 1EEZA 3P0VL 5F7DA 5F96L 5ILTL 2QR0A 3OJ2C 2MSPA 2XKNA 1BBDH 2GCYB 5ESQB 3RIFF 1G1YA 3IJSA 3GIVB 4JE4B 1X5AA 1KIPB 2E5EA 2XWJA 1FNFA 5C0CE 4ZNCD 3VCLB 1CFSA 3RUGB 1DBML 5B3NA 3L6FB 4YDLB 3GMQB 5IVOA 1FH5L 4C58B 4KPHL 3WHXA 2K7QA 2QADD 4TSAL 1AQKL 1T4KB 4LSTH 1IQWL 2BSTB 2Y5EA 3MODH 3EYSL 3OPZL 3IXAA 4MB4A 5FA3A 1A7QH 2VQ1B 3O6FB 3TFKC 3F12A 2UY6A 5DUBB 2BNQA 4MHHG 2YPLE 3WFZA 4U1IB 3T3PF 4K8RL 1V3LA 1Z0NA 2ZUYA 1R3IL 4L4TE 1WWAX 1ZHKA 4OJFL 3ES6A 4PJ7F 3U0TB 3D9AH 2CXGA 1JGVL 3SJVE 1S7WB 2X10A 4M1GH 5CZKA 5MI0B 1KBGL 5HD8C 2XWTA 4Z7WA 5T1LD 1IM9D 1G7LB 1JTPA 5F6HI 2YUWA 3DVNA 1P7HL 1HXYA 3ZE1E 1RQ5A 3RY6C 1U58A 1F3JB 4KU1A 5HDLA 4QOKE 4X8JB 3EO9L 1RSFA 5I71C 2YHGA 5HVFB 2UWEF 5HTSA 1OGTA 2ZNWA 4FS0A 2HA1A 1FCGA 2ORBH 5D7SL 1H3VA 3B9AA 1PFCA 2WV3A 3OAUH 4PD4J 4GRMB 4HH9B 2MCG1 2BNRA 3LVEA 3TVMA 3SE9L 5JHDE 1F13A 1J05B 5C08B 2OCFD 4FNLL 5GS2D 4GO6B 3ZHDA 1UXWA 4YHPB 1CDBA 5E08L 4POYA 4PJCE 1JPFA 3MRLB 4CN1A 4JN2B 1VB9A 2AXHA 3TO4D 3HZMB 3BD3A 4PJAA 4QO1A 4ETQA 1H3TA 4FN0A 3T65A 1LP9B 2BXZA 5C09E 2WLYA 3ZMRA 4J8RA 4HGMA 3E2HC 4NJ9L 4DUVA 2Y4SA 1V05A 1TJHL 3BKYL 2WUCL 3PDGA 1IZKA 3BOVA 3VXNB 3M1BB 1CFTA 5D72H 5L88L 1U8JB 4KHTH 2C7UA 3FQXB 4YX2H 4F33B 3A6BL 1BOGB 3M17A 3MFGB 4Q6IA 2X4SA 3JWNC 3O4OB 2A6DB 1XGTB 1LEIB 3GRWA 4EOWH 4HJGB 5KVEL 5LXGL 3L9RA 3RU8H 4LCWE 4JRYD 1INQA 3SCMA 2ZG2A 2ZP0T 2QSCL 4KKNA 1QFWM 2W9LA 2GK2A 2EXWC 2X4UB 1LO0H 1F90H 1QA9A 4X4XB 4LKCB 5BS0A 1T89C 1CLZL 3MRCA 1PKQE 3DTXA 5FGCE 3NIFE 1IGFH 5ECJE 4G6MH 4H26B 3MOAL 1U3HC 1U8NA 5CUSH 5LBSL 3LRSB 4DCQB 4NQCB 3RTQD 3M45A 4RBPK 4LF3B 3Q6GH 1X5IA 2IBZX 5GGSA 2P8LA 5AWNH 1FZKB 2EKSA 5E1HB 2IALA 3CX5J 5DO2D 1YQ2A 3VFOB 3KLHC 2ICWJ 1KPVB 1G6RB 3P73A 3W39A 1JN6B 1T0MB 4PREB 3EOTH 2C3VB 3FO1A 1I1FA 5IHUH 4HX1B 3QZWB 3STZA 4KY1L 1OGAD 3VD5A 4KK5C 3F58H 3VFNB 1IE5A 4PBWD 5DQ9A 4XNMB 3U9PH 3B5TA 3IFOA 5DJYB 1NBYB 2AERT 4L3CB 3HAEA 4PIRF 4J6RH 3SEPA 3ABZA 1F2QA 1EEZB 4UTBH 5F7DB 4KK6D 1PSKL 2QR0B 2XTLA 3G08B 1HCVA 1FAKT 1HZHL 2XKNB 4M3JA 4XP6H 4TTDD 4K3JL 2YR3A 4BSWA 3IJSB 2DQFA 2DTSA 2H45A 4PGZA 2XWJB 3BZDA 3L5XL 2OJZH 3BE1L 1CFSB 2P43B 4GXVL 2ZSWA 5C09A 1F42A 3IDMA 1VGEL 1NGYA 2EKJA 3BHBA 3OJVC 3LN9A 3VXRE 3WHXB 1EERB 2DIAA 2EDHA 4FQ2H 1G7IA 1JWMA 2VR9A 4AEEA 1BZQK 5I6XC 5FA3B 5K93A 3IXAB 3F12B 2BNQB 1DQMH 4NQEE 5F97E 3W11C 3WFCH 3MROA 3AMLA 3QB7C 3KXFA 1ZHKB 4WUUD 3ES6B 2I5YL 4I5BA 5JW3H 2GUOB 2VYRE 2NY3B 4LDLB 2JCCE 2FX9L 2XWTB 4Z7WB 4GG6A 4Z7VE 2DLTA 4FTVE 1IMHC 1HXYB 1O7VA 4NWTL 4XWOD 3IDGA 1DLFL 1PKQA 3LHPH 4V1DD 3PIQA 3N06B 1U58B 3QXUA 1AE6L 2QHRL 3GMLB 4LCIH 4QXGL 1OGTB 1SBSL 4M1DH 5JXED 1A64A 3KPTA 3AY4C 1JF6A 4ZO8A 4FQIH 6CGTA 1G0DA 2ZZUT 2GTZA 1F4WH 2BNRB 3D6GA 2H32H 5AZ2L 5T3XH 1UXWB 1KCVL 1JPFB 4LPUA 1ZHLA 3K74B 4NKIL 5EB9A 3TJEL 4PJAB 2DQCL 5DUML 2YKLH 4L3EE 4ETQB 2EH8L 3T65B 2R0WH 4ZS7H 3KLSA 3VE0A 4U6VH 4J8RB 3THML 1B3JA 1FO0H 4LASL 1ORSA 3QIUA 3REVA 2V7HA 4X9FA 4M48H 1CFTB 5HHOE 4M7ZB 3KYKH 2C7UB 3CC5A 3H3KA 1OOAA 5F7EL 1J0IA 5I15L 2X4RA 1IGMH 4S1DD 3M17B 1YNLL 4Q6IB 3W0WA 2X4SB 4WI5A 3HZKA 1NMAH 1F4XH 3L9RB 2FX7H 2P46B 3P4LA 1INQB 3SCMB 3LKSA 4BQ9A 4M7LL 4E0RA 1QR1A 1QOKA 1QA9B 1HSAA 5D7JA 4OFYD 3HR5A 4P46A 1DJSA 4F9LA 1OB1A 5BS0B 5DVLA 1WITA 2EDNA 3MRCB 4YWGH 3DTXB 4HBQA 5EA0L 4ELMF 2ZUQC 4O5LH 5C9JA 3IU4L 3H9SD 4HMCA 1U8NB 1KGCD 4HDIA 3FT2A 4OIBA 5E2TL 1NMCB 1L4IA 3FAXA 3CSPA 5GGSB 2P8LB 4HUWA 4NQEA 1H5BC 1OAUL 4NCC1 2EKSB 1PDKA 7FABH 2IALB 3VMPA 1KPRA 5BV7L 4OGXH 4OTXL 2CO7B 3VD3A 1J0JA 3E8UL 5T33H 4U49A 3P73B 1DDHB 2N56A 4KVNH 4NC1E 3RVTC 4OD1L 3LEYL 3X3GH 1JPSH 3FO1B 2IG2L 1I1FB 3VGDA 1UB5A 5HHPA 3O41A 4B7LA 1F11A 3STZB 3DV6A 3I85A 5FXCH 2XQBH 3KG5A 3C8DA 1QPPA 1T21A 5DQ9B 3IFOB 1YEFH 3WKML 5A2KH 4PB9H 1GC1H 1KXQE 5EU4A 4FXKA 3HAEB 3PGDA 4L8DA 4HCRL 1HKFA 1MWAA 2F8XC 3MXWL 1AXIB 1AC6A 5EU3A 3VXSA 5CD5D 1WZMA 1CGWA 5IEKA 5E7FA 4H8WL 4PJ7A 4BSWB 5D1QD 1L7TH 5D6DA 3NZ8A 3DHJA 3FMGL 1J18A 2DQFB 2L4OA 1T83C 3DBXA 4P3WA 5C09B 2ZSWB 1SEQH 3IDMB 5IK3A 1NGYB 4AT6A 3S36L 1U3YA 3BHBB 4Y5VA 1G7IB 5MHSD 1JWMB 4J7RA 2VUYA 3RHWK 3P30L 2D2OA 4HSQA 2BRRH 4EI5A 1S5HA 1N7ML 4LPCA 4PBXA 5F89A 3ULUD 1JV5A 2UWEA 5JMRA 3MROB 4PRHA 3KXFB 3BKML 4I5BB 4K71B 4IOIA 1IC5H 2FZ3A 4J3VA 1NCAL 2EDWA 4JZOA 1DUYA 4GG6B 3L5WA 1YN6A 3BMVA 2YA2A 3X13A 4QTHA 4DKEH 4CDHA 3IDGB 5H8DA 3KJ4B 4LVHC 3PIQB 1DBAH 5DI8A 5J6HA 4PJXE 5T1MA 1I8LA 1KTRL 5HPMA 2PO6C 5SWZE 4IRSC 2FHCA 4F7TA 1ACYH 1SJEA 2EEBA 3DNKA 3ZSTA 4ZXBD 3A6OA 2GTZB 1EGJL 2LU4A 5GGTH 4DGVL 1YJDL 1D9KD 1A6WH 1B88A 1BFVH 3WIIH 2BP3A 2DLIA 2LV4A 4KJWD 1ZHLB 6FABL 1EFQA 1BD2A 1HK6A 3GSRB 1LVEA 2VB5A 5E9DD 2GHWB 1WLHA 1XIWC 2AGJL 3VE0B 3SBWA 2VH5L 3HC4H 2NW3A 1RUQL 5C0BD 1OSPH 4I0KA 3BQUC 1UQSA 1ORSB 3MBXH 3QIUB 4OF3A 4UI2A 3HB3C 5EUOE 3CVHH 5GHWL 1EFXA 3REVB 1I8IA 4LK4A 1CFNA 3BJ91 3HMWL 3P4MA 2X4RB 5IBLC 4NNPH 4HUMB 4Y7MA 4PV9A 2DQTH 5E6ZA 4JG0L 4M7KH 3W0WB 3WO3B 4WGWB 3HZKB 2XA3A 3RIAF 2RAMA 2R4RL 4M43L 1CGTA 4YNYA 3NFNA 1PZ5B 4HH8A 3LKSB 5D7LA 4Y5XA 2EO1A 4LSPH 4E0RB 4IS6A 5DTFA 1QR1B 1QFWI 1HSAB 1DQQA 5D7JB 4PYHA 3HR5B 4P46B 3VFSA 1OB1B 3VWKC 3KPSA 4TNWK 1SEBA 1NBZA 5DEZA 2ICWI 5C9JB 5EORH 5D5ME 3ARQA 4HDIB 3FT2B 5HYJA 1HHIA 3I2CH 4P23A 3T2NL 3UBXI 1S9WA 1TQBC 3UTPD 4NZUH 4HUWB 4TPRL 2ZCLH 1A7QL 3GM8A 4RA3A 2WNGA 4N0RA 4S1SL 2BSSA 3LD8B 1PG7W 5I8OL 2IANA 3STLA 2VXUH 1LO3H 4WEMB 4ENED 1NCCH 5DMIH 1WGOA 3OB8A 4FG6D 5IWLA 5IB5A 1HNGA 3P11L 3QJFA 2NX5E 2QADC 1ONQA 4UB0H 5DVOA 2O5XH 4RFNC 1UB5B 2DJ4A 5HHPB 3O41B 4LNRA 3O6KL 1F11B 3DV6B 1QUNA 1MCSA 2NXZD 1A7PL 2R4SL 5C07D 4C56E 1T21B 4XPFH 5D93B 2A9NH 5FYKU 2VJXA 4Z7NE 5EU4B 4FXKB 2N4IA 2A73A 3PGDB 4Y5YC 1MWAB 3TEUA 3OGOE 5EU3B 3VXSB 2DQGH 4PGBA 4K94H 5IEKB 1EHNA 4PRBB 2JJWA 1YECL 2BY3A 4PJ7B 4UOW0 5ELIA 5KVMC 3NZ8B 2EIBA 4X7TA 4HK3J 2VO5A 4U7KA 3HFMH 3DBXB 5IMOB 2BHYA 1JRHL 1R5VA 5IK3B 2Y06L 3GI9H 5FOJA 4AT6B 5T3ZD 4E9LA 4BUGA 4DVBA 4LVEA 3ARYA 4MJID 4Y5VB 4JHBA 2HRPH 1VHPA 1FHGA 4GMTH 2C1OB 3EYOA 4NO3A 5HHMB 2DBLH 3TO4C 4EI5B 1S5HB 3TZVA 1MAJA 5F89B 4OSUH 4DN4H 1JV5B 2UWEB 3VFPA 3EFDL 5DZLA 4L4JA 1TTGA 4AK1A 4PRHB 3QDME 2FH6A 5J89A 5A43C 4O2EA 3I9GL 4WNQA 2ESVE 35C8L 4WFEE 4IOIB 4APQC 5HVHB 2FZ3B 4GBXD 3RI5K 1KT2A 3B9KC 3FN0L 1A3RL 4JZOB 1DUYB 1DSFL 4UQ2A 1N59A 3D1MC 3DURA 3L5WB 4YE4L 1YN6B 1LO0L 3X13B 4QTHB 3DX9A 3OJMB 1W72H 4TUKL 2W92A 2XICA 5BCAA 2DRUA 4G3YH 3MRKA 5DI8B 5J6HB 1DQLL 1IGFL 5T1MB 5FF6A 4EQ2A 4JFYA 3O9WD 4HC1L 1GZQA 5HPMB 4HF5H 3A6CL 5EWIH 1CFVL 2R0ZL 5I8CA 4F7TB 1SJEB 4XPAL 2UVEA 5AWNL 5H94A 4OKDA 4MQTB 5J11C 4WY7L 3KHQA 3VI4F 5JHLL 3MLRL 4G6FB 4ZDHA 2MQCA 3TV3H 4LLYA 4UBDD 1BD2B 4TVPH 5FHBL 1LQSR 3UROR 2NW3B 5J3HC 3BH9A 4OIIH 5DO2C 1UQSB 3OQ3B 3F58L 3PQYE 3ARBA 5AG9A 1CFNB 4ELMA 1RIVH 4JVPA 2FBJH 3CSBA 4EDWH 5L6YH 4J23A 3N1PC 1WWCA 2GAZA 3M07A 4HW6A 2JKXA 4PV9B 1MH5A 1J12A 1D5MA 1AFVL 2Y5TA 4OLWL 4BYHA 2BC4A 4YNYB 1U2CA 3NFNB 5ID0A 4RCAA 5D7LB 4Y5XB 4KDTC 5DEFA 4IS6B 5DTFB 1Z9MA 1Q9WA 1UKQA 3FT4A 5FYJD 1C5BH 1DQQB 3VFSB 4Y4FA 1KCKA 4KDWA 5DVNA 5IBUG 3CFBA 3KPSB 1SEBB 1NBZB 4GKSA 4HWBH 3U1SL 4XB8A 3ZYOA 1YNKL 3IVKA 1FYTD 1RVFL 1XGYH 3NOIA 4CADA 5HYJB 4HT1H 1HHIB 2XYCA 4P23B 4WENB 4G7YL 1SM3H 4LP4A 1JUFA 1S9WB 2KH2B 2BJML 3H9HA 4TTDC 3TT1L 4CW1A 3TVMD 5FV1L 2DF3A 3QI9A 2BSSB 4MAYD 1BP3B 4KUCF 5F9JA 3AS1A 2IANB 3BDBA 3STLB 4G9DA 4FQLL 1RHHA 1ZT1A 1YN7A 3ZKSD 3O3UN 3QDAA 5IB5B 3QJFB 1CBVL 3T8XA 1ONQB 4U1MA 4HFUH 1BM3H 4PJBF 2EDKA 2NZ9C 1UACL 4LNRB 4OV5A 1E4JA 2HJFA 5IMLA 4XI5D 1EBAA 3QXVA 3FOMA 3H9YA 5GRZA 4N9OB 1VEOA 3ZT7A 1A3QA 3U30C 2VXTL 4EUPA 3VWJC 3G9AB 1HIML 1D5XA 1ITBB 4JRXA 3IKCA 2EE9A 1F6AA 4HQQL 2A73B 4XPTL 4XWOC 4RGMC 4IRJA 4B53A 2R15A 1MCWW 5FECA 1PX3A 2M2DA 4WW2F 4PGBB 4JPVH 5F1IA 4BELD 5C2UB 4GKZA 2NNAA 4NPYA 1UEMA 3B3IA 5C0CD 2AJUL 4X7TB 3WFBH 1U93A 3QEGL 2R0WL 1R5VB 5KVFL 5ITBH 1HHHA 1DBJH 2JF1A 2VTFA 5DLMH 2DDQL 2W38A 4WFGE 2YPLD 4M48L 3EYOB 4NO3B 4RX4D 4M5ZL 4L4TD 4HCRA 3TZVB 1NDGA 3VFPB 1J9CT 1K8DA 2V9QA 1BAFH 2AABL 4H1LH 2QSVA 3SJVD 3WFDL 1B4RA 1NMAL 4O2EB 2D7OA 5JDSA 1KT2B 4LKXA 3UTQA 2VDPH 4TOYL 3S97C 3RVUD 4K9EC 4UQ2B 1EX0A 2XPGB 3DURB 5LJYH 4K7PX 2ERJC 3DX9B 3AREC 4LHUA 4QOKD 4AH2A 3Q2CA 3MRKB 4OLVL 5FF6B 3GSQB 4JFYB 1ZEAL 2EXYD 5IOPA 3UJIH 3IDIA 4W68A 4J4PA 5I8CB 4OZIE 5JHDD 2OTUA 1RUPL 4KMLB 5H94B 4UQ3A 4CU7A 2Q8AH 4U1KA 1XGRA 1X6LA 3K7UA 1NGPH 1U6AH 3IFNL 1HQRA 2X1QA 5TQ2L 3GBMH 4ZDHB 5T33L 4X4YA 1CE1L 2CQVA 4KVNL 3KPLA 4GUPA 4LLYB 1A0QH 3OX8A 5B21A 2OI9C 3FAWA 3BP6A 4DTGH 2WP3O 2CD0A 1LO4L 3OJDA 3OB0K 2E7LC 3BH9B 3NTCH 3T4YA 3U4BH 2PUQT 1IT9L 4YUEL 3CXHK 3GMPA 3TBSA 3ARBB 4ELMB 3TCLA 2B1AL 5E6IA 2GAZB 1EGJA 1GC1L 4M6MH 3P77A 3WSQH 4U1JA 5A2FA 1MH5B 1QO3A 3MJGX 1D5MB 2Y5TB 4LCWD 2BC4B 5GGRA 3HC3L 4KK8D 4DOHB 5ID0B 2AP2A 5E2WH 2F19H 1FQ9C 5DEFB 4PJ9C 3FT4B 3GM0A 1Q9WB 1U8QA 3FO2A 2WBWB 2QLVB 2GT9A 4Y4FB 4L3AA 3VFWA 1N6VA 4NHUA 2Y23A 5FYKH 4GKSB 2VDNL 4RGNE 2WUBH 3ZKND 2R29L 3K8KA 1FLRH 4NHCL 3IVKB 1XAUA 1MCEA 3NCCB 4JO1L 4CADB 4YQXL 2YSSA 2YRLA 5CD5C 1TETL 3QXWA 1FBIL 1JUFB 3H9HB 4KK9D 2MJWA 4CW1B 4NN7B 3G6JF 3QI9B 1CDYA 3MBED 2YPVL 2DQHH 5F9JB 1KYOJ 4G9DB 1RHHB 1ZT1B 1YN7B 4JHAL 3VXPA 3DUHA 4U1GC 4XXCA 3GJFK 1IC5L 5SV4A 1INDH 3GBNH 4OCLC 3EUUA 3T8XB 3RZCD 4U1MB 5CJXA 5K9KA 4OV5B 2BY0A 2HJFB 3ULUC 2YD4A 1CDIA 3SQOH 1DBAL 1A02N 3FOMB 5C7XL 3JXAA 4PGJA 4MVBD 4LSRL 1UZ6F 4XZUA 1D5XB 4JDTL 5I1EL 4JRXB 3IKCB 1BVZA 1F6AB 4JFZL 3T1FA 5FM4A 5BV7B 4PRDA 2YEZA 3R1GL 3C09C 4IRJB 4JGUA 5KAQF 1OTUD 3WIIL 5FECB 5F1IB 2MCPL 2GTWA 3CMOL 4GKZB 2NNAB 1N0LA 4NPYB 1MCOH 2NW2A 4WCYH 3B3IB 2VDKL 3FRUA 2GIYA 2OXHA 1A5FH 4ZO9A 1U93B 3VXRD 3ILQC 1CXEA 3UTSA 4OQ1A 3HC4L 4P4KD 1MFNA 1HHHB 3WNLA 2IFGA 2ADGA 4RWYH 2QEJA 2VE6A 3N0PB 5DJ2A 4NQED 5SWSE 4IJ3B 2JJSC 4KXZH 5KVGH 2XTJE 4DVRH 1QFUH 3IF1A 1WTGT 2G2RA 1NDGB 1MFEL 1T0PB 3MRDA 3WUWA 1K8DB 1Q1JL 3L1OH 4LMQI 5CCKH 5JOEA 1R3LA 4PFEA 4XH2A 4Y1AE 2G75A 5JDSB 5ACZA 4FTVD 1TFHA 4LKXB 3UTQB 1JBJA 3O6FC 1UH4A 1FNSL 3PGFH 5EBWA 5TE4H 1ZHBA 3RL2B 4ONHA 4LHUB 1A6UL 1FVEA 4AH2B 4F37F 3PWVA 5BRZE 1GHFL 3IDIB 4PRPA 5MI0C 3ZTNL 1ACZA 3TLRA 2CPCA 4XCFH 1ZLVH 5TDOA 1I7TA 4NZUL 1YEKH 2OTUB 4TULL 4DK6A 1J5OL 1V7MH 4UQ3B 5JR1L 3KYMA 3GHEH 4U1KB 2VLKA 2V5TA 2VXUL 1XGRB 1NCCL 3VMOA 4ODTH 2ZWLT 5E2UH 1HQRB 4Q0XH 3WFEH 4X4YB 3CU1A 4L3ED 3HNVH 3KPLB 4GUPB 1DBBH 4QWWC 3OX8B 3SDAA 5AYUL 3BP6B 1FVCA 12E8L 4Y2DA 1YEHL 1UM5L 3OJDB 5HGHA 4HC1A 4CVZA 3T4YB 5HHOD 3GMPB 1K3ZA 1JF5A 3TCLB 4FG6C 5E6IB 1P2CA 1XFPA 3QEUB 5EU6E 4ZAKA 4OGAD 2FLBT 3P77B 2MKLC 4U1JB 5ITFA 2EDRA 1QO3B 4HKZA 4LMQE 5GGRB 5T3XE 1EHXA 4P2QA 4LLMA 5ALBH 2J7LA 2ICEA 4K94L 4P9HC 5FUCE 4YHZL 3OKOA 1U8QB 3FO2B 3QUML 1AC0A 1F4AA 2R0LL 1N26A 1GAFH 3QISA 5T5FL 2PYFA 3VFWB 2Z8RA 4NHUB 3PWJA 1EBPA 3ZO0A 1MELA 4MNGA 4Y0GA 3GI9L 4PJBA 1RZIA 2YSSB 4XXDA 2A6KA 3TH3T 5C6TH 4K8RD 3MV8E 3NN8A 1AKJA 4PGCA 1NCDL 4GFTB 4TNVF 4NQDA 1X44A 1FNGA 2HH0L 2VZ1A 3I6GA 1NBVL 5E56A 2Y1VA 1KTLA 3MZTA 3CX5K 1VESA 1WEJH 4WW2A 4AJ0A 1EHLH 4LARH 5K9KB 3NVQA 2XY1A 3MV9E 3BN9D 3DXAE 1EFXD 2ZCKH 1ZWIA 4I77L 4NQSA 4XZUB 1ES0A 1IVLA 2YK1H 4O58H 2F74A 5DHVH 2CJUH 3FN3A 3AFLA 1CD8A 3T1FB 2QQNH 4PRDB 3V9FA 2YEZB 1GCFA 5DD5L 1BLNA 1NLBH 3KNBA 4ZO6A 3EYQD 4EBQH 5FGRA 3Q6FA 2W9EL 5K59E 3OZ9L 1V3JA 4ZUTA 4F58L 4M93B 5DGQA 1OTTD 3O9WC 5J57B 3PNWA 2HT4D 1AD0A 3FRUB 4HXAH 1OP5K 3ZDZF 4TVPL 4N8CL 4X6BA 2EECA 1BJ8A 1RZFL 4LNVA 1ZLUK 3UTSB 1A4KA 4FZ8H 5F88A 2IQ9L 1T66D 3BKCH 3MV7E 2ADGB 4PG2A 4OIIL 4XNQA 1AGFA 2VE6B 5DJ2B 1EZVY 3FZUD 1PG7L 3SKUD 3IF1B 5L6YL 2G2RB 2G9HA 3C2AH 1RUMH 4HIEA 4NUGL 4UBDC 3FO0H 5IUSA 5IT2L 3TC9A 3MRDB 3OAYH 4KMTH 4NYLA 3WUWB 2COQA 2DIBA 4M9PA 4YDIL 4EUPG 2NY1B 1KJ2A 4Z18A 4HKJB 4BSJA 4MAUH 4WHYH 1WWBX 3KLAA 1A22B 1R3LB 4QLRA 4XH2B 2G75B 5ACZB 2FCBA 5KSAA 1B90A 5F9OH 4R3SA 5EBWB 1ZHBB 4FQQA 4ONHB 5EC2A 3FQWA 1FVEB 5F8QC 3RWFA 1JPTL 3PWVB 4HWBL 5SWZD 1LO2H 1J0YA 3VH8A 4MA8L 4PRPB 1MCJA 3WO4C 5AD0A 4J2XA 8CGTA 5HI5D 5CZXD 2H6PA 4OCRH 4KGLA 2DI9A 5TDOB 2FGZA 1I7TB 2D7TH 4M4RA 5JPNA 1UJTA 4GRWH 2DQJL 3QRGH 4Y4HA 3KYMB 2VLKB 1FFOA 1QSEE 5FFLA 1I1AA 1OPGH 4NQVA 1OT2A 1YYLH 1V3KA 4U7SA 3BZ4A 3DVFA 3SDAB 4K3GA 1FVCB 5CLTA 3WD5H 3ZTJH 4Y2DB 3TVMC 5TPWL 2CO6B 5HGHB 5AZEH 3S8WA 4MAYC 2HLAA 1J88A 1OD7A 1JMZA 1K3IA 3L3JA 4H88L 1J1XL 1JGLL 4NKDA 1P2CB 4HPOL 3RA7H 1JWSA 3VGEA 3KAAA 2FECI 5ITFB 4HKZB 3DJ9A 4IDJH 2J3SA 4QNPE 5H37G 3G6JA 2OZ4H 2OMBA 2K1MA 4XI5C 4P2QB 4LLMB 3IU3A 2ICEB 1S7TA 3CK0H 2BK8A 5A2LH 5ANME 4M7ZC 5HHXL 2UZYB 2YD1A 3OKOB 2E6QA 3JV5A 4Q6IC 2PYFB 1CYGA 3PWJB 4M7JL 3WFBL 3KR3L 3PL6D 5C71A 25C8H 3INUH 1MEXL 4MNGB 5ITBL 1ADQH 3BO8A 4PJBB 3SCMC 4JN1L 1RZIB 2Z0BA 3B6SA 4XXDB 2A6KB 4KQ4L 3KYNA 3NN8B 1AKJB 3OAZH 4PGCB 3V2AR 4WI2A 5EDXA 4NQDB 5FCUL 1FNGB 3I6GB 3C5ZD 1BAFL 2YN5A 5INDA 2Q6WB 1D3CA 4Q9RL 2NX5D 3BDYL 1WISA 1KTLB 2Y36L 3O11A 3U7WH 4JQVA 2HFFA 4WW2B 3D39E 3P0YH 2VLRE 1R3JA 1ULVA 4C56D 4XP9H 3QXAA 3TN0A 1ZWIB 4P9ML 5M95B 4NQSB 3EJJX 1ES0B 4KQ3L 1N4XL 2F74B 1M4KA 5D2NA 5KANG 3RVUC 2KZ1B 2JJUA 2ED9A 3TA3D 3DMMD 2XN9E 5T1DL 4U1NA 5KSUA 2AS5M 1BLNB 3R8BB 3OKLA 4XX1E 2G60L 4A6YL 5JW4M 2X1OA 1QSEA 3KNBB 3O0RH 4NQXA 2QSTA 1G84A 3VI3F 4KFZC 3Q6FB 1SY6L 2YPKA 2XXCB 4YZFE 1LEKA 3PNWB 2YXFA 4K9EH 1AD0B 4ZO7A 1WT5C 4YXHL 2FEEI 2EYSA 1CXKA 2A2QT 3LS5H 4XNYH 4X6BB 5LKNA 1U2HA 1A4KB 5F88B 4LCUA 2W1NA 2Z93A 3NTCL 4XNQB 1AGFB 1DCLA 5C0AE 2PYEE 2FGWL 5CGTA 2BHUA 1NC2D 3HNSL 2G9HB 4HIEB 3QDMD 2P4AB 4NYLB 1CXHA 4M6ML 2ESVD 1KJ2B 5EOTA 5CLWA 3KLAB 4LLWA 4G9FE 1IC1A 1UB6A 2FO1A 5KSAB 2EEDA 2F19L 5GS0C 2CLVA 4R3SB 4GXUN 4FQQB 5EC2B 1DQJB 3FQWB 1NBQA 3HA0A 3RWFB 1P9MA 1X5XA 4OCYL 4ZS6C 3LZFH 1FLRL 3I50H 1NFDE 1S3KH 3VH8B 4OLXH 2NZIA 1A14H 3N1GC 4KK8C 1S7RB 4Z95H 4KMQA 5AD0B 3VRLE 4IOFD 3B43A 2H6PB 3UTOA 5LCVH 4KRLB 4FMKA 4E41E 4JFDE 2D4FA 5JPNB 2A83A 2DQHL 3D69A 4Y4HB 1KELH 1FFOB 2ED8A 4NNYA 5E4IA 1QSFA 1I1AB 2Z31A 5DD0H 4NQVB 3WUWG 1INDL 5J56B 2YD6A 4QRPA 4L4VA 4R7DA 2DJSA 2YBRA 3LH2H 1NGZB 3MBEC 3HE7D 3PQYD 4DWHA 2KZWA 2HLAB 1UWXK 3RY4A 3H2WA 3L3JB 4NKDB 4BFIA 1FNLA 4JHWL 3T0VA 5I1GH 5A2IH 3QUYA 3PWPA 5FCSH 4OLYL 3SDDA 2CGRL 3BKJH 1OM3L 4NZTL 5I74C 5KG9A 1FAIL 1AI1H 5EO0A 2PETA 4KAQH 3QIUC 3G6JB 5I8EA 1OW0A 3IU3B 3RZWA 1S7TB 3CDGA 3RAJL 5K33A 4P5TA 4YBLB 4MVBC 3UYRL 3L95A 2D4DA 4TVPE 4WCYL 3X11A 2AEQL 4WEBH 2VZTA 4I2XE 1UT9A 5CJQH 1AY1L 3UZEA 4HXBH 4I0PD 2R8SL 3ULUH 5L9DH 4Y8AA 4U1SA 5GJSL 3BO8B 4PJIF 4KH2A 2OSLA 3B6SB 4RWYL 5C0AA 3BPOC 3CAFA 3N85H 1PVHA 1EAPA 3KYNB 2ZCHH 5D7JC 1UKTA 1HILA 4P46C 4F9LC 3C6LA 1HHGA 3QG6A 2CLRA 2FNBA 5D1XD 5DK0A 4M6NL 3DUUA 2UY7A 5INDB 4WV1A 4OBRA 4P4KC 4YK4C 1RZKH 1S9YA 1T04A 5TJWK 3O11B 4DK3A 3QUMA 2IFFL 1KACB 1EVUA 2HFFB 4XNUL 4EN3A 1K4DA 1FFNA 1NAKL 3LD8C 1NKOA 3UJTH 1R3JB 4CMHB 1MI5A 2MQ0A 2NXYB 4X8XA 3TN0B 3QXAB 3G9VA 1RZGA 5DA0B 4AEIH 4L5FH 5C86A 4P2RE 2C1PA 2YZ1A 3O2DL 1HE7A 4WO4D 5D2NB 1CT8A 5E6YA 4LSVH 4WUKH 4XMKH 5TFSL 3S35X 4U1NB 1D7FA 3OKLB 3LPGA 3UMTA 1V7ML 1N2RA 4WWKA 3C60D 4NQXB 3BZFA 5EO9A 3WJLA 4TUOA 2YPKB 4EXPX 3HPJA 4F80A 1LEKB 3WFEL 3O2WH 4JFFA 4HZLA 1A6PA 1EJOL 4Z0XA 5F1OB 1DBBL 3MLPA 2EYSB 1FLTX 4MCZA 1CD9B 4K2UL 4FQXA 4LCUB 4WFGD 4YPJA 5HBBA 1H3GA 4XCCL 2Z93B 2ZJSL 1JWUA 1RUAH 5JO5A 2FSEA 3TGXA 3LRGA 1TZGL 1IAOA 4LIQH 1B4JL 5JXAH 4GAGL 1UYWL 4J3XA 5EOTB 4KTDH 1UH2A 4OLEA 1W2KT 1MCPL 1I9JH 4Y5VC 4LLWB 2D0HA 4JM2D 4NZRH 1UB6B 5ALBL 1NH6A 2IC2A 1G7HA 1NAML 4EI5C 3S88L 5IQ9A 3VI3E 3D0VA 2CLVB 4N1HB 3C08H 4WI4A 1N6UA 4Z76A 3QCUH 3SDCD 4PJFF 2YUVA 4JG1H 2O5YL 5HVHC 2EDLA 4U3XA 5E95B 3S37X 4N90E 3RWGA 5I75B 3QFDA 5C6TL 2DICA 1I9IL 4GRLD 1F8TL 4KRPB 2ZUSA 1LMKA 4Y16A 2A83B 3AUVA 5F7KC 3D69B 5CFHA 1I8LC 3QBTB 2UV3A 4M7LT 1QSFB 4FHBD 2Z31B 4P9HH 2EDDA 4U3CA 2J6EL 1WEJL 4K8RC 4QRPB 4L4VB 4R7DB 2E7MA 4MJ5A 4OFPA 1FN4A 2JE8A 3TNMA 4ODHH 2YBRB 3PP3H 1OAKH 2Y07H 4JO2H 3VMNA 2E7BA 4LPYA 2V9TA 3O8XD 1MY5A 2EE3A 3HMXL 4NC1C 2ZCKL 3MLSL 1GGIL 3RL1A 4BFIB 3MX0A 4BZ2H 1I3VA 4ZQKA 3FHQA 3QUYB 1MRDL 2YK1L 3PWPB 2J4WH 2CJUL 1V3MA 3SDDB 3VH8G 2CR6A 1IEBA 5KG9B 5EO0B 3VFUA 1MQ8A 1NLBL 5I8EB 3PWNA 3S9DB 3BN9C 5T3ZH 1IEHA 3UJJL 3CDGB 1UWGL 1U8OA 4P5TB 4BZ1L 4MSWA 3L95B 1YY9C 4FZEH 3X11B 4HXAL 5EULV 3WFHA 4RGND 4R0LC 2Q3AA 3DRTA 3QH3A 4UDUA 3LRHA 4Z7QF 5J13B 1YMME 4NP4H 1VGKA 4U1SB 4I3RH 5D7IF 1G6RH 4X7SH 2OSLB 4Y5XC 3EYQC 1HINL 4R26H 1EAPB 2JIXD 1OTTC 1PLGH 4YAQA 1HILB 1O7SA 3C6LB 1HHGB 3QG6B 3S96A 1WFOA 1OTSC 2CLRB 3C2AL 1RUML 3MV01 5LGKA 2N1KA 3FT3A 3QIWA 1YPZF 3MXVH 3DUUB 1TQCB 4GQ9L 4CKVX 4WV1B 4CDGC 3T0EE 4PJ5E 4P23C 1S9YB 1T04B 3ARFD 3QUMB 2C5DC 4X83A 4EN3B 3X3FL 1K4DB 1FFNB 2N7BA 5FYKE 5IR1A 3QDGA 1DBKH 1MI5B 1EMTH 4ZFOL 2X5PA 4X4ME 5IWLC 1RZGB 4RMWA 3G6AA 5HHVH 4ZAKD 5E5UB 3K1DA 4Y4KA 1HEZA 2C1PB 4KXZI 4NZJA 1T1XA 3ARUA 1CT8B 2EEAA 3NCJH 4ZTOL 4E5XA 5I1HL 2E8ZA 3NCMA 5CINH 5D8JH 3IS0X 2CLZB 4OUOA 4HS3B 4WWKB 4QRRE 3BZFB 5EO9B 4OQTL 4TUOB 4NJAL 3HPJB 1OPGL 4JFFB 2E3VA 4HZLB 3MLUL 4Z0XB 5ETUA 3U7YL 1S8DA 1C1EH 4DEPB 3V7AE 2FJGA 2QV2A 4BH7A 4K7PH 4R6UA 1UWEL 4MCZB 5I17A 3TWCH 3T08A 4FQXB 1JWUB 5SWSD 2O26U 2XTJD 5JO5B 5GGQH 3RGVD 1B6DA 2FSEB 3VXOA 3LS4H 2XQYK 2BVUA 4PJDF 1T80A 1FIGL 3RA7L 1HI6A 2YZ8A 2DJUA 2J88H 4A6YA 1FDLH 3MACL 4IDJL 4Y1AD 1SY6A 1JNNH 3JVGC 4MB5A 2GJ6B 1NEZA 5FK9A 4JHZA 5EOQL 3RDTA 3CK0L 1JZ3A 4C57C 3OGCB 4UAOB 1NGWA 4Y19A 3TZVC 2X2YA 3D0VB 2XKSA 2H8PA 5BRZD 4Z76B 1VCAA 1YMMA 1RMFH 5MEQA 1QSZA 5IQ7H 3C8HA 4U3HA 5IHBA 3RWGB 3QFDB 4ODWA 5LVEA 4YHYB 5KW9L 1I1YA 4UMGA 1J8HE 4Y16B 3PL6C 1QRNE 3Q5YA 2FD6H 3ZE2E 1NFIB 2I9TA 4ZNEA 1MRFH 3MLVL 4MJ5B 1FN4B 3WEXA 3TNMB 4FXGB 3GRWH 3I6KA 2B0SH 4Z8FL 3C5ZC 3CXDH 4XP9L 5EU6D 1TZIA 3RL1B 2HT3D 2LU3A 1IL1A 4WDIA 4K23L 4ZQKB 4PJIA 3WS6A 3G6DL 4YXKL 5T3XD 3D85D 4P4RA 1IEBB 1I1CA 3ARDD 1MSPA 3IDXH 2HLFD 5C0GA 1JFQH 3VFUB 1JJUA 3PWNB 4FQCL 5KSBE 2DI7A 2NQCA 3ARBC 4LLDA 5I18L 1F58L 2APWA 4PLJD 5C0JA 1U8OB 3T0DA 3QCVL 2AV1A 2DM4A 4MSWB 3DX6A 5LGHL 4GXUM 1FJ1A 3DRTB 3LS5L 3QH3B 4JO3L 5JQ6H 4UDUB 1LHZA 3TA3C 3DMMC 1VGKB 3DVGA 3W82A 1PQZA 2LAAA 3W9EA 2HFTA 4RFEA 3MV8D 2WQRA 3WN5A 3ZHKA 3NCFB 3S96B 2E7CA 5IV2B 2ADJA 3FT3B 3QIWB 5F1SA 4MA1C 1D6VL 3ZYJA 4MD4A 1QBAA 2AQ2A 1KYOK 4NN7C 3HAEH 4XX1G 3QI9C 3MV9D 3DXAD 5IM7A 4XPBH 1E6JL 5IR1B 3QDGB 4J3UA 4YHKL 4MJ2A 3G6AB 3GMMA 3V6OA 2VSDA 4FABH 1ZLWH 4X4ZA 4YXLL 4PPTA 1AGCA 3DIFA 4Y4KB 1HEZB 5J1SC 3A67H 1U8IA 1D5ZA 1T1XB 5C0RH 5IEHA 4E5XB 4X99A 3A0OA 2OJEA 3Q0HA 4OM1H 4X98A 1QRNA 2R0KH 1FC1A 3QCTH 1C5DA 4F9PA 4XT1C 3CLFH 2VLJE 2XZQH 3DI2B 3I3EA 3LQZA 5DD0L 5I19L 5GS0H 5JQHC 5ETUB 5I73B 1S8DB 4PGEA 2FJGB 5BV7C 4BH7B 3MV7D 3E6HA 1YNTA 5D9SA 5EZOL 5I17B 4IRJC 3QEQA 3JV4A 3IDYC 3LH2L 3UBXB 4LGSB 1P4BH 1BQUA 2BSRA 3VXOB 5F3BA 5FDYA 3O2DA 4PJFA 3JV6A 4HJ0D 1HI6B 4MGXA 1G7JA 5ALCH 3MRNA 5GXBB 4A6YB 5HI4D 4I3SH 3MMEA 1EUUA 1AI1L 1OARH 1MQKH 3HE7C 1BGXH 3S34H 1NEZB 5FK9B 4Q9QH 1QYGH 3RDTB 1GOGA 1RHFA 1NGWB 4Y19B 5ISZA 1YMHA 1NC4A 4OM0L 2H8PB 1ZGLP 5J12C 4HXBL 1YMMB 4LU5L 5HVGB 2YUZA 4DKDC 2ATKA 2X4PA 3VXUA 5MEQB 4H8WC 4MQSB 4DKFL 2WSKA 1EV2E 1LK3H 3MJ9H 4ODWB 2ZCHL 4EIZC 3PDDA 1KIQA 3GHBH 1I1YB 1QSED 2AJXL 3EJYC 3NA4A 3V79C 4PRIA 1FZMA 4M8QA 1PY4A 3ALWA 4MA7L 2I9TB 1BX2A 1NAMA 1RZKL 3IJHA 5D70L 4G6KL 4J4PC 2IADA 4YC2B 2VAAA 2Q8BL 4JKPH 1S9XA 3GSWA 3WEXB 4N1EA 2GQHA 3LDBB 3SE4A 2NY4D 1ZLSH 1TZIB 3NFPA 1FP5A 3MRJA 3MGOB 1IL1B 4WDIB 1NGQH 5D7IA 4PJIB 5I9QC 1UC6A 3QHTC 2W0KA 3EYUH 4R2GB 2E9BA 4XVJH 4XAKE 4GRWE 4XRCA 3D2UD 1PX4A 4P4RB 4MHHI 4WUKL 2RFXA 1OL0A 3VXQA 4CBPA 5C0GB 4Z7UF 5CGYD 4LLDB 5C0JB 1T03H 2J6EA 1MREL 5IBTL 5E6IC 5I1KH 1BBJA 1YPZA 2AV1B 3V5HA 4YDKH 1OCWH 3DX6B 4D0DA 1YJDC 3V7MA 1FJ1B 3O3AA 4XHJD 3P40A 1XEDA 3LIZL 4WO4C 3ARGD 3GMNA 3HMXA 3DVGB 3NABH 5K9QG 1PQZB 3W9EB 1Z5LA 5EN2A 3IFLH 3HUJF 4RFEB 1UGNA 3QHFH 2IBZY 3HRZA 1FRGH 4NM8L 1MCLA 3WN5B 4Q58C 5KZCD 1YEJH 5CP3A 2ADJB 1AJ7H 1SMAA 3QFJE 1NEUA 4CN4A 3FKUS 4KTDL 1NCNA 5DXWA 2PKDA 7CGTA 4MD4B 1H3PL 2XZCL 5DMJB 4NZRL 3QUZA 2EE6A 4KJPD 3D39D 4HAFA 4MNQA 2VLRD 2P5EA 5IM7B 1MWAH 2B5IC 4OZ4A 1AO7A 5GS1C 4RAVA 3BSZH 2J5LB 3MUJA 3Q1SH 3QCUL 4YO0A 3IT8D 3C5SA 1UEYA 1F6FB 4BK5A 3BT2H 4XXCC 2R56L 3GMMB 4JM2C 1AGCB 2RBLA 3DIFB 4PB0L 2XN9D 4YHMH 3GO1L 1U8IB 1ZANL 1D5ZB 3NIGE 1TVHA 5IEHB 4X99B 5FM5O 3K1KC 1QNZH 1FGNH 4PJDA 2OJEB 4X98B 1INEL 1URLA 4DGYH 4S0SD 3LCYA 5DYOA 3AMKA 1C5DB 2FX8H 3LQZB 1ZS8A 1FV1A 3P0VH 3KPRE 4PGEB 5F96H 3AAZA 5ILTH 2GJJA 3E6HB 5D9SB 4NKOA 3QEQB 3JV4B 2WK2A 4PJHE 3RBGA 1OAKL 5C0AD 2PYED 4JO2L 1A7RL 1NL0L 2BSRB 1MIEH 5F3BB 4DAGL 3L3OA 4MB3A 4Z5RA 4PJFB 3VXME 4U4BA 4BZ2L 5DQDL 3JV6B 4YHLH 1FH5H 2J4WL 1G7JB 4KPHH 2H41A 4JFEE 3MRNB 4G9FD 4NCDA 2F54E 4TSAH 3SGKA 2DWDA 4OQTA 5HD8D 1IQWH 1HXMA 5BMFL 5C70A 3OPZH 1L9MA 3O8XC 5GZOD 1T7WA 4RISL 1MCBA 1JPST 2VWEE 2RB8A 4H1LG 4K8RH 4EZMA 4OJFH 1H8NA 5ISZB 1YMHB 1NC4B 3LAFA 4MXVF 4UTAH 3F7VA 5DT1L 2DYPA 1JGVH 1T2JA 1U36A 5I1JH 2ATKB 1KBGH 4LQ1A 2X4PB 3VXUB 4NRXA 3F7PC 5K9OA 3IDUA 3QUXA 4E41D 4KJQD 4JFDD 4NO0D 2LVEA 5E8OA 1UJ3A 3BYYA 1KIQB 3WNPA 2UUDH 4RGNC 3EO9H 2R1YA 1I85A 3BPNB 4PRIB 1CDCA 4CGTA 1FZMB 4OAWA 4M8QB 4X5XA 5D7SH 1BX2B 2EICA 3B9VA 3IJHB 2IADB 2VAAB 2NY2D 4OZGA 3SE9H 3CLEL 2CUMA 1S9XB 4ZD3L 4FNLH 3GSWB 5L2KA 1F2XK 3HG1E 3IETA 4HG4K 5J6GA 5KTEL 4N68A 3NFPB 5HYSA 5TQ0L 5E0QA 2YXMA 3MRJB 5LQBL 1KENL 5D7IB 2HN7A 4L8SA 1GXEA 3H8NA 5F7FA 3SDAC 1Z0MA 4NJ9H 1RURH 3AB0C 4JKMA 2H32A 4XRCB 5IHLB 2XZZA 1CICA 2RFXB 3LEVH 5D8JL 3VXQB 2EXWD 2V2WA 2H2SD 2GEEA 4TVPD 4O2FA 3GBLA 4KRMB 1PJ9A 1BBJB 1YPZB 3I6LE 4QHMA 4XB7A 3A6BH 4ZAKC 3V5HB 2DMCA 4D0DB 4B50A 1C1EL 3O3AB 5KVEH 5LXGH 1U3HD 3V4UL 3RWJA 1FO0A 3GMNB 3IFPA 2QSCH 1Z5LB 5EN2B 3CZFA 3HRZB 1WFNA 4YFDB 3ORJA 3IGAA 1CTNA 3LS4L 1CLZH 4ODBD 1C16A 4OIAA 5I0DA 1MCIA 1RIHL 4JFEA 4HIHA 5E5RB 3MOAH 2QQLL 5LBSH 2J88L 4ZUWA 4A2MA 4ONGL 3V5DA 3QUZB 3PABA 3PGCA 4I4WA 1AIFA 1FE8H 4MNQB 2XG4A 2P5EB 2VDLH 4NFBA 2CUIA 3PJSA 3O4LB 4OZ4B 4MDJA 1AO7B 4RAVB 1IKFL 3IAGC 4PJ8D 4YO0B 3IAPA 5DFWH 3C5SB 4EKXA 4P2RD 4OCNC 1BVKA 4U7MA 4M1CC 1JK8A 1S7QA 3V7AG 5GRUL 5E8NA 1FNEA 4KY1H 2AJSH 3PF2A 1TVHB 4PJDB 4D8PA 5HHQA 3MLWL 1FSKB 1JPGA 4K3HA 5DYOB 1QHOA 2FD6L 3HC0A 3OF6A 4WEUD 2FO4A 1ZS8B 1FV1B 4QHUA 1C7TA 4X6DF 2J8UF 3AAZB 1PSKH 1OWWA 5HYIA 2ED7A 3SOBL 4M61A 4NKOB 5F9DC 1HZHH 1G7PA 4G6JL 3GRWL 4OZFA 1K2DA 1KJMA 2R2EA 3ZE0E 3ZYZA 3L5IA 5ADPL 4K3JH 4WJ5A 1N5YL 4IEFB 4XBEH 4LVNB 3CNKA 3R0NA 2QQKH 3L3OB 4W6YB 3L5XH 4GXVH 4Z5RB 2P45B 1U95A 3RUGE 1VGEH 5GRJH 3B4NA 3RBSA 3MYZA 4OFKA 4Y88A 2DWDB 3VRJA 1HXMB 4M6AA 2C4FU 5MENA 5I8KL 1OHQA 5LGJA 4G5ZL 3SGJA 4P2YA 3KYAA 3MUZ1 2HT3C 2VDOH 2FDBP 3QNZA 3V8CA 3NCYS 4GT7A 2I5YH 3QIBA 1NUNB 3BH8A 5DURB 2NY6B 3NA9L 3F7VB 2DYPB 4NN5C 4N90D 2FX9H 2HLFC 4NRXB 1F5WA 1MJJA 5K9OB 3QUXB 1P1ZA 4ZOCA 1NCUA 5KSAC 1ZLVK 2GITA 4NWTH 5F71A 5E8OB 4LIQE 1DLFH 1UJ3B 5MERA 1QKZL 2NY0B 3T4AA 5FGSA 3BVNA 1AE6H 2R1YB 2KQNA 2IAMA 1PG7X 4OAWB 1IAKA 4X5XB 4GW5A 1E4XH 1A6VL 4ZPTA 4PBVC 2OMNA 5HY9A 4LDOB 1R24A 4MXWL 5HYQA 4OZGB 4I18C 4Z7UA 4HKXA 1G7MA 1YY8B 5TGBA 5AZ2H 5C08E 5L2KB 2WINA 1KCVH 2MOVA 3IETB 1WJ3A 2A74A 2OTWA 2IF7A 3ARTA 2ADFL 1GPOH 3X12A 5J6GB 4L1HA 1I1AC 3TJEH 4KV5F 1RK0A 2DQCH 5DUMH 2X89A 5HYSB 2IWGA 1ORQA 2EH8H 4FABL 1B0WA 5BQ7A 2HN7B 2PTUA 4L8SB 1LP9E 3HUJA 1HKLL 3THMH 15C8L 2H32B 4LASH 1MY7A 3W9DA 1B9ZA 4LRNL 2V2WB 3ZYIA 3QEHA 2R0KL 4O2FB 2Q76A 5F7EH 3V6ZA 5I15H 4QHMB 2XZQL 2M1KA 1YNLH 1R6VA 3RWJB 1FO0B 1CVRA 1CGUA 2V17L 3CVHA 4BQ8A 4TTGA 1JYWA 3CZFB 4HUNB 4YBLC 2DOCA 3IGAB 2D0GA 2YA1A 1OP5H 1C16B 5EA0H 1I3RA 1MFBL 2AK4A 4LQFL 3IU4H 3MRHA 4HIHB 5JW5A 3T0ED 4PJ5D 4G42A 2B2XL 5E2TH 3RVTD 1E4WL 2AAVA 4EUPH 5AAMA 5FYJU 4NQCE 1BGXL 3V5DB 1UVQA 1YYML 1DVFA 1DFBL 3PABB 3PGCB 1GC1C 3UYOD 2YD3A 4I4WB 5FYKD 1AIFB 3HPLA 5T1KD 5BV7H 4NNXA 3PJSB 4KHXL 4RMVA 4HJ0C 4X7CC 4XNZB 4ODUA 3E8UH 1YEGL 1BF2A 4JFOA 3REWA 4GKOA 4KDVA 4CU8A 3GFUA 4OD1H 5ESVA 2YS4A 4M6OL 1CR9L 3ULVL 1BVKB 2IG2H 1JK8B 1S7QB 3MUGA 5E8NB 3MRFA 4FQHA 4A2LA 3RVVD 3X14A 1FNEB 1LK3L 4P0DA 4S11A 4ZFFA 1DP0A 1J0ZA 2JJTC 4IHOA 1NGXA 4QRRD 4CMHC 4D8PB 3TN0C 4F15B 1UM4H 5HHQB 1JPGB 3WKMH 2VN7A 5FIEA 3L5JA 5FAAA 3VU2A 1DL7L 2EDQA 3HC0B 2HTKC 2FO4B 3PWUA 4QHUB 3QWRA 4HCRH 1IAIL 4ODVL 3L3DB 4JKPL 3HI6L 4M61B 1BZ7A 4S0TD 1G7PB 3Q48A 3V5KA 4OZFB 1K2DB 5HDBF 1KJMB 1G7QA 1C08A 2R2EB 3FB7B 4BJLA 4H8WH 3QQ4A 4WJ5B 3TYGL 5DJCA 3BD5A 3BP5A 2NTSP 2AI0H 5DD6A 3FMGH 3QUKA 4XVTL 5FUZL 1YZZA 5E7BA 5A40E 1C7SA 3OAYK 1U95B 2XY2A 1SMOA 5CWSA 2X7LA 3S36H 3EYUL 3FQUA 2P5WA 4QRTA 1TZHA 5TE6L 5FM8A 5D71L 1Q94A 1XH3B 2DLEA 3T2PA 3VRJB 5MEPA 2BY1A 3VG0L 5MENB 3U4EA 3VFTB 5LGJB 4G8IA 5H37H 2NY4C 1U8JA 1RJYA 3V6BR 4Z7OE 1N7MH 2BNQE 5GGRY 2EYTA 4DN3H 3QNZB 4YDKL 3GKWH 4ONOA 5DVKA 1UH3A 4RRPA 5ICYA 1RJLA 1FIEA 3QIBB 3BH8B 3IS1X 3WNNA 2V6HA 1QSVA 5DZOA 2RCSL 1NCAH 4Z78A 1MNUL 4LHQB 2H1PL 3LOWA 3D3VA 1MJJB 4Z7WE 1P1ZB 4MX7A 2GITB 1EO8H 2DWEA 2HVJA 1Q0XH 1CFBA 1J8HD 5MERB 1VFBA 5CBAA 5L8LB 3T4AB 2Y6SD 3MA9L 1QRND 2NY5H 3BVNB 3O2VL 4P49A 4XHJC 3ZKMC 1UG9A 5F7WC 2IAMB 3ARGC 5CP7A 1KLFA 3QR2A 1IAKB 3ZDYE 3ZL4L 5CEYA 4GW5B 3HTLX 4ZPTB 2WLZA 1J0HA 2FRGP 4F7EA 5HY9B 3IJYA 1EGJH 4DFIA 1R24B 4Z7UB 4DGVH 1FZKA 1W72A 1YJDH 2PXYB 2BNRE 4HKXB 1G7MB 2I26N 2DLGA 3MOQA 3BQUD 3J8F7 2WINB 5JA8B 2A74B 4IRZL 4M03A 6FABH 3X12B 3BXNA 1RK0B 2A6JA 4PJAE 5IBLD 1ORQB 5E5MB 1N0XL 1KXTB 2AGJH 3PP4H 3HUJB 1JNHA 1T7ZA 2PR4L 2VH5H 4KJPC 1E27A 2B4CH 3JWDL 2BCKA 4RDQF 3W9DB 1N6QL 5GHWH 1FGNL 5FO8A 2W07A 4DGYL 3DETC 3QEHB 2GK0A 2Q76B 2V9RA 2VZVA 3V6ZB 3PHQA 3TIEA 5GGVY 5ERWA 1BHGA 4JY5L 4JG0H 3RWEA 2XXMB 2OX5A 2R4RH 3G08A 4M43H 1X4XA 3L7EA 3CVHB 5DMGC 5DUPL 4LLUB 3NPZB 3OAZK 5ESAA 1MIEL 4HMDA 2CRYA 5F1NA 5BS0E 1I3RB 2CKBA 2AK4B 4YHLL 4JFHE 3MRHB 5D2LF 5JW5B 4WTXA 3K3QA 3UZQA 3PXHA 4G42B 4WRLA 5JMOC 4OGYL 3T2NH 2HVKA 4JO4L 1UVQB 2PCPA 4TPRH 2XACC 1DVFB 3EGSA 4MMZC 4PJEF 5DRXA 4S1SH 3UTTA 4UUJA 3C6LC 3HPLB 5I8OH 4NNXB 1J86A 3O45A 5GGVH 4ODUB 5HGAA 2CXKA 4UTAL 2GUOA 4JFOB 3REWB 4WV1C 5C0NC 5GRVK 4X6DA 3P11H 2J8UA 4KZDL 4K94C 5ESVB 5I1JL 3T09A 4DW2H 1KB9J 4JFXB 4XGZA 4PV8B 3MUGB 3MRFB 4FQHB 3X14B 5GZOC 1I3GL 3O6KH 3AC0A 1I9RL 3DRQA 1KOAA 4ZFFB 1A6ZA 3S5LA 4IHOB 1NGXB 5GPRA 1A7PH 2R4SH 2VLJD 4QRUA 3B2VH 3GMLA 4L1DA 3EYFB 2ZOKA 3EFFA 3KDMA 4LSQH 3PWUB 1UCBL 4GSDL 4KJQC 3NIDE 2VERN 4N0CD 2VLLA 4TQEL 4NFDA 1DANU 1BZ7B 1W0VA 3V5KB 1G7QB 1C08B 1YECH 2DMBA 2EYRA 3QQ4B 4DJMA 5DJCB 5E24E 3BP5B 4KROB 5DD6B 3I3BA 3QUKB 3QO0A 1TNMA 5CJBA 4DEPC 2JB6A 1JRHH 1ZTXL 3HNTL 2NY2C 5CWSB 2X7LB 2Y06H 2EDXA 1RURL 3FQUB 4UT7H 2P5WB 4APQD 4QRTB 1TZHB 4FQXC 2P8PA 1WF5A 3B9KD 2H9GA 1Q94B 2GW5A 3LEVL 5MEPB 1UWXH 3T0AA 3U4EB 3IYLW 4G8IB 4YBQD 1RJYB 3FFCA 3QNYA 3K8LA 3EFDH 2EYTB 4MWFA 4Y2OA 4BUHA 1QQDA 4NM4L 5ICYB 1RJLB 3KXFE 2WW8A 2IBGA 2X40A 5F44A 3I9GH 35C8H 2CK0L 3P0GB 3UP1A 2AK1L 3DROA 4KI5E 3G5XA 5JORA 3FN0H 1A3RH 4P2OD 4Z78B 3D0LA 4ZODA 3TJHD 1DSFH 3D3VB 4YE4H 2ZOLA 2H2SC 3QQ3A 5BOZG 4GG6E 4MX7B 4Y8DC 3F5WA 1KEML 2DWEB 2HVJB 3ILPA 4TUKH 4OZFG 1VFBB 2EH7H 5CBAB 1DQLH 3NPSC 5DGRA 3EZ8A 4HC1H 4JKWA 3A6CH 5CP7B 2WAHA 5C3TA 1CFVH 2R0ZH 4JM4L 1F4YL 5CEYB 1KB5L 4BQBA 1DN0A 3EO1A 4XPAH 4GH7B 4F7EB 2MWCA 3IJYB 5J3HD 4YHYC 1W72B 1FE8L 1AR1D 3K4DA 2VDLL 2QJDA 4WY7H 3ARWA 5JHLH 3MLRH 2XNAA 5IESL 1DDHA 3PUCA 3ULVE 1EH9A 3BXNB 3F65A 2WBJA 3DECA 4YH6A 2A6JB 3AM8A 1OAXL 4KVCL 2VLME 1HYSD 4XAKD 5FHBH 1JNHB 1E27B 1XF4A 2BCKB 2AJSL 3MRPA 3ZDXE 5EFIA 1BIHA 5FO8B 3OV6A 3LKNA 3U0WL 4PJ8C 2GK0B 3NH7L 2DM7A 2VDRH 3PHQB 3TIEB 5ERWB 1CGSL 4ZFGL 1AFVH 1VFAA 4OLWH 3W0WE 3RWEB 5IIEA 4Z9KB 3DUSA 3L7EB 3OHXA 4TRPH 3BW9A 1NCWL 1OF2A 4YPGA 2Y9RT 3KYOA 5ESAB 2BDNL 3LPWA 4XBEL 3D48R 4LPWA 1ERNA 2QQKL 5F1NB 3QFJD 1PKOA 5DD3H 5IGXL 1U0QA 3U1SH 2CKBB 3OXSA 1YNKH 5GRJL 1RVFH 1Q72L 1PY9A 3U36A 1JGUL 4G7YH 2HVKB 3TT1H 2BJMH 5D96B 2W0FA 2PCPB 1MLBA 1JYVA 3EGSB 2NZ9D 5DRXB 3UTTB 3HE6A 4JZNA 4UUJB 4HHAA 2VDOL 2CK2A 2Q86A 3QIWC 3O45B 4FQLH 2C4XA 4Q9BA 5HGAB 3VWJD 4HS8L 4X6DB 5DWUH 4F7PB 2J8UB 4JB9H 5ADOH 1CBVH 5EBGA 1RZ8A 4XGZB 3OKYA 4JGJA 4G8GA 1UACH 5E1AA 4HUXA 4YDJA 3DRQB 2LU7A 3CFDA 1CICD 1TTFA 1A6ZB 3S5LB 2R2CA 2LVCA 2VXTH 3SDXF 3SO3C 3VGGA 3NGBB 2R9HC 1HIMH 2NYYD 4QRUB 2W0LA 4DKAA 1CD0A 4AG4L 3V0VB 1E4XL 4KKBC 4I1NB 3KPRD 2ZOKB 3EFFB 2JLLA 4HQQH 4OD2A 3KDMB 3GSUA 4XPTH 4Y4KC 3V0WL 1T83A 2IPTL 1MJ8L 4JRWA 2VLLB 2XZAL 1C8PA 1W0VB 3VXSE 1Z9OA 5CZVL 3QT2A 3T3PE 2EYRB 4L9DA 4S2SA 1BQLL 4JQXA 1GPOL 3VXMD 4PJ7E 1CL7H 2AJUH 3GSRA 3QO0B 1P7QD 3QEGH 3QNXA 4JFED 2JB6B 5KVFH 4D94A 2F54D 5I1IL 2DDQH 1JZ8A 1S5IH 3QQ9C 2P8PB 5GZNC 2H9GB 4PJGB 1CDJA 4G7VH 4OZHF 1MJ7H 4M5ZH 4BK4A 5HHME 3ARED 3FFCB 1C12A 3QNYB 3MGAA 4MWFB 3T3MF 2AABH 2UWEE 5JIKA 1QQDB 1Q9KA 4PRHE 3WFDH 4YIQB 2EIZA 1BJMA 2YWYA 3DROB 3G5XB 5JORB 2PO6A 1PZ5A 1LDPL 2CSPA 3QHZL 4TOYH 3D0LB 5AG8A 2ZOLB 3RDTC 3QQ3B 4NRZA 1X3DA 3F5WB 1W8NA 2F53A 2VR5A 3ILPB 4YHOL 3K46A 4KWUA 4OLVH 3U2SA 1A4JA 5FYLL 1ZEAH 1T6WA 1WFTA 2NY7L 1NJ9A 4RIRA 2X1PA 1MFAL 1KULA 1UM6L 1BZ9A 1DN0B 3EO1B 1GJIA 1RUPH 5T5NF 1N64L 2AEWA 5DMYA 3HHRB 3HG1D 1GZPA 3PP3K 5CILL 3QXTA 3IFNH 2XNAB 1AQDB 5TQ2H 3T0EC 1CE1H 2JB5H 4HGWB 4OCXL 1IBGL 2WBJB 3RX5A 1BD2E 3DHMA 4RRPG 4YC2C 2HT2C 3EHBC 1LO4H 3VFVA 2F5AL 1XF4B 3MRPB 3LDBC 5E00A 1J1PH 1IT9H 3KPQA 4YUEH 5EFIB 3HR6A 2B1AH 3I6LD 3LKNB 4PJ9D 4RQQA 1UM4L 1U8KA 5D2LA 4Z77A 4X6CF 3QDJA 2VITA 1IFHL 2CRMA 5CJ5A 3E6FA 5HSFA 3VWKA 5TDNB 3WS6C 1I8MA 3RVVC 1VPOL 1VFAB 4R2GC 2ZUQB 2V5MA 3FRPG 3HC3H 4PJEA 5GJTL 5IIEB 3DUSB 4M02A 3U9UA 3OHXB 2Q3ZA 4UV7L 3BW9B 1RULL 5EBLA 4PRBA 4ZUSA 5D7LE 1OF2B 4YPGB 3G5VA 2QSQA 3KYOB 5KS9F 2AI0L 1F6LL 5DJDA 1KN4H 5IMOA 2VDNH 4HLZG 3KPSE 4HUUA 2R29H 5TDPA 3OXSB 4NHCH 4GW1B 3U36B 4JO1H 3P3YA 4YQXH 5C1MB 1T1ZA 5HYJE 1TETH 1CS6A 1FBIH 1KN2H 1G6VK 2W0FB 2C1OA 1OT1A 3QZWG 1MLBB 4YFLI 3TH2T 3LB6C 3HE6B 2YPVH 4JZNB 4HHAB 4DN3L 2Q86B 3GKWL 2WWKT 4EDXA 2IANE 3MO1A 1T7XA 1HOCA 5TH2A 3MRBB 1B0RA 4JHAH 3DV4A 3H6JA 3RVXD 2P1YA 3NCEB 5B8CC 1RZ8B 2Q20A 2HFEA 3N9GH 1KEGH 5IVXB 1RZ7L 4JDZA 4G8GB 4AQ1B 5T1LA 4MZ2A 1IM9A 4NQUA 4P57B 1EO8L 4Y5YA 5B38A 5E1AB 4HUXB 1Q0XL 4YDJB 3EZJB 3WXVH 4HIJA 3CFDB 5C7XH 3K2MC 1BEYL 2NY5L 4LSRH 3DPBA 2OK0H 4JDTH 3V6OC 5D1ZD 3ULUF 4WIQA 1TJGL 5I1EH 1WAAF 5CHNA 1MCCA 2DL2A 4JFZH 4OD2B 1EAJA 3GSUB 3ILQD 4AMKL 3RP1A 3R1GH 1AR2A 3I3DA 1CLYL 4KJYA 2Y6SC 2MCPH 3CMOH 4S2SB 4RNRA 2VDKH 4D3CL 3OBAA 3TO4A 2Q1EA 5DHVA 1TPXC 3QNXB 1DN2A 3PP4L 2O61A 2B4CL 1MAMH 2GYSA 2OS7A 5E2VL 3MOBL 1A8JH 2YD2A 4HK0A 4U6XA 3AGVA 3O6FD 1ZA3A 2AJ3A 2HTLD 1MVUA 3OKNA 1Z3GH 1NUGA 4OCMC 1C12B 1MFEH 1PGRB 4LVHB 4LGPB 1FPTL 1Q1JH 1Q9KB 1D5BA 3ARRA 5JPMA 3DGGA 4OBSA 2EIZB 2O5ZL 2PO6B 4IRSB 4JRYA 3DGCR 5CD3A 4NRZB 1JP5A 1FNSH 1M1SA 2F53B 1A6UH 3QPXL 4HS6A 5JUEL 1QLFB 3U2SB 1WBXA 1A4JB 3NFSL 3LKPA 3MLXL 1BQSA 1GHFH 4BFGA 1QP1A 2W9DL 3ZTNH 1NJ9B 1J1OL 4RIRB 4QWWD 5IJVA 2H3NA 1D5IL 3EDFA 3UAJD 4TSBL 1BZ9B 3RTQA 2EIDA 4TULH 4TSCL 1XIWB 5C08D 1J5OH 3LQAH 5JR1H 4BZYA 3MLYL 1GZPB 3GIZL 1UZ8A 4LLAA 5GGVL 2OL3L 5F70A 1QBML 2APBA 2B39A 5IVZA 2HMID 5AAWA 4DW2L 5AYUH 12E8H 1YEHH 3VFVB 1UM5H 1ZVYA 4LSUL 2WZPD 3FCTA 2V2XA 1OP3H 1U8HA 2E7HA 1OGAA 3QJHA 5E00B 3RWIB 3KPQB 5IKCA 1KB5A 1LEGA 1BWWA 4RQQB 3V0AC 5I1CL 4ELME 2N7AA 3B2VL 1U8KB 5D2LB 4Z77B 3G5YA 3OKMA 3QDJB 2VITB 2DQUL 3E6FB 4LSQL 3VWKB 5EZJA 1I8MB 1HHKA 4NCC2 4WFFE 3KJ6L 4PJEB 4NGHL 4N8PA 4JR9H 3TPKA 4DOHE 3U9UB 1A2YA 5EBLB 4JZJA 4ZUSB 4YHZH 3G5VB 4H20L 3LKRA 3QUMH 4OCSH 2R0LH 1KF9B 5T5FH 1CE6A 1KXVC 5DJDB 3VDAA 4OLUH 5FUOH 4HUUB 5TDPB 2R23A 1GIGL 3RNQA 4N0CC 4UT7L 2OZ4A 1A7NL 4NQCD 3SGDI 4UV4L 1T1ZB 1CK0L 4W4OA 2Z35A 3O3EA 2QADB 4CUCA 1NCDH 1KUMA 3SDXA 3SY0A 3EDKA 4RFNB 4NDMA 2HH0H 3UC0L 1NBVH 4EDXB 3MO1B 1EEYA 1HOCB 5TH2B 1B0RB 1R5WA 3DV4B 4WUUA 1ZOXA 2O93L 2VDQL 1MFDH 1M7IA 2W60A 3ZT6A 1ZLWK 4XMLL 1VEMA 2HFEB 3HAEG 3QUZC 2XPGA 1WZ1L 1CLOH 4JDZB 5T1LB 1IM9B 4YBQC 2Q7NA 4Y5YB 5B38B 1QLRA 3RKDC 4HIJB 5FHAL 4V1DA 5FYLE 1OSZA 1RU9L 2EH7L 1S78D 4UINL 3GSQA 1X9QA 2DQDL 2ZKHH 2FB4L 4I77H 4JAMA 4P2OC 5CHNB 3TJHC 5JXEA 4JRXE 3QSKB 2Z8SA 2G5RA 4OZHA 5DD5H 5L0QC 3UYPA 4KJYB 1B2WL 3UEZA 3JTTA 4XP1L 2EC8A 2W9EH 3OZ9H 2HWZH 3ARXA 1FSKC 4F58H 1TJIL 4RNRB 4L9LA 2HKHL 4XAWL 2QBWA 4EI6A 3TO4B 4N8CH 5DHVB 1AXSA 3FTGA 3VFMA 4O51A 1RZFH 1L6XA 5FYJL 2IQ9H 3TT3H 2O61B 3RHWF 1AR1C 4FFYL 4UT6H 4HK0B 4U6XB 3VG9C 4JPKL 4QTIL 4NO2A 3RY5A 2BNQD 1ZA3B 1PG7H 2AJ3B 1JHTA 5MHSE 2ID5A 1MVUB 3BGFB 3OKNB 4DGIL 4NUGH 2VABA 3OSKA 2VDRL 5IT2H 5CIPH 1YC8A 3ESUF 1MHCA 2VN4A 4TN9A 4YDIH 1HYSC 1D5BB 4X0KA 2HKFH 2NY3D 5JPMB 3T2QA 3DGGB 5F7YC 3SGKC 2JTDA 4D0BA 1RZJL 4TRPL 1IARB 4JRYB 3DSFH 5CD3B 3F7YA 4UU9A 4OFYA 4HS6B 1GVIA 4ALAL 1JPTH 2FATL 4URTB 2NY6C 5DD3L 1WBXB 4W70A 1F45A 3N1QC 5J11B 2IPKA 3LKPB 5KANI 4MA8H 2DLHA 3H9SA 5IJVB 2FLRT 2H3NB 3SE8H 3QUXC 2E6JA 5I30L 3RTQB 2BNRD 1HWHB 1UJ3C 2NY0C 4D0CA 2DQJH 3ECBA 4X6CA 2E7LA 1B0GA 1FGVH 1UZ8B 2E27H 2XV6B 3EKCA 4X5LA 4F7CA 3LY6A 4TVSa 5DWUL 4JB9L 5IVZB 5ADOL 4S1RH 2W59A 2MPAH 3S6CA 4I48A 2YWZA 1A21A 4HBCH 3B2UC 1XGQA 5DMKA 4GG8A 3MTRA 5TPWH 3V95A 2VC2H 3MREA 2ARJA 5F7HA 3FCTB 5AEAA 1AGDA 5KS9A 2V2XB 2LAGB 1XCQA 1U8HB 4POZC 1OGAB 3PXJA 3QJHB 4RGOL 4H88H 5IKCB 1BFSA 1J1XH 1JGLH 1KB5B 1LEGB 5E8PA 3FJTA 3GK8H 2GSGA 1GOFA 4C83A 3G5YB 3OKMB 4HPOH 4L8SC 1E6OL 3NZHH 4P3CL 5EZJB 3V4PH 1HHKB 4HEME 2QHLA 4GMSL 4LFHG 3SCMD 1CICC 3OXRA 1KJ2L 5JIPA 1UCTA 3CFJA 1EVTC 5J0BA 1A2YB 3MLZL 5DF0A 4JZJB 1G9NL 5HHXH 4TNWF 2VKWA 2NYYC 5BS0D 1DLHA 3HLAA 3LKRB 1CL7L 5D1QA 4JFHD 3RIFK 1CE6B 4WI6A 5BZDA 4M7JH 3KR3H 5FKPA 3V4VL 3GB7A 1MEXH 4ERSL 4YEFA 3ZHLA 2R23B 2DI8A 4NRYA 4RMQA 3RNQB 4S1QL 1S5IL 4JN1H 5JNYB 4E42A 4KQ4H 2Z35B 3O3EB 4G7VL 4BFBD 2HJLA 3KPNA 3WHE0 4N0UA 5CSZA 3SDXB 1MJ7L 5EZLA 3SY0B 3STBA 2BZDA 4NDMB 5FCUH 5IFHL 1WAAA 4Q9RH 1EEYB 1NLDH 1R5WB 2EC9U 4WUUB 3BDYH 3R4DA 2J8HA 2W60B 1M7IB 2Y36H 3SQBA 4RAUA 2VWEC 3GMRA 3H3PL 3RL2A 3RX7A 5IJKC 2H2PC 1QLRB 5EPMA 2A1WL 3DOSA 1JRHI 4XNZC 4V1DB 3D87B 1OSZB 4WW1A 1AHWC 4P9MH 3CX2A 4JAMB 4KQ3H 1N4XH 4IOSD 1QFPA 1AD9A 4J3TA 1EDQA 4IM8A 1VFUA 5T1DH 4ZXBA 3GMOA 4MJ6A 4OZHB 3VFGH 2G60H 3MC0A 4A6YH 3JTTB 2CRIA 2AJYH 1D9KA 1SY6H 3ZE1F 4F15C 4L9LB 2JB5L 3CSYA 2I24N 4YXHH 4EI6B 3HN3A 1IEAA 3CD4A 1MLCA 5C09D 1QFOA 2D0FA 4JDVA 3MCLL 1AXSB 3FTGB 2UZIH 4O51B 3VFMB 4DZBA 5E9DA 3IDJA 3UTSE 5JLZA 1PAMA 3V8OA 4KTYA 5C0BA 3JWOH 4JCLA 1J1PL 5FV2A 1OVZA 1T5WA 5HVWA 3G04A 2H26A 4H0IA 5GS0D 2FGWH 4NO2B 1JHTB 5TF1L 1VDGA 2BOBA 3R8QA 3QEUA 3HNSH 2VABB 4CRPA 2ERJB 3CPLA 4PJCF 3KXFD 1MHCB 1G9EA 1IC7L 4ZS6D 3RI5F 1H8SA 2ATPA 4KI5D 4X0KB 5F93C 3DYMA 3TH4T 4D0BB 3T77A 4KI1A 3F7YB 4UU9B 3VI4E 4GW4A 2UUDK 1KN4L 4OT1L 3QIBC 4OCYH 2IPKB 4M62H 1OQXA 1VSCA 2IJ0C 5ENWA 3H9SB 3DWTA 3L5HA 5F7LB 4PRPE 1KN2L 2OI9B 2P49B 1R0AL 3BGAA 1YEIH 4D0CB 4X6CB 3ECBB 2B1HL 4GS7B 1B0GB 3ULVD 2VLKE 2NCMA 2IAMC 3K81A 4D9LL 4RMUA 4F7CB 4YEEA 5I66A 5DFVC 2AVGA 1QBLL 3AXLB 3NIFF 2A6IA 2CRZA 2VLMD 2YOCA 5F7MC 3N9GL 3P9MA 4I48B 1KEGL 1XGQB 5DMKB 4GG8B 1KC5L 4QHNA 3MREB 2ARJB 5DEGA 5IROA 1KJVA 3QIUD 3WXVL 4U05A 1AGDB 3VW3H 4KTEL 5KS9B 1XCQB 5M7QA 1MCNA 5E8PB 3U82B 5HDQH 4JHWH 3RVXC 5C07A 3K2UL 2BY2A 5GRWA 5C2BL 2OK0L 2GSGB 4MLIA 4C83B 3CDYA 3CDCA 1IGCL 3RJQB 3W0WD 4OLYH 4WTZA 2DTMH 4LP5A 2CGRH 1MFCH 4NZTH 1OM3H 2EDYA 1FAIH 2OL3A 3OXRB 3CFJB 3RAJH 3EDDA 4P2QE 3UYRH 1RZKC 5D7JD 5I76A 1FG2A 4P46D 2AEQH 2WM0A 2F9BT 1DQTA 1DLHB 3HLAB 5F7UA 3T0XA 2MHAA 1AY1H 5D1ZC 4L8CA 5D1QB 1HNFA 2R8SH 5BZDB 1GGBL 2OM5A 5FKPB 3GB7B 2YRPA 4NRYB 5GJSH 1II4E 4MNGE 4XPGL 4LFHD 1MAML 1YDPA 1MPAH 4PJBE 4JY6A 4E42B 2NMSA 4MJIA 1KG0A 4N0FA 1TVBA 2HJLB 3KPNB 4LEOA 4N0UB 2BHZA 5CSZB 2FBOJ 3RPIA 5EZLB 1Z3GL 1J8KA 4M6NH 4NQDE 2DQIL 3JUZA 3UO1L 4YDLC 4HKJA 4HWUA 1DQDH 3CFCH 1Q0YL 4XBPA 1IJ9A 3GI8H 2IFFH 2BFVL 4GBXA 4JJ5B 4RAUB 4XNUH 4DUXA 3GMRB 1CL7I 1NAKH 3EW3B 2HTLC 4MDIA 3GZKA 1MHPL 1SJHA 5EPMB 5FGBA 1KB9K 4WW1B 2I60H 2VZOA 1NCBH 4FOMA 4HWZA 1RJCA 3O9WA 3JSSA 5CMAA 3CH1A 3O2DH 4MXQC 1AD9B 2AEIT 3L3GA 1MF2H 5TFSH 3S7GA 2APTA 3CSGA 3MJ6A 3GMOB 4MJ6B 2JCCF 4ZXBB 3VXSD 3VD9A 2ZUVA 4C59B 4WU5A 3LQAL 4Z7VF 3H42H 2ICES 1OQOA 1D9KB 3WS3A 1EJOH 3CSYB 2OR9L 3D5OF 5C8JA 1IEAB 3EBAA 5BVPL 1MLCB 3UAJC 2XA8H 4JDVB 2VL4A 4DZBB 5E9DB 3PV6A 4K2UH 3B8SA 3IDJB 4ONFL 4XCCH 4BH8A 5JLZB 2ZJSH 1JZ4A 5C0BB 4ZSOA 5IMKB 2R2HB 5CBEA 1T5WB 4U6YA 5HHMD 3G04B 2H26B 1TZGH 4EI5D 4KROC 2BSED 2BOBB 1B4JH 3VXTA 2HMIC 2AEPH 3CPLB 4PRHD 4U31A 4GAGH 4OCWL 1UYWH 3BYTA 4FXLA 2ATPB 2DAVA 1IAMA 1MCPH 4LAQL 4XCNA 4LRIC 4JR9L 3T77B 1NAMH 4O9HH 3S88H 3RRQA 4OCSL 3I02A 4GW4B 1ZV5A 2DM2A 3O4OC 4OLUL 5FUOL 3WJJA 2O5YH 1F00I 4R90H 2X09A 5ENWB 1FYTA 4HEPG 1MCRA 1QLEH 5DRNA 1I9IH 1F8TH 3PE9A 4YHNA 3HZVA 3SO5A 4KKLC 2R69L 4MAYA 4G6FD 2Q6WA 1MIML 4HIXH 5I66B 5H35A 1BD2D 4YDVA 1BF8A 1CIUA 2J6EH 2A6IB 1MFDL 3V6FA 3P9MB 5B3JF 5BW7C 1MOEA 1CLOL 3PWLB 5FO9B 4QHNB 4G43A 5T5NG 5DEGB 1KJVB 1I8KA 1JHKL 3HMXH 3MLSH 1GGIH 4FQJL 2NXZB 1CDUA 4HK3N 1YY9D 2ZKHL 1LO5A 5C07B 3P4OA 2BVOA 1IKNC 1MRDH 5J1TC 3BPLB 2A0LC 4X80L 1PEZA 3FFDA 5CP3H 3UXFA 3ALXA 2IQAA 2OL3B 1FCCA 5D7LD 3G6JE 3UJJH 1UWGH 1S78C 3H0TA 2HWZL 4BZ1H 5I76B 1FG2B 4XBGA 5EOCL 3HZYA 3WIHL 4AM0A 1OTSD 2MHAB 3KPSD 5C0CA 4RMSA 4L8CB 4MQ7A 3BAEL 4G8EA 1T1WA 3TT3L 5HYJD 4P23D 2YD8A 1YDPB 3CVIL 3N1MC 4OB5H 2X05A 4JY6B 4UT6L 4R8WL 1HINH 4MJIB 1KG0B 4N0FB 1TVBB 4LEOB 4PGDA 3RPIB 2VDML 2YPLA 4PYGA 2HFGL 4RX4A 4ODSL 2IAND 1UZ6E 4L4TA 4AEHL 1G9ML 4GQ9H 2OP4L 4R4FL 2DQEL 2Q7YB 1X4YA 3SJVA 2HKFL 1RJZA 4XC3H 5DVMA 4MS8D 4XBPB 5D96C 4GBXB 5J4MA 3DSFL 4WI3A 3X3FH 4MDIB 2CIIA 1DQJA 1SJHB 4QOKA 4QRSA 3ELAT 2F5BH 5B39A 2NY3C 4HWZB 3CJJA 4FRWA 1S7RA 2R2BA 3O9WB 5CMAB 1WT5A 5J8OA 3SE8L 3CH1B 1UA6L 5IB1A 2VZUA 5D2NE 4ZTOH 3L3GB 2FHBA 4M5YH 5I1HH 5JHDA 1U42A 1FORL 4WU5B 3MRRA 1V7NL 4XPHH 1FGVL 2E27L 4PJCA 1NQBA 4OQTH 1FVDA 3NGBC 3WS3B