4U6HB

Vaccinia l1/m12b9-fab complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
DVVMTQIPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWSLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHDPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent neutralization of vaccinia virus by divergent murine antibodies targeting a common site of vulnerability in l1 protein.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
molecule keywords Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
total genus 50
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB01
4XAWL 1GHFL 4NNXA 1JV5B 3HNTL 4F58L 5FYJU 1NGQL 3S8WA 4YBLB 1H3PL 3SDXA 4I48B 2BY1A 1T83A 4H5SA 2BK8A 3IFPA 4ODTL 2IALB 5CEYA 3PWPE 1Y6KR 3GMOB 1N5AB 2X4PA 5FYLL 1G7MB 4M61A 1U92B 4KVCL 1IRAY 1WBXB 4X6CE 2DDQL 1P53A 4FQXB 4M1GH 1F11B 3VG9C 1UVQB 2W9EH 1XGUB 3FAWA 1DVFD 1VDGA 3P4LA 4ORZC 3UJIH 3D85A 4O2EA 2KL6A 2VSDA 4Q6IA 5CJQL 3QUYB 2Y06H 5BCAA 3T3PF 1ZT4A 2ZPKL 5I8KH 2BNRB 5IW3A 1A1MB 3MNVA 2FJGA 3IETB 5ALBH 1OP5H 1KEMH 2CQVA 1P5VA 3ECBA 1RUQL 2L7JA 2Y1VA 2XWJA 3M45A 1P6AB 4LKCB 1YY8A 4OQ1A 2WZPD 3JWNC 4X6DB 5T1KD 3MSPA 2W0FA 1HZHL 1FSKB 4WJ5B 2R0WL 3Q3GB 2PCPA 4IHOB 3ARRA 2P24B 1JWUA 5D7JD 1NDGB 3CH1A 5HGGS 2YD3A 3BH8B 1F4WL 2KKQA 2PO6D 4MD5A 2IQ9H 4JLRB 5I76B 3CK0H 3NCYP 4JVUA 3RUGE 4YDKH 5JPMA 4R7DB 1OP9A 3SDDA 2Y7QA 4XXCA 1DBAL 4P23B 1UXWB 2AKRA 1EAPB 1G0DA 4MB4A 4HUXB 3S34L 5DI8B 1EGJL 2I07A 5FUCC 1KSRA 5HHNB 5SV3A 3WKMH 2M26A 1EO8H 1MI5E 1JYNA 1A47A 5BV7H 3EFFA 5SWQA 5HHXL 3AREC 1U58A 5GRVK 3RTQA 2A1WH 2YR3A 4JFQA 1P5UA 2P42B 3G6JA 3UYRL 1TIUA 4FQXD 1EHAA 5ICXA 4M7JL 3BIKB 4YPJA 1KN2H 3EJYC 4XNQA 1INQB 4L3AA 3B5TA 3QJFA 4LHQB 4KVCH 4QTIL 1A0QL 1AGEB 3OAUL 3MXVL 2GSGB 4B50A 4DVBA 4WY7H 3O45B 4Y2DD 5TF1L 1RZIA 3FAXA 4R4NC 3JTSB 2B4CH 1M6OB 4ERSL 4B7IA 4Z7OF 4L4VD 1OWWA 2HRLA 3P0YH 4QNPF 1ADQL 3P9MA 4NZJA 4OD2B 1XGYL 1MCRA 2EC9U 4WDIA 1RD6A 5FM8A 1BQHG 5EG6C 3RVXC 5IVXE 3BOVA 4OBSA 3L3KB 5JW3L 3CPLA 5D9SB 2VLKD 2F8XC 4GRMB 4EVNA 1GGIH 4HAFA 4GAYB 5HHMB 5FA4B 4ZAKD 2UZYB 3ARFB 3GMRB 3VI3E 2IGFL 4OZHA 4FQJH 2VDPH 4KJQD 4P0DA 1FGVL 1QVOB 5HGDA 3G08B 5H35B 4Z77A 1A6PA 3SCMA 2D4DA 2VXUL 2NX5D 4M1DH 5TDNB 2Z8VC 5F7UA 1UT9A 2H45A 3IGAB 4OKDA 3UTSD 4GFTB 4MQTB 2O5ZH 1T2QH 5CSZA 3SJVE 2X4QA 2LAGB 1ZANH 1PZUB 2KBGA 2X4OA 1CS6A 5IK3B 2Q6WB 1Q9KA 1AO7D 3RVTD 1GGUA 3GMMB 3NCBB 3W0WB 4Q9QL 4XMPH 3BKJH 1JGEA 3C6SB 2EIEA 4LVOC 1C5BH 3DGCR 1ZT1B 4M3JA 3GHEH 1CD9B 3B5GA 1C16A 2BOBB 1RZKL 3ULVE 4OD3L 3DV4A 3CFBB 3G04B 5JNYA 5LG1A 2MTPA 1TZHA 5SWZA 4UIMA 1CXFA 4OTXH 4KJQC 3QNXA 1LK3H 4KC3B 4LF3A 3I02B 4X4XB 2CUMA 4WHTB 2CDFA 5E1AA 3MRBB 3WE6B 1EV2E 1IAIL 1MFBL 4DOHE 5TQ0H 5MERA 3SKMB 1XCTB 4XPTL 5HSFA 3IKKA 3O2DA 2YD9A 4R97C 2CRYA 5EU5B 3D0LB 5GS2D 2ICEA 5BVPH 3MA7A 1RUQH 1FC2D 3H0TA 3OMZA 5FHAH 4UDTB 3ULVC 1XGTA 1IQWH 4U1LB 1WBZB 3VE0A 4PGDA 1A4KB 2DQEL 3TZVB 4HS8H 4LBEA 3P0YL 4QRTB 3QAZB 4KMTL 4XWGH 5EZLB 1D6EA 2B8OT 2EYRB 4MD0A 4ZOEA 4G80B 3E6FA 2CIIB 1YNKH 3L7FA 3VCLA 3ZDYF 4U6HA 4YLQT 1KCUH 1C5DB 2ZWLT 4HEPG 4M7KH 2H32H 3DWTA 1KB9J 3P4OB 4DZ8B 2J8OA 3CX2A 3BKML 4HQQL 1JHLH 1TQBB 4LSQH 4A6YB 3GK8L 4Z78B 4KXZI 1Q1JL 2XNAB 3BISA 1CK0L 5GGQH 2DM7A 3BFOA 4CMMB 5CIPB 4MQ7B 4TOYL 3VXUD 4X9BA 2GTZA 2ZP0T 5CIPH 1N26A 1ZTXH 4L1HA 3NFNB 5I8CA 4QHKI 2YD2A 2ZCLH 4LQFH 5KS9B 1I9EA 4I77H 1MFDH 3DO3A 3L5HA 4XI5D 4MA3B 4JM2F 3W39A 4YE4H 1IT9L 3RWHB 3QG7L 4IOIA 5FYKE 1MHEA 2DQDL 5DTFA 1QRNB 5B3NA 4R97B 1CVSC 1UEMA 3O11A 4PFEA 1TMCB 3OAZH 2Z35A 4D0DB 2ENSA 1ZS8A 5ERWB 3S35H 5FYLD 1FVDA 2HA1A 2VC2H 4YPGB 1I8MB 4PJAF 2Q86A 1QBAA 4V1DB 5SX5K 5CGMA 1DEEA 1NCDL 3JTTB 4PRID 2V2WA 4JQXC 6FABL 5TF1H 1UWEL 3C6LC 2K3TA 4K23H 5D7SH 4JFDD 4OM0H 4MA7L 1QSFE 4PP2A 5CMAB 1M7DA 4KHTH 5C1MB 1G9MH 1VGKB 3OWEA 5A16B 4K9EC 2V2TB 1FBIH 3QG6B 1S5IL 3O6KH 2QEJA 3ZYZA 2FX9H 2B20A 3QRGH 1FL3B 1NQBA 5C0EB 3TCXA 4BYHA 3O8XD 5I1CL 2Y5TA 3NA4A 3B6SA 3NABL 2FX7L 1S3KL 4LHUD 1LP9B 4KKNA 1ZWIA 3KR3H 4X6FB 2V5SA 4OD1H 5HXMA 3CSYB 4KQ4H 2IGFH 3L1OH 1R3IL 3EW3B 4ODBD 2CKNA 2G9HB 3HC0A 1CD1B 1DQTA 3B43A 1KB5L 1TDQA 4OUUA 1I3VA 3MXWL 4PTUA 4NC2B 5D7JC 1YEEH 4JY5H 4GKNB 3MRDA 4NWUH 1JPST 1CR9L 3H7BB 4E41E 1BVLB 3FHAA 1QO3B 1CFNA 4KH2A 3QUMB 1YQVH 3REVB 5AG9A 5E8NB 4WFGE 4H1LB 5IBTH 3PIQA 3ZO0A 1KNOB 4DAGL 1AD9A 4RFEB 4NKOA 4P4KC 3ARBD 2PW2B 4P2RA 1U91B 3PJSA 2R9HD 3D69B 2CGRL 3INUH 4Y2OA 4N8VB 1S7UB 3P40A 2O61A 1JWMB 1O0VA 2IQAA 3H9SA 5FM5O 2PXYB 4NJ9H 1F4XH 2H41A 4YH6A 1B9ZA 1RUKL 2ATPA 5B38G 1PAMA 5I1DA 1SY6H 5M94B 4OZFG 1OAKL 3F7PC 5MEND 2FEDC 3MOBL 1NC4A 3KPOA 5EC1A 5MENB 3W82A 5D8JL 1FJ1A 5BMFL 4G5ZH 5C2BL 3QDMD 1XF5B 1MPAH 1WCQA 5D5MF 2AVGA 5DVMA 3W0WE 5EUOE 3K2UH 5HYSB 1ZHBB 5IVOA 1QUNA 2DQEH 4Y8AA 5IESL 3EOAB 4YNYA 4JRYD 5IWLA 1YNTB 4RZCA 2BVQA 2P7TA 4OQTA 4ZTOH 4Z7VB 5IF0A 2VLKA 1ZGLB 5IQ7H 4M6NH 1W0WB 2FYYA 4P9HH 2XWBB 1X5LA 3LN4B 1IAIM 2ZUYA 5FYKD 1RZFL 1RUAL 2R0ZL 3I6KA 2NLJB 3U9PH 5CZVH 3NPSC 2I25N 3LN5A 3SY0B 1I7TB 1HXYB 4MQSB 3HKFA 3K4AA 4OLWH 2W60A 4XH2A 4LSQL 4KQ4L 3FOLA 1FZOB 1MHPH 4DZBA 4XMLH 4MJ4A 3NMEA 1D9KB 1T4KB 5GGRA 2FEDD 1KPUB 4IMKC 3AMLA 3QULA 4U1MB 2O26U 3NZHL 2VJXA 4JM2A 3GNML 2G60H 1MF2L 3KAAA 1RPQA 2Q7YB 5I18H 2F53B 4WW2B 5IROC 4NO2B 2VWEC 3ZYJA 1EFXA 1NAMA 2VXQH 2V7HB 1QFUH 3MRNB 4KK6D 2BFVL 3QUKA 5DEFA 5GS0C 2BRQA 3TBVB 1S7VA 5T3XE 3LHPL 1T1WA 1LEKA 1T3FA 4MAYB 3JV5A 3GSNL 2YBRB 2CRIA 3BP6A 4OB5H 1GL4B 2OR9L 3QUYC 4LLQA 4LPYA 2B0SL 2VC2L 3CSPA 4GRWH 1LEIB 5MEOA 5KOVC 4UILH 1DN0A 4X7CC 4HK0A 2ZUXA 5IB1A 5KANI 4I5BB 1V7MH 4PRDA 1PFCA 1CGWA 1OT1A 4JZNB 2IBZX 3P0GB 2O5YL 4NFCA 4E41A 4MAUH 5GS0H 3VFGL 1RK1A 4MZ3A 4WRLA 5DD6A 3TGXA 3K2MC 2IEPA 3TN0C 1T5XB 3QEGL 4I18A 4K7PY 5EO1B 4NM8L 3QCVL 1NFDF 5E8DH 5CZKA 2BSRB 1CD8A 2FIRT 4HGMA 4LU5H 4P2RE 4MCZB 1NLBH 1GZQA 1BFOB 2NXZC 5DJCB 3BUYB 2B1HL 4KQ3H 5B38A 1C8PA 2CKBH 5SX4I 4X7DC 3GSOB 1IGTB 3V6FB 1KELH 5IESH 5E8OB 4DN4H 4R2GC 2YC1A 1J86A 3NVQA 5D7LB 4MNQA 3O4LD 3OKOB 5KSAB 1UB6B 3PP4H 5L8LB 4AT6B 5FOBA 1XF4A 4PRAB 5CP7B 4U1IA 3UBXI 3BVNA 4NHUB 4FA8A 5E4EC 4D9QE 3HZYA 4HWBH 2A6DB 4HF5L 3EO9H 3OX8B 5B8CC 3KPMB 1SJXA 1KIRA 2MMXA 4KPHL 5GSRA 5DHYB 1CIUA 4GQ9H 4RNRB 2LAAA 2NY2C 1NL0H 3HAEG 3B2VH 2PTTA 1JF1A 5EUOA 3MLRL 3LOWA 2ZKHH 2FCBA 2VKWA 3FQXB 4OCWH 4OM1H 1J8HE 1XMWA 1IMHC 2JB5H 3HR5B 5E99L 3VXMA 3EJZC 5CILH 5F9WB 4ZXBC 4KY1L 5I15L 1GOHA 2OS7A 2Z93A 3GI9H 2OTUA 3LCYA 4KAQH 1B0GA 4TUJA 4XX1E 1LO0H 2CIKB 4K94L 3FQRA 4TUKL 3LZFH 3NA9H 2EC9T 2VDQH 1KULA 4HUKB 4IRJB 1HI6B 4P2RD 4XZUB 4RWYH 5HHOA 4YDIL 2GI7A 1UXSA 1SJVA 2MCG1 5C0FB 1UH4A 1M7IB 2EDBA 3MJGX 3WFHB 2Q3AA 5FB8B 4XPBH 2W9LA 5SWSA 1HEZA 2HH0L 5BRZD 3V5DB 5CUSH 4POYA 1T1ZB 5C6TH 2DICA 4L3ED 4LFHG 5IMMA 5KSUA 5DMIL 2GFBA 2H2SC 2UVEA 4G9DA 4NQDE 3IJSA 4EUPB 3F65A 5J1TC 2ZG3A 4O2FA 1G7QA 2ITCA 3MZTA 4JGJA 3P77A 3OF6A 1AHWB 1FN4B 4G6JL 4U3CA 3D3VD 5AUMB 3HPJA 2Q8AH 3ZHKA 3QEGH 3FN0L 2VDLL 3LH2L 4X6DE 5EU6A 5A2JH 3D3VB 12E8H 4KJYB 5HJ3A 4P3CL 2AJXL 3K7UA 4G42A 5HGAA 4PJDE 1NGYA 2NR6D 1S7SB 3UMTA 1MRDL 4KI1A 4OI9A 2W0LA 2NY7H 4EXKA 1RQ5A 1FG2A 2GIYA 2E7BA 1T7ZA 1ZHNB 1IGJB 2EDYA 1NC2D 4JHWH 4GUPB 1T5WB 4HWUA 5IOPB 2ICWJ 3TJEL 3N1GC 3V9FA 1P69B 4UT9H 1QSEB 5LAXB 3PF2A 1QR1B 5I74C 4MJIA 1G7HA 4FS0A 5T33H 3T77A 3MLWL 4MJ5B 1SYVA 5DEGA 2OQJB 4IIQC 5KS9F 4HGWA 2NX5B 2WNGA 4PRIB 3KLHC 4X0KA 5B3JE 5GRJL 3T08A 1ZT7A 4K3DL 5HHME 2IG2L 4J3XA 4XCFH 5DJXA 1KXQE 5KN5B 3OKLB 3O6FB 3KPRE 1EGJA 2D0FA 2XV6B 1MFAH 3B2VL 4KXZH 3TPUB 1VFBA 3P0VL 4BELD 4U33A 2JIXA 4WTZG 4BA8A 4RGOH 2HFFB 4ZS7H 1CLCA 2CO6B 3W9EA 4GMTH 2IPKA 2MCPL 1MRCL 1HHJB 5MEPB 3HI1A 5GIRA 2A9NL 2VIRB 2B5IC 3UEZA 1UA6L 2JB6B 1RZ8B 4JZOA 3TA3C 3SDCB 1MUJB 5D2NC 2X41A 2I9LA 5IMOB 4U49A 1RMFL 1LE5B 4NZUL 2UWEE 4KHXL 1JIBA 2Z9TA 1F58L 2WWKT 3FQWB 2ESVD 3SO3C 5L9DL 5IW1B 1ZVHA 5IHZA 4H5SB 5HY9A 4OGYH 3ET9F 4MSWA 4NKMB 1TJGH 4G8FB 4S1DC 1FNSH 4LU5L 5ADPH 3LS5L 3UAJC 5CUSL 3B9AA 3IVKB 1ULVA 2AV1B 3T0EE 4YK4C 1XGUA 3SO3B 1PG7H 4ALAL 5E8PA 4N5UA 2ZUUA 4XNYL 3QXAB 3OXSA 2YK1L 4KKAD 5IUSA 1A1MA 4B41A 1JZ2A 1R5WA 5D70L 4HF5H 1I3UA 3BGFB 1D5IL 4JY4B 4RMSA 1E6JH 3NCJH 4BSVB 4C4KT 3WMSA 1TZGH 1CFVL 1KCRH 4QHKJ 2PCPB 4ETQA 5JO5B 2A83B 4LP5A 3BPCA 1QBBA 3LQAC 1R5IB 3IDJA 3O6FC 3DX7A 4G8GE 4NRZB 4FG6C 2V5RA 4LHUB 1T1XA 2MWCA 2VZVA 2VWEE 4E0RB 5D6DA 4EI5B 5DQJA 4EDWL 1FNGB 2FB4H 2CLZA 5IM7B 3SE4C 4J1UB 3HUJF 2XOTA 5TQ2L 1MLCB 1YMHB 4HUNB 4TPRL 4TSAL 4XBEH 1C08B 2FJFA 4LARH 1WC7A 1EAPA 4DQOL 2UV3A 2DQJH 1MFCH 3IXAB 2I07B 3OAYK 2BDNH 2JJVA 3WFCL 2DQIH 4XT1C 4JGUA 3HE6A 3A67H 1F3JB 1QSFD 3WO4B 3EOTH 4NUGL 1JRHI 1OF2B 1U3HD 5TF0A 5SWQB 4M7LT 3ESUF 1AQDA 1BX2A 3VXRA 5F3BB 3SDAC 5CKGA 2EDRA 4YWGH 3QQNA 4OQTH 4QT5A 2IFFH 4DN3L 5ICYA 3ARGA 1QA9B 4X7TA 4OJFH 1KCLA 5ICXB 4DEPC 3KPRA 3QUZA 2PO6A 4PR5A 3V6OC 5ENWA 1I9JL 5I1IL 3MRJA 2X89A 1HNFA 2J1KA 1HQRA 1BPVA 2CRMA 1EEYA 5D7LE 1DVFC 1EXUA 4DVBB 1B4RA 1RZIB 4MS8D 4WFHE 2XN9E 5C9KA 5DZNA 1F00I 1FAIL 2LVEA 3SDCD 3KPRD 4LPXA 4JRXA 2O5ZL 4HKJA 4HIEA 4J3VA 4PJGF 3WIHH 1RULL 3KPSA 4OZ4A 2L4OA 1S9WA 4K3JL 3ARVA 4ZD3H 3X13B 3QFJE 2D31A 4HUWA 4XC3H 4RMTA 1FZKB 2BNQA 2ERJC 3TJHD 3GEWB 5FYKH 2Q8BH 3MV01 4HHAB 4AEHL 5GRJH 3HRZB 4NIKB 1EO5A 1DL7H 2AEQL 3F6IA 3UDWA 2P4AB 4GKSA 1X3DA 1DQQA 1ZANL 3CU7A 1E6JL 3QFDA 4PJIF 5F9WC 4ZXBB 5JOPE 2NYYC 3VGAB 5H35A 1MFAL 3UTZB 4RMWA 2Y72A 1R3KB 3IXTB 2X4TB 1A7PL 3I6GA 3BE1H 1YC7A 4G6MH 2P44B 4AQOA 3GMLB 4X9IA 3CSBA 2E3VA 2ZUTA 1U3HB 5IBLC 4X7EC 1IAIH 1MFBH 1OSPL 3HUJE 1Y18A 4QGTA 5JW3H 3HNVL 2IANE 4N8VG 4XBEL 2BVOA 4LARL 2XA8H 3MJ8A 1K4CA 4HUUA 4YFDB 4MNQD 4Y4HB 5L9DH 5IJVA 2WQ8A 4OFPA 1OD9A 3GHBL 5F1NB 1GGBL 4X6BB 5IGXH 4RA0C 5BV7B 4YZFE 4HG4J 5CSGA 5E6IA 4S2SA 2A77L 1X5IA 1C16B 2DS4A 3P4NB 4Z7WB 1KLGA 2P5WA 3SE4A 2VH5H 4CVUA 5EFIB 4EI5D 1JPSL 4AENB 4UIMB 5IB2B 4BQCA 3FZUC 1JUFB 3UPCA 4NQDB 2LFGA 3GMQB 3GJEA 2CDFB 3TN0B 1A7BA 3MRBA 4WWKA 4YHZH 1KB5A 3FB5A 4XP4H 5HYSG 1UZ6E 4LSTH 3RWGB 4H0GA 4Y7MA 3LN9A 4ZUWB 3W81A 1OWRM 3C5JB 3L6FA 1UWXH 3FT2B 1IKFH 3P9WB 3O6LH 3Q5TA 4N8CL 5JUEL 4Z7UF 3OR7B 3VXSB 1K4DB 4JFFE 2QSQA 2EDJA 3Q1SL 1D5IH 4NNYB 3WIFA 2CDEA 5TGBA 1S9VB 3EYVB 2R2BB 3FHQA 4JKPH 3F7QA 4PJFA 3V4PL 4Y16C 4L5FH 2ICWI 3GIVA 3AM8C 1ORSA 4EIGB 4JG1H 1MRFH 1GH7A 4ZXBD 4FTVE 4G80A 3AM8A 2JF1A 5LQBH 5J0BA 2W07A 4XTRD 5EOCH 3D0VA 4ZTPL 3VCLB 1HXMB 5K9JL 3RVVC 2ZCLL 4LQFL 1Z9LA 4Y5VA 3EO0A 3JWDC 5FO9B 1YPZB 5TQ0L 3MYZA 4BH7B 3P4OA 1BEYL 2DWEA 2ESVE 1XIWB 2WW8A 2XNAA 3TLRA 2X7LA 3BGMB 1R6VA 3MCKA 4L4JA 1A7OL 4JRXE 5T5FL 4LEOB 1JZ8A 1JNLH 1MAML 2DQUL 4A2LA 4XWGL 3TA3A 3FB8A 2BNUA 3LKSA 2UWEF 4F9LA 3OKEA 3H3KA 5T1DH 3RTQD 1S7WA 4AEFA 3DMMC 2V2XA 4HPOH 1QLFB 2OI9C 3MBEC 4KHTL 1KCKA 1F3DH 3FT4B 1JZ3A 3RKDC 1I8KB 4G6FD 2PXYD 5I16B 2PETA 4YPGA 3B9EA 4NRYA 1HHKB 2OXHA 4HEME 2P5EE 5C09A 5CKAA 1UJ3B 1KB5H 4XC1H 3BXNA 1U8OA 4PJAA 2XN9B 3PWPB 3VXRD 1ZTXL 1WIOA 4EJ1C 3VWJA 5IVNA 2QHRL 5C0AB 4P2OC 5DD5H 4YFEA 5DLML 3MLYH 4OZGB 3MUGA 3KPQA 1CDHA 4UB0H 3C08H 1Z5LB 3QFJB 3BZEB 4OV5B 4NYLA 1T0NA 3HG1D 3QSKB 5EU7E 2BHZA 5JR1H 3G9AB 3OJMB 4NP4H 4XVSL 5DRXA 4OCYL 4ZS6C 1KCSH 4JDTL 3VXQA 2MJWA 3CFKB 5DC4B 2A74A 4JPKL 5JXEA 4XCYB 5EO0B 3Q6FB 3U2SA 4PJHA 4UT6L 2HJLA 4KVNL 4MLIA 2R4RL 4HZAA 5I1GL 2PR4L 3MYJA 3BIBX 1U8KA 1J87A 3QZWA 4PRNB 1OB1A 4Q9RH 4NJ9L 1U8LA 4RAHA 3OKKA 3IFLH 4GW5B 1YUHA 1RUKH 3IKCA 2GJ6B 5DRWA 3LDBB 4UZGA 2VYRE 3V2AR 3S96B 1R3LA 5DO2D 3JV0A 4GQPH 2BJML 2G5BA 1JWSA 3QUXC 3HUJB 1D9KD 1CFNB 2WBJC 2X4SB 2AQ1A 3MO1B 2VABA 4P4RB 1J0ZA 3D39B 3UX9B 4BSWA 3GI8L 3PIQB 3L5XH 4C56E 2ATKB 3MRRA 3UBXA 5CEZH 3WS3B 3RL1A 5KVEH 4QCIA 3VD7A 4PLJC 4X99A 4UOJA 3DUSA 1NC2A 5I0DA 3ULVD 4E9LA 4ELKA 3U7WL 1JNLL 1CE6B 5D1ZC 1H0DB 2BC4B 2DLGA 1F8TL 2CJUL 4MHHG 3DRTB 3WYRA 4IMLB 1RZ7H 1TTGA 4EI6A 3FFCB 3LEYL 2NY3B 3GBNH 4YHIB 4BKLA 4CADB 1A9BB 5I1DB 3QQ3A 4Q7DA 1D5ZB 1Q9WB 3DMMA 3QYCA 2WLYA 1QRND 2EXWC 5ESVB 4LSTL 5F6HJ 4UOW1 1JYXA 4O58L 2EDTA 4CL7A 2AXGB 5F9AC 1OPGL 1BQHA 3NIDF 4GS7C 4OLUL 1MJJA 3C60A 4N1EA 1P9MC 2HTKD 3MA9H 1F2XK 4PP1D 3LV3B 4FQQB 3DJ9A 3T0EB 3PP3K 1NPUA 3GNMH 4JQVA 5DD3L 4I48A 2NXZD 1OLZA 5BS0D 4P2YA 5DMYA 3FN9A 1VEOA 5CEYB 1N5AA 2X4PB 3MLZH 3FO1A 3WLWD 2OZ4A 3GUTA 1D7FA 1JGLL 2PYEB 1ZGLA 2HVJB 4NQUA 4BQ8A 1VADA 3WNPA 3RJDA 1WFNA 1VACA 5ADOL 5ISZD 3EAKA 3AU1A 1A6UL 1S7XA 3E0GA 4Y5VC 1BJMA 3HZMA 4XRCA 2DWDA 4OCYH 4XVUC 3B8YA 1KCSL 1OARH 2VDOH 3HMXL 3ZHDA 2UVFA 5C0JA 1I1YB 1QFHA 1UM5H 1QSZA 1IBGL 3L5IA 3MLTB 2OTWB 5E24E 4O2EB 1CIDA 3IDNA 3ZKQD 3ULVF 2OL3B 4Y4FB 3FOMB 2KZ1B 5ICZB 3L3JB 1RU9L 5E9DE 3RVWD 1TQBC 5F88B 4QXGL 3L3DB 4ZFGH 1BF8A 5D1QD 3BESR 4XP5L 3VFGH 2GYSA 3BHBB 3OR6B 2B1AH 2VERN 4HIIA 3P30L 5C0RH 2W0FB 4XGZB 3TBWA 1G7LB 3GSWB 3MOQA 4R4BB 5JHDB 2HVKB 4RGNC 2AQ3A 1IKNC 2FZ3B 1L9NA 3OHXB 4P9HL 3ZYOA 3VXPB 5DEFB 1DJSA 2H6PA 3QAZC 1ZT4B 4JFDE 3RBGA 3IU4H 3V5KA 4NQDD 3TZVC 5KVFL 2BSTA 3BH9B 4G8GB 3E8UL 1N3NB 2XZAH 4JZJA 5FGCE 4CVXB 5F6IB 1T6VN 4X6CF 5DR5H 5MEOB 2LU3A 5FYLE 1MOEA 5FK9B 1G1CA 1MVUA 5GS3A 1S7TB 5F44A 5IROA 4UV4L 3L5WB 4D0CA 4ZOCA 3BEVA 3U0PB 5GS0D 1E28A 1DLFH 3ULSA 3R06A 4MDIB 4JM2C 4H1LG 4ODUB 1V3JA 3RY6A 5IV2A 2EYSB 3MR9A 3PP4L 4J8RB 3OG6B 5DGQA 1RHHA 3BEWA 5JPMB 2BFVH 3V52L 2BSRA 5HGBA 1ZVSA 5MEQA 3OKNA 2C1PB 4LSVH 4MCZA 2VR5A 1BWWA 4RX4D 2QQKL 2AK4D 3CMGA 3BUYA 4JDTH 3UXFA 3CFDA 2GTWB 3TESA 1T03L 1JHKH 4P46D 1F6AA 4ONHA 4KVNH 1KCVH 4OZIE 4P99A 5D1XB 1SVCP 5JZ7D 3EDEA 4JY6B 2P48B 3DSNA 3QR2A 3RWEA 1UB6A 5KS9E 3AVEA 2XICA 1A1OA 2HT4D 2VZ3A 1NBVH 4I4WA 3ARZA 2WBJA 4OF5A 2ESVB 3GSQB 4FMFA 1HDMA 1YEIH 4QHNB 1NGPH 4NHUA 5DJ0B 4UDUB 1TLKA 1R3JB 1U58B 3RTQB 4WHYH 1YNLL 4KTDL 3VGDA 4HIJB 3T0BA 1G9NH 4XP6L 1VFMA 3NA9L 1IBGH 4OD2A 2HKHL 4R2GD 1YMMB 3SKOA 1UWXK 3UTQB 3OAUH 2D4FA 3JV6B 4U31A 3UZQA 3P9LA 4R7NA 1S7RB 1EZVX 1EZVY 4AIZB 4HBCH 4YC2C 5D7IE 3V0AC 3O3AB 4URTB 5A43C 1INEL 3UPRA 5C0BB 1FRGH 4X8JB 4IRZH 4Q0XH 4O51A 3DVIA 1F13A 1WVZA 2DQHH 3LEYH 5IIEA 2I60H 4KRNA 5DFVC 1IFHH 4P2OA 2GCYB 1RUMH 3DMMD 1CF8L 1J10A 2PYFB 1G6VK 4ZUTB 4QXTA 3QO0A 5E9DA 4NN6C 5SWSB 5IMKB 3QZWG 3TYGL 4LCWD 5IK3A 2Q6WA 2GHWB 3WHE1 4OZHB 4N8PA 3NCYS 3KNBB 1ED3B 4HUVA 4KZEL 3O8XA 4MB3A 5INDA 2IANB 4F15B 3SCMB 4JG0H 1I7ZA 1PD6A 3FB6A 1AHWA 1FN4A 2APBA 3RIAF 4IDJH 3AAZA 1WWAX 4OZGF 1LP9E 3MLZL 1KPRA 1U8JB 5EORL 5KANG 3UZVB 3DV4B 3JWOH 4GBXB 1J5OH 3MRPA 3QIWD 4TNVF 2A1WL 3C8HA 1I7RB 4Q9QH 3BRDA 1H9VA 4J3OC 3UP1A 5J6GA 4M43L 2C7UB 4M7JH 1BFTA 2MHAA 1UM4L 2WIMA 5GGSA 4M7ZB 3MREA 3E3QC 2ZJSH 1J0YA 3P73A 4FMKA 4MJ5A 4ZS7L 1MCSA 3UTSA 1SM3H 4ZOAA 3D39E 5HHQA 3MA7B 5A3ID 3H0TB 1DP0A 4EN3C 2DIBA 4JFHD 2Y9RT 3C6LA 3DURB 4NQVA 2HN7B 2W0KA 1NLDH 2YXFA 3RX7A 5I6XC 5IKCA 3X3FL 4XP6H 5F1SA 3EOYG 3RHWF 2XRAL 4GMSH 3ES6B 3WJJC 3WNOA 4QEGA 4YHML 3PWVA 3VD5A 1G9EA 3H42L 3P2TA 2F19L 4P5TD 5J89A 4I18C 1AI1L 1F42A 5KVFH 4CW1B 4DOHB 5C0GA 2HFFA 3QCUL 1MIMH 2IPKB 4N0FA 2VL5A 5BO1L 4J7RA 3N06B 3TV3L 2ZUQB 3GIZH 1EHLL 1F11A 3VE0B 4Y89A 1YPZF 4GKZB 1HILB 4JZOB 4QOKB 3QQ4A 2PF6A 3DTXB 3D85B 1L7IL 5EZLA 4UU9B 3TVMC 3KYMA 1YYML 5GRXG 3GJFH 3QDMA 2XKNB 1TNNA 1Q0YL 5J11C 5I8CB 2FBJL 3HAEB 4QY8B 5E8EA 4XCFL 1JZ4A 1Z0NA 4RMUA 1UQSA 2AJZB 3O3UN 3RX5A 5J56B 1HH9A 1QSVA 3MRMA 3MNZA 3AUVA 1JFQH 4O9HH 5CHNA 3QISA 1TCRA 5B39G 1OP3H 1U8NB 2AV1A 1I1RA 3QXUA 4PJBA 4GRLC 1JWUB 5CIPA 1MJ8L 3WV0A 1XZ0A 1FORH 1TETH 4PD4K 2A73B 3PGFL 4TUOB 2A9NH 3K3QA 3BH8A 4HPYL 5ERWA 1U95B 4I3GA 3IT8D 3BAEL 2CMRH 4C83A 4JLRA 1NBVL 1IL1A 2FJHA 3T4YA 2AJSL 3QDJD 3QDGE 1EERB 2EZ0C 2DQDH 1E6OH 2AK4A 1PZ5A 3RWHA 3DX9A 4M43H 3GMPB 1QLRA 2BVPB 4JY4A 4DGIL 1T1YA 4N0CC 2V2TA 1WAAE 2XWTA 3MJ7A 1RIHH 5GS1C 5AAWA 1ZS8B 2F5BH 3AXLB 4PBWD 2E27L 3IDUA 4R90H 1P7HL 1U9KA 3VWKD 1KBGH 1P9MA 4HCRA 3DRQB 5ILTL 1RIVL 3HC3L 3TH2T 1JRHL 2OTPA 3VRJA 2PNDA 2JELL 1LP9A 1TXKA 1ZWIB 3TBSB 1JZ5A 1HH6B 4OT1L 1WFTA 1BP3B 4GG6A 5DQJB 1VFOA 4XNYH 4OFYA 3FB7A 1KTLA 4YR6B 5B3JF 2EICA 2ICWB 4QRSB 3CCHA 2G9HA 5E6ID 2VMFA 5GGRY 1D3CA 2DQHL 2DBLH 2XI9A 4YHOL 5F1IA 4NQEB 2ADJA 4Y5YC 2HLAB 2XY2A 4NHCL 3SKJL 5C0EA 4YHNA 1HQ4B 1J7VR 3S9DB 3PHOB 3IDMA 1KUMA 2FEEL 5FKAB 3F7YB 3ULVH 5MHSD 1JHTB 1Q1JH 5FECA 2Z0BA 5CBEB 1CK0H 4PJIB 3UTSE 1VSCA 3JTSA 3TH4T 5IR1A 1E4WH 4HSQA 4TOYH 3WIHL 1BBJB 1D5BA 4ODHH 1AD9B 3P9MB 5GRVL 4P59H 3B9KB 1FVCA 5D4QA 4BFGA 3VFNA 2Q8BL 4YHPA 2B2XL 4LLAA 4GKNA 3DX6B 8CGTA 1U8PA 1FFRA 1GOGA 1I1AC 1NGXB 3M1BB 4JFFB 4CJ1A 3I9GL 3D2UA 4F7PA 1VA9A 3QDJA 5DJ8B 1YQVL 3H7BA 5E95B 3WL9B 5DHVB 3REWB 1OCWL 3MPCA 4KRPC 4LSSL 1HINL 3V0VA 3GMRA 3S3SA 3VFPA 1KIPA 5ESQA 5EN2A 4K2UL 1CVRA 4N9GB 5F9JB 4KKBC 2NY6C 4NKOB 1J8HB 3MV9A 4FQIL 3WIHA 4FFYH 3QJHA 3NIGF 2AQ2A 3WSQH 5BS0A 5D7IB 3HNVH 3O3BB 2AJSH 5J57B 4PJGA 3RDTB 5JW4N 5KW9H 2CK2A 5FCUH 1Q9KB 4P9MH 2CUIA 4PJCA 5AZ2L 2AGJL 3WD5H 3QI9C 2D03L 2QSCL 3D87B 1YNTA 1JGEB 4RZCB 3VWJC 1A8JH 5I8KL 3WLBA 4RDQF 5TE6L 3H42H 5DVNA 1KEML 5JW4R 5E1HB 4PJBE 4OAWB 1MCWW 1MH5A 3I6GB 3CFBA 1Z0MA 1EEUA 2HFEB 4KI5C 3FQNA 4FQCH 1P84K 3EYUH 5EZIH 5HD8C 3QIWC 1GZPA 4LF3B 4XP4L 1T6WA 5GGUB 2VZTA 5DUBB 3O2VH 4EEEA 2NPLX 1H3TA 5CJ8A 1N7MH 1L7IH 3LSOA 2DBLL 2FR4A 1RUAH 5CINL 2FH8A 1KT2B 1FLRH 3R0MA 2D7TH 1CG9A 1CLZL 4TQEL 5BQ7B 5E5UB 4F33B 2J6EL 4GT7A 2DOCA 4JPVH 4YHYC 1DBAH 2JE8A 2GAZB 3V4PH 2CLVA 5EIQA 1LMKA 2YSSB 5GRZA 3ULUF 4LVHB 1HHGB 2WP3O 2VZ1A 4Q6IB 3B2UD 4WWKD 3MLSL 5D7KE 4HXBL 1YA5A 1BM3L 1T3FB 4H0HB 2ZOKA 4PBXA 1D6EB 5K9JH 2Z92B 3V4VL 2FJGB 5IBUG 3TF7C 2UZXB 3RI5F 3LKNB 4OLYL 4LLQB 1MRFL 3BAEH 5HI5C 5D7KD 3ARSA 3EUUA 3I9GH 3H3PH 3K0WA 1H3WM 4TTDC 1R0AL 1IC7H 1OL0A 1C5DA 1HKLL 1TQCC 3LD8B 3MV8E 5CLTA 5EZOH 4ZFOL 5IB1B 4Y5XC 3FT2A 2F53E 1EFXB 2J2ZA 4PJ5D 5TH2A 2YUVA 3TIDB 5E00A 3WIFB 3I84A 3CH1B 3MACH 5T5FH 5DJYB 4CMMA 2VXTL 3KXFA 4FQIH 3QUYD 5DYOA 2R0LH 3BPNB 3MXVH 5C3TA 3T0AA 1A7OH 3T8XA 2IH3B 3CX5J 5T1DL 4LKXA 4M8VA 3QEQD 2WINA 1HXMA 1S9XA 1CTNA 1EH9A 1UXWA 2AKRB 3QDJE 1JZ7A 2A38A 3GSOA 5DI8A 3MQIA 3WD5L 1RI8A 4U6YB 2YC1B 3E6HB 5D71L 1JNNL 5AWNL 4FQ1H 4I13B 2R0ZH 4PJBF 5H8DA 4U1IB 2YD1A 4LLVB 5F7KC 1CLYL 2FECI 1DQLL 4OLWL 4TNVK 3OX8A 1PSKL 1XF3A 5DJCA 1N5YL 1SEQL 4FTVB 2FLBT 3I3EA 4P2QE 4KK5C 2WP3T 3V6FA 1U42A 2KPNA 5DFWH 2FECL 2VQ1B 2WIIA 2NY1D 1VGKA 2FO4A 2R0KL 5IG7B 4UAOB 4RFNC 5J8OA 4HMEA 2RQ8A 3UTOA 4AY0A 5FOBB 2B2XH 5DD5L 1FLRL 4P5TA 3PV7A 1AFVL 2YMXL 1GGYA 4JN2B 3WFDL 5H94B 1EFQA 5T5NG 4HXAL 4NQTA 3VWKC 3HFML 3VW3H 2X89D 4IOFC 4Z7OE 1MAKA 2NY5L 3H9SD 4PTTB 4LSSH 4WW2F 3MRHA 4OZHE 4P46B 2VDKH 4ZG1A 3D5OF 4S1QL 2G75A 3IS1X 5CLWA 5D9SA 5D96C 1MJ7H 3KYOA 4U6VL 5EPMA 4WTWA 3MV11 3EKCA 4DGYH 4U6XB 3QI9D 3QNZB 5EZOL 2C1OB 4RWYL 1Q9LB 2EDDA 1O5DT 3FL7A 3DYMA 4H1LA 5DURB 2A74B 2JJTA 4P23D 2D03H 4P49A 3HPJB 4XPAL 2EDXA 4OZHF 4OV6F 2Y07H 3L3IA 2OJZL 1A3LL 5DJZA 5E2TH 3QIUA 5IT2H 3T2PA 3BJLA 2HMIC 3D69A 4ZO6A 3WXVH 2CJUH 5FA3B 4GOSA 3RVTC 1OAXH 5ELIA 4PJ5E 1F4WH 4ZDHA 1S7SA 1FDLL 1JNHB 3RWCA 4HULB 3S96A 3VWKB 3V6OA 5C0NC 1IGJA 5DLMH 2VXVL 5I1KL 2ATPB 1BZ9B 1WIUA 3PABA 4OGAC 3G6JE 4XVTH 5LBSH 3SN6N 4C4KO 5DRNA 3KDMA 1AD0B 3GBNL 2YWZA 4U05A 4OZFA 4E5XB 5EO9B 1B88A 4KJWC 1NBZA 3RL1B 1TZHB 2V5MA 1OSZB 4X83A 3L95B 3ESVF 3EYFB 1AGFA 2QL1A 4WHTA 4ODXB 4PBVC 1OPGH 3LKQA 3S98A 5HYSA 5FOJA 1ITBB 3SE9L 3DI3B 3DRTA 1BQUA 2IALA 1BJ1J 4LNVA 3BSZH 3PQYB 3RGVB 1QR1A 2UZIL 4BKLB 4OI8A 4ZMAT 5J12C 4X7FC 5K59E 3RVVD 3QIBC 4I9WE 3PWJA 3RWIB 1LDPH 2FYYB 1KEGL 5DUMH 2IG2H 4A2MA 4M5YL 5BW7A 4QXWA 2W92A 2EO9A 1I1AD 3HI6H 1FO0B 3PDOB 3MC0A 4JM2D 4MYWB 1A4KA 5LXGL 4C57C 2V9TA 2VITB 2EDQA 3QCTL 3TVMA 4RGOL 5DK0B 4XB8A 3QUYA 1G0YR 1W0YT 3EBAA 2IMMA 3BP7A 3BZFB 4P2QA 5GGRB 1AE6L 3U46A 2OP4L 3MNVB 5DJDA 3V95A 2OZ4H 1IGYA 1ZHLA 4MSWB 2F54B 2AW2A 1UWGL 1CI5A 4X5LA 3MFGB 1YY8B 4YIQB 3RWDA 4ODVH 5GGTH 4Y5XB 4Y1AE 1RJYA 3FFDA 2X40A 5F6IC 3ZHLA 3AU1B 1Q94B 3P30H 1HN1A 3MRNA 4JJ5B 4Z18A 1LE5A 1AR1D 1JI1A 2YUZA 3OKYA 5C0JB 3O6FD 4OGYL 5EUKA 1VFAB 1Y0LA 3LQZB 1LEKB 4OCRH 4XHJD 5IW1A 4XPGL 2C9AA 1EJOL 1QFWH 3IETA 2OL3A 3P3YA 2FX7H 1S3KH 4RWHA 4Q6IC 3MRQB 1T7VA 2B4CC 4LVHC 3L3DA 3TT3L 4M1DL 5DF0A 4JHWL 2QR0A 3L1OL 1T21A 1KLFA 1DBBL 1UADC 1MHEB 5HYJB 4HFWA 4JR9H 3VG0H 1T2QL 3CX5K 5I19H 5KZCB 4MQXC 4P5MB 1FNHA 2OXGA 5E7FA 3V0WH 3VFSA 1T89A 1QBML 2VKXA 4ZQKB 4AG4H 3DBXB 1DE4B 3MJ9H 5EC2B 2V6HA 9CGTA 2APTA 1ITCA 1X7QB 5I2IB 4LHUA 1K6QH 5M7QA 4PV9B 2QQLH 2AV7A 2Y7QB 3QIWB 4CVZA 1FNGA 1F90H 3OAYH 5E2WL 4HS6A 5IM7A 2AI0H 4P23A 1HK6A 5I9QC 2YEZA 4IJ3C 5MHSE 4M6OL 5IVZA 3CDGB 2E7LC 2VDMH 4NKIL 1PKQE 4UNVA 1MVUB 4KK8C 1EPFA 3L5WA 1DBKH 1CQKA 3O8XC 1ORQA 2GK0B 3HI5L 4M1CD 1CN4A 3HZVA 5F8QC 5LCVL 1NGPL 3R06B 4MDIA 3B6SB 3CVIH 4Z9KB 1TJHH 4HKBA 3QI9B 2FB4L 2HWZH 2FGWL 3HE6B 4M5YH 4GKOA 4K3EL 3WEXB 3VI3F 2IBBA 4U1SB 2A6DA 4NCC1 1KIRB 3RDTC 4IIQA 1MCPL 3U36A 1LWRA 3RY4A 4GRWE 5MEQB 1AQDB 1BX2B 3O9WB 1MLCA 2FEEI 1G6RH 1EDQA 1J05B 4JFEB 4YUEL 3VXRB 5FYJL 2FJFB 1KTKE 1A5FH 5EBWA 4I3RL 2DRUA 2GEEA 4QKXB 2XKSA 1QA9A 3NIFE 4OLZL 3SGJA 1N4XH 3MRJB 1JF5A 4OZIB 4PJFF 4NZDA 3RWEB 4R9HA 4G9FE 1B0GB 3EFDH 5DD0L 2UUDH 1L7TL 1F4AA 2JCCE 5AZEL 1EUTA 4ACPA 1P2CB 2ADIA 1GC1H 5A2KH 4J6RL 2OL3H 4M1CC 4JHZA 4G8IB 3IDIA 5HHOB 1JMZA 2SEBA 4QT5B 5ICYB 4HIEB 4UQ3A 3B9KC 4U1GB 3OKMA 3SKOB 2JJUA 4GRMA 3GMNA 5ENWB 1CU4H 1K8IB 4WU5A 2VXSH 2FNBA 1MCOH 2IBGA 3NAAL 3MLUH 2VB5A 5CS7A 4B53A 4DW2L 3BX7C 3LEXA 5F71A 4I0CC 4FXGB 3U30C 2HFGH 3G6DH 3W0WA 1B6DA 5D2LF 4R8WH 1X6LA 3IJSB 4EUPA 5BXFA 3GB7A 1PW3A 5I66B 1JBJA 1H3VA 3N85L 4HKJB 1LO4H 4Y5YB 3JWOL 4JFED 3QG7H 2VLKE 1BLNB 3HS0B 3K80A 3S37L 3RAJL 1DSFL 1GOFA 3GMLA 3ARXA 4W6WB 4PYHA 4KJPC 2AEQH 5DGRA 4F80A 3HI6L 3PWNB 4YO0B 1XCQA 5E1AB 4YQXH 5LGKA 4ZXBA 4HJJH 4BZ1L 2YPVL 2RR3A 1XT5A 2VDML 4NKIH 3GSNH 5DSCA 5MERB 1FFQA 4Z7VA 5IF0B 4CN6A 1JGVL 1Z9MA 3B9KD 1FYTA 1KN4L 2OR9H 3ULUC 1IGIH 4MJIB 5F9DC 4CAGA 1RJLA 1G7IB 1QHPA 3KLSA 4LHJB 2DJSA 5EWIL 5E6IB 4ELMB 1UWGH 4HJ0C 4Z95L 4GRLD 2Y06L 3TO2A 5ACLA 3SDDC 4PJEA 3TZVA 1MCPH 5D93C 1FP5A 1YJDL 1VKXA 1KJ3L 4H26B 5I1HL 4Y16D 4FG6D 2VLRD 5JZ7C 3S6CA 4UIKL 1WAAF 4OCXL 5JPNB 5DD1L 4Y4HA 4WU7A 1RK0B 2DYPA 1QPPA 4GRLB 3TV3H 4KJPD 1A6VH 1JL8A 3P73B 2RAMA 2EECA 1CICD 3ARWA 3UTSB 1ZSDA 3EZJB 5GIRB 1T20A 4JY5L 4Y4HD 2VIRA 3VXSA 4NSKA 5GISL 1DBBH 2H32A 5T3XD 4IOSD 3TBVA 2H8PA 4LCYA 2I9LB 1KLUB 4LCWA 5C0ND 2YBRA 4HIXL 5FYKU 5J11B 2DTMH 1UCBH 3BP6B 2FL5A 2GTZB 4K3JH 4CNIA 4KKCD 4B5EA 1A7NL 5AYQA 3VFRA 3MRFB 2AEPH 2IQ9L 4L4TA 4NKMA 3EYSL 1JPTL 3QBTB 3W39B 1MCOL 2EIDA 4DKDC 3ZTJG 3OR7A 4X80H 2AI0L 4HW6A 3RWJA 3W11D 2XA3A 2DWEB 1U6AL 3WNKA 1HILA 4I18B 5GGVL 3VJ6A 4M1GL 5HHMD 2EDWA 4J3SA 1L6ZA 5EOCL 2UWEB 2ITDA 3ARQA 1JK8B 4JDZA 5T3XL 5DEZA 2Q86B 3QDMB 4LEOA 1SY6L 3VGHA 3WCYA 5I6XB 1I3GH 2V2WB 5FO7A 2IPTH 2AJYH 4JFOB 4EN3B 4D8PA 5T3ZH 3IDYC 1FZJA 5DTFB 5E8OA 4YDIH 3IRPX 1S7WB 4JRXD 1HE7A 4KTEH 4WY7L 3ILPB 3ULUE 4BH8A 3QXVA 3MRLA 1XR8B 5LWYH 1MIML 1R5IA 1NEZG 3CDCA 3H9YA 4M7ZC 3HZYB 4U3HA 1QLEH 2NY0C 4R90L 4QWWC 1I8KA 1I9IL 2VUYA 4X6DF 3EFDL 5C09B 1OY3B 1WUNT 1JTTA 2JELH 2X4UB 2YZ1A 4NQSA 4RNRA 4JREB 1JF1B 5EBGA 4BFBD 1YYLL 4YDKL 2Q8AL 3DX9B 4NDMB 1QLRB 2BVPA 4GLRH 3EO1A 1GJIA 4KWUA 5IWLC 1LNUA 1MCJA 5BRZE 5T3ZE 3T0VA 3H9HA 2NY4D 3RP1A 3MRGA 4TUJB 3DO7A 4HX1B 3FQRB 4RMVA 3G5VA 3MUY1 2FHBA 5E4IA 2N7AA 1IGCL 4NN6B 4MLSA 1EO8L 3TBSA 1HI6A 3LAFA 3KPTA 3QDGD 4GBXD 1T7XA 4RIRA 1AR2A 2HJLB 1E4WL 1KTLB 2PW2A 4HIXH 5C0FA 3Q0HA 2D2OA 2DTML 3GM8A 3PJSB 4ONFH 4FABL 3SJVD 4MNGB 3ARGB 1U8KB 2JTDA 2R2HB 4X7TB 4FZEL 4K3HA 4LMQE 3IAPA 1SBSL 1YY9C 4NQEA 4G6AC 2ADJB 2AEPL 1QZ1A 4HMCA 1HEZB 4I0PD 3V5DA 3W9DB 4CU7A 4WIQA 3PL6B 1HIML 1DSFH 3BKCH 3BZEA 2G5RA 1AKJA 1M05A 4WGVB 1QO3A 5J6HA 3PL6C 2BNRD 3OB0H 1A7RH 2PO6C 1UKTA 4QHMA 4O2FB 4YC2B 1KNOA 3ARGC 3QWRD 3CGTA 4FFYL 5EO0A 4YXLH 5EZJB 1PKQB 4BSWB 4D3CH 1T04B 5HYQB 4RFOL 5ILTH 2UYLB 1BF2A 2B4CL 4TN9A 4MJIE 4MNQE 5IHUL 1LP9F 1E27B 1ADQH 2X70A 3X13A 2BJMH 2FSEB 3S35X 3UJTL 4ZNEA 1QBLL 3RTQC 5GJSH 4G6FB 3KPNB 4LLUB 1IILE 2G5BB 4R0LC 3MRCB 4ZPVB 2HKFH 3GI8H 5D7JA 2VABB 4Y88A 3STLA 4UTAH 5KOMC 1X4ZA 2B1HH 4KQ3L 5FHBL 1SQ2N 2AJ3A 2VLKB 4FFWD 4G6AD 3ZE1F 5GXBB 1J8HA 4HGWB 5EC1B 3WIIH 3EYUL 4GAFB 1XF5A 5BS0B 2NY0B 5HHPA 4ODHL 1H0DA 4CU8A 3BP4A 3C60B 4LDEB 1X5GA 3PDDA 4F7CA 4I8DA 1T4KA 1KTDB 3FFCA 4X6CB 2BVOB 2Y6SD 3QULB 1WITA 4PLOB 1WBXA 5IJVB 3FO1B 1W72L 4UUJB 4GXUM 2J88H 5GS2H 3QEQB 4NP4L 5CEZD 1A9EA 5C0BE 3CXDL 1CLZH 4Z0BH 1F6LL 5CILL 5SWSE 2KQMA 3NTCL 1OM3H 1FFOA 3STZB 1OTTD 4P5KB 1CFQB 4OF8A 3K1DA 3VI4E 3T0EA 5KSVA 4NQDA 3MLTA 4KK8D 4OLYH 4Y16A 3GJEB 4OIBA 5DUBA 3V4UL 1HSBB 3FB5B 2DL9A 3ECBB 3C5SA 5FM4A 3UTPD 3HLAA 4WV1B 1T89C 3BDBA 5HPMB 1ZLUH 4X6DA 5EU6E 3CVHB 4ZUWA 1OARL 4PRDB 3X3GH 2EXYC 3BKYL 4G7YH 3VXNB 1S7VB 5IB5B 3RPIB 2ZOLA 4J4PC 1WV7T 4RCAA 3CFCH 2DMKA 4DTGH 5ICZA 4G8GA 4CDHA 3UO1H 5CBAA 3BGAA 5DVKA 2ICCA 2CDGA 1UENA 3QDAA 1RZ7L 4K7PX 5F7LB 1UWEH 2NXYD 2VQUA 3S4SA 3QPQD 2AS5M 4APQD 5H2BB 1NCCL 1Q9OB 5C09D 4NRZA 3W0WD 2DLEA 2APXA 3KS0H 5D93B 3QEUA 4E0RA 2YRPA 5GGQL 3WN5B 5JTWA 4CVXA 4X6EA 5ACMA 3T8XB 2IH3A 3T1FB 3CZJA 1RZJL 3OB8A 3U82B 1VGEL 3DLQR 4HWNA 1EBAA 5JIKA 1PQZB 1UEYA 1MFDL 4JEGB 2XZQL 3ZSSA 1F6AB 4LGRB 3JUZA 3ULSB 3OKOA 3HMWL 4X4YB 5EIIA 3ULUH 4ONFL 1CLOH 5C0BD 3UDWC 2A6JA 3MLVH 1DANU 4AEHH 2CK0H 5IFAL 4I4WB 2QQKH 3LQAH 5IJKA 5DHYA 1KFAH 3NTCH 3MV7E 4M6MH 5D1ZB 1DUYA 3WFEL 1S5HB 1MRCH 3D48R 4MA1C 1I85C 3U4BH 2DLTA 1OHQA 1C7SA 2XN9A 4J3UA 4JO4H 1NCDH 1PY4A 2R2EA 5FYJD 4NN5C 4F2MA 2EKJA 4PJ7E 4JVWA 4N9OB 2NCMA 2WIIB 3TPKA 1UFUA 4JY6A 3O2DH 1QP1A 4EVNB 5C08B 3K4DA 4XP5H 4KHXH 4PRHD 4MX7A 5CWSB 4PGJA 3QFJA 1BQSA 2WBJB 5L6YH 1YEDA 4JN2A 2WAHA 3B5HA 3QEHB 5GSVB 4MD4B 3OGOE 5C0BA 2C3GA 1G7QB 2ITCB 2I27N 1QOKA 3D2UD 4PGCB 5F9OL 4HK3N 4L4VE 4OIIH 5CSBA 5TDNA 1S9WB 4EQ3A 3JVGA 5CSZB 5KTEH 5L7XL 4W68A 5T5NF 1R3IH 4O5LL 1MWAL 3O41B 2BNQB 1K2DB 1FE8L 4WEUD 5IVXF 4OI7A 4ZNCD 5TDPA 4NQXA 1MPAL 1Y6NR 1LE9B 3VA2C 4M6AA 5DQDL 4KV5F 2F5AH 3D18B 1FDLH 3HUJA 5IOPA 1IFHL 3OQ3B 1FV1B 4ZO8A 3R0NA 5KJRH 2IANA 2NQCA 3X12B 3ARGD 5IIEB 4DKFH 2V7NB 2KZWA 3C6LD 3IXTA 4KGLA 5DEGB 3O9WC 3NCJL 1INDL 3AAZB 4OZIF 4PGEB 3S36H 3JWDH 5HJ3B 4ENED 5DA0B 3PGDA 4DAGH 2FWOA 2NX5A 1I3RB 1U3HA 5DURD 3IDGA 1NGYB 3QNXB 3QH3A 1EHXA 4QXTB 5D6DC 1QPXA 2BY3A 4LPVA 5DK2A 1NC2B 2R9HC 4N1CA 4S1QH 4XHJC 2DIAA 2ENYA 5F7MC 2F9BT 3N9GH 2X44D 3WUWG 3NZHH 4FZ8H 6CGTA 1JNHA 3O6FA 4DFIA 3TPUA 2Q7NA 3DETC 5GGSB 3GKWH 5E08L 4LNRB 2D0HA 2H2PC 2X5PA 4ZPTA 3HMWH 1SYVB 3ULUL 1BGXH 5CP3H 4IJ3B 2ICEB 4JPWH 5TE7H 1KJ2B 3DMMB 3HE7C 4JDVB 3GBMH 4E5XA 4K9EL 3FRPG 1U2CA 2WMPA 5K9QI 1OOAA 4PRIA 4XPFL 5HHQB 2VLLB 3ZYIA 4AM0B 3GO1L 1SMAA 1G9NL 3MV9D 5DJXB 3UCRA 1GGTA 1LO5A 2ADGB 4S11A 5KN5A 4PRPE 3H7LA 1KB5B 3DVGB 5T1LB 1BAFH 2WSKA 4G43B 4NQCD 4NUGH 1MJUL 3O0RH 3VGFA 4Z0XB 4ZO9A 5I71B 1XIWC 4XWOD 3C5JA 3L6FB 4XXCC 1G0XA 3SDAD 4PUBH 1ZXQA 3C9NB 1NLDL 4M5ZL 4I1NB 5HGHB 1J18A 3K4ZA 3TT1H 5C6WH 5E5RB 1DDHA 5JA8B 3VFWA 2N56A 4ZUSA 5IQ7L 1S9VA 1WISA 2HN7A 3PGCA 1JN6A 2F54D 3HZMB 2DWDB 4MQ7A 3Q5OA 1PLGH 1DLHB 4CJ0A 3DTXA 5C71A 3D9AH 2OTWA 3A0OA 3DXAD 5HY9B 1MCQA 3OXSB 1A14H 3BP7B 2XKNA 3N0PB 3ZTJH 3FOMA 1IAMA 1FAIH 3L3JA 1V8HA 3QUZD 1KELL 1R5WB 1U8HA 5I19L 4OLVL 5JOPD 5A2IH 1MF2H 4XAWH 4Z8FL 1DQJB 2Z31C 4W4OC 3WXWH 4HBQA 4R4ND 3MCKB 5JDSA 1FC1A 3OTTA 1NCWL 1MQKH 1CLOL 4V1DA 3F62A 1I8LA 4RGMB 2X1XR 3SBWC 3S3JA 1GHFH 4EI5A 1FH5L 1H3PH 3EGSA 5AAMA 2R1WA 5EA0L 1Q8MA 4G6ML 2DQCL 4V2BA 1AXTL 4IM8A 1AE6H 2ICES 2P5EA 4HKZB 5C09E 1A64A 5L8KB 4AJ0A 5LCVH 2V2XB 3GI9L 3HG1E 4NUJB 2A83A 3RGVC 3C2AH 1JI2A 4RX4A 3IAQA 3QP3A 2K7QA 4X7SL 2MKLC 3FT4A 1YEFL 1N2RA 4TUOA 4OF0A 1XH3A 3DUUA 5ALBL 3MROB 1I8IB 3V7AE 1E6OL 4PY7A 1IL1B 2FJHB 3UYRH 1ERNA 3NZ8A 1F4HA 3FQUB 1OF2A 3R1GL 1ADQA 4NQED 2NX5E 3QIWA 4CVZB 1BOGB 4PGZA 1PZ5B 1WC7B 3VXMD 4XBGB 1D5XB 3DGGB 4OFDA 4OZGA 4I3RH 1B4JL 1Z5LA 1PYWB 5FUZL 3W2DH 5JOFB 1CWVA 5CZXC 3HR6A 1QKZL 3VRJB 1IVLA 1AO7B 5CD3B 3DIFB 5E8NA 1MI5A 4PJDF 4OGAD 4D0BA 2ERJB 1H15A 4PS4L 1CXHA 2ZUWA 4JRXB 5I1JH 3S34H 1G7PB 4TVPD 3SKJH 4PRPA 2DLFH 3KPSB 1U8LB 3PHQA 3WKML 3UTQA 3DX6A 4XCCL 4FQJL 4JKPL 1FAKT 2ZZUT 4M6OH 3MLRH 1CU4L 1QTYT 1DVFB 1H5BC 4JHAL 3OJDA 1DQQB 1WBYA 1GIGH 5IR1B 3CXHJ 2OBGA 4CRPA 3RL2B 4BM7A 1WFUA 4PGBA 4KAQL 3WXWL 2VL4A 1FFPB 1R3KA 1Z6JT 3NACL 5JHLL 5F7EH 4G8IA 4PJ9A 1YMMD 4V2CB 3ZTNL 5GZNC 4FTVD 1MQKL 1DQDL 3QXWA 2X6MA 1A21A 3V6ZA 4N0UE 1YECH 1MFEL 4P48A 2LVCA 1A6UH 3WDJA 2JIXD 1EO7A 1II4E 3O3BA 1DBML 3VFVB 4LRNH 3O81A 3QO0B 1Y18B 2YUWA 4OCMC 4PJXA 4DGIH 1KN4H 1KIPB 2BVQB 3AY4C 2P7TB 4LLWB 4NRXB 4UAOC 2MCPH 4FXGA 4GSDL 2R1YA 3CD4A 4HUUB 1XIWD 2V17H 2VLJB 5DVOA 2RHEA 3O6MH 3FRPA 2X4TA 1TENA 3H6JA 2MPAL 4JQXA 1RMFH 3LN5B 3SY0A 3M8OL 4S2SB 2ZNXA 5C0DA 4V1DE 5FAAA 2I24N 2QKIA 1CGTA 3FFCD 1OAUH 1VHPA 4GBXA 1FZOA 1SJEA 4L8DB 4AENA 5IB2A 1WICA 1UYWL 1NCAL 1JUFA 1NBYB 3ZSTA 2QQQA 5F1KC 2DJ4A 3ORJA 2FDBP 3TN0A 3M17A 4C56D 2B39A 1S7QA 4GAJH 2Z8RA 1A3RH 3IU4L 1WWCA 4QRPB 5DJ6A 1T80A 4UIKH 1PX3A 1UZ8B 4XC1L 5J3HC 4O2CB 3IFOB 4H8WC 3GUTB 4UTBL 3VXSD 4WW2A 5GS1A 1FGVH 4PY8I 3QXTA 1G7IA 4AMKH 5ADPL 5EZIL 2NW3A 1N0XL 3AC0A 1DQMH 1NMBL 3MCLL 2W65A 3D39D 2HFEA 1WZLA 3BGFC 2H1PL 3EYOB 1BREA 3C8KB 4XXDA 2VR9A 2PTVA 2HT2C 2BOCA 4KGJA 4NO0B 4WENB 4WWKB 3GIVB 5BZDA 3OV6A 4Z7UE 3SE8H 3U6RA 4LVNB 1KCUL 1V05A 2K1MA 5JOEA 5F88A 2X1WL 3GM0A 3WS6A 3KJ4B 1ZGLM 1X5FA 3TBTB 4CW1A 4OGXL 3V52H 3LD8C 4GRLA 4ENEC 4XWOC 5B39A 5D1QB 4DCQB 2VNCA 4E41B 3RUGF 4NNYA 2CDEB 5TGBB 1IGIL 2GKIA 4WWID 1AGDA 3LEVH 4HJGB 4EDWH 2NTSP 1FFNB 1I9RL 2HT4C 4WO4C 4X7SH 5JHLH 4ISVA 4MCYA 4XPTH 2X4RA 1R0AH 4N68A 4CMHB 1J8KA 3SDCC 5BVPL 4F57H 1GYAA 1MCHA 4D9LH 5KVEL 4BH7A 1NFIA 5EUOF 3MBXL 3G6AB 3BEVB 2QSCH 3RKPA 2C3WA 5ECJE 3ZDZE 4TSAH 4XP9L 1J88A 1A4JB 5E00B 5C0IB 5A1AA 4DUVA 5TE6H 1J1PH 3UTTB 5AYUL 5DJYA 3CUPA 4U6YA 1WZ1L 3E6HA 1R24A 2XQYG 4JRYA 1B0WA 1CTOA 3MRKA 2EH8H 4XVUD 4RQQA 3VRIA 5LWYL 2DIJA 5AEAA 1RURL 4XVJH 2ITDB 1JK8A 4JDZB 1ZVSB 4NRYB 4Y19A 2IFFL 1OAUL 5KVMC 1S5IH 4M7KL 3OKEB 1TJIH 3V7MA 4BQ6A 3LKPB 1T22A 3MV7B 4YFLF 2QADD 3GSNB 4NO5B 1FL6A 1JHLL 3ARYA 2KQNA 5AWNH 3VWJB 1FZJB 3LS4H 2DD8H 4GXVH 5I1JL 4QNPE 4L4VB 1P1ZA 1RZGA 5I74B 1XR8A 5D2NE 5JW4Q 4MXVE 4NYLB 4XBPB 4Y2DA 1UCTA 3IDXH 4DUWA 2AEWA 2XZCH 3VXQB 5DUPH 2EDLA 3C2SA 4AK1A 3FB7B 1YMMA 3A6CH 5HI5D 5DJ2A 5IG7A 3MUGB 3H2WA 1IM3B 3OF6D 4PRNA 1QSFA 4G6KH 4R7NB 2FD6L 1PG7W 4KRPB 3JUYA 5D5ME 3FZUD 1XGQA 4FP8L 4BQ9A 1AY1H 1R3LB 4EBQH 3CLEL 1J0IA 4KI5F 3QNZA 3CFKA 4FHBD 3G5VB 5EBLB 4JHBA 3RVWC 4HD9A 3MRHB 4WW1B 4P46A 1ZA3B 3WKNA 3BI9X 5IHUH 4L9DA 4Q2ZA 4A6YH 2Y36L 4U6VH 1KJ2H 2YD7A 2Q76B 3DI2B 5MP6L 4IBLT 4RFOH 2E9WA 1OTTC 3SQBA 4I3SL 5ID1A 2GJ6A 5DRWB 3FMGH 4JFPB 2H9GA 1BD2D 3BPOB 4ZFFB 1QSEE 1NBQA 3WL9A 5L8JB 4NOFA 4HUVB 1FNFA 3MOBH 1B3JA 3V0VB 5FM5M 4YHIA 4CADA 4L8BA 3MRRB 5MI0C 3LB6D 3CC5A 4YBHA 2VTFA 1GAFL 5HYQA 5ESVA 4HIHA 2EXYD 4KMQA 2UYLA 3VU2A 4X99B 2DYPD 2NY2B 4X4ME 4RAVB 1CE6A 1I7RA 2MQ0A 3L95A 3TYFB 4J3TA 4W6YB 2EIBA 1CE1L 1RULH 2P1YA 5L88L 4D9RE 4HLZG 3LV3A 4X98B 3LKQB 4ZODA 5E4EB 2J4WL 3BZ4A 5IBTL 3WFZA 3BT2H 3S7GA 1YYMH 4Z5RB 3SEPA 4GAGL 4PG9B 3RGVA 5GRUH 2JJSA 1CBVL 1A6WL 3HB3C 4R2GB 1OM3L 4LSUH 1NANH 5LGJA 4LMQI 2J6EA 3CAFA 4NQVB 4YGVB 4JG1L 4LCIH 5IBLD 5HHPB 1GVIA 1I1YA 1I8LC 2NXZB 4MHHI 2E7CA 2W9DL 3FQWA 4Y19E 3MJ9A 3T09A 1GPOL 1GZPB 4HGKC 3MTRA 4LCUB 2HRPH 3EHBC 4XTRC 3IDNB 4F7CB 3PWVB 5CJXA 3LEVL 1OGAE 4P2QB 4AEEA 1KG0A 1ETZB 3ZMRA 1SJHB 3QIBD 3PHSA 5ITFA 5D7LD 5IW6B 3PWJB 3RWIA 1NGWB 3NPZB 5FGSA 5E0QA 4UBDC 4QOKE 2DKMA 3EJYD 4UUJA 5JLZA 1FO0A 1PGRB 3BP5B 1BJ1H 4Y5XA 1SYSA 3E3QE 1G7LA 3GSWA 4R4BA 1OAKH 1N6UA 1H8NA 1K9TA 3QQ4B 1B90A 2Z4QB 3QWOB 1HHGA 1V3MA 4DTGL 3TVMB 3QXAA 3L3GB 1JGUL 4N0YH 4PPTA 3I3BA 1IM9A 4U4BA 3N1QC 3C5ZC 4QY8A 4M3KB 3VMNA 3S4SG 4WI8A 1IC5L 3FMGL 4BJLA 1RZFH 2EC8A 5GGSY 5D5MA 1ZEAH 3O4OB 2Y5EA 3HC4L 5EOTB 2YRLA 4WW2C 5E70A 1Q94A 3RX8A 3DX7B 4X5XB 3S5LB 2R4SH 5JORA 1Z2KA 3LQZA 1C5CL 4OCSL 4ZQKA 1T1XB 3N1MC 3AFLA 1DE4A 4M62H 4I0PB 2EYSA 2RIKA 1MHHB 4R96A 1D9KC 1VCAA 3BDXA 1T0MB 3FQTB 1VEMA 2C1PA 5E7BA 4LKXB 3QRFM 4WFGD 3BWAA 2QR0B 4OFYD 5FUOH 1T21B 1S7TA 1CE1H 2GJ6E 3HE7A 4N0RA 2GTWA 4MQXD 1UACL 2VXQL 3NH7H 1ND0B 3MV8B 4ZTPH 1JZ6A 2IAMD 4TRPL 2EDOA 3BT2L 5D1XA 3VFSB 1IEAB 3EO9L 1DBJH 1JPGB 2ILLA 1N59A 1WCBA 4K7FA 4PJDB 3T2OA 1KFAL 1X7QA 1XEDA 3OKDA 3SGEI 1BHGA 1QFUL 4ONGL 1DZBA 5C0CB 4QHNA 5DJ0A 5JIPA 4JQVC 4C59B 4UDUA 5E56A 4UILL 4U1SA 4XMPL 5GRYA 1SHMA 4XVSH 1OAZH 2I5YH 3UJJL 3AS0A 4X4MA 4YR6A 4O02L 1QRNE 2R2CA 1PVHA 3O9WA 4JPKH 3ZLQC 4PJ9C 5GS0L 2QADC 2JKXA 5F1IB 3SCMC 4OKVA 3U4BL 1MAMH 1PQZA 4WFEE 4F15C 2GK0A 2HWZL 2FO4B 4H8WL 4ORGB 2C3VB 1D5MA 4HKXA 5EIIB 3P9LB 3BDYL 2X9XA 1A1OB 2IFGA 4I2XB 4HKBB 2BSED 3PWUA 1KTRL 5GGTL 4MAUL 1AGBA 1QYGL 4PJIA 3O3AA 2PXYC 2X09A 1A1NA 1G7JA 1G6RL 2A6KB 4BQBA 4X8JA 2H26B 1BBJA 5BVJA 3VWJD 2YN3A 2IAMC 4OCRL 4LPTA 4JFEA 3QCVH 5KSBA 4O5LH 3U48A 4OFVA 2GCYA 2XACC 1MCWM 2VQTA 5F7NC 4WUUD 3R8BB 4UQ3B 4S1RL 3UBXG 2DM4A 4HUWB 2PYFA 1FIGH 1OGAA 5F3HB 2BMKA 4LSPL 5DVLA 4QF1A 3CFJB 1TCMA 3BQUC 3AB0B 4Q97A 3OXRA 1P4BL 4JB9L 3NGBC 3QFDB 3L3OA 2DM3A 1CDIA 4NGHH 4U6XA 3LQMA 3KNBA 1JGDA 1ED3A 5FKPA 4R26L 4M8QB 3FN0H 1Z3GL 1G9NC 1X4XA 3MJ9L 4PJCF 3JWDL 1EVTC 3MV9B 4ZS6D 3TC9A 3FB6B 3RU8H 2Q3ZA 2SEBB 1K6QL 2NY2D 1C5CH 3QHFL 4OCSH 4KPHH 1KPRB 1U8JA 2JB5L 4IS6B 5J7CC 2BY2A 3BPLC 5T1LD 1QFWM 3S36L 4PJGB 5E9DB 2CKBA 4X9GA 3QO1A 1K2DA 5IMKA 4XB7A 3ILQC 3ELAT 3PWNA 4ZDHB 3LEXB 4U7KA 4XP1L 4LCIL 2NW2A 4NQXB 3MA9L 4QHUB 5DJAB 2M2DA 2VLRB 1GPOH 2AJVH 4TRPH 2YS4A 4Q6YA 3RAJH 5C07D 3DX8B 5TE4H 3X11B 4WHCA 5DRNB 3SJVB 2E7HA 3GO1H 1RSFA 4HWZB 4PRBA 1HKLH 5C70A 4ONGH 4PLJD 1PG7X 5HDBF 1CT8A 1NJ9B 3GBML 2FWOB 3C6LB 3DURA 4HC1A 2F5BL 3TNMA 1Q0XH 2QQNH 5GGUA 5CJOH 1WZMA 4QXGH 1JRHH 2GJZB 1AGCA 4ZFGL 2XTJC 4MXQD 3WUWA 1MWAH 3LVEA 3S37X 3U7WH 2OK0L 5JPNA 3PQYA 1CFSB 2ED8A 1MCCA 2YRZA 5C0AD 4ZPTB 1FVEB 5C0GB 1MJUH 2YPLB 3BDYH 1W72A 1CXLA 12E8L 1TNMA 3Q6GL 4NZUH 1IC5H 3ILQD 2CLVB 3TM6A 2WUCH 1CL7H 4OF6A 1G9ML 4X9HA 3CMOL 4PJFB 2OL3L 4NO3B 2CO7B 3AS2A 5EULV 1ORSB 2VR4A 4FFZL 2YPLE 4OLUH 4RGNB 3TO4B 4WU7B 1YPZE 3VFRB 3KXFE 1YEGL 2PUQT 5FO9A 4LIQE 1NFDE 2BXZA 5D72L 1T20B 3NCMA 3RZCD 4JN1L 1FQ9C 1KC5L 1U8NA 1UH3A 3TCLB 2A6IB 4HDIA 3VFWB 4PJIE 1J8HD 4Y4FC 2X7LB 1VB9A 1HCVA 3N1PC 4JJ5A 1KLUA 1BIIB 2YA2A 2GUOB 4UU9A 4IRSA 1XZ0B 1QHOA 2V5TA 3KYMB 3RU8L 1RIUH 3OZ9H 5INCA 3T0ED 3EYSH 2UWEA 3SHSA 2N7BA 5M95B 4P57B 1MWAB 4IOFD 3HFMH 2CXKA 5I75B 2HYMA 3FB8B 2BNUB 4LSRH 3MRQA 4QRRA 1RJCA 4D8PB 1KIQB 4Z7NE 3ZE0F 3GMPA 3O0RL 1I1FB 1QLFA 5K59F 5F70A 1KCVL 2X1OA 1F58H 5T3XH 3MJ7B 2FHCA 5IFJB 3IRZA 4UV7H 4GW4B 2HG5A 5TE4L 3RUGB 4Z95H 5JDSB 4C83B 2XTJB 5CGYC 4GS7B 5I2IA 5J9PB 2VDNL 4FFVC 4PV9A 2VUOA 4WFFE 1HH6A 2Z91A 3KPSD 4KDTA 5E94B 3I85A 4GG6B 4JJHA 3E8UH 2XQBL 2ICWA 4QRSA 1MSPA 1MEXH 4NM4L 3RY5A 2W91A 2Z31D 5DDHA 1CXEA 2XWTB 5L2KB 2X2YA 4YDJB 3AGVA 5EB9A 3L3HB 1LNUB 2EKSA 4LVOB 2AXFA 2EDEA 5H94A 3I6LD 1K5NA 1EK3A 1P4LA 3W5MA 2HT3C 1TTUA 2V5YA 5DRXB 3VRLF 2R69H 1JHTA 2N1KA 4RBPK 2D0GA 5FECB 5D70H 4YAQB 3MROA 5LJYH 3Q6FA 4NGHL 3HZKB 5I1KH 1FO0H 5L2KE 4PJ8D 1UCBL 4ZTOL 3OGCB 2RBLA 3RHWK 4P4KD 2COQA 1D5XA 3U7AA 3D1MC 1NSNL 1RUML 3PWPD 2R2HA 4GW5A 1QQDB 4QHLB 1JPTH 3QUXB 5F6HI 3HG1B 5KVDH 3PHOA 5DJ8A 3SQOH 3PL6A 1ZLWK 1CGSH 3LDBC 1M05B 4EOWL 2X9WA 4L3EB 3NGBB 1O7VA 3ARFC 4AL8H 3NFPA 3QFJD 4QHMB 4YGAB 2FHFA 2AERT 3QIUC 2YD4A 4NC0B 1P2CA 2J8UE 4X9FA 1L4IA 2EYTB 2C3HA 2AJVL 3TFKD 3C87A 2OJEA 3MMEB 1MCDA 2ZNWA 2JJTC 2NY5C 3CSGA 5GZND 3VXRE 4I0KA 2XN9D 1KPVA 2IPTL 3D2UB 4F7PB 3FRUA 3W9DA 2FSEA 4TPRH 1AKJB 4WU5B 5DHVA 3REWA 2A9ML 2DQJL 4WTZA 3G5XB 5KVGL 1IC4H 1NFDA 4TYUA 1B4JH 4PRHA 3ARBC 4MXWL 3STLB 1D5ZA 4HUMB 4WUUE 5BXFB 1OAYH 4KZDH 2NY0D 4PJ9D 5JW5A 2GJJA 4PGBB 4YHKL 3QJHB 2V17L 3C5ZD 3JXAA 5F7HA 2QADB 2ORBH 4HLZH 4PJ9B 1S8DA 3ARDA 5HBBA 2O5YH 3SDXE 3RDTA 1JCKA 3WHE0 4WUKH 3AREB 2HLFC 2R1XB 4GAJL 2F58L 3C60D 4ZPVA 1SMOA 3SDYH 4P5TC 1XF2B 1CGUA 2VZUA 3MBEB 4XX1G 4LFHD 1KTDA 2ARJB 4X6CA 2FBOJ 3GSXA 3B3IA 5BO1H 2NMSA 3QUML 3O4LB 3MUJA 1EHLH 2H3NB 4GJTB 3QCUH 3FT3B 5BQ7A 1GIGL 1D6VH 1HWHB 2R0KH 1DANT 3O3EB 5FYKL 1UB5B 1J1OL 2RCSL 4HFUH 3RGHA 4KUZH 1FFOB 4LDLB 4QRPE 3RA7H 4K3GA 3OAZK 1Y6MR 4JGMA 1KJVA 4OCNC 4Y4FA 2NNAA 4MNGE 5H37H 4M00A 3KYKL 4FZEH 4AG4L 4I0PC 3LSOB 2Z92A 1W72H 5DJDB 2FR4B 2X42A 2I9TA 3BKCL 1DBMH 2GSIB 3C5SB 2DYPB 4OLXL 1A7PH 4F33A 4PYGA 3QEQA 5ACZA 2CGRH 4XGZA 4XPHH 3TBWB 5JHDA 1RJYB 3FFDB 4X5WB 5F7DB 3O4OC 1TETL 1L0YA 3NN8A 3D25A 1OP5K 4ZAKC 3DNKA 3STZA 3RKDD 3O2WH 2DLHA 5IP4A 5EUKB 3TN0D 3TNNB 5HHXH 4L1DA 5KSVB 1X4YA 1U8QA 1EX0A 3L7EB 4Y16B 1NKOA 1BWMA 3KXFB 3VDAA 5DYOB 3U6RB 5J3HD 4NBZB 1QBLH 2P43B 4TUKH 1IQDB 1LD9B 1H8SA 4L4TB 3CVHA 1KN2L 2WINB 1CL7I 5HYJA 3V79C 1CICA 1J1PL 1A3LH 5E2TL 3ALWA 3SPVB 1L6XA 5IT2L 3EOBA 4FQHA 5C2BH 2EDFA 1NGZA 3LMJL 2EH8L 2HT2D 2WK2A 1Q9OA 3ARUA 4KROC 4ODUA 5EC2A 2I26N 4U1JA 2XTJD 4YHKH 2BHUA 1A0QH 4PV8A 1RHHB 3BEWB 1IGML 2XFXA 4LASL 4PJHF 1HOCA 1LVEA 1EHNA 4YBLC 4ELMF 5E9DD 4F7MA 2CLRB 1NAMH 2NY6D 2R69L 4FTVA 4KRLB 5BV7C 3IYLW 4WI9A 5IVZB 3T1FA 1NKRA 4L9LB 2EE3A 3S4SB 3MGOA 5ID0A 2JK5A 2NR6C 4LOUC 2P8LA 3KWWB 1MLBA 2WWKO 1DUZB 1FL5A 2VDLH 3LH2H 3U9UB 3ULVL 3F6LA 4LSDA 1Q38A 2VZSA 4S0TD 4PRHE 2DD8L 4GXVL 3UTTA 1X9QA 4RGNE 1YN6B 4NHCH 1JFQL 4O9HL 3SE9H 4C58B 2ESVA 3GSQA 4HV8A 3ZDXE 3V5HA 3MRKB 5I8OH 3RIFF 3P4MA 4RA3A 2UZIH 1WT5A 4LP4A 1CFTB 1XGRB 3ME0A 32C2A 4PTTA 4Y19B 2RCSH 5D1ZA 2VXUH 4TNWF 4Y1AA 2BVUA 3MGTA 1LO4L 2GITA 2R2EB 4PLKD 3JV6A 4P2QD 3TP4A 3NFSH 5LXGH 3DXAB 5F89B 2UY6A 5MI0B 1RZKC 1EUUA 1RZGB 4D9RD 3B8SA 3MBXH 1RAMA 4H20H 3MRGB 2C1OA 2VISA 2MQCA 2GY5A 1Q9LA 15C8L 3BPOC 3T4AB 1WZ1H 1DUYB 2E27H 5ETUA 3RNQA 2E9IA 3PNWB 1MNUL 1UM6H 4P3DB 2O5XH 3GMNB 2CRZA 4HPOL 3KYOB 4PJAE 4HH9A 5C08A 1NAKH 4MNGA 4QRUA 5CCKH 3THML 5CAYB 5FF6B 5EPMB 4L3EE 1QSFB 5C0CD 3RVUD 4YHOH 3D6GA 1BD2E 3RWCB 3ZT6A 4S1DD 3QEHA 4ZUVA 3D18A 1BZ9A 5I66A 2CD0A 2L7UA 2Q87A 1PKQA 2R29L 1W0VA 1AD0A 5SWZE 1CDUA 4JR9L 4LVEA 4OZFB 2PYEE 4Q2ZB 1BLNA 1FE8H 5DJZB 4PJHE 3MRPB 1GAFH 4WHYG 4FN0A 4LASH 5FA3A 1IEBB 4OZFH 2A0LD 2OMBA 3C08L 5FHAL 3U0TB 3VH8B 3FTGB 5HI4C 4KUZL 4KMTH 1IEHA 3MREB 4PJEE 1B2WL 1OGTA 1ZA6A 1ZE3C 4PB9L 8FABB 3O3DB 1MREH 1I4FB 2B7DT 3PABB 2YK1H 3F7VA 3JV4B 5HYFA 3OJ2C 2J6EH 3X12A 4O58H 4LNRA 4DGVL 4LEXH 3TBYB 3MLVL 4L8BB 3CC5B 3MX0A 5EO9A 3T2NL 3SOBL 4BUHA 4OM1L 4ZSOB 3KYAA 1OSZA 1NUFA 5C3LD 5I15H 4QRPD 1N8ZA 3BKMH 4HQQH 4R6UA 1AXSA 3DROA 3WHXA 2PYED 5DC0A 4RAVA 4ZUUA 4G9FA 2XT1B 4OD3H 4KUCF 3BP4B 1LO5B 3EJZD 5DRZB 4UT7L 3GJFB 2XPGB 4JFXB 5GGVH 3O4LE 4HXBH 4JPWL 4YE4L 1MY7A 1OQXA 2DQTL 1V7NL 1IAOA 3GFUA 1IGYB 3IAGC 1ZHLB 5I17A 4MWFA 5CEZL 4XPFH 4LRIC 3VXTB 1X6NA 3CDYA 4YXHL 2X4NA 4YIQA 2DB8A 3RWDB 5DZLA 5E2UL 5TQ2H 1A9EB 5HGHA 2VXTH 3ZE2E 1ZHKA 5DHXB 1U8IA 2H8PB 4LCYB 4PG2A 3PXJA 5E5MB 5DK0A 1R3HB 1VFAA 1JV5A 3HA0A 2C4FU 5T1LA 4WO4B 3U1SL 1HSAB 3OSKA 4D2NA 4JO3L 4QWWD 4ZFOB 1UQSB 2AJZA 4M5ZH 4HC1H 1SJHA 1K8DA 2DMBA 5ITFB 1QFPA 5HPMA 3MNZB 3F8UB 3C9NA 2F5AL 4NKDA 4OM0L 2X05A 5D1QC 4HFWB 5IVXB 5JLZB 4GAGH 3PGCB 1IAKB 5HDBE 4Q9CA 2D7TL 4OJFL 3HC4H 3HPLB 5DQ9B 2L0DA 3NAAH 3VJ6B 3KJ4C 4LSUL 3RPIA 2ZOLB 4NT6B 4JPVL 4U0QB 1OGAD 1SEQH 1NDMB 1NCNA 4FQ1L 4E42B 2MKWA 2CR3A 3NABH 4AH2B 1FYTE 5D2NB 4WWKC 4K71B 4OSUH 3U0WH 4L8SB 4KUCD 2AV7B 2YD6A 5FO7B 2YKLH 1L0XA 4JKLA 4OD1L 2CDGB 1W8OA 5C08E 5BW7C 1PBYA 3CU1A 4AIXA 4ZYKA 2JJSC 1H3UA 5ADOH 2Z8WC 3IFNH 2P5EB 4HKZA 1NANI 5E08H 1MCLA 1ONQA 1C12A 4TSCH 4W70A 1NCUA 3MRLB 5T1MA 3AXLA 2P24A 4ONOA 3SKNA 1U93B 4K07A 1BBDH 4HJJL 1E4KA 1XH3B 4JO1L 1YDPA 3HNSH 3ROLB 5BRZA 4OF3A 2BVEA 3HMXH 4CN1A 4R96B 1I8IA 3WN5A 4PY7B 3GBLA 1P4IL 3NZ8B 5GJTH 4IIQB 3U36B 4YJZL 4NQSB 1IZJA 2NY5H 1RHFA 2YEZB 3WJLC 4PY8J 3VXSE 5T1KB 3TWCL 3MOAH 5ANMB 5HDQL 6FABH 1KGCE 3D3VE 5CD5C 4LCWE 3QA3B 1N2RB 5C0RL 5L0QC 1VESA 5FKAA 3THMH 1N59B 1WCBB 4JRWA 4HX1A 4LDOB 5GJSL 3WEXA 1NEZA 4L4TE 5J1SC 1AO7A 5CD3A 4PP1C 5IFHH 4F37F 3ROOB 3VXUA 4G5ZL 1TZIA 3CIQA 5EBWB 1FIGL 1DQLH 4ODWB 5IGXL 4YHPB 1AHWC 3G6JB 3K2UL 5JMOC 2DQGH 4F2MB 3OKMB 3L5JA 4X8XA 2OJZH 1E0OB 4OLVH 4OIAA 5JOFA 4XNQB 2BCKA 4U7MA 4OZIA 4HKXB 3UYOD 5J6HB 4I2XA 4IRSD 4FXLA 1NUNB 1Z3GH 3DIFA 5EN2B 1DLFL 2IWGA 3CZFA 1AGBB 3LIZH 3QPXL 4MA8L 4M9PA 3QHFH 3ZKXB 1G6RA 4MD4A 3GB7B 4GW1A 1T2XA 1NCWH 3IDIB 4Y4KC 3GSVB 1G7PA 1FFPA 4IRJC 3BD5A 4G7VL 5DWUH 4XMLL 3VGEA 4IEFB 2X70B 4H25B 3L3KA 3PHQB 1U6AH 3V6ZB 1QR4A 3CPLB 3SGEH 3SDAA 1LO2L 1H3GA 4O02H 3OB0K 5TDPB 1CDCA 4PJCB 5LVEA 1OTUD 3JZ7A 5KSAD 1E4XH 4HWEH 4LLWA 4NRXA 3WFBH 1YQ2A 5DSCB 2EEDA 5F7EL 2AJ3B 4M8QA 2Q1EA 5C7XL 1FYTB 2M8XA 2V7NA 4RDQG 2VAAA 3BWUC 4OAWA 3CLFL 1YEIL 4JPIB 1A6AB 3PV6B 3HS0A 4XMKH 3HNTH 4F58H 4TVPH 2EH7L 1A6TA 2FGZA 2IADB 5CJOL 3TO2B 5DK2B 4XPAH 2DAVA 2X4QB 2OP4H 4B7LA 3ZE0E 3KYNA 1OQOA 1N6QL 3H8NA 4KKLC 3TWCH 2BVYA 2FIKB 3T3ME 4F3FB 4IRZL 3B4NA 4OCLC 1S7QB 1ZMYA 2PKDA 3PL6D 1YEHL 3UO1L 3LKRB 1RJLB 4JO2H 3E1F1 2DQUH 3X14B 2NZIA 3ISWA 2FRGP 3IJYA