4U6HB

Vaccinia l1/m12b9-fab complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
DVVMTQIPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWSLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHDPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent neutralization of vaccinia virus by divergent murine antibodies targeting a common site of vulnerability in l1 protein.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
molecule keywords Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
total genus 50
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB01
3ILQD 1F8TH 3IRPX 3MUJA 4JY6B 1RIHL 4ZAKB 4JO4L 4NZUL 1H5BA 4NM4H 3KXFE 4Z7WF 3P9LA 4KKCC 5C0RL 4LEXL 4N90D 4X0KB 1P2CB 3IKKA 5EU3B 3ZYJA 1C1EL 5IMOB 5J89A 2RBLA 4S1RH 1UVQB 3GMOA 4PJBE 2P5WE 1Q9WA 4RQQB 3B4NA 4QEGA 4JAMB 4HIIA 2A9ML 2OR9H 1U8MA 5EORH 4GAJH 4PR5B 3RU8L 1HIMH 1FV1B 2BDNH 2CJUH 3ZE1F 4MJ6B 3V5DA 1X7QA 1AR2A 1QFPA 1KTRL 4QRQB 5D7JD 3BP5A 1AD9A 3V4VL 5EULV 1QG3A 4K71B 5DD5L 3U46B 3WFHA 1KCRL 5CUSH 5F1IB 4ONOA 2XN9E 5IP4A 3D3VD 4R97C 3TN0C 5JHLH 2VLLA 4AIOA 3GMRB 1U92A 1U8LA 3JWDL 5FCUL 5HHVL 4JPKL 5ERWA 5HHME 3R4DA 4OAWB 4MS8C 4FFVD 2C4FT 2OSLA 5FYJL 4OF5A 1D5MB 3NH7L 5DVMA 3W2DH 4I8DA 5GS0C 4RRPA 4U3CA 2FH6A 5EO9B 1N59A 1BP3B 1OSZB 2UWEE 2NNAB 4MNQA 4QTHA 1J8HD 3DVNB 3B2UC 1NLBL 4XCFH 4OCYH 2ESVB 5DYOB 1GRWA 3CFBB 3U46A 3RVXD 3WFHB 1D5IL 5D1XB 5A2FA 1SVCP 5FOBA 2CK0L 4OTXH 1OAQH 2AK1L 3HCVA 1EGJL 3QUZC 3SDDC 1UZ6F 3V6OC 1KLGA 2P43B 3WEXB 3KS0J 1BQHB 3DTXA 3NPSC 5E94A 4DGIH 1J0HA 1IKNC 4LVNC 4P5TC 3MXWH 5SX4H 2XKSA 4M3KB 4P5KA 4ZMAT 2E5EA 5FA3A 3B3IA 4IIQC 4P48A 1U3HB 5T1LD 4YGVB 1UH2A 5EPMA 1WAAE 3I75B 4JO1L 3W0WA 4TRPH 1F11B 3M1BB 1QA9A 1I8IB 1NCDH 5I1JL 5I1IH 3IJSB 2KDGA 3QHZL 4QRSA 3OAYK 1RUPH 1EA9C 3SGJA 1IMHC 5GGRB 1NEZA 3C87A 4IOFD 4WW1A 5FEBA 4FQHB 5C3TA 1KIPB 5E7BA 5DJAA 4G5ZH 4UIKH 2PO6C 2IMMA 3LIZL 5DHXB 4HKZB 4ZG1A 4WVRA 5DEGA 4PRAA 4ZDHB 2PCPA 4MB5A 2WIIA 4WGVB 3ES6B 1VDGA 4YC2C 4LSQH 2DKUA 5E03A 3IS1X 1NFDB 2Z91B 4FG6D 2X7LA 3ARBD 2W38A 1I9EA 3W39A 3L1OL 5I18H 3SDAB 5FK9A 1K8IA 2DLHA 1T03H 4KKBC 4FFYL 1MRCH 5HYSB 2HP4A 3ECBA 2A73B 2EDOA 5FM8A 2B2XH 3SE3A 2BVUA 3VXRB 3UJJL 3FO1B 2VDMH 3DURA 2HH0H 2NZIA 3T0WA 4OZGE 4BA8A 4X98B 5HVGB 5TE7H 1TVBB 3QPXH 4MXVE 4KGLA 4KVNL 1YEEL 2MKWA 5JHLL 1MCKA 3K4AA 1NCAL 2A6JB 5DHVB 3MUZ1 4JQVC 3WFDH 4Y19E 2KQNA 2XN9B 4GAYB 5GRJH 1NGZA 4PJ8B 4NM8H 4KMTL 1UACH 3DX6B 4XCCL 3LKQA 2X89A 2DLFL 3CH1A 2V6HA 4U1NA 5I6XC 3H3PH 2GI7A 3IFOB 3AU1A 2P5WD 1IEHA 1CE6B 4AK1A 2DM4A 1NMCC 4JRWA 1FYTB 1OTTC 4JDVB 3KPLB 3KPSD 3U36B 4XNYL 5HGBB 3UEZA 2JJTC 2YPKB 4LVNB 4P5TB 3RDTA 2VSCA 3MRPA 4XPAL 3CUPB 1IC5H 3LKOB 1UZ8B 4HBCH 4M5YH 2BSTA 3GDBA 5D6DC 1KULA 3MLRL 2R2BA 1ORSB 2BOCB 2JF1A 3WHE1 5T1KD 3WUWG 5D7SL 1IAII 3CFDA 4LIQE 3H9HA 1A5FL 4PJ8A 1LHZA 2V9QA 2C3VB 3Q1SL 1AGFA 1T80A 2FECI 1IBGL 1WWAX 4KUZL 4UINL 5DHYA 4F9LA 2X89D 5M95B 2R0KL 3U4BL 2IWGA 5AAWA 2XRAH 3QXUA 4H8WH 4QXTB 5EOQH 2VLMD 3U4AA 1J86A 3H0TA 4TUKH 5GRVK 3O9WD 3I02A 2YC1A 1U93B 1RQ5A 2PXYB 5F9OL 1I7ZB 1N7MH 2R0WH 5DK2B 4LLVB 1DQLH 1C5BH 4IRJC 3VXSE 2ZCKL 1SJEA 1B0GA 1SM3H 5I19H 3QDHA 5DUMH 1YN6A 3QULA 5I15L 1EHNA 2HTLC 2MTPA 4PJ8D 1R3KB 1S3KH 1B0RB 3A67H 1FC1A 2RAMA 4HJJL 2CDFA 2D7NA 5AUMA 2X1OA 1MIML 1HHIB 4JM2B 1K6QL 3QCTH 5D1ZA 1XF1A 4M5ZH 2VXUL 3ORJA 5CSZA 5EOCJ 4FFWC 1OAQL 1AR1C 1J05A 3BX7C 3C5JA 4J7RA 5DRWA 4ELME 2O93L 1L0XA 4ORGA 1FIGH 1EAJA 2GCYA 4LKXB 2M26A 3OAZK 3U0WH 4I18C 1RULH 3GI9L 3VWJD 4PJ7A 5DFVC 4WFFE 1X5XA 1NANH 2ATKA 2R9HC 5FYLD 3SGKA 5I8OL 4WWKB 4ONGH 4YPGB 1MCPL 3G6AA 3LQAC 3WXVH 3JV4B 1FNHA 4KK8C 1ZLWK 3RUGF 1OD9A 4I0PC 4M6MH 5LQBL 4E41A 4KJPC 2BNRE 4FQIH 3BYTA 2BC4B 5I76B 5DD0H 1T0MB 1PZ5A 4QTHB 4A6YH 1HHIA 5E2TH 4BSWA 1HNGA 2FIRT 1JNJA 4UNVA 3RIFF 1S7VB 1J12A 4PG9A 4Y16D 3D39B 4BZ1H 4B50A 2VAAB 1FAKT 1CXEA 3BSZH 5FYJU 3MMEB 4U3HA 5BJTB 5B3JE 4JJ5B 5ILTH 1S7QA 3R1GL 4U1LA 4XB7A 1A9EB 2AEPH 3LSOB 2ZKHH 2JJSA 3MA9L 4C56B 4QOKA 1OF2B 1XGPB 3DGGA 3K2UL 3UTQB 2B7DT 3H6JA 1BBJA 3SOBH 1HHHA 4Y19D 1Y6MR 3VCLA 1AI1L 4KK9D 3JTSB 2WSKA 4XNZB 2EDYA 2ICCA 3L5HA 4LOUC 2W92A 3FB8A 3QUYD 1P9MC 2WIIB 1FLRL 3TVMD 4LOUD 3V5KA 4QRSB 1T1YB 3TVMC 4TVPD 2Z35B 2VERN 4RX4D 4P5MA 1G9NL 1IQDB 3GB7A 3M1BA 5SWQA 2X1WL 1AKJA 2W60A 3RGVD 3AFLA 3NOIA 3RUGB 3MXVL 3QJFA 5FK9B 5FECB 1NBYA 4BFEA 1IC7L 1DLHA 5GISL 2W9EH 3DX9A 4UI2A 1F2XK 3T04D 1KXTB 2OTUA 3WYRA 3T0EE 4WEMB 1HHHB 2DQIL 4X5WB 1L9NA 4ZFFA 1RZFL 2CUHA 1GH7A 2EEAA 5E4EC 1FL3A 5FB8B 2HLAA 4JZJB 2PYFA 1GGBL 1M05A 4JM2D 2PKDA 3ARWA 3RZCC 3QUYA 5GQBA 4ZD3L 5I75C 5IWLC 5GRVL 3D3VB 5KVGH 4Y5YC 3CMOL 4MD5A 4OZIE 4XMKL 1LVEA 2OP4H 4S2SA 3MJ8A 2V7HA 1F6AB 1V3LA 1MJ8L 4DZBB 4PJ7E 1MCWM 2B1HH 4GXVL 1I1FB 4WW2B 2MQ3A 3U36A 5BVPL 3L95B 4CKVX 1IFHH 1S5IH 1GJIA 4JFDE 1OHQA 4ODHH 4NJ9L 1N5AB 3TA3B 4EDWH 2ARJA 3IF1A 3CXHJ 3O9WA 1HCFX 4JG1H 3RZWA 2H45A 5D9SA 4G7YH 5GS0H 5BS0B 4MXWH 4MJ4A 3GO1L 3PP4L 4G9DA 4NZJA 4YHPA 2OL3A 4L8SB 6FABL 3D3VA 4OGXH 5SWZD 1UGNA 3D0VA 2JK5B 2QHRL 4MWFA 1AQDA 4HV8A 3VXPA 1XCTB 4QKXB 4MA1B 5GGRY 1KCSL 2D7PA 5IW6B 4L3AA 4Y4HD 2Y06L 2YA1A 1A4JB 4RAUA 2OM5A 3MR9B 3QI9A 2Q8AL 1UH4A 3TC9A 2IH1B 4WFFD 4ONFH 4QRTA 3QQ4A 4GKSA 4FQJL 2BSTB 5HPMA 1JGLL 4RGND 3K2UH 3IGAB 1YY8B 1NCDL 1UCTA 4ZFGL 3KYOB 3BHBB 3ELAT 4HUNB 3W5NA 5TPWH 1CK0H 3MJ6A 5IGXL 1K6QH 1NBZA 3QCTL 4QXGH 4M93C 1FL6B 2NMSA 4JQIL 3LQAL 4QF1B 1JYXA 4P2RE 4RGMB 1KENH 3LDBB 4OLXH 1S7XB 3FONA 4Q6IB 4HPOH 2EXYC 4F58L 4J8RB 1NMAL 3KR3H 2YPLE 5HDQH 2F8VA 5JW4N 3RL2B 3N1QC 2NYYD 5FKPB 3FB7A 1MAKA 5E9DD 1PLGL 4MAUL 4P9MH 5E0QA 5F7WC 1RMFH 1T22B 3Q1SH 4R3SB 1UEYA 2VQUA 4HKJB 4LHUD 5EBWA 1WFOA 3QWQB 3QI9D 3ARDA 5DMIH 5DZOA 1UB5A 2Y6SC 4OZIA 1H5BB 1RZKH 5KSVA 4JVPA 1T03L 4OM0H 2VLJE 2FIKA 2GFBA 3NAAL 1NAMB 4MXQC 4CDGC 3MRLB 4UQ2B 4HZLB 3UTSB 2VXSL 2AJXH 1FH5L 4H1LB 4MQXD 3MBEB 4FXGA 3EKCA 4NRYB 1FQ9C 2R0LL 4MLSA 3MREA 1JNNL 5GZNC 3GFUA 4FABL 3ZKMD 1DN0B 3C5ZC 2R1XB 4BQCA 5HGDB 3W9DA 3WIHH 1PZ5B 1R3IL 1JF5A 2ICWI 5GGSB 1MI5B 4LEOA 1QBLH 4U6XA 4P2YA 2IPUG 4Z7NF 5IB1B 3N06B 4KZEL 3LKRB 3EYVB 4UDUA 4PREA 3A6CL 3T65B 5E8DH 2F74A 1WAAA 4XXCC 2OXGA 1AP2A 2GK2A 3WFBH 3VFTB 3TH2T 3DMMC 2XWBB 5BV7B 4NRYA 4CADA 1AHWC 5FO7A 4CN4A 1EERB 2P1YA 4TQEL 1MCLA 5DK0A 1KJ2B 1T83A 4YPJA 4KI5C 2H2SC 5ICXA 2VDNL 1FRGL 4OD1H 1OARH 1EVUA 4GKNA 1ES0A 3ISWA 4YHOL 1T7XA 3GMPB 3HFMH 4W70A 3MX0A 5L2KE 2J8UF 1NKOA 3GSNA 1CYGA 2V2XB 3PWPB 3LS5H 3LSOA 1YMMA 3LQMA 3TCXA 3BH9A 2YKLL 4X6EB 5D1ZD 1A7NL 3DGGB 4CGTA 1BMGA 1CK0L 3MRBB 1G7LB 1VCAA 4X4MA 2DJUA 4M6OL 5CIPA 4OZFA 1V3MA 1JGUH 1IT9L 2ZUSA 2GTWB 4XPFL 4XXCA 4HS8H 5KSBE 2EDBA 1XMWA 1N8ZA 3H7LA 2IPTL 4I9WD 1FVDA 5DUBB 1KTDA 2ADGB 5DF0A 5TH2B 3HR6A 4Y4FC 1F11A 5H8DA 2DQEL 2N1KA 1KTLA 1S9VB 4Y4FA 2I9LA 4XNXH 1YEGH 5K9QI 2A6KB 4PY7A 1FGNL 3EDJA 3SKNA 1EZVX 1NANI 3GMPA 2IPKA 3BISA 4AENB 1UKQA 2AEPL 2YC1B 3BPCA 4GXVH 4ZFZA 3WHXB 1MUJA 1ZHKA 3QJHB 4NUGL 2FLRT 5C08B 3QQ9D 3N1GC 3PUCA 4GSDL 1CZ8H 1T6WA 1FNSH 3P0VH 1NGXB 3F8UB 1FLRH 1UXWB 5D5ME 5KS9A 5C07B 3IJYA 3HZMA 1F3DJ 3O8XB 1AI1H 4P4KC 2BVPA 3B5GA 3LH2L 4ELKB 5C07E 1HXYB 3PHOA 4HX1A 3SDDB 3N85H 3MFFA 1HYSD 4OI8A 4BJLA 3AUVA 5C0AD 4DQOL 1FG2A 1MQKL 3RAJL 5BS0A 3T2NL 4ZUUA 2O61B 1QYGH 3WJLC 4FNLL 2YPVH 3GIVB 5EU5B 1P69B 1QPXA 2FL5A 3FAXA 5HYJA 4DJMA 3FT4A 2O5XL 3FT2B 5F7DB 3BPCB 4ZFZB 4YDIH 1AQDB 3QG6B 2MFNA 2VQ1A 4MQ7A 5DDHA 3DHMA 4L8BA 3V4UH 2EE3A 5JHDE 5BXFA 4DZBA 1J8KA 2RB8A 5DD3L 3FQWA 5E99L 5F3HA 2GSGA 5I1HH 43C9B 3D9AL 2NZ9C 1KJ3L 2OR7A 2HFEB 5J13C 2BVPB 1QLRA 1XH3A 3SDAC 5HDBF 2RCSH 4J23A 5HGHA 1J1PH 1KPVB 4HHAB 4RNRA 1JPGA 5E6ZA 3U7YH 3CDYA 4YGAB 2OP4L 3CH1B 1OT2A 4U1NB 5JIKA 3UTTE 5L9DL 1DDHB 2XQYK 1NCBH 3S36L 4XX1E 5L2KB 3IXAA 1T04B 2CK0H 1W0YT 2DYPD 1T0NB 4NO5A 4X9GA 4NJAL 4M62L 3VXRA 4RZCB 1LD9B 5IW3A 3OKMA 5I8KH 4UV4L 4RMQA 1L0YA 1A4JA 1KIRA 1EHLL 3HN3A 4R96B 3BZFA 3OF6D 4EUPH 3QRFM 1QRNB 2HTKC 4NN6C 4OCRL 4ISVA 1T3FB 4LL9A 2Q3ZA 1H3WM 5MENB 4HW6A 5J57B 4LLUB 4Z5RB 3D18A 3WUZA 5GGUB 5D6CA 3OPZH 1FO0B 3MTRA 2QQNH 4YHMH 4U31A 4ZAKA 4D0DA 2X4QB 1MH5A 1RZ7L 2W0KA 1VFAA 2GAZA 1FH5H 3QR2A 5H94A 2XY2A 4WTZA 4Y4KD 5ESAB 4KHXH 3BZ4A 5IW1A 4NNXB 4KJYA 3FRUA 5L2KA 3U9PL 4YZFE 4XT1C 1SJHA 3BPNC 3MRRB 4PTUA 2R1YA 5F88B 4MHHG 1NBYB 3EJZC 3EJYD 3G5VB 4PJFA 1KIRB 4LMQI 4L8CB 4APQA 1FBIH 2DQDL 4M7ZC 3KPOB 4KJQC 3VXRD 5DC9B 5ADOH 1JV5A 1UZ8A 1WCBA 2N7AA 3ZDZF 1I1AD 1IAIM 1INDH 3QO0A 4HGWB 2QLVB 3MJ7A 1QD0A 5H37G 3W9DB 4PV9B 1HH6A 3DBXA 4N0YL 4WFHE 1AGCB 4Y88A 4I48B 2I5YH 3U7WH 2UUDK 1I1RA 4FQ2H 1A0QL 4UNTA 3VDAA 5DJ0A 1KENL 3GSVA 5EU4A 4OLXL 3OR6B 1BFVH 2GTZB 6CGTA 4HT1H 4PRHA 3LEYH 3IYLW 5CILH 4X6DE 3WO4C 1EEUA 1DVFC 5MP6H 1U95B 5JW5B 1U8LB 3KXFD 4YAQB 1ADQH 2LAGB 2IBGA 3WLBA 3MZGB 3QWRA 2AXFA 4WI4A 3K8LA 4U6HB 2UVEA 3SE4C 1WWBX 5F3BB 4I13B 2R1XA 2OQJA 4L9LC 4YDIL 4UBDC 4HGWA 4R9HA 1PG7W 3BQUD 3OX8A 3PDOA 1HH6B 3BUTA 3BFOA 4L9LA 3OGOE 5IB3B 4WO4B 4AEFA 2DTML 3T0AA 2LE9A 1PY4A 2QSCH 2CKBL 3ZYZA 5KVFH 4LHJB 3UBXG 3MLTA 1I85C 3E3QE 3AC0A 4MCYB 4XTRD 1NC2A 2DDQH 1S9WA 2DQEH 1OL0A 5FUOH 2FGWH 4EKXA 4QCIA 1PYWA 2VDRH 4HWUA 1KXQE 2CKBA 2ESVD 3VD4A 1QFHA 5T5NG 3BT2L 1G7LA 1CLYL 2GJ6E 4JDZA 1WCQA 1JI1A 3C60A 4OLEA 1YMME 4MNQD 3C6LD 4PGEA 1P5UA 1MF2L 1QA9B 4RAUB 5C6WH 5I2IA 2Q20A 4I4WA 4ZFGH 1MJUL 3LRSB 4FFYH 3VXTB 3LN4A 3KYNA 3MOBH 4P57B 3RVUC 3TO4C 5K9JL 2YD8A 1W8OA 4JRXE 1B4RA 1C7SA 1RK1B 4P3CL 3VRLE 4L8DA 3DO7A 1EVTC 1X5FA 4J3TA 1WC7B 2I26N 2XA3A 5I8CB 4IIQB 2EC9T 3B2VH 4JB9H 5CFHA 5A43C 5EOQL 2D7QA 2JCCF 2IAMC 3OZ9H 4XPTH 3AY4A 1YEDB 4JDZB 3NVQA 2H8PA 3LD8B 2CD0A 1MCDA 1QVOA 2VLKA 1T1YA 4KKLD 3TIEB 3GJEA 5D93C 3ARGD 2YK1H 5BOZG 3IDXH 4XCYB 5FO9B 2EH7L 5C09E 3KPRE 4XPHL 5GGVL 3BPNB 4OM1H 4YEEA 2A0LC 5LJYH 5CP7A 1U91A 1QSEB 5FKAA 5AG9A 1P5VA 5DJCB 3RA7L 3FT4B 1DLFL 1GAFL 5DXWA 2UY7A 5I1EL 1MIMH 5ACLA 3BAEH 1JCKA 1YY9C 4UIKL 5JOFB 1I3UA 1NFDF 2DYPB 1CBVH 5IJVA 3NN8A 1XR9A 3NZ8B 1NKRA 1WFTA 3I6LE 1SY6H 2HLFD 4CW1B 2NY6B 3LDBC 3N0PB 3QFJD 3FL7A 4WTWA 1RUML 4M1CC 4N1HB 4LVHB 5FGCE 2IFFL 1AXSA 3GM8A 1U91B 1FYTA 5T5FH 4BKLA 3HA0A 3S3JA 1HHJA 5GGSY 4Q9RH 3WJJA 2CMRL 1MCOH 5CLTA 5CD3A 3MRQA 4YWGL 3VH8A 5HXMA 1L6XA 4H26B 4PRNA 3TYFA 1R3LA 5FYKH 5T3ZL 3CC5A 2DDQL 1JWMA 5IMLB 4PJGE 3I50H 4HWBL 1ETZB 5C3LD 4GG6F 5F7YC 3OKEA 2V2WA 5J12C 3DRTA 4O2CA 3X3GH 3S88H 5GS0D 1JZ7A 5MI0B 4MWFB 4LPXA 3BRFA 4YUEL 1XF3B 2C7UB 3U7WL 1ODAA 2YD4A 2VXVL 1SM3L 1KNOA 4HIXH 1NUDA 2XZQH 4WWKC 1FE8L 3KS0H 5ENWB 1HHKA 4K8RH 5BMFL 3I9GH 3WXWL 1T20A 4HLZG 1ADQL 1IVLA 4IDLA 2KKQA 4ZXBA 5F21B 4KV5E 2X4QA 4HJGB 4Q9QL 5DO2C 5CILL 3TWCH 2CUMA 5J1AA 4MJ5B 1UWEH 3MRNB 3BKCH 4Y5YB 3VXOA 1NC2D 3GMNB 3QPQC 4JFZH 4M4RA 5JMOC 2GSIA 4LSUL 3BP4A 4LU5L 1ZKAA 1SY6A 3DROA 3UBXA 3VMNA 1A6VL 1S9YA 4AH2B 4AQOA 5F6IB 1G6RL 1OF2A 1Q9OA 1IGIH 3C60D 4OFYD 3ULUD 3DBXB 5SWSD 5BO1L 3H9SD 4U6YB 4UDTA 4N8CH 2PO6D 43CAA 3TV3H 5CJQH 5EU7E 1U2HA 2XA8H 3OR6A 3SGDI 2ZUQB 3RTQC 3BIAX 4OQTL 4OZIB 3BT2H 1HXYA 3FFCA 1VSCA 5DJYB 1OAYL 4XC1H 3GUTB 4W6YB 4MJ5A 3GSXB 1AIFB 2CUIA 2P8MA 4R26L 4EBQL 1UADC 1PZUB 3UTSA 1RZ8A 4OZHB 1ZLWH 3FQRA 5MERB 5HI4D 3TFKC 1MCFA 1QFWI 2AJZB 2FATL 4PJDB 5BVPH 1BJMA 1TVHA 5K9OA 5HI4C 2V5RA 1S3KL 2X4OA 3A67L 2OL3H 3UDWA 3QQ3B 3LKPA 4OJFH 1BEYH 1CFSB 1GZQB 3ZTNH 1R5WA 2OX5A 3O3DB 4X6FB 1MHPH 3OJ2C 5M7QA 4HFWB 4MXWL 2FX7H 5T3XH 3PP4H 2ZG2A 3QDGD 3VI3E 4TTDD 5HI3D 2X44D 1T5XB 4FQPA 3T3PE 3EOYG 3MLWH 4PJ5B 5KSBB 2EYSA 3DYOA 2EEDA 5D7IE 2WWMD 2AGJH 4MCYA 1DDHA 4FZEH 5DA4A 3O2DA 1NAML 3S88L 2Z4QA 2B20A 2D7OA 4JFPA 3O4LB 3VD7A 3GGWB 2CPCA 4WU7A 2DKMA 4Y16A 2I27N 2P24B 3VFOA 4D9RE 1CFSA 4U7MA 4ZD3H 3SE3C 1IJ9A 3C2SA 3PGCA 5C0BB 2W07A 4C56E 4TULH 3RI5K 4M7KL 3IDNB 3EO0A 3DVIA 5A40E 1HILA 2QSCL 3GRWL 4N9GA 1T5WA 3LVEA 3MNWA 4ODSH 3WS3B 3JV5A 1M7IA 3U82B 4G6AC 5DRNA 2GK0B 3F7YB 5ILTL 2YD3A 1CGSH 2ED9A 1XCQB 4UOW0 3D2UA 3WNPA 2FX9H 3PP3K 1JL8A 1RUMH 1QRND 1HEZB 2VDRL 5IMMA 5KVMC 2W0LA 2WINB 2XKUA 4JFQA 1QR4A 4MA7L 1L7IL 1A6UH 3VW3L 2PYFB 5I71B 1QEWB 1B4JH 1JGVH 4MAYB 1MWAB 1JPSL 3G6DH 4ZUWB 4HC1H 5L0QC 3ARBB 5JR1L 4HG4J 1YEFL 4NCC2 2JE8A 3GHBH 1U2CA 1HIML 1T0PB 1ZHKB 1D5BA 5IFAH 5AAMA 2R0LH 1LNUB 5FAAA 5FYKL 2EXWC 3D5OF 2YD7A 4PRHB 2D0FA 3X14A 1IM9D 1VACB 3WL9B 4BK4A 1UWXH 4X4ZA 4AT6B 3KPQB 5GHWL 5TH2A 4O51A 4U1JB 3MLSL 2KL6A 5JORB 1H15A 4NWTL 3IFPB 3UO1H 4XP6H 2I9LB 3TH4T 4ZS6C 2LU3A 3QUXC 2F54A 1L0QA 2NY0C 4HXBL 2Y9RT 1IQWH 1UT9A 1J1OH 5E7FA 2C1OA 4QRQA 2CRZA 5AEAA 4MZ2A 1EDQA 3IT8D 4H88H 1HHJB 1DJSA 1UXWA 5F1IA 4J4PD 4LHUG 1F4AA 3LKSA 3HS0B 5GIRA 1ETZA 5FA4A 5DMGD 2X41A 1MEXL 1MRFL 1UCBL 2NY4B 5C08D 4MDIB 2CKBB 4JO4H 4NZUH 1ZGLP 1F13A 2UYLA 3MRIA 4KJQD 4CL7A 5I17A 4YBLC 1C12A 4R2GC 3VFNA 2ITCB 4PJBB 3RZCB 3OQ3B 1JTTA 1ERNA 4XC3H 3WN5B 1IGJB 3LRGA 4F7PB 1DBBL 1JWSA 1EGJA 5T5FL 3IETA 2ADJB 4NN5B 5F7LB 2JTDA 3V4VH 1XGTB 4PD4K 2BX5A 3MRPB 4M43L 4LASL 4Y2DA 1AQKH 1G6VK 1XEDA 3KJ4B 3GI8H 2EH8H 3T3PF 5DHVH 1MNUH 5C92A 5DJZA 4PJ9B 2OR8A 5D5MF 4P5KB 1QFUL 4PJFE 2WQRA 5EO9A 2X1XR 1BLNA 1EBPA 3WSQL 4OCSH 5FCSH 2AV7B 4UU9A 4XVTL 3RPIA 3IDXL 2CDGA 2GYSA 2QSQA 3O0RH 4CVUA 2H8PB 2MCPL 4OJFL 4O02L 4NUGH 1WFUA 3VRJB 3MO1B 2XOTA 1S7SA 5L8KB 2ZPKH 3L5XH 3LZFH 2F15A 4MNGE 5DR5L 1XGTA 5C86A 1XGYH 4XVUC 5J6GA 2AERT 5F89B 2NY5L 4HPOL 3OKLA 4YDKL 2XWJA 5CIPB 3HZVB 3D3VE 5DQ9A 4AYFA 4NQCD 2DQUL 4YE4L 2HRPL 3QIUD 2VDML 4YX2L 3VFWB 3Q5YA 1N8ZB 2HH0L 3G9VA 1NAMH 5EH1A 2ADIB 2WBKA 5DVOA 2EDTA 4X7TA 2BNQB 1BF8A 3MLZL 1G0DA 4MA3B 2AGJL 3TEUA 1Q8MA 1ZA6A 5C0BE 1U6AH 5HHQB 3TT1H 3OB8A 5HYJD 1U8JA 5EU6B 2VLJD 3QO1B 3SCMD 3UTZB 2EKJA 3MRRA 4YBLB 5MEPB 1J8HE 3WHXA 4LSUH 1IC4H 1RUPL 5EZLB 4GLRI 3C5ZB 2E9BA 2YA2A 1WIUA 2NY4C 1YC8A 2OJEB 4DW2L 4JN1L 4NBZB 1TZIA 3EYUH 1EFXD 1HK6A 3OMZA 3JV0A 2Z8WC 1FN4A 3G08A 4ERSH 4S1QH 3SQOH 3HI1A 3PV6B 4NOFA 1CN4A 1FYTD 4O4YL 1ZHNA 4Z0XA 1NGZB 2P5WB 3DV6B 4NHUB 1U8JB 1N0LA 1YEHH 3LEVL 3TO2B 4X99B 2ZP0T 4OZGA 2B2XL 4U0RC 3RBSA 3MNVA 4RRPG 3ROLB 3OKNB 3QXDB 1BX2B 3HI5H 1JYWA 1HKLL 3QXVA 1RJCA 2AK4A 3N9GH 4N9GB 5JIHA 4NSKB 1T6VN 3FO0H 4WENB 4OTXL 2V9RA 4PRPB 4OFPA 5IVXF 2CLZB 3JBG7 4OD1L 5CD5C 3WUWA 2FR4A 3V8CA 1QFUH 1UWEL 2HLFC 3BKCL 4KK5D 3LEXB 5HHNA 4TOYH 5FUCE 5IROA 5L2KD 4S0TD 2IGFL 2AV1B 1G7IA 1VADA 2F19H 2Y36H 5GJSL 2YWYA 3MCLL 1KBGL 3WFDL 4LVOB 4OI7A 2J8UA 1LO4H 4D9QE 1S9YB 4R4ND 4HWNA 2VLKB 4AEHL 4JANA 5ANMA 4LSTH 4P0DA 4M8VA 1XF5A 4I9WE 5HGAB 1AD0B 5A3ID 3SO3B 3G5YA 4M02A 4QY8A 5HYJB 3KDMB 3K81A 1CLOH 2ZOKA 5MP6L 1DL7H 5F7NC 2VMFA 2WIMA 5ESAA 4WCYH 4JFYA 3Q6GH 4DGYH 4P4KB 3EOAA 2HN7A 4PTUB 5F88A 1QKZL 3WN5C 5B39B 3ARRA 2APXA 5MERA 4NC1E 1ZTXH 5E95B 3GHEL 4Z7QE 2HG5B 4CMMB 1U8KA 3ULVC 2Y5TB 2V17L 3TIEA 5C2UB 1CDBA 4FXKB 2APWA 4PV8A 1MY5A 2VZTA 4PJ8C 1ZS8A 5BW7C 3TBVB 4ODXA 1IGYB 4HQQL 5C0AE 3TT3H 1CXKA 1OQOA 4IRZL 1SJEB 2C9AA 4QY8B 4YIQA 1N2RB 3EW3B 3SDYL 4G9FE 3VWKA 1WBXB 3FKUS 3PWPA 3T3MF 1C5BL 3GSOB 4Y2DB 4NQDE 3I6GB 5FYLH 1MHCA 4H26A 3UO1L 3SO3C 1ONQA 3CAFA 3L5XL 1RU9H 3IFNL 3H3PL 3ZSSA 3TNNA 2DF3A 2QTEA 4XP9H 4JY6A 1WTLA 4QNPE 2AJVL 4K9EL 3V0WL 3QRGH 2Z8VC 5IB3A 3UYRH 1IAOA 3HG1A 5CBEB 1A3RL 4RAHA 3X11B 3P77B 3MRKB 1ZVHA 1BBJB 1JJUA 4F37K 2ZCLH 4EI5D 1MCNA 4XPTL 1B90A 2FSEA 5BV7C 1EFXA 3BXNA 3MLZH 4QRPD 1U3JA 5MHSE 5HYIA 4PG2C 3JVGA 1QO3B 1A1MA 2R2EA 1ZSDA 3EDDA 1A6PA 1JWUB 3OXSB 3VGHA 1ZLSL 3OR7A 5E1HB 2XZCL 5C2BL 3EYFB 3QJFB 5A2IH 1NCUA 5DS8B 5IBTH 3CFCL 4OZFG 4FQIL 4KDVA 2VZVA 3OG4B 1MHHA 4OZ4A 1CD0A 1JGDB 1TTUA 1GOGA 5FECA 1OP3K 1NFIB 4OGAD 3O4OB 3GSWB 3PABA 2YSSA 1KCVH 5AG8A 3DNKA 1FVEA 1BGXH 4URTB 1N0XL 1GOHA 3CZJA 1I7TB 1OTTD 5GRYA 4HMCA 4J12A 4K23H 1KF9B 3QIBA 1GC1L 3OGCA 3ZLQC 3O11B 2W60B 4P2QB 3KPPB 3MBED 5EU6A 1LP9B 2HKFL 3PQYE 2F53E 1PKOA 3RDTD 2ICEA 4Z8FL 2B0SL 4UT6H 3M8OL 1H8OA 3QNYA 4QOKE 4NGHH 5FV2A 1GL4B 4JFOA 2GJ6B 4O58L 3R06A 1SEQH 2DBLH 3RNKA 5ID0B 1F90H 1KIPA 3ME0A 4PJAF 4MHHI 2DQFB 5EIVA 4P3CH 2F5AH 4LQFL 3GKWL 3FB5B 1NGPH 3FQTA 4BSJA 2W9EL 4XH2B 3BZFB 3GSWA 1IGTB 5JOFA 5E9DB 3BQUA 1ZK9A 2IBBA 4QXWA 4JEGB 3NCYS 5FUZL 2OYPA 1IGCL 4OFVA 1BOYA 2GJZA 5I1LB 3TA3C 2VDLH 4KGJA 1R0AL 4ONGL 3MLXH 3HC3L 3O9WB 1KELH 4P4RA 4G6MH 4WHYH 1I9RH 5CGTA 2BMKA 5IJKA 1V7ML 5CKGA 1LO0H 5I1GH 4J4PA 3EHBD 1QOKA 3L3JB 4HIXL 4TUJA 5D8JL 4AM0A 3IDGA 4MCZB 1OB1B 2BVOA 4MA8L 3VGFA 1QNZH 4W6XB 4LF3B 1TENA 5EZOH 1YQVL 4NKMB 3SKMB 4X6CA 4S1QL 4XWOC 3U6RB 4JKPH 4DEPB 2QADB 4WV1A 3VFMB 1P1ZA 1IL1A 1XF4B 2ADFH 2HJLA 3STLA 3IXTB 5D2NA 1BPVA 1R5IA 1QQDB 3TCLA 3OF6A 4NSKA 2IFFH 1H8SA 3LKNB 1AHWB 4PY8I 1MJ7H 4IDJL 1MREH 5DJ0B 5T3ZE 2DQTL 3LHPH 4K2UH 3GO1H 3X3FL 2VZ1A 4ZAKC 1S7XA 3MODL 4OM0L 1Q0YL 3NAAH 1X4YA 2PF6A 3LB6D 3MRJA 4GRLA 3K3QA 1K4DA 4ZOBA 2FH8A 1RFDH 2YBRA 5CJXC 1K8DB 3S36X 1GZPA 3L6FA 3HAEH 4CMMA 4RMRA 3MOQA 4WV1B 5A2KH 5FYKE 3ARDB 4GAGH 3SKJL 4BSVA 5LAXA 1LEKA 1KIUA 3MBXH 4F2MB 4L9LB 1IM3B 4R3SA 3BKMH 1NUGA 4CAGA 1N5YH 3WFEH 2EH7H 4K3JL 2BSSA 4LPTA 4C59B 3HUJA 1FPTL 3D2UB 3O4LE 1H8NA 1UWGH 5B8CC 3CK0L 4QXGL 4NQEE 4NQXA 2VLLB 3BP4B 4BH8A 3NFPA 4JN1H 3PWNA 4QO1A 3D87B 5DLML 1KCKA 5SWSB 2CIIA 2OK0H 3L3DB 1EO5A 3C60B 4LSTL 5E5UB 1ZWIB 2P8LA 4KI5F 4OQ1A 2CGRL 1FZKB 3S37X 5BZWB 5F96L 3M45A 3ZE2E 3B8YA 5BW7A 4Z78A 5GS3A 3UAJD 5JW3H 2BK8A 5DJYA 1VGEH 4HIEA 4MJIE 1T1ZB 4FZEL 5DYOA 3BZDA 2XWTA 3HLAB 4WUUE 2QV2A 2J3SA 4P2OB 3I3EA 3LMJL 4YHKH 3RJDA 4PREB 3F6IA 4OZHA 3GSUB 3LEVH 1N6QL 3A6BH 2XG5A 1VENA 5D2LB 4O51B 4I3RL 1UFUA 4YWGH 3V9FA 2VDPH 3O6ML 4RIRA 1K85A 4NQUA 4U6VL 4X6FA 1J05B 3CJJA 3C5JB 2R2EB 4OD3H 4CNIA 2WV3A 3BWUC 3LKRA 3HB3D 2XT1B 4NFDA 3QUMB 2VL5A 4WGWB 1FP5A 2GIYA 5L88H 4N68A 5HHXH 2JKXA 5JDSB 4PJIB 4ISVB 5GSRA 5EIIB 1CGTA 3MROB 5MENA 1FL5B 2DIJA 4WHYG 3UPRA 1UYWH 2E7MA 4LSQL 4OZFB 1E6OL 4A2LA 4QXUL 2UYLB 3MRIB 1EFXB 1CZ8L 5A2JH 4P99A 3IDYB 1AO7D 3NZ8A 3G5ZA 2DQGL 3JVGC 4PB9H 4X7EC 1UWXK 3DECA 1M4KA 2AVGA 3ALWA 2X7LB 3PNWA 3O6FB 3CLEH 3QNXA 1RVFL 4PJ5E 1KPUA 1JUFB 2NXYC 3N1FC 1T5WB 3WS3A 4MMZC 2EIBA 3BO8B 5FXCH 5T33H 3NCJL 1NMBH 3VI3F 4YDLB 5KG9B 1FORL 3QFJB 3TM6A 4Y5XB 3VWJB 4GG8B 1NFKA 3RI5F 4GAGL 2VDNH 3SKJH 4C56A 4F8TA 3K8MA 3OKKB 4K7FA 4ZSOB 3QUML 3C2AL 5GS1A 1F4XL 5I1DB 4JY4A 1FNEB 5FM5M 5MENE 2NPLX 3FOMA 5E8NA 3B6SA 3RQ3A 1UZ6E 3MLXL 4G8FA 1JVKA 1UWGL 2CQVA 3K0WA 1VGKB 4IRJB 3P11L 2BDNL 4NC1C 4FN0A 5BZDA 4MA8H 3V52L 3VFVB 2ENYA 2A2QT 4FXKA 3Q6FB 2OK0L 4RFEA 1FGVL 3O6FA 2PYED 1S78D 3CCHB 3FRPA 2ZSWB 3U4EA 4LCYB 2UWEF 1A7OL 1LEIA 4KK5C 3QG6A 3QH3A 5TE6L 1U9KA 3QFJA 5KS9B 3NCCB 4AM0B 2D31A 5JW3L 1MFBH 1X5LA 2BXYA 4Y1AB 4XMLH 4P5TA 3NH7H 1G9NC 3PG2A 3DSNA 3JTTB 2R2CA 1RZGB 4G8FB 2R0KH 3U4BH 4L3EE 4K8RC 1IBGH 5CSBA 4NDMA 3EFDH 1AFVL 1MAMH 2X1QA 4U1KA 4XB8A 2C3VA 2RFXA 3PWPD 1KN4L 4TUKL 2IF7A 2FBJH 3MV9D 3T2NH 1NL0L 3TBTA 1KFAL 4Y2DD 4OF3A 3PWJA 5HHOD 4R4BA 5TF1H 3V7MA 5FHAL 3VFGL 3MUHL 3T0EB 1BIIB 1LMKA 4PJBF 4PBWD 2ZCKH 1YN7B 2K9UA 1TPXB 1ZV5A 4JRYA 3BGMB 3WFZA 5IVNA 4F8QA 1UJ3B 5ABDE 2FHBA 3QWOB 5HVWA 2R56L 3OBAA 1RZGA 5GZND 5DMKB 5ICZA 1MRDL 5I1AB 2FLBT 2K3TA 4U7SA 3WE6B 4HK3J 1KELL 1U8NB 1RURL 4KC3B 3WIIL 4C55A 1L4IA 1BZQK 5LGHH 3BEVA 5INDB 5IW1B 1T21B 4H88L 3BYYA 2Z31B 2GAZB 5GGTA 1BBDL 4XPAH 4Y7MA 5HD8D 1CR9L 1EX0A 1A6AA 3TBSB 5D8JH 1A4KA 4M7JH 1FFNB 5AWNL 2X70A 3U1SH 1CD1B 1JGDA 1JHLL 4Z95L 3TIDB 3U2SA 3U0PB 4PV9A 2KZ1B 3BKJL 5F9WC 2OJZH 2BOBB 2MJWA 3QQ4B 3NIFE 4XBPB 5CHNB 2BSSB 4BM7A 4J1UB 4JR9L 1NLDH 5I1AA 4JRXA 8FABA 1XIWA 4X6BA 4NKOA 4U1MA 1KJMB 3TN0B 3H9SA 4QHMA 1B6DA 2ORBH 2AXHA 3SY0B 5KAQG 1AC6A 1T21A 5IG7B 2BXZA 4WV1C 4M1DH 2IADB 4I77H 4XBGB 4ZYKB 5FA4B 2QL1A 5DJXA 3CX5K 1Y0LA 2FYYB 2XTJB 3E6FB 1DEDA 3F58L 2Y5TA 4YEFA 1I8LC 1NPUA 3IGAA 1Z6JT 2P47B 2O5YL 1KG0A 1IGCH 1H3XA 4N8PA 4P2CG 5KN5B 1O7VA 2D9QB 1CLYH 5ICYB 5DQJB 1UYWL 4PJGB 3V4UL 1ITBB 3MRGB 4YXKH 1N7ML 2R0WL 1FZOA 1ZT1A 5KSVB 3IFLL 5AZEL 5C09B 4O2FA 3VGGA 4HPYL 1PSKH 4WI5A 5DLMH 4UBDD 2YR3A 2BC4A 4LSVL 3RWJA 1M6OB 4LCWE 4MDJA 4JFEE 1C5DB 3V6FA 3BMWA 4MJ2A 3C08H 4X6DB 1T7YA 1BFVL 2XZZA 3WKMH 3J8F7 4G8GD 3RPIB 3DRQB 3GMLB 1X7QB 3SKUD 3V0VB 1IC7H 4OIAA 3WNNA 5GISH 1AXTH 1MWAA 1P1ZB 2HJLB 1IAOB 4JFFD 5D1XD 3P30L 1L6ZA 1N6QH 2ZJSL 1Q38A 1JYNA 3D85D 5IB5A 3T4YB 4O5LH 3V5HA 1N64H 5E6IC 4LFHG 8CGTA 2GUOA 3T0ED 2ZCHL 2CKBH 2HFGH 3G04B 5E08L 5DC0A 4DW2H 1V7NH 1GIGL 4WEBH 3QDME 2FB4H 3HPJA 4PP2B 5C0JB 5BS0D 1F00I 1QFWH 4OGYH 3ZHLA 3PL6A 4I18A 4XXDA 4U1SA 4R0LC 3WMSA 3HMXL 3O2VL 3DX8A 3PIQB 4WTXA 1EAPA 3RBGA 5F7KC 1NEUA 2PETA 1ROWA 5DJ2B 3FTGA 4J3OC 3NIDF 1MF2H 5J11C 4GQPH 3TA3D 5IESH 1X6LA 4LEXH 4HCRA 4BUGA 4QWWD 5E94B 4ZNEE 3DX9B 4KRPB 2F8XC 4NNPH 3BO8A 2OMNA 3ARFA 4WI3A 3OJDB 5E8PB 3NABL 3S5LA 3CVHB 4GBXC 3QEQA 3ZL4H 2CIKA 4OUOA 5GSVA 5CMAB 3R0NA 4ZUSA 5C0FB 4ODUB 3O6LH 1XGYL 3RWIB 4JFEA 1TCRB 1NBVH 4G7YL 2MSPA 2OI9B 3L95A 5CGYD 4CU6A 2VXUH 1MCJA 1WF5A 4WDIB 1Y6KR 5FDYA 2DYPA 3ARPA 1PBYA 3P0GB 4HQQH 4IOIA 5DI8B 3IJSA 5SWZE 3EYFA 3S35L 5IHZA 2YN5A 3UYOD 4KY1H 2YS4A 4PJHE 3H7BA 1TMCB 4GW4B 4X6EA 4YBQD 4L8SA 4YHNA 2VR4A 3DUSB 2H32A 3E6HA 3DMMB 4NKIH 5GGVH 1SEBB 5B39G 4PIRF 4DVBA 1W72H 3BN9C 4OZGB 3IKCA 3MUY1 4KKAD 1OLZA 5CD3B 1SJXA 5EOCL 3FOLB 1N5AA 2LVEA 1C5CH 3ZDZE 2IAMB 3NCYP 5DFVD 5GJSH 4POUB 1INEL 1XR9B 3GBNH 4CVZB 4ENEC 2YD5A 4H20H 1JIBA 3TJHD 5IGXH 5ALCL 3BSZL 1DLFH 5CBAB 4DN4H 4TYUA 1SVZA 1E27B 4AIZA 2A74A 3OKDA 5JMRA 2NX5E 1S8DA 1BVLB 4PBVC 4ZNEA 1FYTE 3SO5A 4KWUA 3TZVB 5IHUH 5HHXL 3ULUF 1TVBA 2WUBH 3BIKA 3FT2A 4K3DL 4OZHF 1RZIA 1SYVA 5F7DA 2MPAH 5HYEA 1NGWA 5IVXA 1VKXA 5EZJA 5EA0H 1JTPA 2QJDA 4XI5D 3GMRA 1RUKL 1UXSB 4MVBC 1OAXL 3QAZB 3EO1A 1DEEB 2A6JA 5IKCB 4FQ1H 2GJZB 5I1LA 1A64A 4F3FB 1KLUA 4OFIA 3S96B 4I77L 2A9MH 2OR9L 2DM7A 2R0ZH 3U9UB 5C70A 5GS0L 3LAFA 2Z93A 1XCQA 3ABZA 3VXUA 1RVFH 4KJWC 3GMMA 5CZXD 1GGIL 5F71A 4QHMB 1OGTA 3JWDC 4PJXF 5EU7C 5LCVH 4KJWD 3B9AA 4K3EH 3T0XA 5IQ9A 3QHTC 2UUDH 3LN5A 3C2AH 3BPOB 1KEML 2AJSL 1K2DA 3IFLH 5AZEH 4KDTA 3LPFA 4JPKH 2BY2A 2VISB 5I66A 5L0QB 5K9KA 1WWWX 2V7NA 1K4CB 4E41D 5EU6E 5FA3B 3K8KA 2OCFD 5IKCA 3T08A 4YHZH 5E2UH 4QTIL 1RUAH 2DL2A 4WUKH 2NY7H 5CEYA 5CINH 3LV3B 4IBLT 5HBBA 1A6TA 1ULVA 1X5KA 3UJIH 1PAMA 5SV4A 4UT9L 3OJVC 1GVIA 4ZO6A 3NIDE 3ZKXC 2IPUK 3QUKB 4HUWA 3MRJB 4KXZH 3FQRB 4HIJA 1DBJL 4Q6IC 1OARL 4TNVF 4FG6C 2VYRE 1JP5A 4Y19A 4BH7A 4EOWH 1JYVA 5IFJA 2IQAA 3D0LA 3SDCC 4ONHA 1JRHL 2NTFB 5J1SC 4XHJC 3IDMB 3VRIB 1YN6B 5I1CL 4I3SH 5DQJA 3CSYA 5DMIL 2X09A 1UJTA 3P4NA 1IGIL 5EBLA 4MD4A 1EJOH 1X5JA 5AUMB 1FFQA 2UWEA 2A6DA 4APQB 5C7XH 3QFDA 4L3EB 2H6PB 1G9ML 1WUNT 5DRWB 1TJIL 4PRIA 2NXZB 4LKXA 1C12B 3C8DA 4YBHA 5H35A 4G6FD 5I75B 1WWCA 2J8UB 5ETUA 5IB2A 4E42A 3PDDA 4JO3H 4Y4HB 1CU4L 5IVZB 2MPAL 4GMSH 4CNIB 4KI1A 1ZA3A 3DUUA 3K4DA 4U1HA 5T1DH 1DSFL 4Q0XL 5HDLA 3MPCA 4PPTA 3V95A 2FD6H 5T3XL 3SDXA 1HDMA 1NQBA 5E8DL 3S7GA 1CICA 2QQLL 1IAIH 1HILB 2AEWA 4OLUH 2AK4D 2GUOB 3GJFH 4FHBD 2F5AL 4K7PX 1F42A 2CLRA 3Q0HA 1QSFB 1U8QB 4BFBD 3KPLA 1FVDB 4HJ0C 3RGVC 3MNZB 4PJEA 3PHQB 2P24A 1AGEA 3FB8B 1I7TA 2NY3D 4P9ML 2F5BH 1RMFL 3DX8B 3P30H 1W72L 1UM4L 1CD1A 4PY8J 4CN1A 4KV5F 1BQLL 2P8PB 1LP9A 2PTVA 4HWEL 4P23D 4ZUWA 5J0BA 4OFYA 3DSFH 4JREB 5IB4B 1KEGH 4RAVA 3VXMB 1DBML 5AZ2L 5B3NA 4KMLB 4XAWH 4RFNC 4KTEH 5ALCH 32C2B 1I9RL 5F7FA 4OB5L 1H0DB 5C6TH 4WI2A 4FZ8L 1WEJH 4XP4L 3DMMA 4OT1H 1CGXA 3PQYB 3TLRA 3QI9C 2G75A 2G5RA 3B5TA 3JTSA 2BNUA 1T1WB 2Q76A 4NWUL 1OW0C 4M5YL 4RFOL 1CTNA 2NLJB 1FNGB 4HCRL 5TDPB 3O3EA 3WL9A 3DVNA 1T7WA 4WW2C 1A6ZA 1IGMH 1MIEH 2O61A 3JWDH 1IQDA 2YD6A 4U0QB 4PJAA 1JBJA 3S34L 4NNPL 4YHNB 3U48A 4EN3A 4XRCA 3KLHD 1HI6B 1RHFA 4EIZC 2EDXA 1IKFL 4WU5B 2X4NA 4Z8FH 4C83B 4I2XE 4GLRH 3QEUA 32C2A 4XNMB 3QDGA 4F57L 3BJ91 2NTSP 1SEBA 4E41E 4QRRE 3X3FH 5GGQL 1EO8H 4CN6A 5ISZD 3QUXD 3O6LL 1PVHA 1FNAA 4LPUA 4R8WL 5KANG 4Q2ZB 3DETC 1GPOL 1UXSA 1HXMA 2QQNL 4JREC 3GKWH 3RP1A 3A6OA 3JTTA 3K2MC 2FSEB 1R3JA 1U3HD 4KY1L 3QZWB 1I9JL 1M05B 2AABH 3MRHA 3PWVB 4G7VL 4NO3B 4NDMB 1A7RL 4I0KA 1NBQA 2R9HD 3RAJH 2EDNA 1HSBA 1P84K 4OF8A 1ZXQA 5TFSL 3WN5A 2A74B 3OKDB 4LK4A 1I1FA 4WW2A 5F1NA 2ZSWA 3E8UH 4DVRH 4HKZA 2CXGA 1BAFL 3MJ8B 3MSPA 1P6AB 4ZQKB 5E99H 3CX5J 4CJ1A 5HHPB 2DB8A 2R69H 4M93B 3T4YA 1NUNB 3MACL 5GIRB 4MD0A 1OAZL 4DFIA 5D1QC 2XZAL 3HG1D 4EUPA 1IT9H 4IM8A 1JHTB 3QIBC 2P44B 5DJDB 2BVYA 3QUXA 5JLZB 5K9KB 3SJVD 4H20L 3HC0B 4NQEB 1VFAB 4DKFL 1F4YH 3W0WE 1TJGL 4U4BA 4BFIA 3F5WA 2WUBL 3DYPA 4P9HL 4MAYC 3EGSA 2GHWB 3KPPA 1JWSB 1LILA 4X6CF 4DGVH 1WT5A 4NOBA 5IW6A 5F93C 2D4FA 5JA8B 3BGFC 1YDPB 4GSDH 4LKCB 1HCVA 1EK3A 1U6AL 4X80L 5H2BB 4YHKL 4HAFA 3IU4H 1CDJA 3BQUC 3OHXB 1MCPH 4PJCF 4XPBL 5HGAA 3BDXA 4M43H 3REVB 3HZVA 5DQ9B 3UPCA 3X13B 3QWOA 4OD3L 3FFDB 4EIGB 1DBBH 1IC1A 3ARVA 5HJ3A 2FZ3B 4F7EB 2VDPL 3QB7C 5I0DA 3FJTA 1QUNA 2NR6D 3MUGB 3CSYB 1LEGB 3UTPE 1MNUL 4K7PY 3QUKA 2ESVE 1A7QH 4MNGB 2F58L 4N0UA 3VXOB 1ZA6B 2J8HA 3RWCA 3CLFH 4CVXA 1RJZB 3CZFB 3FZUC 3O4LD 3G6JE 1E4WL 7FABH 1N3NA 3ILPB 3N50A 2H32B 2HT3C 1C5CL 3D0LB 4QTIH 5B38G 2X9WA 3N1PC 3RVWC 3PDOB 1Z3GH 1A0QH 1MJJA 4HWBA 5ACZB 5C0CE 1CGUA 3CPLA 4G6FB 4XBPA 4NFCA 4MNHA 4N0YH 3HNTL 1IL1B 1XF4A 1M71B 4UT7L 5CEZL 4H1LA 1RJYA 3D69B 4M00A 4APQD 3LPGA 2DD8H 2NY5C 3VGAC 5JHDA 1FO0H 1T89A 1H3GA 4HXAH 1DUYA 3BEWA 4FFZH 1ZHNB 2WW8A 3HZYA 1QLFB 1EXUA 4TOYL 2FYYA 3E6FA 1WC7A 4QXTA 4X6DF 1D6EA 3MLVH 5FO8B 4DTGL 4G8GB 2VH5H 4GBXD 1TDQA 3MNVB 1BQLH 5JW4R 1PKQB 4QHLA 4HWEH 3QG7L 1PQZB 4KUZH 5LQBH 2J7LA 1YZZA 1XAUA 4LLWB 5T5NF 1JGEA 4QT5B 5IVZA 2OZ4L 3VXSA 4LASH 4NFBA 1E4XH 3SGEI 4XWOD 3ALXA 4Z18A 1NSNL 5GXBB 3QNXB 2DTMH 4WI8A 5J1TC 3QCVL 1BF2A 3JUZA 2MHAB 1GAFH 1A7OH 2EDKA 2AEIT 3OAZH 1AP2B 3MV01 3PWUA 5DK3A 5KG9A 25C8L 4KROC 2WLYA 4LCIL 1CICC 1FGVH 3RFZC 3Q48A 1C16A 2HVKA 5F8RC 4PJEB 1A1OB 1ITCA 2R2HB 5C0BD 3ZE2F 5JO5A 2B5IB 3IRZA 3HRPA 5HI5C 1ED3A 5E5MA 5F7HA 3D25B 4WY7H 3W0WB 1ES0B 4WU7B 2X4PA 3NFPB 2Y23A 2XTJD 1LE5B 2LVCA 3DLQR 1KB9J 1UEMA 4J4PC 3KPNA 5C0IA 1J1XL 5E8EB 2BHUA 3EJZD 4ENED 4ZOAA 1CDGA 2VRAA 1WV7T 1UM6H 3WD5H 4OSUL 4X8JA 2V17H 1G7JA 1BZ7A 1LO5B 1UB6A 5BQ7B 1NAKH 4BK5A 3NPSB 3FO0L 1RHHB 3QIUA 1XF2B 4JPVL 3ZE0F 4E5XA 3KLAA 1CVSC 4PRPE 3QDGB 4W68A 1TETL 5DD5H 2CO6B 4LSSH 2RIKA 5E4EB 1KCRH 4XMPL 3NCMA 1B9ZA 4XXDB 3B9KB 3MRDA 3RIFK 3WIHL 4DKAA 1FNGA 5TDPA 4Z7WB 1ADQA 1A7RH 3CDGA 4WHTA 2D3VA 4ODVH 5DQDH 2G5BB 3CFKA 3RJQB 4X8XA 5BV7H 1EJ6A 4TSAH 5I1KL 5LXGL 3EOTH 5JPMA 4ELMA 4OLYH 3U30B 1II4E 4ONFL 1FFOB 5IFJB 4PGBB 4NQCB 3C6SA 1YJDH 4RA3A 3TBWA 2FL5B 1BZ7B 4X5XA 3CDFA 1Z3GL 3QZWG 2GITA 2FGZA 1WK0A 1S7UA 3FQUA 1F4YL 4G6JH 1RIUL 3NCFB 1MWAL 1X5HA 4S1DC 4FQLH 5GRZA 4TSCH 3GSOA 4OUUB 3BUYB 1LK2A 4TQEH 2DLIA 2H26B 1KNOB 1MJ8H 4MAUH 4LIQH 3RVTD 1NUFA 3CMOH 3SGKC 4XMKH 1NMAH 1N59B 1OTUD 3CDGB 4PBXA 1OSPH 4XVUD 2Y07L 1F5WA 1OQXA 1I1AA 3WCYA 2Q8BH 1S7WA 1LGVA 1J8HB 3CFIC 4J6RL 4DFHA 3M17B 1IFHL 1V3JA 2AJ3B 2HTKD 3DMMD 4LRNL 4ORZC 2QADD 3INUL 4F80A 3BW9B 2C26A 3CU7A 1XGUA 3TV3L 5HHOA 2HT4C 1A7NH 1WBXA 1RZIB 4ZQKA 4J2XA 1E4XL 3AXLA 1KV3A 2YOCA 3CFCH 4B5EA 4FOMA 4GG8A 2X4SA 5HHOE 5C0DA 2IANE 3SBWA 3ULUH 4I0PB 4L4VE 5FO7B 2ED8A 3U9UA 1WZMA 3S3SA 5F1OB 4KZEH 4HG4K 4YUEH 2M8XA 3BH8B 3S37H 3OKMB 3MCLH 4HK3N 1YECH 3GBML 4M3JA 4PJXB 3GSQA 4H0IA 3VWKC 2IQ9H 1ND0B 1Q0XL 1TQBC 1KJVB 4MB3A 4Q58C 1AIFA 1ZT7A 1QR1A 1ZOXA 4UTBH 5IT2H 2AEQH 3JV4A 4BQ8A 4P49A 1A3QA 1JF6A 1CR9H 2X2YA 3VFSA 5L8LB 2FWOB 3FB6A 1H0DA 2AJVH 3HPJB 5BRZB 3L7FA 4NUJA 5DVKA 4K9EH 5F9WB 1FVEB 2B5IC 4FQCL 4BSWB 4OCYL 1YYLL 4F3FA 3OAYH 4U1GC 3X17A 1BZ9B 4FQXA 4JG0L 1VHPA 4NZTH 3RX8A 2OL3B 4PRIE 2K7PA 4CJ0A 3O3EB 5LGKA 4XMPH 4N0UB 2DL9A 4IHOB 4KPHH 3JSSA 4GRWF 1PLGH 3GHEH 5KAQF 4P46A 1UENA 4Z76B 5HHMB 3JWOH 1RJZA 2X05A 3RWJB 5JUEL 3AY4C 4OCNC 1QFWL 4OGYL 4JO1H 3KPOA 2CMRH 4M48H 1C5DA 4NQVB 2K1MA 1RZKL 2EYRB 5HY9B 3QEUB 4GJTB 1E4KC 1ZT4B 2E9JA 1QLEH 4G5ZL 4KHTL 4X7DC 2EE2A 1PY9A 5ACZA 4XH2A 2LTQB 3O41B 4HFUH 2Z91A 4OKVA 4R26H 5E9DA 4PRBB 2EZ0D 1IC5L 3GRWA 3BEWB 1OP3H 3ARGA 5BRZD 4NZRL 2DI8A 2B8OT 4LDLB 4D8PA 1AH1A 4RMSA 5D7IA 2PO6A 4QYOA 2WWKO 4F7TA 3BD3A 5DVNA 4HUVB 5ITFB 1GSMA 2AJUL 4OCRH 5TDNA 5IMKB 3M8OH 3VD9A 3T0BA 4QNPF 1YQ2A 3PL6B 1YNLH 5DDHB 4G8GA 5JPNA 1CLZH 4PJHA 1TQBB 5ID1A 3WO4B 3EO9L 3KXFB 4K8RL 2CH8A 5CEZH 1INQA 3RWHA 3FQXB 4X7SL 2QR0A 4GXUM 4P2QE 1M7DB 2LQRA 1NAKL 2BZDA 4KTDL 3SHSA 4DUWA 2FX8H 1HWHB 1A2YA 1FZJB 4W6WB 2L0DA 4LDOB 3DIFA 1ORQA 2NW3A 3S35H 2CO7B 3NIFF 4HXAL 1IRAY 3HC3H 2P48B 3BP6A 2PR4L 1UACL 2VN7A 1IE5A 3ARGC 4CU8A 5DEFA 1MFEL 3MQIA 5IMKA 5TDNB 2DWDA 4GG6E 4U1IA 5EUOA 5I2IB 1F4WH 4E42B 3LKOA 1CGYA 4PJ9C 3MCKA 3BD5A 4YR6A 3OHXA 1T66D 4EDXB 3DI3B 1LO5A 5C1MB 1KPUB 4LHUB 1N26A 1TZHB 4LCUB 4P23B 1FAIL 5TQ2H 1C8PA 4AIXA 5GS2H 1A7BA 2APTA 4F9PC 1LEKB 3KHOA 3MLPA 4KVCH 4L4VD 3ESVF 3HE7A 3K7UA 5FF6A 2NY2C 4MA7H 4MQSB 3H9YA 3M07A 4J6RH 3LY6A 4LVHC 1LO3H 3G5XA 1DBJH 1X5GA 1BFOA 2A1WH 5IQ9B 2JCCA 2Q1EA 4U7KA 3ZL4L 5B21A 2HA1A 3MRMA 3AMKA 4PJFB 3B9DA 3HS0A 3MRDB 4Y16C 4ZOEA 3VXSD 2E7HA 1S5HA 4S10A 1A5FH 2Q7YA 1QSFD 4JPIA 3QSKB 2XY1A 4Y0GA 4I3SL 1BD2E 4EDXA 5BZWA 1J1XH 5DJ8A 3HAEG 3N85L 1KSRA 4RAVB 4XNUH 1CE1H 3LCYA 2X4TA 4AG4L 4XVTH 5D7LD 4LLMB 3QPXL 1S9XB 1WQVT 2AXGA 5LKNA 5F9OH 2VQTA 3IETB 2VDKH 3NFNB 4X0KA 4OZIF 4PRID 5L88L 1NFDA 5BV7L 2V5TA 2E6PA 4JKMA 5EZIH 3D85B 3GSUA 3S8WA 1I1AB 1U58B 1JWMB 3H3BC 1BIHA 3IVKB 1ZLUH 4LHQB 5E2VH 4HS6B 4IOSD 4OBRA 1E6OH 1GGCL 2H3NA 1AE6L 4MQXC 4EUPG 3VFRA 2YEZB 1YJDL 5C0AA 2CGRH 2AJ3A 3LQZB 2I07A 1VFUA 2VABB 3REWB 4X7SH 3UTTD 1NCBL 3PJSB 5T1KA 3S36H 5E1AB 1C08A 3TJEH 3HZKB 3UJIL 5C0EB 4N0RA 4KKNA 4PB0H 4CRPA 2F54D 4IMLA 3V4PL 2H2PD 5DD6B 2BP3A 3D85A 4H0HB 2BRRH 2Z0BA 4JM2C 1UG9A 1B4JL 5DMYA 3V5KB 1FNLA 5I8EA 5I8KL 1PD6A 2Y07H 3RVUD 2ED7A 1N4XH 2G2RA 3THML 4A6YL 3ROOA 4LPYA 4JGMA 2W0FB 2VL5B 3PNWB 1MVUB 5D2NE 2DN7A 4UDUB 4YHML 1FVCB 2D7TL 1NGYB 2E8ZA 3GI8L 4YXLL 4JHWH 1G7HA 2VXQH 3KYMB 4HFUL 5ITBH 2EDQA 2JCCE 5GRUL 4Z76A 4P2OC 5BQ7A 3MROA 3U9PH 1VEPA 3ULVL 2QEJA 4L3CA 1ONQB 3G6JA 2FWOA 3BKML 5DJDA 4EXPX 4XVSH 4HH9A 3MNZA 2ILLA 3SOBL 2FNBA 2B1AH 4JRXB 4YNYB 1F45A 4N8VG 1LQSR 2VDOL 4UTAH 4XP6L 3GB7B 3SY0A 1WLHA 2LV4A 1BQHG 1FBIL 2DQDH 1DBAL 5ADOL 2WUCL 3KWWA 5T1DL 3I3BA 2C1PB 3PV6A 4RFEB 2HFFA 4MQTB 2WWKT 3VFVA 2WBJC 3QIWD 1TITA 5DJXB 4Y5XA 2W65A 3VWJA 3UBXB 3DX7A 2FX8L 1IAIL 1CG9A 3BWAB 4NBXB 2WBJB 4S11A 3LKPB 4Z5RA 3KYKL 1X4XA 4QRPB 5IB2B 3AB0C 3QDAA 3HMWH 5T1LB 4RGNC 1FN4B 1ZHLB 3G08B 1KC5L 5DK2A 5FHAH 1WT5C 3KJ6L 1XZ0B 1KCSH 3FMGH 4FXLA 1W2KT 3ARGB 3MV11 4RCAA 5KS9F 1CDYA 4B7IA 1WIPA 4LRNH 3RIAK 3RA7H 1I1YA 5FGCB 5EG6C 2DQIH 4NNYB 4OLWH 2BVEA 3FQNB 3DSFL 2JK5A 4LCYA 3C8KA 1TTGA 1HI6A 4Z7UA 2CLVA 4EJ1C 4YDJB 4HAGA 4AMKH 1FSKC 2V9TA 5KSAB 1XGUB 1UH3A 2EDEA 3P11H 3QAZC 2DQFA 3CFEB 3DV4A 3L7EB 4PRPA 4ZFOL 2VISA 3MCKB 3F12A 4PJDE 4XI5C 5D7KD 2W1NA 5I66B 4ZFOB 1XF5B 4QRRA 5FFLA 3ARQA 1IEAB 4WWKA 4X7FC 3VFUA 3AU1B 1AD0A 4Z7OF 3CVIH 4A6YB 4O4YH 1QPPA 3DX6A 1HSBB 1VPOL 4NZDA 4AQ1B 1IILE 1NCNA 2V5SA 5FHBH 3PGDA 4F7MA 3MV8B 4XNUL 2WINA 4PB9L 2XICA 1K3ZA 1G7PB 1RK0B 2Q7NA 3VXUD 4KRPC 3SPVB 4D0BA 4MCZA 4JHWL 4JRYB 2CJUL 3O9WC 1NCWL 2PXYC 1UJ3A 2J6EA 1LDSA 1YMHB 3T8XA 6FABH 3VFPB 1YEIL 2A6KA 4PY7B 4WO4D 2X9YA 5BRZA 4JN2A 4PLJD 4KTDH 2NTFA 3RVVD 1W0VA 5JXAL 1FCCA 1P2CA 3KPRD 4GOSA 3EFFB 4ZPVB 3OXRA 1IEBB 4MB4A 3VGBA 3BPLC 2QADC 1CF8H 5GPRA 2EDHA 5IWLA 4PRHD 4ODBD 4O00A 1RU9L 4JAMA 2WUCH 2J6EH 2DWEA 4GQ9H 4J8RA 1AR1D 1LE9A 4M1GH 1G6RA 1QHPA 4FQXD 3RL2A 3DXAA 1E6JL 2PYEA 2QKIA 2P5EE 1YNTA 3MV9E 1RIVH 2D0GA 3ARBA 4AEIL 4LLUA 1IGYA 4P9HH 4POYA 4OV5B 1AO7B 5JIPA 4KVCL 1ZA3B 1XIWB 5I30L 3CVHH 3TWCL 2ZUYA 1IM3A 1MFBL 1Y18B 3VWKB 4HGKC 1DL7L 5BCAA 4IRSD 1OD7A 4HZLA 1HDMB 1IAKA 4DGIL 3VXQB 1G6RH 2UZXB 4WRLA 4QRPE 4UB0H 1P4BL 2YBRB 3RWDA 5IQ7L 2J12B 2AJZA 4RWYL 3V7AG 1YPZF 3HI6H 5GGQH 2AJXL 5ISZE 1N4XL 3THMH 4HHAA 4HUVA 4PLKC 2FDBP 5HI3C 2XA8L 2H3NB 1UA6L 2AI0H 1KT2A 3NGBB 1GZQA 1QO3A 2YXMA 2JELH 2C1OB 4N8CL 5TJWK 5IB1A 3QCVH 1KFAH 4NQCA 3H8NA 2VABA 4D3CL 1F6FB 3BDYH 4JFHD 4GW5B 4PGCB 2DI7A 5D7IF 1XGRB 1JN6B 4DZ8A 5JW5A 1G0XA 1BQHA 3DTXB 4NN6B 5HDOA 4X4YA 4C58B 3EDKA 2GKIA 1JNHB 2NW2A 5D5MB 5FCUH 4OLZH 4XPHH 3S4SG 5CWSB 5C0JA 2OI9C 1MFEH 1BEYL 1DQQB 3HHRB 3V6FB 1NFIA 3O81A 2VUOA 4PJHF 1KB9K 5D71L 3HNVH 3GKZA 2PNDA 1EO7A 5LGHL 3TF7C 3OKOB 3IFNH 2W0FA 1NJ9A 2PTTA 2ITCA 4JQIH 4LLDA 1FVCA 1D6VH 1TPXC 2WK2A 5K93A 4CDHA 4YNYA 3SJVE 4HUUB 3RGVA 3ROOB 3KYKH 3ZT7A 3HMWL 3TN0D 3VXME 1KJVA 5E24E 4EN3B 1EEQA 2R1YB 4LHUA 4GS7B 5IIEA 5F9JA 3TBYA 3CZFA 3QJHA 1OP5H 1K2DB 2NYYC 5DEGB 4ZDHA 2BRRL 1TLKA 1CQYA 5GSVB 1A9BB 1C1EH 4FFZL 2NW2B 3ARFB 3LRHA 5D5MA 5KS9E 3RWIA 1CQKA 1KB5A 4YO0B 1GC1C 3FB5A 3FQTB 1X6NA 1R0AH 5DUBA 3ARDC 5ESQA 1RZJH 4D0CB 2IMNA 2ZJSH 2MCG1 4RGOL 1OSZA 2D7TH 2DKSA 4H5SB 2PTTB 5IBTL 2IALA 2YD2A 4Z7OE 1J5OL 5TF0A 1WZLA 3FO2B 4Q97A 25C8H 1U8IA 2C7UA 1UB6B 3GSNH 3VI4E 3H42H 2D2OA 3ZTJG 1I1YB 1P53A 3MV8D 3UTPD 1KCVL 2WBJA 4C57C 4HIJB 3UPRB 1VFMA 3C5ZA 1D6EB 5FO8A 4W4OC 4X4ME 4P2RA 5EO1A 2HJFB 5HHMD 3VW3H 5EZIL 2VDOH 5CIPH 1QBMH 5INCA 5GS1B 5I1DA 5HVHB 4YO0A 4X5WA 4FFWD 4JHBA 4O9HL 5JOPD 2VXVH 3VE0A 2HLAB 4WHTB 1BJ1J 4PRBA 2CRYA 4OCWH 4U0RB 4UB0L 4NYLB 1I8IA 3WBDA 1JUFA 5JHDD 4DEPC 3BN9D 3IFPA 1NLBH 2ZUVA 3P0VL 4O58H 1CFVH 1NC2B 1NCWH 1GHFH 3QFDB 2H32H 1NEZB 4L3EA 5E2WH 5LBSL 4UT6L 3TZVA 1Z5LB 1X5AA 5KW9L 3L3GA 3BPOC 3TJEL 2G60L 1XT5A 3QXTA 5H35B 4NQVA 5JXAH 4NKMA 3SKMA 3RTQD 1F6AA 4ETQA 4Y5VB 1JPTH 1LK2B 4J3WA 4U6XB 3EO1B 4QHNA 5C0EA 5MEOB 2C4FU 3IDYC 1FRGH 4OQTA 2F74B 1D5ZA 2RR3A 2W0PA 4ODVL 3U79A 4Z7VA 1IZKA 4PRDB 3W39B 5J12B 1X5IA 4NM8L 4WHDA 3VMOA 1G1CA 3WIFA 1H3PL 2FJGB 3KLAB 4L4TA 4JM4H 4IMKC 4GG6A 2COQA 4JZOA 3MFGB 4XP1L 5F96H 3HE6A 3OKYA 5FGRA 3VRLF 2C3GA 4X98A 1RJLA 4HS8L 5GJTL 3TA3A 3TPKA 3GJEB 4Z7WE 3ROLA 3O2WH 1EBAA 3LMJH 2PW2B 4IEFB 5I30H 2AKRA 1RUKH 2CLZA 4R4FL 4KDTC 4Z7VB 1YEJL 1B0GB 5B4MC 5IK3B 3MODH 3BH8A 4NNXA 2R0ZL 3PQYA 3JWOL 2G75B 3QUZD 4HIEB 4HWZB 5C0NC 4OLVL 2NY6D 4FQ1L 2O5ZH 1SJVA 2DAVA 5IMOA 2QKIB 3UJJH 4YFLF 4PRPD 5DSCA 5HVFB 1EHAA 2DWEB 2NX5D 3EYUL 4KHTH 3QEQE 5J13B 4DKEL 5FDWA 1ZANL 3FZUD 3G5YB 3CSBA 3HE6D 1QRNE 1CXLA 2D03L 3RPKA 3Q2CA 1PQZA 1NCAH 4K3JH 1S7WB 4QRPA 3UCRA 4OZFH 2VE6B 1SBBA 1F3JB 2BOBA 3VDCA 2XACC 3UTOA 4NZRH 3H9HB 3I2CL 3SE9H 1CL7I 5EFIA 2ICWJ 3P9LB 3GK8L 5EBLB 2ZSVB 3KLDA 4NN5C 1U8OA 5CSGA 1QFWM 4R7NA 3HE7B 1N2RA 4N1EA 5DTFB 1D6VL 4NWTH 3PHOB 4HX1B 4HT1L 4U6HA 3FQNA 4G6JL 5EZLA 1BM3L 1YUHB 1NCCH 3IAPA 5CEXA 4PG9B 2XQYG 4M7LT 4BH7B 4QHUA 2H6PA 2BSRB 5GGSA 1RULL 4U6TA 1FORH 1G7QB 4NJAH 2E27L 3GSRA 5ETUB 1I1CA 4TVPH 4KH2A 3FFCB 2YRPA 3EBAA 3V2AR 5IG7A 5EC2A 1YMMD 3MBEA 5EU6D 5I74C 1FCGA 5I1CH 2FEDD 1IEAA 2A6DB 2NY1C 1C08B 2P46B 2V5YA 4V1DE 1DQQA 1D5MA 1Y0LB 1PYWB 4NHUA 1KEGL 5ALBL 1T20B 1J0YA 4NC2B 4MX7A 4Q6YA 4QHKJ 3QQ3A 3CXDL 5C7XL 4J3XA 3D2UD 5IFAL 4KUCD 5EBMA 2VLME 1G84A 4KFZC 4KQ3H 2VR5A 3U83A 1AQKL 3MRNA 5IJKC 5BVJB 1B2WH 1YMHA 5C09A 2N7BA 3O2WL 3L3KA 5EWIH 1M1SA 3X11A 3PE9A 1YEHL 4ESKA 1T7ZA 3NCEB 2ATPB 2EE6A 5E00B 5J56B 1JE6A 4L4TE 5CCKH 3MRBA 3VA6A 2CR6A 1ACYH 3QH3B 4JFDD 2AEQL 1KJ2A 5IBUB 3MRFA 2NLJA 4PGDA 3BESR 3QWRD 3W82A 4EVNB 1HQ4A 2GTWA 4KAQH 2VTFA 1GYAA 1URLA 3BZ4B 3MJ9L 1H3TA 1GGTA 5B3JF 4DOHE 4JG0H 2DQGH 1LP9E 1IGJA 4F7PA 3G9AB 4S1SL 1ZVSA 3IDNA 4YQXL 3B83A 2BY0A 3GI9H 3OAUH 4UAOC 1I9JH 1YMMB 4LVOC 3WFCL 5FM4A 3GZKA 3QNYB 2VUYA 3HNSL 4U1KB 4WU5A 3GMQB 5DRXA 3TO4A 5C9JB 4LARH 2VKXA 4EN3C 3UBXI 4TSBH 4L9DA 1FZMA 3OJDA 5E8PA 3RUGE 5HYSG 4TNWK 2VZ3A 3VCLB 1YYMH 4R4BB 4C83A 3NIGF 3T1WA 3VXQA 5ESVB 4ZUVA 5T1LA 4ZNCD 5KVDH 2VWEE 2JCCB 3WDJA 3FT3A 1OWRM 1RZFH 1A6ZB 1MVFA 3QZWA 2HG5A 1CLCA 3ARTA 4CW1A 5TDOA 1HXMB 3VG9C 1LDPH 3U1SL 5T3XD 3C6LA 5FGBC 2AXFB 4NQCE 5HD8C 4PYGA 3ARUA 1EEYB 1U8NA 5CZVH 4PJIE 1MHEB 2X4NB 4R4FH 5J06A 4PB0L 3HZMB 1S9XA 2AXGB 3C60C 3DURB 4JR9H 5F3HB 2Z31D 3BKJH 1QLRB 1FDLH 1R3LB 3QDJA 5D71H 1EMTH 4YR6B 2XFXA 3L7FB 4NUJB 1EV2E 3HRZA 4BQBA 4NQEA 3SCMC 3RRQA 2HT2D 4QRRB 4GAYA 4ZAKD 2ORBL 5T3ZH 3SBWC 4GW4A 1IM9B 2R4RL 3LKNA 3MOBL 2I60H 1E28B 4LLDB 1YA5A 1CE6A 4KKBD 1KPRB 5CJQL 2YEZA 2BVOB 3OZ9L 2XG4A 3EYSH 3HG1B 5HHPA 3JXAA 1OPGH 4YFLI 1TIUA 3WLWC 5I0ZA 1JRHI 1MPAL 5E1AA 2DS4A 4RMTA 3RNQB 4NQDB 4R0LB 2FJFB 2XXCB 1KYOJ 3L7EA 4DK6A 1RSFA 4MAYD 1K8DA 3P0YL 3BE1H 4FFVC 3L9RA 3KPMB 3STLB 1JPGB 1X44A 1MQ8A 4Y4FD 2Q8AH 2A0LD 3KNBA 3L3IB 3VFNB 1GGBH 1KG0B 15C8H 1NCCL 1CIDA 4KRNA 4WNQA 1A8JH 3QIUB 1XF2A 3EGSB 4RMVA 5EUOF 2B4CH 2WWMC 3QCUL 1DN2A 5TQ2L 4G43B 4G3YH 3SN6N 2XZAH 2L7UA 2LU4A 4XCNB 1G9EA 1YC7A 2ZSVA 3NACL 4P46C 4ZYKA 3I9GL 1YDPA 4LKCA 2XXMB 2R29L 4TVPL 1GZPB 4KZDH 4NKQB 1HHGA 1U0QA 2PYEB 3QUYC 1U58A 1U8PA 4L3CB 3AMLA 3ET9F 5JPMB 4S1RL 3PABB 2PUQT 2RHEA 1YEJH 1A1NA 3WJLA 1JFQH 2DJ4A 5FGSA 4I48A 4DAGL 4JN2B 1P9MA 2R23B 3ULVF 2YUWA 3EYVA 2QR0B 4CVWA 2CDGB 1I3RA 1T5XA 2R4SL 2VE6A 4L4TD 3CPLB 4ODWA 4YXLH 1FHGA 4XTRC 2VXQL 1A6VH 5D7LA 1O0VA 2O5ZL 4HLZH 5IR1B 1ZTXL 2I25N 2SEBB 4R8WH 3ZDXF 5EU3A 1FFPA 2DQJL 5C2BH 4UILL 1M6OA 5JHDB 3V5HB 3FN3A 1MCOL 1LDPL 3UX9B 5K9OB 1LE9B 4X6DA 2PW1A 2N56A 2W59A 3U30C 1DUYB 4WWID 4NIKB 1CGSL 2MNUA 4CU7A 5EC1B 4I1NB 4JGUA 4DKEH 1R5VB 2ADFL 4NP4L 1ZANH 1Z0NA 2H9GB 2IGFH 2H2SD 5DZNA 4RGNE 5EU4B 3BP5B 1OWWA 2GTZA 1E4XI 2BVTA 5SX5K 1UB5B 4YFDB 3MGAA 1I3RB 1FIEA 4DK3A 1HNFA 3NIGE 5TE4L 3SE9L 3DI2B 1VPOH 1EFQA 3EHBC 2NY4D 1M7IB 3KYMA 4YXKL 3VXSB 1BREA 2XWTB 3HLAA 1CD8A 2EECA 2KBGA 4CMHB 4D9RD 4ZO7A 2VJXA 4OF0A 2D9CA 2NX5A 4NNYA 4HC1L 2HTLD 5ERWB 3C08L 2FO1A 3QYCA 4UUJA 3UZQA 5A1AA 2YUZA 2CIKB 4PJIF 4K7PH 3ZKNC 4R7DB 3SDCA 1TVDA 5LGJA 2YMXL 4G42B 1MLCA 4XGZB 4MJ6A 1AXTL 1R5VA 4XNZC 3P4MA 3K74B 2M1KA 1AD9B 3LRSA 2EDLA 5I73C 3C09C 1A21A 1I3GL 3ZYOA 5SWQB 2VAJA 4HIHA 1MI5D 4JFXA 2IANB 4G8EB 4GRLC 2KH2B 4XCEB 1ZVSB 5ISZA 5IEHB 1MLBA 2BFVL 5F9JB 4F9PA 3I6GA 4ODTH 5ENWA 4XCCH 3FFCD 5KVDL 3X14B 3D9AH 1VESA 3DARA 3BOVA 3TJHC 1MAJA 4KI5D 2A6IB 3UTSD 4Y4HA 2JB6B 2CKNA 2FRGP 4XNYH 4J3UA 1XZ0A 3SPVA 4D0BB 3T3ME 2IPTH 3SDYH 1S7RB 4ZTPL 4CMHC 2J5LC 3H0TB 3Q3GB 4P46B 3G6JF 2C5DC 4HIHB 2X4UB 4WW1B 3TBWB 1W0VB 3MLRH 4KK6C 4NN7B 1FGNH 2VDQL 4JY4B 1VEMA 2HKFH 1QSFA 5JXEC 1M7XA 1A6UL 4RMUA 3QQNA 3FQWB 4X5XB 3MZTA 3TH3T 3QXAA 1FNEA 1CDCA 4P3DB 5TGBB 5DTFA 5IM7A 2QQKH 3OV6A 5EZJB 1REIA 4OKVB 2EIEA 12E8L 1YUHA 1NDGB 1MELA 2CRIA 4K3EL 4K55A 5CAYB 4QHUB 4WFED 1JHKL 1KJ2L 1LEIB 4GBXA 1TETH 3V79C 3SKNB 2JJTA 4LSSL 3IJHB 1MVUA 2F8OA 3RVXC 4DN3L 1D9KA 5B4MD 1YEEH 1XIWD 3BJLA 3QG7H 3TBTB 5J7CC 1JZ2A 1UM5L 5ALBH 4ETQB 4UZGA 2ARJB 3IF1B 4L5FH 1DUZA 5C07A 2A9NL 2VZOA 4M9OA 3X12A 2O26U 4P3DA 4M5ZL 5TGBA 5IM7B 1WISA 3C5SA 1AY1L 4WFHD 3U7YL 4YHPB 2X4SB 4Z7UF 1U8MB 4JE4B 5HPMB 1SMOA 4D0DB 2IBZY 3EYQC 4JKPL 4L8SC 4UNUA 3VGEA 3KNBB 2UZIH 3L3IA 4PJ7F 4YDKH 4G6KH 1OSPL 5EU5A 5CEYB 2C1PA 3GGWA 4LIQL 4PGCA 3BVNB 2A38A 2BNQD 4PYHA 4NQDA 4R0LA 5JNYA 5IEKB 1X3DA 5IBUG 3GIZL 1I85A 4LSPH 3BD4A 1FFNA 1JPSH 5DWUH 1QSZA 4I0PA 4HDIA 1OGAE 4NQTA 5F7EH 5F70A 4KJPD 4EUPB 1Q94A 5C07D 4O2CB 3AS0A 4K94L 1JI2A 4JPVH 3WE6A 1PKQE 2DQJH 4WNQB 2EKSB 3E2HC 5FYKD 3H9SB 2I24N 5HHQA 4Q74A 3NFSH 2Z31A 5CBEA 4D3CH 5D1XA 3MLSH 1A6AB 1Q9OB 3STZB 5JNYB 3KJ4C 1G7MB 4BFGA 2AW2A 4O2EA 4NQED 2E3VA 3WFEL 4OLZL 1R5IB 1IQWL 3PWLA 3Q5TA 5IVXE 1J0IA 2P5ED 4N5UA 2FD6L 2ADIA 1MI5A 4LEOB 1ZSDB 5K9JH 1J88A 5ICYA 3T09A 4UTBL 3MRLA 3ULSB 5HI5D 3EDEA 4Y5YA 5JQHC 4XP5L 1AC0A 4FQQB 2YUVA 3R8QA 4NZTL 5DS8A 3QUYB 5KW9H 1U92B 4X4YB 5KZCD 1OAKL 3GBLA 4HJ0D 3TVMA 4FQCH 3B2VL 1SJHB 1VGEL 1YYLH 1ACZA 4FXGB 1T83C 3S9DB 4UV4H 4X9FA 5GRWA 1P7HL 5FUCC 2Q86B 2Z8SA 3NCJH 1V8HA 3JUYA 1NMBL 1H5BC 4R4NC 1MJ7L 1U8QA 4IDJH 4JHAH 1KIQA 2AXJA 1P4BH 3K80A 5HJ3B 1TZIB 4K8RD 4DN3H 4ORGB 1NJ9B 3K46A 5INCB 2RQ8A 4MS8D 3RWHB 1U8HB 3PWLB 5HYQA 4U1GB 4OT1L 5I8OH 3T0EC 3QDJB 4LLVA 3MUGA 1PEWA 3MRGA 4KTEL 4ODTL 3O3AB 4UAOB 3T65A 3DIFB 5ECJE 2HWZH 4X4XA 5ISZB 4H1LG 1G9MH 1TJIH 2JJUA 4MXQD 1N3NB 3ILPA 1C7TA 4ZTPH 1H3VA 1CDUA 3WSQH 2BERA 2X4OB 4LNRB 1D5XB 4HV8B 2WANA 5DEFB 4Y16B 4WWKD 1MLCB 1QRKA 1FYHB 5CSZB 4ERSL 2W91A 4NRZB 4ODHL 1VA9A 4AL8L 1CIUA 1IGTA 2DBJA 3O3BB 5LGJB 1YECL 3GBMH 3VJ6B 4TNVK 3MYJA 3FQXA 3F7RA 4JFXB 5E8OA 3ULVE 1YNTB 2X6MA 3GIZH 4NT6B 3T1FB 2IH3B 4N9OB 4XCEA 3NBNA 3O8XC 1UQSA 1JGEB 4GKSB 2EYSB 1RUAL 4Y8DC 2ARWA 1B0WA 4ALAH 3BRGC 5IEHA 5IB5B 2EXWD 3N9GL 3MLYL 2AP2A 5DR5H 4JFYB 1CL7H 3S5LB 1N6UA 2ITDA 3MRCB 4GKOA 4KXZI 1ZGLB 4IRZH 1T0MA 5IJVB 5HGBA 3UMTA 2A83B 1TCRA 5EUOE 4ZUTA 3NPZB 1WICA 3QUMH 4G7VH 4X6CB 4YE4H 5MEND 4YX2H 4JANB 4PJAB 1JFQL 4P2QA 2IC2A 4P59L 3CMGA 3SDDA 4M9PA 4QHKI 5DMJB 1A9EA 1LO2H 1BAFH 3Q3GA 1CXFA 2W65B 3ARBC 3MA7B 4KRMB 3E2HB 1BBDH 2ATPA 2BNRB 1PFCA 1DR9A 3HR5A 4I2XB 5M94B 4OCLC 3HG1E 1ZLVK 1RAMA 2DM2A 1LNUA 1CLOL 1GOFA 2Y1VA 4I0PD 5I6XB 5KTEH 4QHNB 1VACA 4M7LL 1YEDA 4ZUTB 2AAVA 3HUJF 1HINL 1QSVA 1H15B 4M7JL 4W81A 3BI9X 1H9VA 1Z9LA 3GIVA 4U1JA 4X8JB 3OKOA 3HAEA 5SX5H 3L3OA 1WIOA 3GNML 4L3ED 1IKFH 4ELMB 5LWYH 1I7ZA 3HUJE 5JZ7C 2NY0B 3B9VA 1BWMA 1QSEA 5KSAC 4YLQT 2C3XA 4TUJB 4DOHB 2HFGL 5T1KB 4N1CA 3QULB 1JMZA