4U6HB

Vaccinia l1/m12b9-fab complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
DVVMTQIPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWSLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHDPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
publication title Potent neutralization of vaccinia virus by divergent murine antibodies targeting a common site of vulnerability in l1 protein.
pubmed doi rcsb
source organism Vaccinia virus
total genus 50
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB01
1L9NA 3T2OA 4HKZB 4XVUC 5IG7B 1FRGH 1FLTX 2EE3A 2HKHL 3MGTB 1K8IB 4PJHE 4Q58C 3FQWA 2ZJSH 1U3HB 3MOBH 3DO7A 3V6OA 3HB3D 3C87A 3G04B 4JJ5A 5KG9B 1MHCA 3QQ9C 4NRXB 3L6FB 2GJJA 5D7IB 1QSED 1NBVL 3GRWH 2VDMH 2Y5EA 1D9KD 4LP5A 4U0RB 5HYJD 3BZFA 1BWWA 4PB0H 3WDHA 3FQXA 1LEGA 2IBZY 1RPQA 4XPGH 1E28B 1BVZA 4GKOA 4HXBL 1SEQL 3L5XL 4N68A 4JFED 5HGDB 1JVKA 4EIGB 5GZOD 1UM6L 2ARJQ 4TRPL 3O3AB 2Y06L 4ODVL 2VZSA 2Z31A 2CUIA 4KTEL 5DRNB 3V4PL 1FBIL 3VFTA 4YC2C 4PGZA 4UV7H 1BD2A 1HHHB 3ZKQD 4JFXB 2AK4D 1N3NB 4F7CA 3UCRA 1PG7X 3GSOB 2ESVD 1JUFB 1NEZB 1RIUH 3SDCA 4TVPD 5CUSL 4PRHB 4TNWF 3O2DL 2PYEB 3BRFA 2HRPL 2UZXB 2E7LA 5SWSE 3QIBC 4KTYA 4P23D 2MKWA 3WFDH 1DVFC 4AENB 4FXGB 5E8DH 3S96B 1IGFL 1G7IA 3O4LB 4HIIA 5EUOF 5D2LB 4UDTB 3GIZL 1RUMH 4W6YB 1E27B 1IBGL 3DX7A 2X5PA 1OAYL 1CIDA 1TXKA 4P2OB 1N7MH 4JHAH 4MHHI 5EBLB 4IRJD 1MIMH 5EZLA 3F7YB 4IOIA 4N90D 5JPMB 3MUHL 4FFYH 4IRSA 4MXWH 3WE6B 2FHBA 5KBNC 1CD1A 4AL8L 1RZGA 4ZXBA 1YEHH 2BVQA 4AIZA 4MLIA 2CIIB 3RI5F 5TDPB 1U8OA 1EFXD 1IGYA 3FOMA 3WIFB 2MQCA 1ZVYA 4DZBA 2A6JB 3BH8B 3DX8A 5DSCA 5HHXH 4X9GA 4KI5E 2UYLA 1FO0B 1TZHA 3CVIH 2OBGA 4MJ6A 4QRTB 3FRUB 3FO9B 2R0ZH 4XPFH 1A7QL 3VRJB 1MRDL 2XG4A 3FAWA 5CS7A 1JWMA 1SQ2N 1NFIB 1FNSL 3WS6A 5HHQB 2Z92B 2APWA 5IF0A 3IFOA 3REVB 1J8KA 2DOCA 3LS5H 4CMMB 2QADD 1BZQK 4Z95H 3LEXA 2EDBA 1NANI 1Z3GL 4ODWA 2D3VA 3MR9A 4CVXA 2DLFL 2O5XL 4I0PD 5BJTA 1TZIB 4MA8L 4LSQL 3KS0H 5AYQA 3MMEA 2XPGA 4ZFFA 3MCKB 2AK1L 2UWEE 1DDHB 1HWHB 3C6LD 3RPKA 4M7LT 4QKXB 1MH5A 3KXFE 4ZAKB 3B8SA 4GKNB 4YDVA 3LCYA 2X70B 1UB5B 5D9SB 2HT3D 1JGVH 2AJYH 4G6AD 4PJ8D 2X4SB 1QUNA 3EOAA 4YFLI 2XZQH 4J3SA 4JZJC 5I17B 3EDJA 5SWZD 3GGWB 4K3JL 4Z18A 5IBUG 5CWSA 3QRFM 5DXWA 2FSEB 4NFBA 1DQML 3PIQA 2P8PB 2H26B 4ZNCD 4X8JA 4OGAD 3RWHA 2W92A 1L0XA 1EPFA 1NBZB 5BV7B 2WK2A 3MNZB 3W0WA 4W4OC 1TFHA 1NGWB 4BKLA 5FUOH 1GIGL 3RY4A 3ULUL 2IADB 3UBXG 3UYRH 3VXRA 1N2RA 1YY9D 3QG7L 5EU6E 1FDLL 5FYLD 4XNXL 3M8OH 3HKFA 4HEPG 2GCYB 4HUXA 5K59E 3AC0A 4YWGL 1DFBL 5CEZE 1T21B 4X7CC 5D7LD 2OL3L 2O26U 5TPWH 4OJFH 2EDYA 3MV9D 3QDGD 4MAYC 2XKNA 4Y4KA 5GS0C 3CCHB 1KPVA 4MCYA 1FRGL 2HWZH 2ZJSL 2GK0B 3MOBL 2A73B 1ZLWK 2C1PA 1S8DB 5HPMB 4LPXA 3SDXB 2NW2B 2H2PD 3KLAA 4L5FH 3W9DA 2VDML 5JIPA 4PB0L 1HHJB 3U9UA 5C08B 2IH3B 3ARUA 4XZUB 5BVPH 3VGDA 3C8DA 2M8XA 1FFPB 5LBSH 5H37H 1H8NA 4ELME 3WO3B 1U8LB 4JQXA 2BNQA 1IGJA 1BBJA 2ZZUT 5FOJA 1WFUA 5B8CA 5I15H 4S2SB 2VIRA 4GRLA 5DJ6A 2ATPB 3ARBC 3FQTB 1QLFB 4EKXA 4M02A 4UV7L 4B5EA 1DN0B 5F6HJ 4HG4J 1PAMA 1H0DA 1C16A 1I7RB 1RIUL 4QRRB 3NVQA 2XWJA 4ZUUA 2WW8A 4NQCE 1S78C 4PJ5A 2CXGA 2E5EA 1FFOB 4OLWH 1QOKA 3BX7C 1S7TA 4GOSA 4WFGD 5D5MB 3WFDL 4PRPE 5CJOH 1QFUH 1OWWA 3DX9A 5E8NB 3OMZA 3QISA 1N7ML 2WM0A 4JHAL 2EEDA 4DKEL 3OSKA 1LD9B 4M5ZH 1PFCA 2DQFB 2J3SA 3G08B 4FFYL 4PP2B 5E70A 2RR3A 4NFCA 4KJYB 5T3XL 2V2XB 2C3GA 1YEHL 2AQ2A 2PO6D 1QHPA 1TTFA 5J57B 2I9LA 1H8OA 1F13A 2P8MB 2R0KH 3FN9A 4JN1H 3QDHA 4BFEA 3V95A 5HHXL 4NGHH 4X80L 2ICWB 2EDLA 3QDMA 4JZNA 3VU2A 1A6PA 4K07A 1EEYA 1VADA 5J1AB 3CSGA 4Y4FA 1NH6A 4TNVK 4OKVB 4Q6IB 4DFIA 2YD4A 1NUNB 3NH7H 4GXUM 3W2DH 4J23A 3E8UH 2EDDA 3LS5L 3AGVA 1JWUB 5GZND 2IMMA 1U8JA 4XWGH 3IJYB 4OZFB 4RGMC 3U6RA 1G9MH 4QNPF 3B2UD 1A6UH 4NZTH 1Y18B 1H3UA 2Y5TA 3QO0B 3VFWB 1HZHH 1P7QB 1T04A 1A6TB 1OTSD 4YFLF 2DWDA 1WBXA 3GMOA 2UVEA 1JV5A 2GJZB 2H1PL 3ARGC 4A2MA 4JLRB 3FB8A 3C09B 1JGVL 4RFOH 3D9AH 4RMQA 5J12B 2AJYL 3WSQH 3RKDC 3NGBB 3QUYA 1XF4B 2WANA 1NAKH 4XGZB 4JDVB 1N5YH 1S7SA 1AHWA 3OR7B 4OZHA 5CHNB 2VQ1A 5TGBA 4RGND 3EJJX 4F9PC 2FWOB 4NKOA 1W8NA 5EZIH 3K4ZA 3EO9H 4JFFE 5HYSG 4CU7A 1LE9B 2COQA 1RV6X 3GSXB 4XNYH 4P9HH 3RTQB 4EIZC 4S1QH 2I26N 4N1EA 4MA1C 5A43C 5IB2B 4JKWA 5EC2B 5FUOL 3UYRL 1MCBA 4MJ5B 3DRQA 3KYOB 1OP5K 3M8OL 2B1HL 1M71A 1MUJB 1HHIA 1S7QB 3L9RB 3L3HA 1T03H 4RZCB 4Z78A 4PG9A 2J8UB 2VDQL 5IHBA 4G8IA 1K8DA 3N1FC 4FFVD 5TPWL 3S3SA 1RURH 4MD4A 1F4WH 3UX9B 4OJFL 4KV5E 5DTFA 3UROR 2B5IB 1YYLH 1ZWIB 1XGUB 2X89D 2HWZL 2EC9U 4HZLB 3H3BC 1XH3B 2V5MA 2MSPA 4L5FL 4NWTH 4G9DB 1INEL 3GHEH 1WWWX 5KSBE 4X6CA 1FYTE 3L7FB 3ZHKA 3DVNB 4YPGA 5TDNB 4D0CA 4WWKB 3DV4B 1HE7A 2XNAA 5BVPL 4B50A 5I8CA 2P24A 3CLFH 3MRHA 4KU1A 3GNML 3OXSB 1K4DA 3GJEB 3CC5A 1TVBA 5F96H 4PJDF 1CR9H 2R1XB 4GG6E 3GSUA 2GJ6B 3B6SB 1G9NH 3SGJA 4L8DA 3MV01 5ANME 3HAEA 1WZ1H 4NC1E 2F5AH 3LN9A 4KI5D 1Z2KA 4K7PH 3MJ8A 1M6OB 2P5WD 2BVPA 2HTLD 4LLWB 3Q5OA 2CMRH 1YJDH 5HGAA 5FYKU 3V5HB 3BHBB 4OLWL 3VMPA 3BE1L 1GXEA 2D9CA 2YPLA 4U6YB 5CJOL 5JHDE 1DJSA 1NGZA 4HS3B 4NQDE 1QFUL 1RAMA 3ZDXF 1WT5C 5JHLH 4JFOB 2W9DH 3GB7B 1CLZH 3LKPA 4LCWE 5EUKB 1J8HA 4Q9QH 4JPWH 2OS7A 1UFUA 2V7HB 4LPCA 2B4CC 2R1YB 3V5KA 2DL9A 4JFQA 2EE2A 1DLHB 4EN3C 4PV9A 1KBGH 2W9EH 4X6FA 2JJSC 3MC0A 4PJIA 4TVPL 1KXTB 2VLKE 5KS9A 2BJMH 2R0KL 1A6AB 4M8VA 5DJDA 5FV2A 3BWUC 1OOAA 3B4NA 1A0QH 4LDLB 2BHZA 5D1XC 4WHCA 1R6VA 3P2TA 3MNWB 1XFPA 3EKCA 4CMHB 1JWSB 1T7XA 3D3VB 5ACMA 3GJFH 2FNBA 2GAZB 4L29A 4YBQD 3REWA 1F11B 1JZ5A 3NH7L 3JWOC 3SCMD 3E8UL 1AXSA 1IQWH 2YPVL 1DLFH 2DRUA 1WFOA 4X4YA 4DGVL 4XWGL 2R29H 4DVRH 2Z31C 3QPXH 5FKAA 1W2KT 4U1LA 3R06A 4D9RE 1FVCA 4WTZA 1YEDA 3QIWC 4D8PA 5E8OA 1A6UL 5EU6D 1ZGLA 3BDYL 3VFGL 4PJ9B 3TP4A 1HZHL 3T3PE 2AABH 3SDCC 2A6DB 4HD9A 1U93B 4MD0B 3ZZ1A 4ZTOH 5CEZD 5I6XB 1MCCA 5CFHA 4RFOL 1QEWA 3D9AL 5TE4H 2OK0H 4DEPB 3VXUB 4WW1B 1EVTC 1UADC 2H9GB 1B88A 4JEGB 3LSOB 1NAKL 4HKZA 3GSWA 3ZKNC 3PL6C 5IG7A 1N5YL 2MNUA 2H32A 2XIDA 1K8IA 1U3HA 1ADQH 4J7RA 1JGUL 1L7TH 2D2OA 5EZIL 1G9EA 4NRXA 1RZJH 4RFNB 3EO9L 2EDKA 3CUPB 4KROB 1VGEH 2IJ0C 4XNYL 1A3LL 1JPFA 15C8H 4LGRB 4S1QL 5GRZA 4PY8I 1CZ8H 3WNMA 3LB6C 2E6JA 2X40A 3K2UH 1JPGB 2GY7B 4MJIE 5LGJB 3MV8A 1S5HB 4JZOB 5HGDA 3TVMA 5ISZA 1QR4A 4O02H 1CDGA 1KXVC 3O3AA 3O6ML 2FECI 1KTLA 1J0YA 4HFWB 4LAQH 4NJ9H 5DRNA 4Q0XH 5LKNA 1YECH 3EYUL 1I1FA 4JFXA 1U8NB 3FTGB 1RURL 2R4SH 1F4WL 1VSCA 3RWFB 1S9YA 1AO7B 1M7XA 5I1KH 1LWRA 1NEZA 4F7TB 2O61A 5ALCH 4P5KA 1RU9H 4PJIF 4PRHA 2Y6SC 4ZPTB 5CEXA 4Z0BH 2PYEA 1NC2D 4YHIB 4CVZA 5C8JB 3F7VA 2Y9RT 1LGVA 1F3DH 3BFOA 4I2XB 4NWTL 2YA1A 1D6VH 3GHEL 4LHUG 3O4LA 1DBBH 5C71A 5D2LA 4QOKA 2I9TB 5C0CE 4G9FB 1NAMH 1QD0A 5DJ8B 3CLFL 3L3IB 3X3GL 3F7YA 3ALWA 4KRMB 3WE6A 2K3TA 5T1KB 4XPTH 2CIIA 3G6JB 3WLBB 4BQ9A 5TDPA 1CN4A 1JZ7A 2MPAH 4HT1L 3WIFA 1G9NL 4O4YH 2X1PA 3M07A 2A6JA 3NA4A 4KK9C 3TN0C 3BH8A 1LNUB 2XZAH 1ZLVH 1LO4L 1FO0A 1GGYA 4K7PL 1NUFA 5EUOE 9CGTA 4QRTA 1MRFH 3FB6B 3NCJH 3STLB 3QJFB 3CFJB 5CJQL 2CMRL 1YJDL 1ZA6B 5DRWB 2EYRA 3HCVA 2Z4QA 4YXLL 4U4BA 2PXYD 5IEKA 3SQBA 2XICA 4ZS6C 2Z92A 1QQDA 3QJHA 4ZFZA 3REVA 3IT8D 4UU9A 5JHLL 1T0MB 2VN7A 1YEFH 4CMMA 2YMXH 2W9DL 1JFQH 1CLZL 1SYVA 3QNXA 3IDGB 2QSCH 1TZIA 2GKIA 4NNYA 5CP3H 2ZUYA 3JV4A 1YEIH 3OKDA 5HI5C 2VRAA 5D7IF 2Z8RA 1DDHA 4FQIH 3WXVH 1KBGL 2W9EL 2OX5A 1S5IH 2BJML 5JOFA 4OI8A 3D69B 4DVBB 2V6HA 4U1GB 1A0QL 2VDKH 3VXSD 2P45B 5JUEH 5IB5A 1VFOA 2XN9A 1KB5H 2X4TB 4P46B 1NDGA 1RHFA 4E9LA 3RVXD 3BW9B 3GGWA 4C54A 1XF5B 1P5VA 3V6OE 3L5JA 4KUZH 4ACPA 1N4XH 3DO3A 2P8PA 3BXNB 2H26A 1PEZA 4AM0A 5FGSA 5I8KH 4JFFD 2X4NB 1IQWL 1DLFL 3MRCB 5B8CC 4TSCL 2R29L 3MUJA 4DVRL 3QPXL 1I7UA 4JGMA 1CGXA 4BJLA 2IADA 4OUUA 3U2SB 3MYJB 3L5IA 5EO9B 2XTJC 4I48B 3QXDB 4WUUB 1WUNT 1NCNA 3HE6D 4L1HA 1U95A 4FZ8H 4OD1H 2AABL 2OJZH 4X9BA 1U8IA 1CE1H 4WHDA 4ZTOL 3JUYA 1H3VA 4U1SB 1BD2E 1UWGL 2NX5B 5TE4L 4L3AA 1LP9F 3O9WB 2EH8L 2IAMD 2SEBA 3O8XA 1KGCD 2VXUH 2ZSVB 4RRPA 3L3OB 2F8VA 3HUJB 1ADQL 2GK0A 3D2UB 2P5EA 3DGCR 2AJ3A 1IEAB 1JTPA 3GSRB 1S8DA 1RZJL 3LPGA 2IBZX 2NW2A 4WNQB 1H3PH 3QNYB 5L8JB 1VGEL 4NQTA 1ZT4A 1EJOH 5HDQL 2G9HB 15C8L 1E4XI 2GITB 5EULV 3PJSB 1CZ8L 3BPLC 3HHRB 5DHYB 5EDXA 1FFPA 4KJPC 1U8LA 4N9GB 3SBWC 5GXBB 2ICWI 3V52H 5HHVH 3Q0HA 3QQ4B 3QUMB 4S2SA 3CJJA 5DFVC 2OI9B 4NJ9L 2J5LC 3FQTA 1QLFA 2C1OB 3BESR 4Q0XL 2GSGA 3N1MC 1YECL 2CDGB 1ZA3B 4PB9L 1DN0A 3G5YB 2R4SL 4ZUVA 1CFSB 4H1LB 3VA6A 1U8HB 4UUJB 3DNKA 1I7RA 1ZT1B 5ALCL 4OF7A 3CFBA 1NCUA 1RU9L 4RNRA 1T1WA 2QKIA 4XBEH 2EDQA 4KMQA 3CVHA 3JWNC 2DJSA 2NZ9C 4PGDA 4PP1D 3RGVB 2VISB 3TA3B 1D6VL 5E8EB 3Q6GH 1EK3A 1DBBL 3KJ6H 4NQDD 1T4KB 5I8OH 4BSVA 5E8NA 5GGRA 3QFJD 1W72H 1NAML 4ZO8A 5CMAA 4MS8C 1ITBB 5E5MB 1CL7H 2DQFA 4XNUL 5HJ3B 2ITDA 2NQCA 4KJYA 4Z8FH 2V9TA 4HUKB 5F1IB 4O4YL 1FL5B 1ZHNB 5EU7E 3BEVA 3QHZH 5F3BA 43CAA 3B9VA 1NL0H 2BNRA 1HOCB 2VITB 2VSDA 2CDFA 3JSSA 3AXLA 1TNNA 3MGAA 4WO4B 3KPMB 2ZNWA 5J1AA 5CSZB 4UT7H 4FFWD 2BHUA 4CUCA 3G9VA 2Q1EA 4OKVA 4Q6IA 2BXYA 1NSNL 5L2KB 4P4KB 1I7TB 3S36L 2FJFA 1YEFL 5I30H 1JWUA 4XNQB 1JFQL 4NBYB 1SJHB 1A64A 2FZ3B 4BZ1H 2QSCL 5MI0B 1A1MB 3W0WE 3IJYA 4OZFA 4ELKB 3FB7B 4GO6B 2J8OA 1YEIL 3VXRE 4YK4C 3SDXF 1Y18A 1MQ8A 4PBXA 1RJLB 4QTHB 4K94C 5L6YH 3QO0A 1YDPA 4FQIL 3WXVL 1GGIL 1P7QA 5IESL 1A6TA 5C0EB 3RZCC 2GJZA 4W68A 5HGHA 2WBJD 1OM3L 4D3CL 2VDKL 5T1LA 1TIUA 2A2QT 3T8XB 3UDWA 5JUEL 2CRMA 1IAOB 2UUDH 1KB5L 4AG4H 5H37G 3EGSB 3WNPA 4YHKH 2CIKB 3TNMB 2X4RB 3U30C 2YR3A 5JQ6L 1SBSH 1FGVH 5CD3A 5IMMA 4R0LC 3ILPA 4OGXH 5BZWB 5I8KL 4M7LH 5K9QI 1ULVA 1BBDH 1OT1A 3DXAD 3WO4B 1KJ2B 2D4FA 1UKSA 3RTQA 4KK5C 1UCBH 5IB2A 3AS0A 5EC2A 4ONFH 2D9QB 3O0RH 1ITCA 5DJAB 3SGJC 2AJUL 5D5MF 1EGJL 3OG6B 3V6FB 2DQEH 2BNQE 3DTXB 4ZG1A 3KYOA 5HI3D 1MY7A 2DLGA 1MUJA 3KR3H 3ARWA 3AS3A 3QWOB 4OD1L 3S5LB 3KPSD 1IARB 3BYTA 5DI8A 4CU6A 3L9RA 5F9DC 2N7BA 1I1YB 4OLUH 4RZCA 1CE1L 2J8UA 2FYYB 5D4QA 3WCYA 1F4YH 1IAKB 1U8KA 2V2WB 4GQPH 4YHOH 5DO2C 5IJKA 4PJFB 4UTAH 1YC8A 3BO8A 1MQKH 1YNLH 3QUXC 5H2BB 2CR6A 3BMVA 4R4BA 1KULA 1YQVH 2VXUL 5CLTA 2I07B 1ZWIA 1XGUA 4TTGA 2Y7QB 4KKAD 4BQ6A 1BFOA 4PJ5E 1CGUA 2R2EB 5LGKA 3LN4B 1DCLA 1XH3A 1BOGB 3EJYD 4AT6B 5J0BA 4QYOA 3L5WA 3JV5A 1Y0LB 1EJOL 4GAGL 5TDNA 3DV4A 2JJWA 1ERNA 1FZJB 1UH2A 1D5ZB 1LK2B 1XGQA 3T0ED 5GS1A 2GHWB 1MFNA 1WEJH 1ED3A 4R90H 4E0RB 2YEZA 5IT2H 1QSEB 3H9SA 4Q9CA 4KKLD 5HHVL 1D9KB 5HYJB 4OCXH 4J4PC 4O9HL 5FA4A 5D1QA 1XF3B 5CZXD 2GYSA 3KYAA 3MLWL 2GJ6A 3WL9B 1MOEA 4JFEB 2XQYK 2ZUQC 1II4E 1JPST 2BCKB 3Q6FB 4MVBD 5FOBA 4JHZA 3QDME 5I8EA 1M6OA 1L9MA 5F9AC 4XBEL 5A2KH 2CK0H 5DMKA 4U3HA 2AK4B 1YMHB 4U6YA 2I24N 2ESVB 2VZVA 1FFNB 3KJ6L 2X2YA 4JFOA 2QR0B 1URLA 1W72L 4L8SB 1U6AH 3C5SB 5E99L 1WJ3A 4P23B 4G8EB 1RZ7H 2V7HA 3VGAB 2ENSA 1T2QH 2R1YA 4W6XB 4Z8FL 1OSZA 4JKPH 5GGSB 5A2FA 4ONGH 2FEDC 4IRJB 1PSKH 3HC4H 2IAND 3ROLB 1A6AA 3QHZL 4OQTA 3OB0K 4X9HA 3Q1SH 1G7PB 2BZDA 4QHKI 3H7BB 3HRPA 3UJIH 4XP6L 2V9QA 2YD9A 4U0RC 1EFXB 3LQAC 4UT7L 4ZQKA 2J8UF 4OZHE 4M6MH 1KG0A 2FDBP 4N0YL 1OAXL 4HKJB 2EXWC 3ZT7A 2ZUVA 1SJEB 4Y4HA 2EECA 3O2WH 3QRGH 5I30L 4JKLA 5DA4A 4BZ1L 1B9ZA 2IQAA 3UEZA 3ISWA 4HPYH 1BFTA 4PY7B 1I8IA 3ARSA 4Y5XB 1G9MC 5L6YL 1MLBB 3SDAC 3HS0B 4HJGB 4JM4L 2A6DA 4QRUB 5ICYA 4K71B 3TT3L 4APQB 4CNIB 3GMNB 1J05B 1KEMH 3SE9H 1BD2D 4DK6A 5E0QA 4WW1A 4RFEA 2H9GA 3C6LB 3LSOA 4YFEA 3ULVE 3ILQD 4MCZA 5D93C 1UH3A 4LEOB 1JBJA 4P2OC 3GSQB 4KXZI 1SBSL 1FGVL 4PJ8B 3U4BH 3ZTNH 1LEIA 4OGXL 3UZVB 4YDIL 4EVNA 4M7LL 4MXVE 3CUPA 1BBDL 3TNNB 2AEPH 3RWEA 3QCVH 4X6CE 3HE7D 4MSWB 5J6HB 1QTYT 4H88H 2MWCA 4P9HC 4ONFL 3O0RL 1JPGA 3HLAB 1S5HA 1QFWI 4JZOA 4IRSD 1D5XA 3KR3L 4XP9L 3AS2A 3O2DA 1F5WA 2I5YH 4M1CD 3SE3C 1KLUB 4O51B 1F4YL 4B7IA 4OSUH 4YHOL 5E03A 1MWAH 2ZUSA 4UTAL 2X1QA 5DJCA 1EO8L 1MQKL 4NO5B 3A0OA 4G8FB 4F7TA 3IF1B 1YQVL 3RIFF 4L1DA 4ZPTA 3MOAH 5D7LB 1I75A 3ZDYE 5DUBB 3J7HA 5GRXG 1MFDH 4RQQA 4YHIA 3HG1A 5C8JA 3DI3B 3C2SA 4NHUB 5F8RC 4OUOA 1UWXK 2HVJA 2YPLE 3QDGB 4HWNA 4R4NC 4NC2B 4X5XA 1UXSA 2BDNL 5F89B 4JQVA 3K3QA 4HHAA 3IVKB 4G9FA 4ZAKC 4PJAB 1MLCB 5FA3A 5DJ8A 5ILTH 3RU8L 3G6AB 4R90L 1J8HE 4F57L 5IT2L 2HMIC 1WITA 3BGMB 3OKNA 1L6ZA 4PJGA 3OQ3B 1VPOH 3VFVB 4AMKH 4I3SL 3CFKB 4IMKA 1HKFA 1FJ1A 1SEBB 3RX7A 3V4VH 3U4EA 3PF2A 1KF9B 1AQDA 4PJIE 4BQ8A 2CJUH 4HX1B 5KS9E 4HCRL 4FG6D 3ZE1F 1CU4H 1LNUA 3L3GB 5IHZB 1BGXH 2G2RA 1JTTA 5FYJH 4Q7DA 3FB6A 3QH3B 3OTTA 5EPMA 2CK0L 2JB6B 3CFJA 5DRWA 1X5KA 5BV7C 4ONOA 1AE6H 5ADPL 1YJDC 3MV7D 4KVCH 1J1PH 3DETD 4OGYH 2VAAB 2YOCA 1T0MA 4KH2A 4XVJH 1D3CA 1Z9LA 5D7KD 1BAFH 1WBYB 3SGEH 1U2CA 3VXNB 2AAVA 2UZIL 3ESUF 3GBNH 5HXMA 1U6AL 3IDGA 1AD9A 4RIRA 3KLHC 5I1AB 1HQRB 4WW2F 3VXRD 5JIHA 3D18B 1QSZA 3GMMB 5JO5A 4NYLA 4JKPL 5ICXB 4ONGL 1PSKL 3HC4L 2XWBB 4XRCB 2HKFH 1EXUB 2PR4H 1ORQA 4EQ3A 3GMQA 1F6AA 3QCUH 3DMMA 2PO6B 4XX1E 4UDUA 3WUWA 3AM8A 5GJTH 1QVOB 1A4KB 3BW9A 4IOFD 1EHAA 4PGCA 2BMKB 1XF5A 3KAAA 5I1GH 4QF1A 1G7JA 4MMZC 2PYFB 1VKXB 3BN9C 5D1ZD 3S4SB 1T6VN 4ODUB 3AUVA 4LKXB 1UCTA 3O2WL 4CAGA 7CGTA 1A14H 4H20L 3AY4A 2R1WA 5T3ZH 3MRKA 4X7TB 3U0TB 2NXZD 1UZ6F 3G6DH 3U2SA 5EO9A 3MV8E 3F6LA 3RFZC 5ISZE 5MEOA 3TYFA 4DCQB 2J2ZA 4AEEA 2NY2D 2DIBA 3WD5H 5CP7B 4U1SA 2R0LL 3SE9L 4AY0A 1P84K 2NX5A 1T80A 2A0LD 1TCMA 3TBVB 2EO9A 3O9WA 4G6KL 4EXPX 5DD3H 5F7DA 2ZSVA 1GZPA 1FGNH 3LD8B 4FXKB 4XCYB 3L3OA 3G6JF 5HYEA 4PRHE 4HIEA 4ZD3H 4JO3L 4N8VB 3D2UA 2PYEE 4K8RH 3U4BL 3ZTNL 4FQXD 3TC9A 3MRLB 3SY0B 3GSRA 1NCWH 5ALBL 3MRFB 1F8TH 3BGFB 5FB8B 2X4UB 1QBBA 3FFDB 3QNYA 4QHMB 3H2WA 4TYUA 3O4LE 3QCVL 5D2LE 4XHQA 4HUWA 4QOKE 4JG1H 4NCDA 2GITA 4MA3A 4RGNB 2A77H 4XCCH 2AEQH 2DQTL 1HH9B 3SE4A 2OCFD 4R97B 4K9EC 3QQ4A 3QUMA 2JIXD 1HXYB 3UPCA 3MFFB 1BVLB 2I5YL 5GSVA 1X5AA 3VG9B 4M8QA 1MFEH 3VWJB 5J56B 5EO1B 1MWAL 4PRNB 2CDGA 2UV3A 1ZA3A 1PBYA 5E6IA 5FO7B 5C9JA 1KXQE 4UUJA 3DURB 3QDMD 1I8LC 2JCCB 3I9GH 1CE6B 1ODAA 2BC4B 3MOAL 1GGTA 2R2BB 2WINB 4PREB 1MFDL 4Y4FD 5FFLA 3VMOA 4LSVH 5C70A 3QZWB 5IIEB 2D31A 4HIJB 1HEZA 4P57A 2VDOL 3C60A 2YKLH 1FC1A 4JDTH 4NKIL 2X05A 5K9OA 1G0DA 5EG6C 3W9EA 2X9XA 5ILTL 4GBXA 5SWSB 3VRIB 4YHML 2NNAB 2XZCL 5E6ZA 2H45A 4HAFA 5HJ3A 4AMKL 1VPOL 3C09C 5J12C 3RQ3A 3NGBC 1NGPH 2J8HA 2GY5A 3V4VL 3BZ4B 1DE4B 3SDDD 2R69H 2CJUL 2W59A 3O3BA 5F1IA 4GW1B 3QNZA 3HZMB 1JK8B 1TMCB 2GK2A 2F54D 1HOCA 4R26L 3ZE0E 2VITA 1OTTC 4WU7B 2VXSL 1PZUB 3TBYB 2PW2A 3FO2B 5JR1H 2RB8A 2F53D 2XN9E 1Z9OA 2FJGB 3QXVA 1JE6A 5CSZA 4LVHB 2Q86B 3RTQC 3TT1H 4I0KA 3MODH 2AXFB 4KDWA 5DURD 1HKLL 3QHTC 1FN4B 4PTTB 3DUSA 4LPYA 1DANU 3QXAB 3RWCB 2ADIA 4KVCL 3QCTH 5F88B 3M17B 4KUCD 5L2KA 4E41D 1J1PL 3MBEC 4P4KA 2GSIA 2P5WB 1LO3L 1D7FA 1HWGB 4XVJL 2XRAH 5J6GB 3O41B 1BAFL 1I3VA 4IRZH 4XNQA 3GBNL 1SJHA 2FZ3A 3HUJF 1A1MA 5IM7B 4ELKA 3FB7A 4XCFL 1IM9D 2FX8H 2G5RA 5D7SL 4QTHA 2F8XC 4U6VH 2Z8VC 2B5IC 1D5MA 3HRZA 5MEQB 1TCRB 4G42A 3QR2A 2BSRB 2R4RL 3WNOA 3LKNB 4RGOH 3QCUL 4UQ2B 1AR1C 3HI1A 3W5NA 4DN3H 1X7QB 3KXFB 3ZT5A 3ULVD 5F71A 4WWKC 2CIKA 3TNMA 3I3BA 5AD0A 4I5BB 5I1CL 5CILH 2X4RA 5I1GL 4LCUB 2VC2H 4NOBA 2P5EE 5IWLC 2GUOB 7FABH 4BSWA 3I6LD 1A7OH 4HK3J 4X0KB 2AJZB 1EJ6A 4P3WA 1A14L 1MFCH 4WHYH 3OKKB 4GUPB 2ZG2A 5MENA 4GT7A 2APTA 4GQ9L 3G6DL 5DYOA 5KSAD 3SCMB 3QI9A 2DLIA 1K5NB 3QQ3B 1MCOH 1CF8H 2HVKA 2C3WA 4UTBL 3K2MC 3S5LA 2NW3A 4LF3B 5C0BD 4PRAB 5EU6B 2X7LA 1FSKB 3DGGA 5H2BA 1PYWB 1R3LA 1R5IA 5DD3L 4ZO7A 3WIHL 1ZXQA 2NY4D 1I9RH 2HT2D 3VXOB 4M1DL 4MA7H 1I1AA 2BVEA 4ZD3L 1DBKH 4K8RL 4JM2A 3LN4A 4KAQH 4XB8A 1NCWL 1BOGA 3IFNH 5KSVB 3WN5A 3VRLE 4OBRA 4BK4A 3RWDB 4LNVA 1Y0LA 1MEXH 2ZG1A 4JG1L 5DJZB 5L7XL 1KIPA 1FZJA 1QBML 4HAGA 4ZFOL 2A77L 4XCCL 4E5XA 4O2FB 3MNVA 2VABA 4I18B 3DVGA 5T33H 1X5LA 4P48A 1AGBA 4C4KO 5J1SC 1D9KA 1BIIB 1JZ6A 2AEIT 2BERA 3E6HB 1BJ1H 5DD1H 5K93A 3BPCA 1XF3A 4HSQA 3B9DA 4P9ML 3U0WH 2X09A 2C5DC 4CMHC 4ELMB 1HHGB 1T5XB 4JFEA 4HH9A 2BNRE 2GIYA 2ATKB 3LV3B 3Q6FA 1TQCB 1B0RB 3I9GL 4O5LH 3ARDB 3ROOB 1FG9C 1VDGA 4JKMA 2K9UA 2HFFA 4HZAA 2AK4A 4LSVL 4XWOC 3LY6A 2J6EH 4X4XB 1JHTB 4GAJH 3RJDA 1CFNB 4M5YH 4PJEF 2AW2A 1MCFA 4PGBB 4NQCB 4PJ9C 3VXMA 4O2EA 2QR0A 4NP4H 5GGQL 3LHPH 5KANG 5HI4D 4L8SA 1XF2B 1W8OA 4WIQA 2Q6WB 3C5SA 4YXKH 1BFVH 4F15B 1EAJA 4P23A 4G8EA 5I6XC 2EIZB 4KMLB 5IP4A 1I3RB 1ZLSH 4XNMB 4DEPC 2MFNA 4XH2A 4S1DC 1KIRB 2OQJA 2ADJB 1A7BA 3W39B 1DQJB 4IRJA 3BQUB 3QQ9D 3ROLA 3CH1A 4JO2L 4WFFE 1P53A 5AZ2H 3T65A 2F9BT 3H7BA 2CLRB 4EUPA 2JJTA 5JR1L 5IBTH 4WW2C 5MEPB 4RFNC 3JTTB 4KROC 1EFXA 3TT1L 4MNGB 3WFBL 4XCNA 4PLJC 4ISVB 4C83A 1J7VR 4OIBA 4WVRA 3C08L 3NFSL 1CLCA 4K7FB 3QCTL 4PJFF 4U3CA 3MX0A 1HHKB 3VI3F 1SJEA 2XRAL 4IRZL 4N8CH 3TFKC 1X5HA 2PXYB 5C07D 3D85D 4PY7A 2W60B 3FHAA 1FH5H 5ISZD 5I18H 3DPBA 1MLBA 4U6VL 1LO2H 4K3EL 4PTUB 1LILA 1LEKB 5IEHB 3QIBD 4I0PA 1A7NH 4PD4K 5CJXC 2J8UE 1Y6MR 2EDHA 3GMNA 1J05A 3MZGB 1RZIA 3X3FH 1YYMH 4M62H 2B0SH 3GBML 5M7QA 1GH7A 1QLRB 4DN3L 5FKPB 5DEFB 1CLOH 1MAJA 2BVUA 3MRNA 3UTSD 5GGVL 4CRPA 4LEOA 3VJ6A 5CILL 1K4CA 4QXWA 3VXSB 3GSQA 2PTVA 2VC2L 3EOBB 4PJ8A 2QSVA 1TTGA 3PDGA 3HNVH 3B3IB 1AP2A 2HP4A 3GMRB 5SWZA 4QOKD 3WFCH 5J6HA 1CFTB 4MB4A 3IAQA 1QR1A 5MHSD 3MACH 1OW0C 1SHMA 1WIUA 4JFFB 3MRQA 3H9SE 5DEGB 5IB3B 1MCOL 5I76B 1F90H 1KJ3H 4D0DB 2WAHA 2W07A 4UAOB 4HWBH 1P84J 4O51A 3JBG7 2CSPA 2DQGL 3FB5B 4ONHA 2GJ6E 3W11D 3UTPD 2EDOA 1RIVH 1FG2B 2X10A 3HE6B 4NO5A 5E94A 3IDJB 4G8FA 2AXGB 3IF1A 3QUZB 4QXTB 1I9RL 3K80A 1MFAL 3C5ZC 3MXVH 5INCB 5D7LA 2EDJA 4KGJA 4NCC2 5B3JE 5DUBA 1DBKL 1PVHA 5F8QC 2VTFA 4KAQL 1WZKA 4NHUA 1VGKA 1UM4H 4P4RB 1L0YA 3MV9A 4YXHH 4Z5RB 2IAMB 2VXTH 1MEXL 4NQVB 3CXHK 1IAIM 4KQ4L 3ZYJA 1R3JA 2ICES 5TQ2H 4PJAA 4IIQB 2FLRT 4LMQI 2ZCHH 3G6AA 3BI9X 5T33L 4U1GC 4CJ1A 1KIQB 2E9WA 1SY6H 4OB5H 2NY3D 5GRJL 1JYWA 1SEBA 5DD1L 4P46C 2BK8A 3N50A 4KKCD 3U0WL 3RWJB 2C4XA 4GG8B 1A6ZB 1Q9LA 1AJ7H 1Z5LB 1D5BB 1DEEA 1CFQB 3VE0A 3L3GA 5DA0B 4IDJL 3FQNB 1JP5A 1N0XH 4KJWC 4QCIA 3U83A 4O5LL 3QH3A 4V2BA 1XIWD 2VQTA 1Q1JH 3P9MA 4H1LG 3EDDA 4GG6B 2JB6A 4LLQA 8CGTA 5GISH 1A6WL 3T0WA 3BDXA 5ID0A 1P7KB 4RMSA 2J6EL 1CGSL 4U0QB 3X13B 3B2VL 2XA3A 2VWEC 4D0BB 4WHTA 1F3JA 3IDNB 4M5YL 5IV2B 3MLXH 2VAAA 3JV6B 4NP4L 1WBYA 5I0ZA 3V6BR 3VXNA 2EZ0C 4YXKL 1T7ZA 4I4WA 43C9B 4BFBD 1BFVL 1JPSH 4EI6B 5F6HI 1DQLL 1ZLSL 5JHDB 4NQDB 5FYKD 3QPQD 5C0DA 1FC2D 3N06B 4JGUA 4C58B 4I0CC 3VW3H 1MCDA 4LCWB 5I75B 4U2YA 2BY2A 2JK5B 4LSPH 3E3QC 5AZ2L 3BKCL 1ZAGA 3QT2A 5TFSH 5IHUH 2C3VB 5IMKA 2AJVH 1LHZA 4D9LL 2WWMC 1K85A 2VLKB 3F7PC 2OJEB 5ITFB 4UZGA 3BZEA 4ZODA 2YRLA 4YHNA 2ZPKH 2P5ED 4HLJA 3ARBD 1VKXA 4ODUA 3G9AB 4LRNH 4ODXA 3KPLB 3KPTA 4N8CL 5DMJB 2OI9C 4I9WE 1ES0B 4X7TA 4JRYD 1RI8A 1I7ZB 3IU4H 2DJ4A 4H5SB 3X12B 5GS2D 3ARFA 1FH5L 4UMGA 5GJSH 2WIIB 1S78D 3LKOB 3EDEA 5I18L 2F74B 1LO2L 1R5WA 1YMMD 2XFXB 4XC1H 3CFEA 3B5HA 1A7NL 5IW6A 5F7KC 4URTB 5CP7A 4AH2B 3X3FL 1YYML 3BP7B 3TBVA 2B0SL 3RGVC 3SJVD 4LRIC 3TA3C 5H35A 2E9JA 4LL9A 5D6CA 1C7SA 1CLOL 2WBJB 1S7UA 1INDH 4M93C 3HNSH 5FF6A 4YBHA 4N8VA 4WEBH 2E6PA 2FCBA 3HG1E 3MRLA 3HNVL 3MRFA 4NSKA 2X4UA 5AWNH 2G60H 3FFDA 4ZFGH 3EFFB 3FONB 4QHMA 2Z91B 4XVSL 5AYUH 3WKMH 2C3HA 3LKQA 4G9FE 3STZB 5F1KC 1WTGT 4J3WA 3MACL 4LVOB 4JY5H 1HH9A 4F7MB 2AQ1A 3MRJA 4PJGE 1EEUA 5FHBL 1OTUD 4NPYB 4G5ZH 2IC2A 1F90L 1KJ3L 4L4VD 1UKQA 1NJ9B 1HXYA 1BVLA 4WO4C 3H42H 1QZ1A 2YN3A 1EEZB 1FIGL 1T3FB 4HC1L 1H5BB 5FO7A 5H8DA 4Z0XB 4GFTB 4NIKB 5GGUA 3IDMA 4PIRF 5DMGC 1EDQA 3KPSB 4V1DD 5FGCE 4LLAA 3AAZA 2JCCA 4A6YL 1M7IB 3TO4C 1IKNA 2M26A 3MXVL 1R0AH 2ICCA 3G5XB 2QQNH 4YXHL 3QZWA 1BZ9B 1C5BH 1HDMA 5IIEA 4MNQD 1ORSA 1PJ9A 2VXTL 3K81A 5DT1H 3M1BB 4U6XA 3VFSB 2X89A 4WI7A 2VL5B 1EAPA 2R39A 1KOAA 3RY6C 3VRIA 1CG9B 2ZCHL 2NNAA 4NRZB 4CBPA 5I1DB 1OF2A 1NUGA 4CDGC 2VQUA 1SY6L 1MHPH 5HPOA 3GO1L 3ME0A 2D7QA 2A74B 3NZHL 3SGKA 5C0CB 1DE4A 3T0EB 4F37F 4QHNA 4GW1A 3QAZB 5IB1B 1JK8A 1HIML 3L95A 2JB5H 4JY6A 3U0PA 3TBYA 1N0XL 3WO4C 2FJGA 1Q1JL 4UQ3B 5F97E 2Q86A 4PJCB 3PP3H 3VWKC 1XGPA 2Z8WC 3ULUE 5E7BA 3IU3B 3JWDL 4PTTA 3WFHB 1C5DA 5TF1H 2DQHH 1XMWA 4FQHB 3MUGB 4J8RB 2P5WA 3I75B 3MLXL 4M3JA 5JA8B 3KPPB 3FT4A 3CFCH 1KLGB 3K8MA 2ED8A 1JPSL 1P4BH 1GHFH 1OL0A 3P0YH 1F42A 4YEEA 4GKZB 4JQIL 1KB5A 5KSUA 2IEPA 5AAMA 1O5DT 2VNCA 4GW5B 4ZUTB 2W1NA 1JGEB 2Q7YA 3VW3L 5IROC 1NBYB 1PQZB 5E2TH 5MEQA 1TCRA 1GSMA 2RHEA 4LP4A 1T20B 4OF8A 3AMLA 1T0PB 4QRPD 5TFSL 2NX5E 1YNTB 1ZVSA 4UQ2A 3OGCA 3EYSH 4FP8L 1UB6B 4B41A 1X7QA 2IANB 3KYNB 1EFQA 2I60L 4YJZL 3QFDB 4P5TC 1EGJA 3E3QE 1WICA 2YRZA 2ZPKL 4OV5B 1XAUA 5GS0H 3NCYS 1NCBH 2AGJL 1D9KC 4LRNL 2JCCF 4KZDH 3OKKA 1AQKH 3DO7B 4QHLB 4GUPA 1FNGA 4HWUA 3IU4L 3QYCA 1MHCB 4OCRH 3BKYH 3SCMA 4JPVH 4GRWE 3FQUA 3BMWA 3H9SD 5GJSL 5BOZG 4MJ2A 3BZFB 4FRWA 3DOSA 4XC1L 3VMNA 4LEXH 3SQOH 5CZVH 4PRAA 4FTVA 1BQHA 1OAZL 1QSFD 1IZKA 4TOYH 5AG9A 5DRXB 4MQXC 2X44D 3MZTA 1H9VA 5FDYA 2OP4L 5FM4A 3L3KA 1ETZB 1F2QA 3VXOA 5K9JH 3HNSL 4YR6A 3V7AG 1V7MH 2X4OB 1BD2B 4QTIH 4H0HB 4WEBL 4L8SC 3ZTJH 1RUPL 4EN3D 4F7CB 3MLRH 4P23C 4P2CG 1YEGL 5AWNL 2G60L 3KPOA 4ZFGL 5T3XE 1V3KA 3VGAC 3RWDA 5A3ID 5AYUL 5DJZA 2DN7A 4M00A 1G7HB 2YK1H 4O2FA 3V8OA 1TTUA 4NZRH 1TETH 2FLBT 3S9DB 4KI5F 4JY5L 5EORH 4K7PX 1G7IB 3PGDB 4G5ZL 1DBMH 2CKBL 3DX7B 4TUOA 3OJ2C 3AB0B 3H42L 1V7NH 4D9QE 2J88L 5EZLB 1FL6B 2EIDA 4IRSB 5LWYL 2ATKA 4DOHE 3BP5A 3VGBA 2BXZA 3T2NH 5HDOA 1OQOA 1RZGB 2BVQB 4XBPA 4AIZB 3A67H 5B38G 1U8OB 1MJ7H 2WBWB 3QIWD 3FOMB 1R0AL 3QDJD 2DM7A 4DZBB 5B21A 4W4NA 2QQNL 3IGAA 1ACZA 3SKNB 5DSCB 2W0PA 1C5BL 4YNYB 4S1RH 5GIRA 4MAUH 5L2KE 5E2WL 2UWEF 1CFNA 2DTSA 5DT1L 2NYYD 4HQQH 4Y5XC 4PGBA 5JNYB 1IL1B 1NC2A 4XBGA 2L7UA 4M3KB 1XF2A 4HS6A 3B9EA 4K71C 4UT9H 2MOVA 4APQC 2BRQA 4P0DA 3G5ZA 2EIZA 1I3RA 4U1IB 3ZKND 3PL6D 4XNMA 3IFOB 3FHQA 1MHPL 1KIRA 3W39A 3C6LC 3C2AL 1ZHBA 4JKKA 4MB3A 4NC0B 3VH8G 4FA8A 4UBDD 4CVXB 4KKBC 3AREA 2GEEA 1EBAA 5BJTB 5FO9A 1I8KB 2FRGP 2HT3C 4WHYG 3MMEB 2CLRA 2DMCA 2XPGB 5MEPA 4ZFFB 3JTTA 3P77A 3LB6D 4IJ3B 2DI7A 2YD6A 3FRPA 1MH5B 4YDVB 4ODHH 4WFEE 1D6EA 4MNGA 5MP6H 4ISVA 2LU4A 3QWQB 5BO1H 5TF1L 2DQHL 1NEUA 3HZVB 5CIPB 4EJ1C 4NKQB 4Y1AD 1KYOJ 5K59F 3CFCL 5L8KB 4L3CB 5JW5B 2D0HA 2VLRA 3K74B 5CWSB 2PXYA 3MV7B 1MVUB 1P4BL 3VXQA 3K1KC 5MENE 1BP3B 1GHFL 3P0YL 3R1GH 1YY9C 1KCLA 4DZ8B 1CQYA 5E08H 1OSPL 3U46A 4O2CB 2W60A 2Y6SD 3WMSA 4DQOL 3RWHB 3DYOA 3SHSA 5IOPA 2FATL 1QNZH 4PTUA 1W0VA 2Q3AA 5E2TL 5I19H 4BKLB 3VXRB 1N2RB 5TE7L 3I2CL 5DQJA 3GZKA 3NTCH 3EYSL 1GYAA 1QLRA 4HUXB 5C09D 3VI3E 4WCYH 5FKPA 5GGSY 5DEFA 1N59B 4XAKD 3QO1B 5AG8A 3VXSA 4WTXA 5FYJU 5IB4A 4ELMF 3EOBA 2Y23A 3HG1D 1PZ5A 1DQQA 5EN2B 5GS0L 3U7YH 3B3IA 3RDTA 4OLVH 2XKNB 1NCBL 3AU1A 2Q7NA 1H3TA 1FAIH 1U41A 1KPVB 4MCYB 3ZKMD 4KZDL 3RNKA 5B39A 4HEME 3V0VA 3S4SG 4ZDHA 1WQVT 2V5RA 5L8LB 2D03H 4Q9BA 3IAPA 4OCRL 3BKYL 4JPVL 5D1ZB 3KLAB 3T1WA 4XB7A 5DEGA 3W9DB 5IB3A 1CS6A 5HYJE 2XZZA 2B8OT 3Q5YA 1FNEA 1ZGLM 4LEXL 3SQOL 3RVUD 5CZVL 2CGRL 2NXZB 4JHBA 1HQ4A 2VDRH 5DJ0A 3O3EA 4JFEE 1PDKA 1TJIL 5ESVA 1FG2A 3CIQA 1J0IA 2WIMA 4JAMB 4S1SH 4Y2DD 5FO8B 1BQSA 1CXIA 3CD4A 5K9JL 4I3GA 5HI5D 4Z7WA 2AK4E 4OD3H 3JVGA 3MLRL 5D70H 3S37X 4ZOBA 4KJQD 5J89A 1KN2H 2DAVA 4QXGL 1H0DB 1DSFH 1X5JA 1C16B 4LVNB 4TVPE 2XWJB 4HUNB 4HCRA 4LHUD 3QBTB 4FNLL 4PJ5B 1OP3H 2YK1L 4FQXB 4NZRL 2E9BA 5IVXB 2X6MA 2YUXA 4YBLB 5EORL 5IFHH 4Z7VA 1KIQA 5D8JL 2BSTA 2PO6C 1DBML 3D25B 3BSZH 3FT2B 3RWJA 5CJ5A 4M7JH 2C7UA 1A6ZA 3FN0H 4N90E 5IBLC 3EUUA 3EZ8A 2B4CH 1Z5LA 1AGDB 1YEKH 3IXTA 3D0VA 3NPSB 2YC1B 3T77A 3DMMD 3B9KA 4HPOH 4L8CB 2DL2A 3A67L 1MJ7L 4YE4L 1JRHI 4X6EA 3VI4E 1XF1A 2XTJD 2VDLH 1JNLH 1IAIH 4G7VH 3O6FA 4S1RL 4D0BA 4JFZL 2EEBA 3QDMB 1QRND 1F2XK 4JN2B 4JZNB 1UJ3B 5IV2A 3E2HB 2ZWLT 4HQQL 5F7FA 1RZKC 3JV6A 4LLYB 1VADB 1O0VA 3VFNB 5GZNC 4Y4FB 3WFEH 5TJWK 4PJBB 1T1YB 4RDQF 43C9A 5KVFH 4YDKL 3UTTD 3MJGX 5DMIH 3B2UC 1X5YA 4U6TA 2HFGL 1A8JH 3QFJA 1OTSC 2DQCH 3EO1A 1CXLA 3EYVB 4J3XA 3LD8C 12E8H 2JK5A 5ETUA 2NY1D 3H3PL 2DB8A 1NCCH 1CXKA 4LCCA 1ACYH 2YSSB 1A47A 2Y5TB 2CD0A 5ESQA 5HVGB 1T04B 5CZKA 1WWCA 4LVEA 3CSBA 2DWDB 1WBXB 3GMOB 2OJEA 4WV1B 4ODHL 5DEZA 5MP6L 2XI9A 2R9HD 4JO4H 5ICZB 4RGNC 1RK0A 3GJFK 1NLDL 1YUHA 3IJSA 1GL4B 3QUYB 1GRWA 2F53B 3FFCD 2VR5A 3ULSB 1E6OH 4R97C 1JL8A 3RUGB 5SWZE 3KPLA 1S7SB 1AHWB 1OAKH 1IC4H 3MXWL 4OZHB 3VG9C 3KS0J 3VWJC 1I7ZA 3R1GL 3WUZA 4E41B 3X12A 5KJRH 3BUYB 3T4YA 4J6RH 4KV5F 3LKSB 1U91B 3KYKH 2DM3A 1QNZL 4GKSA 5DQ9A 2L0DA 2XFXA 4HW6A 5DS8B 5I19L 4Z7QE 1BFSA 2PCPB 1UVQB 2VDPL 3FN3A 4FFVC 4NN7B 3DRQB 2ZKHH 5E6ID 1G6RB 2AVGA 3KDMB 3NTCL 5F1NA 5FYLE 2LQRA 3HMXL 4FQCH 2D0FA 3WJJA 1WTLA 4MS8D 3IYLW 1HHIB 1RULH 5C0GA 5CCKH 3L3HB 4PG9B 4FQ1L 2WBJA 5D7LE 3IS0X 1K8DB 8FABB 4PR5A 3U82B 3U7YL 3MV9E 2LTQB 2X4QA 5DTFB 2Z91A 1FAIL 5DGQA 5IJVA 4TNVF 5C6TH 4HGKC 1HYSC 3C60D 4GG6F 2VB5A 2Y4SA 2UZYB 1FLRH 2AJSH 4NN6B 3STZA 3I6KA 4NJAH 3N1GC 4PJAE 5C0JA 4GBXD 5IGXH 1L7IH 4RBPH 4F7MA 2LVEA 3DXAA 4P59H 4Y5VA 4A6YB 4OLEA 3HI5H 4U1HB 4X6CB 5DJXA 3CSPA 2PKDA 3OJMB 2XNAB 2NR6D 1MPAH 2V9RA 4L8BA 2P24B 1A5FH 4LVHC 4X8XA 1EEZA 3OPZH 1T3FA 5KSAB 1AGCB 1FV1A 3TIDA 5TQ0L 1K4DB 4Z0XA 1UH4A 4KI5C 1DBAL 4S1SL 1TVBB 3KPSA 4MYWB 3QEUA 2HTLC 2VLLB 4UINH 1HCFX 3GSUB 5C0BB 1NLBH 4M03A 2NY0D 4L8DB 5FGBC 3G5XA 4OD3L 5BW7C 3HAEB 5D70L 4QLRA 1BZ9A 1KN2L 1J0JA 1Z0NA 3MJ8B 1G84A 2BVPB 5F9OL 3VFSA 2VL5A 4LDEB 3H8NA 1IEHA 3H6JA 3P9LB 5HGAB 1CFVH 1CG9A 4H25A 4NUGH 4WFGE 4NRZA 4MLSA 3NABH 5IFHL 1SJXA 2DLTA 3ARXA 3LDBB 5JLZB 1I3GL 1MFBH 2A74A 1I9IH 1BHGA 5E2UL 3T0EA 1NANH 3BSZL 1GPOH 4U7KA 1J1XH 2G5BB 4ZNEA 4KQ3H 5FUCE 1DQDH 4M7JL 3FN0L 4X4ZA 2EDEA 2B4CL 3SKMB 4KTDH 5FHAL 2C3XA 4LMQE 1HCVA 3K4AA 1EO7A 4R7DA 4JFQB 1ZLVK 3Q3GB 4PV9B 4HPOL 4X6FB 5EWIH 1DQTA 5KS9B 2XQBH 4FABH 5DJDB 4I1NB 3MCLH 3LQZB 1H3WM 2WUCH 2R56H 3IU3A 1IAIL 1TVHB 4YBQC 5C7XH 4KDTA 1UEMA 3MUGA 4J8RA 1YPZB 1NMCB 1V8HA 3SCMC 5C6WH 1C08B 3I75A 3T3PF 1BOYA 4XNZC 1KLGA 1GGUA 3WFEL 2DD8H 5DO2D 3O6KH 1RUQH 4ALAH 5HHPA 5KVFL 1MCEA 4M6OL 3JWOL 3REWB 4L29B 1Z9MA 5MEND 5DMIL 2D4DA 3RRQA 3GSNB 1XCQA 4HGWB 2LABA 3LN5A 3K7UA 1NCAH 1AXSB 1FSKC 1JGEA 5AUMA 1MF2L 2XG5A 5IMOB 3MRRB 3FO0H 4DKFH 1NCCL 1FVCB 2ENYA 1ACYL 2YHGA 4IOSD 3VFRA 1GGCL 1TPXB 1UB6A 4KY1H 2IANA 5EC1A 4OV5A 2MHAA 4JM2D 4I18C 3O2VH 5KW9H 2P49B 3TEUA 3IKKA 3CU7A 1B4JL 3UAJD 3GSWB 1VFBA 4G6JH 3G5VA 1XGRB 2H32B 3RX5A 1OAKL 4QHLA 4RGNE 4HJ0C 1VFAA 2LFGA 4TUKH 5KJRL 1JMZA 3NOIA 2FH6A 3WIHA 3KYKL 4EDWH 1TQCC 1DBJL 1JPFB 5C07B 3ARDC 3D85B 2JJUA 1B3JA 3MV8B 3VFMA 2ZKHL 3TVMB 4W70A 5ISZB 5DUMH 1CWVA 5TDOA 3OF6A 5DRXA 2R2CA 2XXMB 2YBRA 3I84A 2B2XH 4ZFOA 4LU5L 3QIBB 1RFDH 1KTLB 2JCCE 1ETZA 4JVWA 3T2PA 1CGVA 2X4OA 2BVTA 1I1FB 1F6FB 3ZYOA 4F58H 3WHE0 1S9YB 5H94B 1Q72H 2O61B 4YIQA 5GRYA 4P5KB 1AY1H 4PY8J 3UTSB 2R8SH 3OWEA 5D2NA 5CEXB 1H3GA 5JPNA 1HH6A 3VXMD 5I2IA 2H41A 4PJCF 1FLRL 1G7HA 2AJSL 3BQUC 3LQMA 4CVZB 4NJAL 3F7VB 4OCNC 3ZE2E 5D6DA 3T1FB 2AQ3A 1BJ8A 1RUAL 1L7IL 2CKNA 5HGBB 4YEFA 3CPLA 3BEWA 4P59L 3HI5L 2BNUB 3VG0H 3PGDA 3GMLA 3HE7A 4QOKB 4Y5YA 1Z9SA 3B5TA 1MPAL 2MCPH 5E5UB 4Q2ZA 4P2RD 3OPZL 1FL6A 4XPAH 2HFEA 2V2TA 3WJLA 1HK6A 3CFIC 1S9KC 4UINL 5A2IH 5GRWA 1NLBL 3MV11 4HUUA 5E6YA 4F80A 4U49A 2HTKD 3S35H 3SKNA 5DC0A 3C8KB 3SDAD 4YNYA 2DKUA 4WEMB 5ADOL 3PWLA 3RGHA 3MRDA 2P5WE 5MERB 1P9MC 5JNYA 4BZ2H 4H0GA 4LDOB 1IL1A 3FMGL 3BPNC 2EYRB 3HCVB 2Z4QB 5TE6H 5DD5H 4NUGL 4RMVA 5IEKB 1CGWA 2NY6C 4NWUH 4U1IA 3NABL 1QQDB 1A9BA 3QJHB 4ZFZB 4UU9B 4N0FB 1MFBL 4DWHA 4P2QD 2P7TB 5E4EB 1J1XL 1SYVB 3TPUA 3QNXB 4KQ3L 3B43A 1DQDL 3X11A 1QRKA 5D7JA 1I8KA 2HLAB 1BF2A 1FZOA 4KTDL 4NNYB 1RJZB 4U7SA 5GQBA 3JV4B 3OKDB 3SDYL 4K94H 2CXKA 1NFKA 3OJVC 3JTSA 2NY3B 1I85A 1JTOA 3FKUS 1YC7A 1NCDH 4U1KA 5EWIL 2QSQA 2XQBL 5E8PA 3OR6A 4FABL 5JOFB 2HJKB 1HSBA 1FNHA 4G6MH 1YNKL 2WUCL 3MCLL 1JIBA 1JCKA 4FQQA 5HVWA 1ZANL 4OLZH 5IQ7H 3HZVA 5KN5B 2EIBA 4UIKH 5IB5B 5CIPA 3PGFL 2RFXA 1S9XB 2XN9B 1NDGB 1XIWB 1QA9A 2OTWA 2OXGA 4Y2OA 2DD8L 4L3CA 5JW5A 3O6KL 2ITCB 4UAOC 4ALAL 3MV7A 1MVUA 4PJ7B 1E4WH 4KKNA 2R23A 4BELD 2CLVB 4DZ8A 1A7RL 4AM0B 4O2CA 1X9QA 3HE6C 3ZTJG 1T5WB 3FZUD 3ZL4L 2VDNH 3QUZC 3IRZA 4EI5D 1I7UB 1PKOA 2DIJA 4R4ND 3S98A 1JMXA 3VH8A 4M1GH 4DKFL 3CX2A 3UC0H 4OUUB 3PWNB 3VGHA 5T5NG 4FTVE 3IRPX 1AKJA 1S9WB 3SN6N 1CDUA 2GFBB 1S9VB 2UUDK 1U95B 2IAMC 2WLYA 3DVIA 4KK8C 4GXVH 4KY1L 1N59A 5GRUH 1U8IB 2HMID 3QO1A 4IEFB 3VDBA 2N56A 2FJHB 4QRSB 2QTEA 4IIQC 1E0OB 1AFVH 5EN2A 5HVFB 5EZOH 3O2VL 1HXMA 5HHME 4JR9L 3OB0H 2SEBB 3O8XB 4G6JL 3RJQB 1ZHLA 1T83C 4FMKA 4TN9A 4Z6AT 1N6QH 2P5EB 5D96B 2AJ3B 1GC1C 4L4TA 5C0AD 5D1ZA 1CGTA 3GRWL 4S10A 4EDWL 1ZT4B 2EKSB 4ZMAT 4HIXH 3RPIA 4XPGL 3MLTA 2OYPA 3NAAH 4Y16C 1KNOA 1NC4D 4K3GA 4NKMA 5CBAB 3TJHC 4FOMA 2UVFA 4NC1C 5BS0D 3UBXB 5DUML 1MCQA 1RMFH 5BRZD 1CBVH 2IBBA 3QUKB 4JAMA 5FO8A 1YMMB 1NBQA 2B2XL 3R0MA 4GLRI 1RFDL 4N0UA 4WUKH 3KLHD 2NY5C 2OTPA 4G43A 3ZSTA 2GSGB 2DQJH 4O00A 3MLSH 3AVEA 4ZUVB 3SJVB 4Z7OE 1BF8A 5EBWA 4ZUSA 1C7TA 5CEYB 1ZT7B 3CFBB 1AY1L 1GZQB 4RNRB 2AXHA 1T1WB 2QKIB 3OL2A 4UOW0 2AERT 4FQXA 3CVHB 1AC6A 4PGDB 5IVXA 1N6VA 5E8DL 5JDSB 5LCVH 1RUML 4BSVB 5GGRB 3PG2A 3D25A 3F65A 3IKCB 2MCPL 4N8PA 2J6EA 5CMAB 1MIML 3FT2A 5HHOA 1AR2A 3S34H 3BN9D 2DKMA 4G8GD 3KPRA 2ITDB 4MXWL 1AGDA 3NIDE 2JIXA 2YC1A 2DQIH 2VLMD 2H32H 4JANA 4L8CA 2PF6A 5GGTH 4N5ED 1KJMA 2FHCA 4F9LC 4FFWC 4WDIA 4NBZB 5F3BB 1F3DJ 3BEVB 2WWKT 4MNGE 3UMTA 43CAB 3V0AC 3ZKXB 2BNRB 3S35L 2CDFB 4QRRD 3AXLB 4NO3A 3RHWK 3TV3H 4JN2A 3T08A 1UJ3A 3CVIL 3LQAH 3EYQD 4BZ2L 1N5AB 4LLYA 2R0ZL 3VFNA 1FZMA 4XPFL 1IQDA 5TE6L 5DD5L 2VLRE 1T1YA 4PJBA 1BQUA 2FIKA 4BYHA 1EHLH 4F7PB 4M6NH 1KEGH 5C2UB 3QULA 4MNQB 4KHXH 4WJ5B 3ARFD 2FJFB 4E42A 2DF3A 4Z95L 3WJJC 1UWXH 4DAGH 3EYVA 1EVUA 5ABDE 4LHQB 1EBPA 4OFYA 1MCKA 4K94L 1GOGA 1IZJA 3P9WB 2YSSA 5LVEA 4R2GD 5DJ2A 1YDPB 4NKDA 3SDDA 1TZGH 4P2YA 3DLQR 4DFHA 4WV1A 2Z9TA 1A02N 1QFWM 4G6ML 4X9IA 5HGHB 5ICZA 4G7YH 5T1LB 3VXSE 2F54A 1IVLA 4OLZL 5IQ7L 3RL2A 4MA1B 4LVOC 3U7WH 3D5OF 2R2HB 2F53A 1FL3B 3ULSA 2XZQL 2DIAA 4YFDB 5IK3A 3RUGA 3O81A 3PQYD 1O7VA 5JA9A 3ET9F 1V3MA 1CK0H 3JV0A 4J1UB 5CD3B 1E4WL 4E41A 5IMMB 4JVPA 3BUYA 3ILPB 4RMUA 3T09A 1H5BC 3ABZA 3LKSA 1U91A 2IH1A 4AIOA 1QFHA 2VDNL 4HJJH 5DS8A 4YQXH 4YLQT 3OZ9H 1L4IA 2PCPA 1IM9A 3H9HB 4M1GL 3UC0L 1UVQA 3OKEA 3ZMRA 4M61B 1KELH 4LSSH 5IVXF 1MCNA 4I8DA 1FO0H 4N1HB 1G6RA 1H8SA 3KDMA 2J7LA 1I9JH 4JPKH 4OCWH 3OAYH 5DI8B 3SOBH 5GRUL 1P2CA 4Z7WE 1YY8B 1U8KB 4QRPB 1MCIA 8FABA 1AFVL 3EJYC 3K0WA 1X5FA 3BO8B 3T0AA 3T04D 4R4BB 2EO1A 1KGCE 3QHFH 3SEPA 4Z77B 4NO2B 2WUBH 1BFOB 4HC1A 3DUUB 3N1QC 1OTTD 2MKLC 2AKRA 3QAZC 4QYOB 4KKLC 3L5WB 4A6YA 3TESA 4TTDC 4U1HA 4OFIA 4Z7VE 4HIXL 4FZEH 1FPTH 5CZXC 5JXEC 1XGQB 3NAAL 4N9OB 5LBSL 3ARVA 5GS1B 3MBED 1ED3B 3LKRA 5KSAA 1AGCA 2YEZB 4JO1H 3RNQA 3H9SB 4X99A 3CFDB 1CBVL 1RMFL 4MVBC 5IMLA 5I15L 3BDBA 5FA4B 5D1QB 2VLLA 3GIVA 4C59B 5C0BA 3MLSL 1QSFB 3QXWA 1ZLUK 2PNDA 1TJHH 1SY6A 1BZ7A 5E9DA 2A1WH 5FOBB 2E7HA 5I8EB 1WCBB 5BV7H 4MB5A 3S3JA 1R3IH 2BY1A 2EKJA 5DMKB 5LXGH 3P9LA 4NZDA 1K3ZA 1FAKT 4EN3B 1WZLA 5FXCH 1MRCH 3DV6A 4HF5H 3VA2C 5LCVL 5JLZA 3QFJE 3RUGF 3F7QA 5HD8D 2DJUA 4G6FD 2G5BA 4OZHF 3HPLA 3DX6B 4M5ZL 1LO5A 5BZDA 3ZLQC 1J5OH 1X6LA 5AZEH 4KUCF 3SKMA 5FECB 3E1F1 4ORGB 5A2JH 3EYOB 2QBWA 3ES6A 3Q3GA 1OSZB 1E4KC 2R15A 2DQIL 4PLKD 5GGTL 4PGJA 4TULH 35C8H 3QA3B 4JN1L 3LQZA 1FCCA 3SO5A 3V6OC 1TVHA 5KTEH 4NGHL 3ZKSD 1YPZA 1C08A 3LQAL 1GGBH 5FUZH 3U36A 3QIWB 3QDJB 4ZQKB 4LK4A 3TM6A 5I74B 1Q0XH 4X7SH 1EHLL 4GS7B 4M6NL 1KEGL 2VUOA 1KG0B 3S8WA 3Q2CA 3W2DL 2XY2A 3GSNA 4HGWA 5CSBA 3C6SA 4Y4HB 3K4DA 3ULVF 5T5FH 3OBAA 5IMOA 2IQAB 4A2LA 3ARYA 5BVJA 3MRRA 5SX5K 3MLUH 5F7WC 3PL6B 1G9ML 4FTVD 4MXVF 4NZTL 1B6UA 1CGYA 1I8IB 4X6CF 1TZGL 3TO2B 3ILQC 4UOJA 3ARZA 5ICYB 4FQPA 2YN5A 1ZE3C 4G7YL 3WIIH 1JJUA 3WSQL 2E7LC 2X1XR 3U7WL 4RFEB 1X5IA 4MHHG 4XCEA 5HHMD 5I16B 2LVCA 4L9DA 5F7LB 3D3VD 4MCZB 3VGFA 1XGRA 2OMBA 1CK0L 3AB0C 4C55A 3K8LA 3FJTA 3PWPA 5B22A 2D7TH 1LEIB 2QL1A 3H3KA 2XOTA 4EVNB 4OZGB 4Y1AB 1FORH 4IRSC 1H15A 3GK8H 4BA8A 4XXDA 3DXAE 3V9FA 4Q74A 3RWEB 3IFPA 3LRSB 4LSRH 4P9HL 4ZXBC 4XWOD 3NFNB 1E4XH 4HJJL 4QRQA 3ARPA 3ZDYF 5C07A 4YQXL 4GXUN 3D85A 1XZ0B 3TGXA 1K3IA 1KELL 4LSSL 3MLPA 4K9EH 3MRIB 1D5XB 3C8HA 4JPKL 4K3HA 4OCWL 1MJJA 3KPSE 5LJYH 3QIBA 3S6CA 3P30H 1T03L 2ZSWA 5L2JB 3AMKA 3GI9H 1MREH 4XP1H 5DJCB 4Y89A 3FCTA 3LMJH 3WS6C 5H94A 4ZPVA 4LOUC 3DSFH 2CKBA 5CD5D 1YYLL 3QHFL 3UTSA 1RUKH 3D39A 4HGMA 2WUBL 5KS9F 4OZFH 4RQQB 3HG1B 3T1FA 2DYPD 2HVJB 5HGBA 2JELH 1G7MA 3CLEH 1DN2A 1IT9H 4DN4H 2BNUA 4X5XB 1UXSB 2W0FB 4FZEL 4S0TD 2XWTA 4HHAB 4IJ3C 3T0EE 5FA3B 1KIUA 4NQSA 4ZNEE 2LAAA 1NFDA 4FG6C 5EU7C 3UPRA 3ARED 1R3KA 3UJJH 5EOCH 3OKNB 4XMLH 4PJGB 2FIRT 1HILA 2A6KA 4CKVX 1QFPA 3LPFA 3S37H 1WGOA 1FJ1B 5F96L 5T1DH 4JRWA 5E1AB 3U4EB 1CR9L 2AI0H 1MHEA 4HBCH 1AQDB 2VZUA 1UM5H 4PJCE 4NO0D 1ZTXH 1WZ1L 1TJHL 2F5AL 3C8KA 2A1WL 4Y2DB 5DUPH 3MA9H 2G2RB 5FGCB 3DETC 1CTNA 5MERA 5BV7L 1UACH 1Y6KR 2RCSH 4V2CB 5DQDH 1M05B 1R3IL 5EPMB 4XHJC 1QP1A 2VLRD 3N1PC 5DFTA 1MRCL 4HF5L 1VEOA 3DUHA 4Q6YA 2E8ZA 5EU5B 4GSDH 1UA6H 3WNKA 4WU5A 4ZS7H 3UPAA 4N0FA 2V5SA 2P7TA 2A9MH 1C8PA 4XVTH 1J5OL 1Z0MA 1AD9B 3MQIA 3MROB 2RAMA 4RIRB 4EOWH 2HLAA 4Q9QL 1VFMA 5AZEL 4JPWL 2EYTA 1RJZA 5T1KD 1K6QH 3R8QA 2F5BH 2VYRE 5JO5B 4NYLB 3ZO0A 4NZUH 4Y4KC 5SWQA 5I1EH 4YH6A 35C8L 1J12A 2IANE 4LCYA 2HJKA 5GHWH 2O93L 5KTEL 1ORQB 3GMQB 5KN5A 1F6AB 4JDZA 1S9XA 3DMMB 3HZYA 4W4OA 1GGBL 4UDUB 3RDTD 5FUZL 3WUWB 1XIWA 3BJ91 5ID1A 5GRVL 3RVTC 2YWZA 5CINH 2XTJB 1ONQA 1MAKA 1ZMYA 2ITCA 1F58H 3BIKB 4PGCB 1G7LA 3P11H 3R4DA 2DQDH 4IBLT 1ZSDB 4MXQD 2NXZC 4PJ7A 4QF1B 2CLVA 1G7JB 3UBXI 3W5MA 4JQXC 2CUHA 3C5ZD 4GJTB 2DBLH 3HFMH 1T5WA 5T5FL 1TQBB 1S7XA 4GRLC 2OL3B 2R1WB 3MRKB 4MAYA 3NCEB 3F5WB 2PTTB 5GPRA 4C56A 3MLUL 5JXAH 3SKOA 3PWNA 2VE6A 2A0LC 1S9WA 4Z7NE 1ZOXA 4GMSH 3WEXB 2GFBA 1S9VA 4TPRH 2DTMH 4LVNC 5D2LF 1S7VA 3TYFB 5MEOB 2BVOB 1T89A 2KZWA 4ZOAA 4XC3H 2NY1B 3LH2H 2FJHA 2APFA 4FQXC 4QRSA 4DW2H 5F7EH 2OK0L 4Q97A 1TNMA 2X1OA 1D5IH 3HPJB 4P46D 4YBLC 4AEIH 4MDJA 4QWWC 5F7DB 1JI2A 2Z0BA 1GZPB 1G6VK 5EU3B 3OAZK 2E9IA 3EHBC 4HIEB 5D2NE 2FBJH 5E24E 1Q9KA 3S88H 2D7TL 1L7TL 4ESKA 1HSAA 3ARBA 4P5MA 1FORL 4DUWA 1P7HL 4X5WB 3NPSC 3RWGA 3BISA 2EKSA 4HUWB 4LSRL 4MA3B 4OQTH 2A6IA 4JRYA 3K2UL 5CBAA 1PY9A 2AV7A 4OF0A 4K9EL 5ENWA 2W91A 4GRWB 4PJDB 4J3TA 1FVDB 4XMPH 3UBXA 1I1CA 3QUKA 4O02L 2APXA 1RVFH 1YMMA 2EZ0D 4JFHD 1UJ3C 3BD5A 4M9PA 3E2HC 1AXTH 3P30L 5GSVB 4LAQL 4RA3A 1AI1H 3B9KD 5DK0B 3T0DA 4M8QB 1U8PA 4P99A 4TQEH 4Y4FC 3GI9L 5SV3A 5E6IB 2H2SC 5C9JB 3SJVA 4AEHH 5EBMA 2OSLB 5I1KL 3O6FD 3MJ9H 5CEYA 1ZT7A 1GZQA 1RUKL 2DS4A 4LBEA 4Z0BL 4RSVA 4F33B 3O45B 3FO1A 3TBSA 2B1AH 2WWMD 3ZE0F 2JELL 5JDSA 3ZDZE 3T0VA 2D31B 1IGTA 4DN4L 1HEZB 3PP4H 4P57B 3C60B 1Q0YH 5C1MB 3IFLH 3IKCA 5K9OB 1UQSB 3W9EB 4WV1C 5DHVA 4GBXB 2EDTA 1HYRC 1NBVH 3UJJL 1G0XA 4H8WC 4PJ7F 4XMLL 1NGYA 3S37L 3EDFA 3MJ7A 3I85A 2A38A 3QUYC 4L4VA 4XPTL 2R0WH 2NZIA 3T3MF 5F3HA 2AI0L 4HBCL 4ENEC 2MPAL 4JHWH 1SEQH 1UM5L 3O3BB 3QNZB 1AHWC 3P4MB 3CXDH 4TRPH 3WV0A 4DOHB 4CADA 2XZAL 3MA9L 1EERB 2PW2B 1T66C 4V1DA 3RWIB 3HZKB 2RBLA 1MRFL 2P48B 3NCJL 3V4PH 1UACL 5DQDL 1N5AA 3F8UB 2NPLX 2NY0B 4YK4B 2QQLH 1U58A 5DFWH 1UENA 3RGVD 4MQSB 3DUSB 5J13C 3MV7E 4MWFA 3TA3D 4F7PA 2Q87A 2ADIB 4MNQA 3INUH 4NN7C 4JFDD 1FFQA 2GSIB 2ADGA 3BKJH 3ARGA 4ZS7L 4WJ5A 3O2DH 5D7KE 2HRPH 2YMXL 1CDIA 4FQJH 5M95B 1IGFH 1ZKAA 2BSSB 2WP3T 1K6QL 5DRZB 3MRGA 4ZOEA 2F5BL 2PUQT 2IG2H 2LTQC 4LLDA 4LCIH 3ULVC 5I1EL 1D5MB 1S5IL 3HRZB 4G42B 1J11A 1DZBA 3OB8A 32C2A 3QXTA 4NN6C 3MJ6A 3PWJA 2R2HA 1Q94B 5I9QC 1FL3A 2FX7H 1U42A 3HI1B 3CX5J 4JG0H 2YS4A 5CINL 3I50H 1I1RA 3T0BA 2F19H 3IXAA 3DYPA 5AD0B 2X9YA 1ZEAH 4KXZH 3PV6B 2DQDL 1OCWH 4J1UA 1N4XL 4KUZL 4L4TE 4LLUB 4MDIB 5DMGD 3U9PH 3X14A 4BSWB 3HMXA 1RQ5A 3TO4D 2DBLL 3HFML 3CSYA 2DICA 4LLVB 1MRDH 1F4XH 3A6OA 3HI6H 4YHLH 1NPUA 1FNSH 1VERA 3I02B 5MENB 3H9HA 2NXYD 5JXAL 5EZJA 4W6WB 5DYOB 4M61A 2NLJA 4PS4H 3VRLF 3QI9B 1QFWH 2E27H 2BSED 4GMSL 1UWEH 2FL5B 2HVKB 1KJVB 4HXAH 4U1NA 1MCWM 3W82A 2DTML 4PRID 2CO6B 4JRXD 4FZ8L 2O5XH 2OJZL 4BH8A 1A9EA 4GRMA 4LSQH 4N0UE 2NW3B 4DKAA 3LH2L 1YY8A 4QRPA 2NMSA 5CSGA 5F7EL 4BUHA 2X7LB 2AEWA 1D5IL 3FQRB 1UXWB 3DGGB 4AEIL 3RIAK 1R3LB 1R5IB 4MNHA 4HBQA 3LDBC 3ZYZA 4QY8B 4Z77A 5HY9B 1XGYH 4NO2A 1I1AB 3VD9A 1ZHKA 2FBJL 3DUUA 3O6LH 4N0CD 2QSTA 4JM2B 2H6PB 2WSKA 4D94A 5IVXE 3WN5B 1H3PL 3QP3A 5FYJD 1IC7H 3VWKD 5HYSA 1EA9C 1KIPB 4NM4H 1DQMH 4E5XB 2V7NA 1PKQB 4HKBA 4OQTL 1DUYA 1RZ8B 1OGAD 3MNVB 2VABB 4KRPC 5HHOE 3DVGB 1AGBB 3KPRE 3V52L 3CFDA 4XMPL 1K2DB 5DF0A 4WFHD 5D71H 1T7WA 1NMCC 1CQKA 4RAVB 1I4FA 3BPCB 2DMKA 1AI1L 3ULUH 1FVEA 4YAQA 4TQEL 1WT5A 4XNXH 4HV8A 1A3QA 1QSFA 4LQFH 1QPPA 4HH9B 5IFJA 1FYHB 4AEHL 4F2MA 4OF5A 3TJEH 3VFPA 3MJ9L 1BIHA 1WCBA 4LGSB 2EYSA 4Z76A 5FM8A 4JVUA 3DWTA 4OGZA 1B6DA 1NEZG 2HFFB 4QXUH 4PJBE 4EN3A 4PJXB 2JJSA 3Q6GL 5I8OL 2V5TA 3PP4L 4M4RA 4P5TD 1Q0YL 1TPXC 4O2EB 3VXMB 4CN6A 3IFLL 3BWAA 5D1XA 3PDOB 3DX6A 4K2UH 1CL7L 5IVZA 1IMHC 1G7QB 5FECA 3OJDB 4ORGA 3EYOA 4XH2B 1W0WA 2OQJB 4FFZH 3UJTH 2R0WL 4HDIA 5T3ZD 5GSRA 4JHWL 4P2RB 5E4IA 5EBGA 3CH1B 1YN7A 3QA3A 2DLHA 4UV4H 5A2LH 1U3HC 3CXDL 1NL0L 3T65B 2F54E 4WEUD 4EUPB 4Q9RH 4OTXH 4UILH 1CICD 5LAXA 2HJLA 3OKOA 2F53E 3QIWA 3OHXA 2VXQH 3QDJA 3KGRA 3RUGE 1V05A 5FCUH 2QQLL 2WBKA 2ZCLH 4XCNB 4C83B 3SDAB 5SX4I 4GRWH 4MQXD 5HBBA 1RD6A 4E41E 3INUL 1NDMB 3PHOB 3BKJL 3CK0H 3P3YA 3TVMC 1I9EA 3QUMH 1JHKH 3LEVH 1EHNA 3DARA 4LSUH 4FQJL 3EFDH 4K8RD 3ALPA 3PL6A 3MCG1 4H1LH 5D93B 1F45A 2JJVA 3DBXA 3RAJH 4Z7UB 4DGYH 2Q76B 2IG2L 2QADB 1EZVY 4P2QB 1QHOA 4LCIL 4DKEH 2CDEB 3OF6D 3TO2A 1GCFA 4I0PB 1LP9B 1MVFA 1U2HA 1RZIB 5T3XH 2GW5A 1KCUH 4WENB 3IS1X 2FX7L 3EAKA 4AG4L 4IS6B 5I16A 4JG0L 2VLJA 3I50L 4YHKL 1OD7A 2F19L 3MRNB 3DVFA 3MRBB 3VJ6B 1K4CB 1ZEAL 3TIEA 3U9PL 1OCWL 1WVZA 4X80H 3I6LE 1ND0B 4OZGA 4Y1AA 1AP2B 3NZ8A 1INQA 3AROA 1F4XL 3HI6L 5SWZB 1JNHA 3QEQD 4YHLL 2E7BA 3LRSA 4ZSOA 3EJZD 3NFNA 3OAUH 1UCBL 5B3JF 2Y1VA 1QR1B 3W11C 1XZ0A 4U31A 4IHOB 4PS4L 1KCSH 2DQEL 2KBGA 3MRQB 1QFWL 3MRIA 3O4OB 2E27L 3NCCB 4HXAL 1AC0A 1UWEL 1MI5A 3EYFB 1ZGLP 2W38A 4BH7B 2I25N 4Y88A 1JYXA 4EI5B 4APQD 4OLUL 5JW4N 1FNLA 5C0BE 4ONHB 3L5HA 3GHBH 2EIEA 5L2JA 3T4AB 4F7EB 5J3HD 1YNLL 5E9DE 3UXFA 5E94B 5C09A 2H8PB 1KTRL 4KKBD 3MRMB 2H1PH 3LRGA 1JN6A 1KCKA 1XGYL 5B4MC 2FR4A 1A3RH 3O6LL 1RSFA 5E4EC 5JZ7C 4RRPG 2VZOA 1VGKB 1TDQA 4Z9KB 3MV9B 3MRPB 3QDAA 1IC7L 3KJ4B 2NY3C 4LIQE 4X98B 5KVGH 2RIKA 2W0FA 5D72H 3TN0A 4NM4L 4YHPA 1R3JB 4KKCC 3PXJA 5C0AB 1WEJL 1B0GA 2YUVA 5D7JD 3TH3T 4OCXL 2IPUG 3TZVD 1EH9A 5D71L 3GM8A 4MZ3A 5EIIA 2FGZA 1KPRB 1XIWC 5E1AA 3NIFE 4RWYH 3RVVD 3MPCA 1NC4B 5KAQF 2VJXA 3DYMA 1Q9LB 2B1HH 4LQFL 5BS0B 1BREA 1DEEB 4G80B 3VE0B 5BRZB 5INDB 4Y2DA 3TJEL 3EIFA 3OGOE 4QCIB 1KJ2H 1BLNA 1YPZE 3OX8A 2VDQH 5JTWA 1IC5H 3NBNA 3P9MB 3F58H 1M05A 4QO1A 4LLQB 5ID0B 4NDMB 4J3VA 5EH1A 4QXUL 2EE9A 5ACZA 5EU5A 4WHTB 4W81A 3QPQC 1F3JB 4HUVA 4ZYKB 1BJ1J 4HIHB 1TJGH 4LHUA 1GVIA 2Z35A 2E7CA 1T89C 5ECJE 1R24A 3OKLA 4I4WB 4K2UL 3MROA 1EV2E 3LVEA 1INEH 3P73B 1RZ7L 2PW1A 3CMGA 2DI8A 4R96A 4S0SD 4OZGF 1AKJD 1T2QL 3H0TA 4FFZL 5C0DB 3HMWH 4PG2A 5DC4B 3UJTL 5C3LD 2EXYD 3IAGC 3IDIA 4M4PA 3GJFB 3O8XC 3VD4A 3GNMH 3RVWD 3GBLA 4G8GB 3MA7A 3PP3K 4HMEA 4UV4L 2G75A 5DMYA 3Q1SL 3BZDA 5D96C 3TF7C 1Q9OB 4Q9RL 5JORA 5E7FA 4NOFA 2K7QA 3UJIL 2QQKH 5IMKB 4OTXL 4UILL 4X7DC 4POZC 1X3DA 3F12A 3TCXA 2VXQL 5FCUL 3BZEB 3BIKA 2ZCLL 2OM5A 4CW1A 4JPIB 4M6ML 4YHNB 2WQ8A 1QSVA 3PWPE 4XTRD 1ZSDA 4L4TD 1QRNA 3X17A 4H26B 3CK0L 5HVHB 3GSVA 4Y19D 3QUML 1RK1A 1JHKL 3LEVL 4ODXB 3QRGL 3KYMA 4LSUL 4BFIA 5JOPE 3BE1H 4KK6C 2OL3A 3EFDL 3IDUA 5C07E 3F5WA 2ARJA 2PTTA 4HPYL 3UTTA 5F9WB 5CJ8A 2X4PA 1U92B 3RAJL 3BIAX 2HFTA 4DGYL 5I71B 3ARFB 2PN5A 4OZFG 3WEXA 2OTUB 1A1OA 3WHXA 1R5WB 5CGYC 4F8QA 2BVOA 4GW4A 3CFEB 1EUTA 1XCTB 2ED9A 3ELAT 5IW6B 1KEML 2L4OA 1OLLA 3GRWA 1KCUL 1QBAA 4R2GB 1QO3A 4PJGF 3HPJA 4TVPH 1FNFA 1U0QA 5H35B 1JHLH 2GTZB 2X42A 5D6CB 5IBLD 4OLYH 2KH2B 3SBWA 5EU3A 3UTSE 1S7UB 3D39E 5DK3A 5FF6B 3BVNA 3KPNB 3BP4A 5ERWB 4U6HB 2MMXA 1I8MA 4NSKB 3FFCA 1FQ9C 2BRRH 5IR1B 2AEPL 1OTUC 4X5WA 3PQYB 1NMBH 1UZ8B 4PRBA 2OLDA 3OAUL 4H88L 3MGOA 4NM8H 5I66B 3CDCA 3LKQB 1CT8B 4WTWA 5MHSE 1R5VB 2YZ1A 1NFDE 5HHOD 1KCSL 4EUPH 2GTWB 2YPVH 3ZKXC 4PJDA 3KPRD 3MRJB 1FVDA 2ERJB 4DGVH 3TBWA 2C4FU 2QJDA 5DK0A 2D7PA 3GHBL 5JDJA 3UTPE 3BDYH 4OSUL 3VFGH 4HS8H 3VD3A 1Q8MA 4Q6IC 1Q9WA 2A83B 2OSLA 5GGUB 3IDMB 2FBOJ 3AAZB 1NAMB 1CDYA 5BOPA 1A3RL 4F33A 3O45A 5EA0H 1OVZA 1HDMB 4FHBD 1ORSB 1CD9B 1T2JA 2D7MA 5KVGL 4U6XB 1IC1A 5D72L 1JGUH 3LIZH 1EAPB 1R3HA 1UQSA 3ULUF 5BQ7B 1OF2B 4OFYD 3UDWC 1A3LH 2KQMA 2IPKA 4N0RA 3VWJD 4RWYL 4QHNB 3MBEB 1SM3H 1VENA 1P6FA 5K9QG 3P4MA 3FT3A 1CU4L 1MCPH 4MQ7B 3L95B 4JY6B 3O6MH 3U0PB 1BGXL 3RWIA 1KJ2L 3HZKA 1U8MA 3BGAA 5FYJL 1JYNA 4M43H 1MCWW 1IC5L 4PV8A 3F58L 4WI2A 4DK3A 3EYUH 4YHZH 4LNRA 1XGPB 2BOCA 3J8F7 1VACB 1AE6L 1C5DB 5DD6B 3RZCA 4PJ7E 3WLWC 1CDCA 5HDBF 1YEEH 3WNLA 2F8OA 4OGYL 1TJGL 3FT4B 5BXFB 3T3ME 2M2DA 5SWSD 1P4LB 4RCAA 3RP1A 5FYLH 2BSSA 4C56E 5DRZA 5J06A 1KB5B