4U6HB

Vaccinia l1/m12b9-fab complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
DVVMTQIPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWSLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHDPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
publication title Potent neutralization of vaccinia virus by divergent murine antibodies targeting a common site of vulnerability in l1 protein.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
total genus 50
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hB01
4U6YA 1UG9A 3K2UH 4R0LC 3VWKB 4PB9L 3I50L 1OF2B 1LEIA 3ZKQD 3O41B 3FTGB 5E70A 4K3HA 2NQCA 4LBEA 4HCRA 2H8PB 4EDWH 2CUHA 1ND0A 2YS4A 4L3AA 2CLRA 4FFVC 2R39A 5CSBA 1NCCH 2VXUL 5HJ3A 3MODL 2CGRL 3EYFB 1MREL 1J8HB 4MSWB 1KTDB 5FGRA 3C6LA 5F7WC 3UTPE 4OLYH 4XZUA 1DLHA 4EUPB 3DJ9A 5EH1A 1KJ3H 5EU5A 4G42A 2P47B 3P9LA 5E1HB 4AL8H 2V7HA 4G8IB 3MV9A 4P2QA 4F9LA 4XPGH 2MCPL 4PP2B 3LQZB 2UV3A 1FJ1A 1F6FB 2FH8A 3MQIA 3S88H 3VGHA 3RIFF 4JFFE 5EU7E 1AD9A 5IMLB 2XA3A 3HNTH 2V9RA 1BBJB 2BX5A 2JCCB 3BW9B 2HH0H 3LEYH 5CINH 4N5ED 1JPTH 3OKEA 4KUZL 5HHXL 5EOCL 5D71L 4GAGH 5FECA 1WBXA 4UT6H 3LS4H 3OKKA 3LKRB 3FOMA 2VWEC 1J11A 1JBJA 4TYUA 2LVEA 2J8UB 3RGVB 1GZPB 1MHCA 4A6YA 3MRIA 3S37X 5D7IB 3LKOA 4L4TD 4CDHA 3H8NA 3ZKXC 1NC4A 3CDYA 3KYNA 4K71C 3N50A 1IGML 5C09A 3FQWA 1RK0B 2CDFB 3DSNA 3FT2B 4YBQC 5D1XB 4ZYKB 1EHLL 2X4QA 3H9SA 1I1RA 4Y5VC 2ESVE 3GK8L 4AEIL 4PJ8D 4HJ0C 2VDQH 1FNGB 3QH3A 1T7WA 1B6UA 2X9XA 4F7CB 1KJMB 1IAOA 1ZSDB 3BEWB 4YK4B 1A9BB 3V5KA 3C60A 1XF5B 3WN5A 1SJHB 3D48R 4GBXD 3L5IA 4WUKL 5MEOB 3D1MC 1XGTB 1EUTA 3KR3H 5D7KE 2MPAH 2BVUA 5DLML 2IQAA 5HI4D 5FGCB 1KBGL 2AP2A 1F90L 5DJ6A 1ZT7A 4L8DA 1GPOL 2AXJA 2FNBA 1YDPB 5C0NC 2P8LB 3TYFB 2P49B 5LWYL 2ICEB 3O4OC 4FHBD 1CQKA 3GMOA 2BNQD 3DNKA 4JDTL 2RQ8A 3EO0B 1KOAA 2XTLA 1A22B 2DMCA 2V2XA 1RAMA 4P9MH 1A3LL 3KYMB 2VLMD 4LP5A 3I6KB 3JWNC 3O9WA 2MQCA 3OF6D 3G5YA 1AXIB 3X3GL 3AS2A 4XMKL 4F33B 3K80A 4NQVB 4ZD3H 3QIBC 3PHOB 2Y36L 4AMKH 5F93C 3O4LA 5DK0A 2E8ZA 1TZGH 2J12B 3X11A 3MRHA 3GSVA 4U6HB 1H8OA 1U8MA 2EDRA 5FYKE 5CUSH 3FB6B 1NCBL 2R1WB 4HHAA 3RL1A 6FABH 1JF1A 1EFQA 2AJYH 1BZQK 3MNZA 4H8WL 4ERSL 4ZOEA 3EJZC 1DBJL 3SKJH 5F70A 3OKLB 1XEDA 3GB7B 3GJFB 3O3AA 4XX1G 1QNZL 3OGCA 3ARDD 1AY1L 2MSPA 4ODTL 5IVXF 3KNBB 3T04D 1BQUA 4OCLC 4PJDE 3I02A 3GMNA 5FB8A 1EJOL 2ARJA 5CJOL 5LGJA 1FVCB 4IJ3C 3VWJA 4UT9L 5D9SA 3P0VH 2YWZA 4FP8L 4R4FL 5E2WL 2E6JA 4O51A 4XB7A 1PKQE 3R1GH 5C07B 1YPZE 4I0PA 2FWOB 4WWKA 3RDTD 5F89B 4FFWD 3KPMA 3IGAA 3HFML 3QNXA 3ZKMD 2LU3A 5F9JB 3QJHB 1N8ZB 1FSKC 3CX2A 4JDVA 5F9WC 3VD4A 2PXYA 1F3JB 4YFEA 5J8OA 1DVFD 3EYUH 2GK2A 1MJUL 4FFYL 4IM8A 4DFHA 1UJ3A 3SDDA 4OGYL 4OZFB 1Q72H 5FGBC 4Z6AT 1LO4L 2VAAB 5FYJH 1JHTB 5DJXB 4KI5E 1EEUA 2F15A 2PKDA 4BZ1L 1HKLL 3SDCD 5HHNB 1JNNL 5JW4Q 3MRQA 5IW1B 1CICB 1NAKH 4AH2B 3TEUA 1A9EA 4JN1H 4FG6C 1CGSL 5BZDB 1K8DA 3EOBB 3AREB 3RKDC 3QR2A 3QQ9D 5DRZB 4UINL 1GC1L 4N9GA 1EAJA 4XNYL 1LVEA 3MLYH 2DYPA 1MQKH 2F5BH 4E5XB 1JGDB 2APVA 3H9HA 4HBCH 4JJ5B 4XAWH 1VFAB 3VMPA 2VSDA 2YN5A 4YXKH 4PJ5A 4XWOC 3RWDB 3OAZH 1HQ4A 1PW3A 1I9IH 1I7ZA 1C8PA 3VFOB 1L7IH 2YWYA 1MEXL 3DI2B 4NNYB 2PYFA 2JLLA 3BPLC 5F7YC 4XWGH 3SDYH 4JANB 4EJ1C 5IVZB 1GGBH 3MRNA 3T2PA 3F7VB 4IRJB 2YUVA 2XQBL 4PRNB 7FABL 1U8QB 3WXWH 5CEXB 4JGUA 2B5IB 3JV6A 3Q6GH 2EEAA 4LHUA 4LCWB 5SWZD 2AJUL 1TJHL 1Z9SA 2IWGA 3BIAX 1OSPL 3NZ8B 1IGJA 1XR8A 3PWPA 4NO0B 3CPLA 2DQCL 2A1WL 5DS8B 1OD7A 1KN2H 1MWAA 3IDYB 2MQ3A 1CFTB 3VXSE 2EDWA 4HLZG 4PYGA 4Z95H 2C5DC 1FGNH 3L3KA 3MO1A 3MXVH 1FNEB 3CDCA 4PRPD 4YQXH 1PAMA 3HNSH 2VLKA 4X6FB 2V7NA 1P84K 1WAAF 4M9PA 1KLGA 1KSRA 4JFYB 3OB0H 5C0CA 4JG1H 1D3CA 3BN3B 1MCDA 4JPWL 3V8CA 1JPSL 1RUKL 3RVUC 3S36L 1EXUB 1N0LA 5E4IA 4ZTOL 1K4DA 4YBHA 2VQ1A 4MA7L 1HXYA 3QXAA 5FYLH 4L3EB 5I1LB 3KPOB 5TE7L 2BSTB 4Q9QL 4KJYB 1J1XL 3HRZA 3CVHB 2W9EH 3ARGB 1GC1C 3LH2H 1H9VA 4GUPA 1MIML 1CG9A 4Y1AD 5MEQA 2ARWA 5C0JB 1HHGB 5BS0E 3OR6B 1U58B 1V7NH 4H0IA 1Q1JL 5FO9B 2BVOA 4OQTH 5DRXA 2C3VA 4YO0A 1NBZA 3D0LA 4JDZA 4HIJB 3GNMH 1AGEB 5CGYD 1NCWH 2MJWA 3RBGA 1YY8B 5EC2A 1BIIA 5EN2B 4J4PD 3TFKD 3D69A 3DTXB 1KB9K 4OIAA 5HGAB 3RUGA 2F74B 1YEFH 4F15B 2VQTA 4L4JA 3I3DA 3QRGH 5I1IL 3WD5L 5DK3A 4P5TB 4WJ5B 1MH5B 1KCLA 1MFBH 3QO1B 4WI5A 1LHZA 4YPGB 1B0GB 3JTSB 3QCVL 3RL2A 1NC2B 3QA3A 3V6FB 4JRYA 3G6JB 4BM7A 4KK5D 5I76A 3L6FA 3MRFA 5I30L 4LAJH 4G7YH 3ZKSD 4ZUTA 2XRAH 3RP1A 2CLVA 1BD2E 2RHEA 5SWSD 4WCYL 4R7NB 4IOFC 1CN4A 2VDPH 1IL1A 3D2UD 4C56E 2AJ3B 4YEFA 2XZZA 4XNQB 1WFTA 2R4RL 4PGDB 1KIUA 3HE6C 5GHWL 3QRFM 2K1MA 3GIZH 1U95B 5E08H 1T89A 1B2WH 3MV7A 5ICXB 5I16B 1N6VA 2DQUL 1F42A 3U36A 4OGXL 1H3GA 4OD3L 3RTQA 3SE4A 1MRCH 4ALAH 3BN9D 1E4JA 5KSBE 3JWOC 5C0EA 3VMNA 1G9ML 3B6SA 25C8L 4HK0B 1BVKA 2YPVH 5JW3L 2HT4C 3ISWA 3OJDB 1MJ8H 1J05A 1KLUA 2I9LA 5DR5L 4MCZA 3MOQA 5D2LA 3VXME 5DJDA 4PIRF 3GSWB 1DN0B 5C0AE 1NFDE 1F4YL 1KCVL 5B3JE 3EYOB 1JTOA 2AW2A 2UY6A 5A1AA 2BRRH 2YA1A 4AT6B 4P3DA 1MWAH 4ESKA 1BPVA 4QT5A 2BHYA 2E6QA 2UZIH 3HRPA 1U8JB 2H9GA 3HHRB 3EIFA 5DJ8A 4PTUB 1WIPA 2DOCA 2VWEE 3QULA 3O8XC 4OZHE 5D6DC 2H2PD 1Y0LB 2NY2C 1SBSL 1JTPA 3B5GA 3FT4B 3BQUD 4AY0A 4HKBB 3LPGA 3MBEB 5TQ2L 1CT8B 4P9HC 2OR7A 3D39D 4XPBH 4BQ8A 4YWGL 5LAXA 3QDJB 4L4VE 4Y5YA 3KPSA 1ZGLB 1KB5L 3TZVC 2ORBL 4HS3A 3D3VD 5A2LH 4QO1A 2DI8A 1JPGA 3UX9B 2EYTB 2GJ6B 5JO5A 3IFLL 3GGWB 3MX0A 1O7SA 4JVUA 3TT3H 4YGVB 5TE6L 3DRQA 4MZ3A 1QYGL 3HE7B 3LD8C 4NQDB 2UUDH 1BX2B 3MLXH 5BJTB 3OXSB 3RGHA 1GCFA 1TLKA 5ALCH 3BPNC 2AJVH 5CAYB 1TCMA 2BVPB 4U7MA 1HH6A 2E8YA 2Y7QB 4ZUSB 2H26B 4KTEH 5DEFB 3ZMRA 4Z7VE 1IEBB 5C7XH 1B4JH 1HZHH 2MMXA 3H9YA 4N8VG 2KUTA 5CBAA 2OXGA 4PB0L 3SQOL 2CKBB 5HY9A 3TO2B 4Y16B 5FEBA 4UTBL 4XRCB 2VDRH 3A6OA 1UT9A 3THML 1E4XI 5DI8B 3WV0A 1UM6H 1U8IB 1FO0B 2EYRB 2WBJA 3O2VH 1FL5B 2Q76B 4Z7QF 2UZYB 2YPKB 4NKOB 1IRAY 1HH9A 4PY7B 5E99L 5CD5D 3V0AC 4M6NL 4L8CB 5EUOE 4XBEH 1TTGA 1ZTXL 2HFEB 4AIZA 2VRAA 4IHOB 1DL7L 1I1AB 4U33A 2GJZA 4YDLC 2DQDL 1G7PA 3BKMH 2OP4H 3PABB 2Z35B 4B7LA 4FFZL 2R0KH 1A7RH 2UWEB 4OLVL 3CLEL 4I0CC 2YC1B 3QT2A 1LD9B 4FN0A 3DGCR 5HGGS 1IVLA 4GG8A 4X7SH 3QWOB 1MNUL 5F1SA 3BP6A 5T1DH 3G6DL 4U1NB 3E2HC 5DUML 3U30C 1M71B 4XVJL 3O6FD 4NQCB 3VCLA 1VCAA 1OW0C 4PB9H 5H8DA 3VXOB 1RJLA 2VN4A 4Y2DC 4JFHE 4Y8DC 1C08B 1GZQB 1S3KH 3C6SB 4GLRI 1MY7A 3MLSL 2DWDB 2OMBA 4R7DA 3TF7C 1RSFA 3DUUB 2HT3C 2VXUH 2A6IB 4LGSB 2R0WL 3MODH 3BEVB 2P5WA 2CGRH 1I3RA 4LPUA 1MREH 1IC1A 4KJQD 3IS0X 1U0QA 2WINB 3D85B 2DQFA 9CGTA 5IBTL 5FKAA 4XP4L 2VR5A 2Q86A 4NZRL 2IC2A 5GGRB 1A02N 4LF3B 1ZT1B 3L95B 4YHNA 4ZS7L 5T1LB 2MCPH 3ULUD 4KKBD 4XNMB 4ZO8A 3VI3F 4PJ8A 1KPUA 1XCQA 2BVQA 1G7LA 4TN9A 5E00A 3WFCL 3DV4B 3RWGB 1XGUA 4RNRA 1LO5B 4K23L 4Q9BA 3TBTB 1T2XA 5HHXH 5EOCH 5D71H 4LSQL 1CXLA 1CLZL 4HIIA 2ADGA 2DICA 3HMWL 4TVSa 4M7LT 4IMLA 3AY4C 2ZZUT 4OUOA 2XZQH 2ITCA 3JWDC 3RNQB 4NYLB 4ODXB 1I4FA 3BIKB 3GRWA 1ZXQA 2BNQA 4WHCA 4WW1B 4X5LA 2QLVB 1S78D 3WIHA 1IGMH 4D0BA 1EHLH 1G6RL 4ZSOA 3QNZA 3GK8H 4WEBL 4AEIH 4WI8A 1UH4A 5IEHB 4Q6YA 3F62A 1MCIA 4LASL 3OF6A 2EC8A 1FFQA 1TVBA 4WRLA 4EXPX 3SGEH 5FFLA 1SM3L 5FO7A 3QCUL 5JQ6L 2E9BA 4HZAA 5D2NE 1WWCA 5FYJU 1VFOA 1MI5E 4WUKH 2BVEA 4OUUB 2ATKA 4U1HB 4DAGL 5DLMH 5H2BB 4BKLB 5I17B 3W0WB 1KBGH 1T1YA 4E0RA 4JQIL 2J88L 2NR6D 1F90H 1D5ZB 4D0CB 1GPOH 4OV5B 5LWYH 1QFWI 3P77A 1T21B 3ZYOA 2XTJB 4PRBA 5T5NF 1UXSA 3QWQB 3OPZL 2WUBL 3VRJB 2VLRA 5J13C 2A0LD 4RWYL 3CX5K 3O45A 4KKCD 2Q6WB 1EMTL 1A3LH 4R90L 5F6IB 1XR9B 1NLDL 1V3LA 4N1CA 3EJYD 4HEME 2W9LA 4ODWA 2X4OA 3PL6C 4XMKH 4PFEA 4BK4A 2Y36H 4ZPTB 3L3DB 1BHGA 2IFGA 5DEGB 1WWWX 2FO4B 5DVKA 1KENL 2VLJA 3T4YB 2AK4E 4MJ4A 5HHVL 3PGFL 3SGJC 3RDTA 1NCBH 5K9KA 1K4CB 3UJJL 3VD9A 1K85A 4H8WH 4ERSH 3MUY1 2C26A 1DBJH 4MNQA 5CLWA 5DRWA 3RPIA 4D8PA 3EO1B 3ET9F 3TBSB 1QNZH 4JRXB 1AY1H 5GRWA 2YR3A 1JGEB 4ODTH 5KS9E 3MROA 2AS5M 2W0KA 4HKJA 5HVHC 3NCJL 4MAYA 4TUKL 4JVWA 1HEZB 3VMOA 3SDCA 3RZCD 3T0WA 1JUFB 1EJOH 3LKSA 3FZUC 5CJOH 4N8VB 4LVNC 4GW4B 1AGDA 5AYUH 4UT9H 4FP8H 4NNPL 4R4FH 1W0VB 5E2WH 2CJUL 4QHLA 4YBLC 3QPXL 5I8EB 2D7OA 5FF6B 4WV1B 1JHLL 3BZEA 4YNYA 4P57B 4F9LC 2VIRB 2IAMD 4M8QB 5D96C 1DQLL 4P4RB 3UCRA 4MDIB 2V2WA 4BUHA 4X6BA 5E8NA 5JOEA 4G6JL 4PTTB 1BVLB 4HIEB 1Q9LA 3GMMA 4ZFOB 1MJUH 4FFYH 3X12B 4OGYH 5EU6B 3GMRB 1X4YA 1LO4H 4PG9B 3F7YA 3AGVA 4J3TA 4Z7OF 4XH2B 2NXZC 2FYYA 5HGDB 2CO6B 1FL3B 4BZ1H 1HKLH 1JNNH 1RUPL 3MRDA 4RFOL 2X70B 5GPRA 1RZIB 5DTFA 1TTFA 4FTVD 1MPAL 2FJHB 1CGSH 3DUSA 1KUMA 4HS6B 3U79A 4LKXB 3H42L 1ORQA 2XI9A 1SMOA 2VDLL 3FAWA 3LEXA 5FM4A 2A9ML 4JZJA 3OR7B 5I8KL 3RAJL 1IZKA 2FEEI 2QHRL 3MJ7A 5LQBL 3GO1L 3K2MC 3TCLA 3OJ2C 1BZ7B 3ME0A 4UINH 2ZCLL 4U1GB 1D9KD 1GC1H 3NIGE 3S4SA 5EZJB 1DBML 2Z9TA 3EDEA 3TM6A 5DVLA 4MVBC 4X6EB 5IHZA 4XGZB 3OXRA 1FIEA 3W9DB 3RIAF 3EHBD 2IFFH 3VFVB 4M00A 4LPWA 4YFDB 1U36A 2XWTB 3C60C 1MEXH 1UWXH 3FQTA 4WI2A 5BVJA 2P46B 3MLWL 1T0NB 2XQBH 2R2HA 4UQ2B 3SE3A 7FABH 4UDUB 2EXWC 5KSAB 1NLBL 4FQLL 4HUUB 3KJ4B 3V6ZB 2LV4A 1E28B 5I1DB 3R06B 2AJUH 4IS6A 5IJVA 3FFCD 4X4XB 1OSPH 2I24N 4WO4C 3BYYA 2ZKHL 2YPLA 2DQCH 2A1WH 3MGAA 1BZ9B 1MFDL 3G08B 1BM3L 3CJJA 3JXAA 4Y4FB 1BWWA 5CZXC 3ULSA 3P9MB 1QTYT 4PJGA 2B8OT 3WLBB 2BNUA 2XYCA 1JZ5A 4KGJA 3O9WC 1QD0A 1HDMB 4JHAL 1NGYB 3MV8B 3QFJD 5F8QC 2QEJA 5IROA 2VITB 3DX8A 4Y1AA 3ARRA 4E41B 5DFWH 3LN4A 2QSCL 5KANG 1EVTC 3VGBA 5F7DA 1UB6A 4UV4L 3V0WL 4WFHD 2NMSA 4NKQB 4NUJB 3RWFB 3BGFC 3DURB 5FA3B 4Z78B 4JPWH 2XZCL 3NACL 5E03A 5FA4A 1JPSH 1C5DB 4J4PA 1RUKH 2XV6B 4X6CE 3S36H 3FCTB 1C5BL 4ZTOH 1FZJB 4Y19E 1U8KB 5JIHA 3B9DA 1RZ7L 4L8BB 15C8L 2EDOA 3GMQA 4MA7H 5B38G 1KGCE 3BYTA 3BDYL 4PLKC 4MWFB 3HG1E 5C0IA 5TE7H 5JA8B 5I1AA 1AC6A 2BCKA 3I75B 5BV7L 3BGMB 1VGKB 1XIWA 5B39A 1J1XH 2PO6A 2JB6B 2D0GA 1MIMH 5DHYA 5DHVA 4TUJB 3AMKA 3VWJC 4XXDA 1ADQL 2WWMD 1MIEL 1X4XA 3NBNA 4P49A 2V5RA 1ONQB 2HT2C 3QHTC 5E94A 4YC2C 5SWSA 1L7TL 2JJTC 1KEGL 4LLWB 3WO3B 3P4MA 4DCQA 3WSQL 4U1SA 5JA9A 2VDNL 5CFHA 3D2UA 3LSOB 1KC5L 4L29B 4UIKL 3L3IA 1P4LA 2PXYC 1XH3A 5T33L 3EKCA 2X7LB 4IIQB 1UJ3C 4BQ6A 4WHDA 2IANB 5I1IH 1EEYB 1NBVL 3T8XA 4KJPD 3QDGE 3UO1L 3VFPA 3QCVH 3RWEA 4EI5C 4ZXBB 5D7LB 4OB5L 4F3FB 1V5JA 3FRUB 1S7VB 1U91B 4LSSL 5TJWK 3F6IA 4YAQA 5EC1B 3QIUB 4JY4A 1IGFL 3QUML 2EDKA 5FUCE 4OFVA 3RVTD 4F2MB 2P8PA 3KDMA 1CD1B 3NCBB 4XVTL 5ESVB 2DB8A 1V3KA 4OCSL 3PWNA 1XCTB 4KTDL 1OGAE 5GGUA 2HG5A 2R4RH 4IDJL 5HI3D 4K3JL 4ETQA 2BXZA 2YD6A 4RQQB 3RWCA 5GHWH 4JZOA 5E56A 2EDNA 2FR4A 3BHBB 3VXRE 1INEL 2N56A 4JFDE 1A6UL 4LCIL 3W11C 1CDBA 3WL9A 2DQUH 5A2FA 4IRSD 4OGXH 3NIFE 4OD3H 5J57B 3VWKD 1ED3A 3I6GA 1OQXA 5IHBA 4HK3J 1PBYA 1G9MH 3MGTB 5DUBB 2R29L 3BQUA 25C8H 2CD0A 2NNAA 5GJSL 1RJYB 5JW3H 3QI9B 1M1SA 1S7TA 4HKXA 2B1AL 2ZG2A 3RBSA 5DR5H 4OLZL 1J8HD 4ONHA 1K5NB 4GAFB 4RGND 1E4KA 3D3VA 3R8BB 1F4YH 3MRKA 1KCVH 2EO9A 3ARBC 4PPTA 4U05A 3E8UL 3M1BA 4RAVB 3LDBB 3QXVA 5B3NA 4XP5L 1DANU 3KPLA 5MHSE 2PETA 2JKXA 4LRIA 1QSFD 2YD1A 4WTZG 3LKNB 1U6AL 4MA3B 1KCSL 1CD9B 1AD0B 2ENYA 5D8JL 2GFBB 1T3FA 5KSVA 4PJGF 4OFYD 1SBSH 1G6RA 1AO7E 3OAYK 1OTUC 3GHBL 2FSEA 1IJ9A 3BH9B 5TQ2H 1G7IA 1WSST 2ZUWA 5I8CB 4YWGH 1QRNA 4NQEA 5H35B 5GS0C 1O7VA 2VZUA 4KTYA 2ESVB 1KB5H 5E8EB 2ORBH 5F3HA 1YYLL 2OX5A 1QLFB 3IFLH 4LLVA 3BVNB 3RGVD 1F3DH 5TE6H 1QYGH 2WIIB 2DD8L 1O5DT 4GKZB 3H7BA 5F1IA 2VDKL 5TDOA 1KCRL 4IOSD 4WNQA 1FDLL 1E4XL 1CDYA 3CMGA 1CXFA 2R1XB 3AM8A 1KJ2L 4XHJC 3CFJA 4QRSA 3IDMB 1F3RB 1A6TB 2CDGB 4I3RL 5JTWA 4BSVA 4PJ9A 1FVDB 3K46A 4PB0H 3SQOH 2Z31C 4UTBH 1LDSA 4GSDL 2Z4QA 4S1RL 1D5MA 3WE6A 4P5MB 3THMH 3TVMA 5JORA 3O6FA 3DYPA 1FQ9C 5K33A 4HUWB 2OJZL 5ID1B 5C9JB 1Z5LA 5E99H 1UZ8A 2H32A 4M6NH 5DJCB 4Q6IC 1PGRB 3C09B 3TCXA 4FA8A 5IVXE 1ZTXH 1DL7H 2KPNA 3V9FA 2DQDH 3SKOB 4WEMB 2PTVA 2ZP0T 4FFZH 1R3KA 2ENSA 2EC9T 4OLVH 3CLEH 4Q0XL 3FRPA 1QHPA 4G9DB 4U31A 3ZL4L 4HS8L 4HGWB 1MHPL 3BO8B 4M7JL 1MNUH 5E9DE 3G6DH 5E2VL 4R2GC 3S6CA 2ZG3A 3V5HB 2XPGB 5SWQB 1JK8B 3GSQB 5DUMH 4LSRL 4O2CB 1G7HA 1KG0A 4KROC 4XVJH 5I71C 3QUKB 5DK2B 5AEAA 3HCVA 2VE6A 3BPOC 4MD0A 5F1NA 1CXEA 1MUJB 2OL3B 4KVNL 5HXMA 4Z5RB 1RZGB 2WMPA 4PJDB 5TFSL 1SY6H 4DW2L 3RTQC 2ICWA 3MLSH 3QUYB 1H8SA 4G6ML 3QZWG 1I75A 2VB5A 1PG7L 3VU2A 1HI6B 4NKMA 4TVPD 1NUDA 1HQRA 4RGMC 1PKQB 4JLRB 2R0WH 1TQBC 3VXNB 1YPZB 4KPHH 3MV9E 1A1OB 1T83A 5IBTH 4P2QE 5GGTA 4XP4H 4P23B 4JO3L 5F71A 4D3CL 3MJ6A 2HFFA 4NZRH 2E7CA 2P7TB 5CHNA 4ZS7H 4KI1A 5EORH 4G7VL 1J7VR 4K94L 1JRHI 1KB9J 3D9AL 2OTPA 2AEQL 3WFCH 4XCFL 4B5EA 4QHUB 1FH5L 1FNLA 3QJFB 4K23H 5MP6L 1CLOL 4BFIA 3UTSD 3RWHB 4LSQH 5I1JL 1CLZH 4WHYG 3CCHB 1EGJA 2I9TA 2NX5A 1QR4A 3HMWH 3DO7A 2MHAB 4WHTB 1YNLL 2BVYA 2XY2A 5ACMA 4OLUL 5C09E 1D6EB 1XGYL 1OY3B 2OCFD 2ZOKB 3IETB 2V9TA 4Y5YC 3H9SE 1EHAA 1CICD 5C0BB 2HRPL 5FM8A 3ULVD 4CU7A 5DURB 3BP7B 4WEBH 1W8NA 2F8OA 3IXTB 5CLTA 5I1CL 4PJBA 4LASH 4ZDHA 2R69L 4OQ1A 3U48A 5JOPE 2HN7B 1SM3H 2GCYB 3BP4B 5HDBE 5J1SC 3QCUH 1QFWL 2EYSA 5JQ6H 1N3NA 1S8DA 1T4KA 3QIWB 5ERWA 3IXAA 1KPRA 2W07A 3F12B 4CVXB 3S5LG 4DAGH 4L9LA 4NN7B 3UBXA 3EDJA 5DJ0B 4JQIH 2J88H 4P5KB 3MRJA 4XP9L 1T04A 3RJQB 2WBJC 5ESQA 1TENA 3ZTNL 4E42B 5JXED 5CSZA 1LDPH 5GRYA 3OPZH 2WUBH 1WCQA 4NZUL 4LCWD 4RWYH 3DROB 4FS0A 1EMTH 2GSIB 4R90H 4LIQL 4MCYB 4NO0D 3GSOA 1XF4A 3DV6B 1NLDH 4PJIA 1QO3B 3O4LE 5BXFB 3JTTA 5TF1L 3RZCA 2WLYA 5E7BA 5FYLE 1OP5H 4JO1L 3WUWA 4I48B 1JMXA 3U2SB 5HHOA 3L5JA 1NBYB 2I26N 4J1UB 2Z93B 1FZKA 1CXIA 1KENH 4BH7B 4JGMA 5FAAA 5IMOA 1IARB 4H0HB 1HWHB 5HHVH 4DGIL 3ILQD 3PGFH 1ITCA 4JFOA 2IAMA 2W59A 4TVPL 4X0KA 1IM9B 3UJJH 1T7VA 3L3GB 5I18L 3HKFA 5JR1L 1BIHA 3QEQD 4NNXA 1IGYB 3VGGA 1X7QB 2AXFA 4HJGA 4WI3A 1CDUA 1H5BA 5DJ2A 3BMVA 5D1XC 5D1ZB 3VRIA 2YUXA 3TJEL 5BS0B 4KDTA 3BI9X 4LLUA 3NCJH 3TT1L 1M6OA 2NY0B 4YHPB 4L3ED 1H0DA 3FQNA 3INUL 2DQHL 4FTVA 1U9KA 3DBXA 4NNPH 4X4YB 4HFWA 2CJUH 2GI7A 3QPXH 4ZAKC 2ZUQB 1JHLH 2OTWB 1W72B 1TZHB 2EO1A 3BZFB 1Y6MR 4LPCA 1D9KA 4NOBA 1MCWM 1DQLH 5DMIL 4H5SA 3K7UA 1KIPA 3UJTL 3DGGB 4G6JH 4PJ8C 5ETUB 1N5AB 1P2CA 4Q2ZA 1YQ2A 1ZHLB 4GRWH 1EV2E 3ZHKA 4U3HA 1QKZL 1M05A 3DX9B 4X9HA 4AEEA 3IFPA 1QBLL 4HZLA 5HTSA 2FEEL 3A6BL 3G6AA 3G5VA 2NY3C 2Y4SA 3FONA 3HR5B 3OKMA 2QV2A 3U4AA 5DMJB 4O4YL 2XACC 1BD2B 4RFOH 1U8PA 4P5TD 3N9GL 5IQ9B 1MPAH 3DOSA 2HVJB 1HILB 3O3BA 4Z18A 2A2QT 3UTQA 5EG6C 3H42H 1R5WB 1PY4A 5FOBB 1NC2D 3FFCA 2VDLH 3DXAB 2A9MH 5I8KH 4C56B 3RAJH 3CNKA 4QY8B 2OBGA 5EFIA 3GO1H 2ZCLH 4DGVL 3CLFL 4R0LB 1DBMH 1N6QL 2X4UA 1BOYA 4QHMA 3O2DH 4PJ5E 4WY7L 5F7EL 1BOGA 5GGSY 3I2CL 4OF3A 3G5XB 5IF0A 1KNOB 3LB6D 5DGRA 2EDLA 1BFTA 1QLEL 4NJAL 4IDLA 3MRMB 4IMKA 4QRUB 1QP1A 3HUJA 4FQQB 5HGHA 1XF3A 4U7SA 3HC4H 3KWWB 1P7QB 5KSBB 3REWA 3MLWH 4KK9D 2C4FU 3B9AA 1SMAA 1YN7B 4RIRB 5E1AA 2E7BA 3PWPE 4FQHB 1NLBH 4FQLH 3NCMA 1XMWA 1AFVH 1EEZA 2LTQC 3HZYB 1QPPA 2BNRB 4Y4KB 4U3CA 4ZO9A 5BW7A 4DK6A 2ZKHH 3SO3B 5IB3B 5DQDL 4EQ3A 4CADA 1MFDH 5BO1L 2NZ9C 5FM5O 1BM3H 1JZ4A 4XVUC 1NFDB 5C0AB 3P4LA 2BJML 4Z7UA 1L6ZA 4KZEL 2VLKE 4LHJB 4O9HL 4JHAH 1I7TA 2RGSA 5IK3A 4AEFA 3NZHL 3KLAA 4MJ6A 4MAUL 3SY0B 5C0CE 3V95A 3IB4A 1A1NB 1NGZB 2D0HA 2QSCH 4BZYA 1DANT 2VKWA 4ODUA 4UV4H 3V0WH 4GO6B 4ORZC 1VA9A 4OZHB 5HYQA 2VNCA 3DIFB 3SDXB 3RDTC 5JNYB 1DEEB 4Y8AA 2XZCH 3V5DB 3NACH 2FGWL 2X4RB 4K71B 2R4SL 4QCIB 1C5BH 1N64L 5DDHB 1IGIL 1TVDA 4L4VB 4P4KA 1RZ7H 15C8H 4Y5VB 1CGXA 3CVHL 5T3XE 3BDYH 3BP5A 3GI8L 5HHQA 1SEQL 1NMAL 2GTZA 3PWUB 2X10A 1KJ2A 1OQOA 5HYFA 2B4CL 4M61B 1H15A 4MAYC 3EUUA 3MBED 3SDCC 4TTDC 1XF2B 1Q9KA 1BECA 5KVDL 1RU9L 1ZE3C 2NZIA 4K9EL 1KPVB 1ADQH 3S5LB 1DBAL 1MIEH 3NIDF 1I1FB 1DCLA 2GJ6D 1UB5A 1H3WM 4Z7VB 3RUGE 1LP9A 3F65A 4AIOA 1L7TH 1L4IA 2B5IC 1U3JA 1KEGH 2WP3T 3QQ9C 4MB4A 3HE7D 3WSQH 4NQDD 3O4OB 1RZJC 1IGCL 1GGYA 2VDNH 4GXUN 1NGPL 5A43C 2Y07L 1KC5H 4PGEB 4UIKH 3C08L 3HAEA 4G9FA 3ZDXF 4PREA 3VFNA 4Q7DA 5K9OB 1PQZA 3VGAB 1QSED 1NFIA 5FV2A 3WKML 4JRYE 1NBVH 3ROLA 2AXHA 2CK2A 5EUOB 3QIBB 4Y16D 3UO1H 2HAZA 5D7JD 3NCEB 4YIQB 4OB5H 1AXSA 3S37L 1WISA 2DLEA 3K8LA 1JI2A 1X5GA 4IRSA 2NTSP 3OX8A 2D03L 4LSSH 4OAWB 4QTHB 1RI8A 1ZGLP 3IKCB 1IGFH 4HV8A 1JPFA 4JZJC 3HA0A 3QUMH 3MRRA 3ZE1E 1LK2B 2FCBA 1ZHNA 4XHQA 1P4BL 2XFXA 4JKWA 2CSPA 4XVTH 1Z3GL 4M5ZL 4NRYB 2EZ0D 5EUKA 4OCSH 4KTDH 3KJ6L 3EYFA 1IQDA 1LE9B 1RURL 3W9EB 5EBWB 4K3JH 3WLWD 5EOTB 1ZVSB 5CIPH 1NEZB 3MV7E 1NGWB 3PNWB 4UNTA 2PCPB 3KPQB 2MOVA 3T65A 5J7CC 4G8IA 3ARGC 1INEH 3VJ6A 3IF1B 1A6UH 4PP2A 4LCIH 4LQ1A 1QSFA 3C5JB 1AGFB 2YEZB 4APQB 1PKOA 4F57L 2B4CC 3QSKB 5AG9A 5DMKA 2IH1B 3DRTA 1S7XB 4OFYA 4UQ3A 4YE4L 5D2LE 2R29H 2GK0B 4V1DA 5GJSH 4M1DL 4HMDA 1FSKB 5F9WB 1WCBB 5FKPB 1UWEL 3QFDA 2D4DA 3BXNA 4JFXA 1LEKA 3QISA 1IM3B 2I07A 4OLZH 4AJ0A 3HUJF 1JWMA 4KXZH 1R3JB 4NO2B 5GS2D 5IROC 5IB4B 4RDQG 1CD0A 3E8UH 1P7KB 3W5MA 5D7IA 3WDHA 4XP5H 1YMMA 5E5MA 5T1LD 5IFAL 2DIAA 5I19L 5IFHL 3SE8L 1A2YB 4ZYKA 2KZ1B 1CFNB 1U6AH 2XKNA 5DD3H 2B1HH 2GSGB 1KCSH 5TF0A 1A7PL 3IRZA 5EOQL 2E7MA 3GSUB 3TFKC 3HZKB 4UUJB 5D8JH 4G6FD 3FQUB 3WNMA 3HS0A 4CVZA 1H3PL 5GSVB 3BEWA 3GHBH 3H9ZA 1O0VA 1SQ2N 1T0MB 3ARSA 2JK5B 5EPMB 3UC0L 5FDWA 1T1WA 5CJBA 3MR9A 3VFGL 3VXPA 4Y4HA 1XIWC 2PO6C 4KMTL 1JHKL 4K7FA 2X4NB 1YYLH 5J6GA 3BPLB 1ZMYA 3SDAA 1AXTL 1GL4B 4NM4L 1IAIL 5DJYA 4GKNA 2DD8H 4GG6A 1P9MA 4QYOB 5CILL 5HPMA 4M9OA 5D2NB 5I66B 1KCRH 3H3PL 1FDLH 1EAPB 1E4XH 1MI5B 2GTWA 1KJ2H 2CKBL 2DN7A 3MUJA 4RRPG 3T3ME 4YHZL 4I3RH 4DN4L 2IPKA 1FO0L 2BK8A 2H1PL 3PHQB 2NTFA 3TBVA 3G5ZA 2DWEB 4GSDH 4IRZL 4S1RH 3V6OE 1FVEA 3ES6B 4U6TA 2PW1A 3CSYB 4YX2L 4HWBA 1XGRB 4HUKB 3W0WD 1C12B 2WV3A 4X98B 3QUXD 4QXGL 3IFOB 2R1WA 1W0WB 3BZ4A 1TVHB 3U1SH 2XTJD 1MJJB 1IAKA 4F7MA 2ZOLB 3MLVL 43C9A 5MI0B 1IC7L 2AK4B 4Q0XH 3ZL4H 1OLLA 3HC3L 4HS8H 1YUHB 5C2BL 4JHBA 4M7JH 3QQ4B 5E2VH 1ITBB 1DJSA 4GLRH 4G8GD 4EDXA 4PJAB 3V0VA 1M7IB 3D25B 1FVCA 5IBUG 3D18A 2JTDA 4LOUC 4YEEA 5HDQL 4LSRH 4M7ZC 3BSZL 4WUUD 1A3QA 5KSUA 2VLLA 4RFEA 3WHXB 4LCCA 5KS9B 2FWOA 4KVNH 4PJHA 4U6XA 4JQXA 2CH8A 4XXCA 5TFSH 4DW2H 2P5WE 4KKLD 4Z7OE 4G6MH 5T1KB 5HGBB 3UTSA 4ELMB 1PG7H 3P0YL 2YA2A 4WGVB 4EUPH 2HP4A 2ZNXA 4OZFA 1JRHL 2PTTB 4JRXD 3BQUC 2ZUUA 5DFVC 3SN6N 1TZIB 2PNDA 2FRGP 2YD8A 4WFED 1QG3A 3TESA 4JO3H 3PWJA 1JN6A 4D3CH 5HHNA 1C1EL 5L6YL 1E4KC 4YPJA 3VD5A 4G7VH 3T77B 4K55A 4K94H 4JFQA 4LGRB 3V79C 5KVFL 3OKDA 1NDGA 3D9AH 5DRZA 1UEYA 2AEQH 4XCFH 1FH5H 4LRIC 4XBGA 3O3DA 5JXAL 4QF1A 3RVVD 2R23A 4MQ7B 5MP6H 1CLOH 1I7UB 3KLHC 5I1JH 1I1AC 4PGBA 1F6LL 4JJ5A 5C08B 2O5YL 4S1QL 1YC7A 1CFQB 3BUYA 1XZ0A 2VZSA 2BNQE 3QXWA 2GYSA 2C1OB 1J0JA 4OLUH 1HSAB 1XGYH 4ZSOE 5JXEA 1QUNA 4NQXA 4QOKA 3O11A 1R3LB 2EXYD 2H2SC 5TE4L 3GMPB 4M7LL 5IR1B 1N2RA 1AIFA 2HRPH 1EERB 4WU7B 3HZVB 4JM2F 3J7HA 4KRLB 3LRSB 3TPKA 3V4UL 5I1CH 4KC3B 2JJSA 2R69H 4PS4H 5JDSA 3P4NA 2O5XL 2P24B 1DQJB 4MNHA 3QHFL 3AM8C 3TV3L 4XPTL 4ZFZA 3TIEB 1QFWH 1Q9WA 3SKMB 1MVUB 5EO0B 4PJ9C 1K2DA 5CEZD 1FNEA 2C3XA 1TCRB 3CIQA 4X6FA 4JKPL 2BFVL 1YC8A 3PJSB 5ID0B 4PGCA 4X8XA 2G5BA 2VLRE 4V2CB 3TVMC 4XP9H 5HYJD 4QHKJ 3O6FC 4U2ZA 3ZTNH 3QEQA 2ADIB 2NCMA 5KSAD 4LPXA 4GG6F 4NZUH 2IBZY 4WW2A 4D9LH 3KXFB 5LBSH 1YN6B 3R4DA 4PJDF 5IW6B 3WFDL 3OL2A 1VACB 2BSRA 5JW4N 4ONOA 4PRDB 1WTGT 5HYIA 4Y4FD 5TF1H 2W65B 1V7ML 5GZOC 3HMXL 3O8XB 5I1LA 4JO1H 3KPOA 4KJQC 1NH6A 2VLJE 4OGAC 1OAQH 3UXFA 1YPZF 3L3HB 4NQSB 4Q9CA 3VFUB 2D7PA 3DO3A 5F9OL 4X6CB 5TGBB 4MJIA 5EB9A 4DGIH 4E41D 1R5VB 4R26L 4Y19B 1ORSB 4MNQE 4TVPH 3ULUC 1U58A 4NHUB 3DMMD 3LKQA 4NCDA 3GJFH 3TZVB 1WBZB 5I18H 5JR1H 2Y5TA 3KVQA 5E0QA 1AGEA 1D5XA 4DZBA 3RZWA 1YY8A 1EFXA 4KI5F 3LD8B 4UOW1 1GOGA 3C2AL 2NPLX 3TO4A 2HMID 1NGXB 3M17B 3TJEH 3X17A 2F54D 3UJIH 3BPNB 3UTOA 1JWSB 4JFED 3TT1H 2IALB 3RRQA 3LPFA 4R4BB 1ZVYA 3CH1A 3INUH 2DQHH 1FE8H 3HI5L 4CKVX 2VXTL 1T83C 3KPTA 2A73B 1NC2A 3V6FA 1CL7I 3WFHB 1FG2B 3MA7A 2D2OA 4KJWD 4F7PA 5EU3B 3BWAB 2YK1L 4XTRD 2W0PA 5H94B 5CJQL 4NKDA 5DMIH 3L9RA 5K9QI 2XWJB 3UJTH 3L7EA 4HX1A 3SPVA 3AU1A 4Q97A 4I4WB 4RBPK 4MS8D 2FBOJ 4NQTA 4QRRA 3QDGB 1QKZH 4YDLB 4M6OH 1QBLH 4LK4A 4NP4L 3A6BH 1Z6JT 2EEBA 1OWRM 3OB0K 3DX6B 4I0KA 1KFAH 4GAYB 2R8SL 2IAND 4O4YH 2CRYA 2P8MB 3A6CL 2RBLA 4EZMA 1SYSB 3N9GH 1J88A 1Q9OA 5ESAB 3V8OA 3MLTB 1G7MA 3PDOB 3PV6B 5IBUB 1RIHH 1CLYH 2EECA 4KUCF 3E2HB 5D7LD 4ZXBD 5ITFB 3U30B 3KAAA 3LKPB 4H1LG 2CIIB 3LQAC 1OGAB 5EDXA 4DGVH 3CLFH 4F7TB 4ELKB 3MCG1 3SKNA 3QIUD 4WY7H 5DT1L 5I2IA 5F7EH 1WF5A 2O61A 4LEOA 1IEAA 4NRXB 5KVGL 3VH8G 3EJYC 2E5EA 4P2RA 5FUOL 3H0TB 3I2CH 4J3UA 2VXSL 5MEND 3VXRB 4NM8L 4JFDB 4PP1D 5DYOB 4ZS6C 3CFCL 1QLEH 4NJAH 3CZFA 4O00A 3L1OL 4JN2B 3B9KD 4P2OD 4RAUA 5HD8D 3BRFA 5DGQA 1BFOA 2COQA 2HJFA 4L9LC 1A4KA 4KRMB 3HI1B 3Q1SL 1Z9OA 3M07A 3ALWA 5BQ7B 5CMAB 4LHQB 3FO1B 3RX5A 4WV1C 2YD9A 4UU9B 5DQDH 2B7DT 1QACA 4P2CG 5BO1H 1A47A 2BJMH 1KIQB 4OCXL 1G1YA 3GKZA 4MX7B 3RVXC 4Y1AE 1Y0LA 2HJKA 4KZEH 2AV7B 3FT4A 4BQCA 4O9HH 3ARVA 3MBEA 3QI9D 3C9NB 3NZHH 3GEWB 4MAUH 1I9RH 4PJCA 5IG7B 4QXTB 5EBLA 4HWZA 1CGVA 4BSWB 4U6VL 3IJHA 1LMKA 5ALBH 1AO7B 3G04A 3BKJL 3HE7A 1OARL 4PJ7A 2FGWH 4QTIL 5F88A 1BX2A 2R4SH 4WW2F 1T1XB 3WMSA 4PV8B 1ETZB 1IGIH 3T3PE 4FQXA 3DX7B 4MDJB 1CQYA 1GVIA 1JGVL 3CVHH 4U1GC 1T7YA 3VXQB 2H26A 2CIKB 1H5BC 1QSEA 2R0LL 3GI8H 2OZ4A 1SEQH 4MQXC 5D6CB 2NY4B 5DUPL 3GKWL 4KDTC 4NBXB 2B4CH 4XB8A 5E8PB 3T2QA 5D7JA 3RY6C 2DLFL 1OTSC 3BKYL 1U3HD 1ZA6A 1SJVA 5KVDH 1NKOA 5SV3A 5SWSE 4GS7C 4K9EH 1DBAH 4GQPH 4KHTL 1BGXL 4HH9A 2GKIA 3VRLE 1IGCH 3LN5B 4XT1C 2Y07H 5FO8B 1WQVT 3C08H 4DVRL 3LIZL 4D2NA 3WKMH 4NJ9L 1NCTA 3PL6B 3QWOA 2DIBA 1KIRB 4UV7L 5IVXB 5JLZB 4NRZA 1RULL 5INDB 2X4PB 3CFKA 4G8EA 1T22B 3S37H 5KSBF 3RA7L 1A8JH 4Y0GA 3WS3B 3LS4L 2VZTA 3QCTL 2D03H 5DRNA 3SQBA 3ZE0F 3AROA 2GAZB 1FCCA 5E9DB 3W39A 4ZUTB 3C5ZD 1A1MA 4U6YB 1NJ9A 5FYJD 1P4BH 2C3WA 3V4PL 1Z3GH 4M5ZH 5ABDE 3P73B 1NFDF 4S11A 2BOCA 5ICYA 1LEIB 1AGCA 1U8LA 3KJ6H 3EAKA 5B3JF 1RURH 2YD2A 2DDQL 2WINA 2WZPD 1ND0B 2CLRB 5JZ7C 1H8NA 4YLQT 5HVHB 1T5XA 4IMKC 2UUDK 1S7SA 3UTTD 3IAPA 1TPXC 4JZNA 1ZT1A 3L95A 4LVNB 5T1LA 4XZUB 4EBQL 3CXHJ 1DLHB 1EX0A 2NY6C 4YBLB 4OZHF 4LLMA 2R9HD 1CF8L 3P9LB 4F57H 1I85A 2V7HB 2XKUA 3MV9B 4P2QB 1DEDA 1AC0A 3DV4A 4JGJA 5D96B 5BW7C 4UI2A 4YE4H 5TQ0L 1FJ1B 4KKAD 1LO5A 4M1DH 3TBTA 3JBG7 1QFWM 1UWEH 1AHWA 3D3VE 5C3TA 2LQRA 4ZG1A 5JQHC 4X7DC 1AD9B 1UACL 3TN0D 4IIQC 2AJXL 3OKEB 3TA3A 2Z8SA 2NXZB 5TDNA 5FECB 1WBXB 5EIVA 3MC0A 3OKKB 2M8XA 1R5IA 3FOMB 3MRGA 4AMKL 5IFAH 5I19H 5IFHH 1NMCB 3SE8H 1J18A 1UM4L 2CR3A 1AE6L 1MHCB 4Z7VF 3VD3A 4A6YB 3MRIB 1A7PH 3LKOB 4H1LB 5EOQH 3U0TB 1NC4B 3KYNB 1F2QA 5C09B 3FQWB 1H3PH 2A6KB 1QRNE 4NQEE 4P4KC 2X4QB 3VH8B 2V17L 3QH3B 3O6LL 4PJEA 3UC0H 3JUYA 1GAFL 2EDQA 4K8RC 4UIMA 3VFGH 1NGQL 3ARPA 4KMTH 4PJCF 1JHKH 5EUOF 3V5KB 5I17A 3W0WA 3C60B 2PUQT 4RFNC 1JFQL 3QUXA 1OAUL 1D5ZA 4NCC2 1EBAA 2J4WL 4NM4H 2NW3A 1IAIH 4OV5A 2P1YA 2CLZA 1K8IA 3QDAA 1QFPA 2EDXA 2IQAB 3AS3A 5CILH 4ZUWA 3H3PH 5C0BD 2Q8AL 4G8FA 5DJ6B 1JP5A 1ZT7B 1FRGL 2CKBH 2DM4A 3UYOD 5JHDD 1XR9A 3GMOB 4YHZH 4DN4H 3EGSA 1FO0H 5IHUL 2LVCA 2H1PH 2V2XB 4G8GA 5IEKA 4IRZH 3QIWD 2FO4A 3O9WB 3FB7A 3KPNA 4WUUA 3G5YB 3EW3B 3QUZD 2G75A 4YX2H 1NAMA 5BCAA 1BJ8A 4ZUVB 5IB2B 1K3ZA 1HSBA 3O4LB 1YECL 4QXGH 1FC1A 5DK0B 5CWSA 3X11B 2JF1A 3MRHB 3GSVB 5EA0L 1U2HA 3I85A 4GKSA 1U8MB 5FYKL 4KZDL 3KHQA 1N5YL 1MAMH 3BGFB 1U3ZA 1UFUA 5CZKA 4PG2A 1J0HA 1M7DB 1ZANL 4HHAB 4L8SA 3RL1B 1JF1B 1IC7H 1JGEA 2X4TA 3MNZB 3HC3H 1OVZA 5CCKH 1QEWB 5B21A 4FOMA 5C2BH 3ULUE 2BC4B 1KJVA 3O3AB 5C0FA 3OGCB 1SEBA 1AQDA 4RGNC 2OL3L 4KDWA 3HPLA 3ZT5A 1HN1A 2A74B 2QQLL 5HDQH 3BSZH 3CFDA 3I02B 1IKNA 3GMNB 5FB8B 2ARJB 3CVIL 2ZWLT 5M94B 3VWJB 5D9SB 1L7IL 1IM9D 4O51B 1X3DA 4H88L 4K07A 4L1DA 4LLDA 4S10A 5ILTL 2FECI 2XQYK 3ORJA 4WWKB 5GS2H 3KPMB 3IGAB 5EBMA 2C4XA 3WXVL 3U7WH 3QNXB 1JRHH 5JPNA 4JDVB 5IM7A 2PXYB 1VADA 4RWHA 2QTEA 5HGDA 5MEPA 2IBGA 1UJ3B 2NY0D 3ECBA 4LSPL 1KN2L 3DETD 3IJYA 3E6HA 1PG7X 3DVGA 3T08A 1C1EH 5L6YH 4N1HB 5C3LD 3Q0HA 3ZHLA 2W9DL 3DVNA 2FO1A 4PJFA 4EI5B 3MXVL 2ED9A 5ISZA 3OR7A 4OZ4A 5KVFH 3FO2A 3MRQB 2J3SA 5F7FA 2VQUA 1A9EB 1OTTC 4JM2C 4C83B 1DP0A 5ITBL 1K8DB 3C09C 5TDPA 5J0BA 3ARQA 2HKFL 2QKIA 1BVZA 2HTLD 4QRQA 3A67L 4N9GB 2O5YH 4S1QH 4TNWF 4CL7A 2DYPB 1G0XA 4PRHD 3H9HB 3GSXA 4JPIA 3C5SB 5HYJA 3IDUA 1P5UA 4Y4HC 4AQ1B 1EDQA 3LN9A 4PJ5B 5AAWA 3F5WA 2L7JA 1HQ4B 1I7ZB 5TE4H 3OGOE 4M7LH 4EI6A 4PJBE 2PYFB 3SDAC 5I1DA 2DQIL 2W9EL 3MRNB 5I1GL 3DXAD 4HG4J 4C56D 4TPRL 5T5NG 2V2TA 2XG5A 5D1QA 1P9MC 3JV6B 3V4UH 2W0LA 4LHUB 4XC1H 2O5XH 3P9MA 1S5HA 3TV3H 4XPTH 1T1ZA 1IGJB 3S96A 1XR8B 3PWPB 2ZSVA 3CPLB 3VXUD 3GNML 1JNHA 3IVKA 1F5WA 3IYLW 1CFSA 4Z7WE 4EXKA 4PJEF 2VITA 2E7LA 4JKPH 2BFVH 1U41A 3DMMA 4K7PX 3MO1B 4X8JA 4M02A 5H37G 1DE4A 2DTSA 3Q5OA 1S9WA 1QVOA 2VLKB 2V7NB 4PJIE 1P69B 2W60B 4LAQL 3U4BH 1KLGB 2BNRD 5ENWA 4S0SD 3WFDH 4NC2B 5C0CB 2HWZL 4KI5C 2F54A 1YYML 2FEDC 3BAEL 5HHOE 5A40E 2UZXB 4JFEA 1CTNA 1ERNA 4J3WA 4GKOA 4BFBD 3GZKA 1V7MH 3HMXH 3MJ8A 1F11A 2VMFA 3PWVA 3RHWK 3LQAH 3ARUA 3MCKA 4M5YL 1K4DB 3NIDE 2VQ1B 3F7RA 1EK3A 5IESL 5C92A 5F9OH 2QSQA 1HXYB 4EN3D 1RUQL 2BHZA 2ZCKL 4TUJA 3U6RA 4R26H 3ZHDA 4ODSH 3HRZB 2BHUA 2O5ZH 4Y5XA 5DMGC 4P3WA 4GUPB 1CG9B 1T5WB 1SJEA 3I6LE 5EZIH 5J06A 4LCCC 1MCLA 1N26A 5MEQB 5I74C 1DBBL 2BVOB 2FL5A 1TXKA 3C2AH 3EDFA 5DRXB 3TJHC 1CL7L 2C3VB 2EDJA 4YO0B 1UWXK 4JDZB 1LILA 3B3IA 2NXYC 4YBQD 4FTVE 4F37K 3R8QA 4I5BA 1RK1A 1VKXA 5EC2B 1RJZA 1JJUA 3D69B 1Z0NA 4TSCL 1EEYA 1W72L 2NLJA 1LE5B 3HI5H 2VXTH 5E6ID 4F8QA 3LOWA 5CGMA 4P46A 4MD5A 1J1PL 4ZXBA 5D7LA 2LAGB 3NIGF 4EIZC 2XN9D 4PRID 1FZMA 1MJ8L 2HYMA 3FRUA 5E95B 3RPKA 1HHHA 1ES0A 5CJQH 3WIFA 1CE6A 1Z0MA 3RL2B 3GBLA 4X6DA 3QA3B 4JRYB 1R3HA 2Y1VA 5D70L 1K6QL 5I76B 3L6FB 4Q6IB 3MRFB 3VXTA 5BRZB 4F2MA 3IJSA 5MENA 2C7UA 2CLVB 5DO2C 4FABL 3X14B 4NP4H 2GY7B 4R3SA 1BAFL 2IMNA 1FNFA 3B9KA 4P2OA 2R8SH 3E3QC 3A6CH 3FFCE 1IL1B 5IP4A 1PD6A 4PRAB 4RQQA 1F4AA 4M6ML 3ZKNC 2IADA 4R2GB 2OQJA 3QIBD 4JY6A 2DLHA 5GRUL 3T1FA 4NT6A 4KROB 4OIIL 3RJDA 4XPBL 3RY4A 3D5OF 4PY8J 4F9PA 2NY1C 4ZTPH 1ZT4A 5DJZA 3DVIA 2DM7A 5DT1H 1HYRC 1PJ9A 1NDMB 3HUJE 3U36B 3MLZL 5KVGH 3DHJA 3RTQB 3SE9L 2VXSH 2JJSC 3WDIA 1ZGLM 3EJZD 4NM8H 5D1ZC 4WFHE 3CFCH 3RI5F 5C0EB 1Y18A 4RGMB 4KU1A 1TQBB 5LJYH 3B6SB 3BIBX 1BVKB 4KTEL 3BRDA 3F8UB 2A9NH 1J05B 1NUGA 1X44A 2I9LB 4MCZB 1IC5L 4X6CF 5D2LB 1IAIM 3Q1SH 3FO9A 5DJDB 2I60L 5B8CA 1ZHKA 3TP4A 5I1KL 2I27N 5GZNC 5IB1A 4Z7UE 2DLIA 1UQSA 3WUZA 4MHHI 1D5BA 4WW2C 4D9RD 4P3DB 4OCXH 1IFHL 2YSSA 3T0ED 4QT5B 1PG7W 1S7WA 2H9GB 1N59A 3OSKA 1FYHB 5DJ8B 1F97A 1HHIA 4OV6F 3BH9A 4PY8I 3QULB 2PYED 4U1IA 1U3HA 3LRHA 1VGEL 4G43B 2CR6A 3QQ3B 4N5UA 3CAFA 4QRPD 1A7RL 4ZPVA 4BQ9A 3Q48A 4U6VH 2ZUXA 3RWJA 4BELD 2KL6A 4LEXL 3BVNA 5LAXB 3NMEA 3BKJH 3LZFH 3ELAT 3KPSB 4H26B 1OARH 4Y5YB 4QTIH 5DSCA 3FT3A 3ARFD 4HS3B 5GISL 2V5TA 4FG6D 1JPGB 3EOYG 2WIMA 5JO5B 4JY5L 4JQVA 3IDMA 1JGVH 1E6JL 2L4OA 3FQRB 1A6TA 3RKDD 5GS1A 4YDJA 5ICZA 1OB1A 1YJDC 2R0LH 3TO4C 3UZVB 5LVEA 1G9NC 5DUPH 2HLFC 8CGTA 1S3KL 3GKWH 2C9AA 4LKCA 1B9ZA 4OT1L 2DLFH 3BKYH 2DLGA 3VD7A 2E3VA 1HKFA 1A6WL 1LP9E 2ICCA 3LS5L 4XWOD 1AR1C 5CBAB 5HY9B 4KHTH 4ZOBA 5C8JA 1BGXH 5JPMA 3HZMA 1ZAGA 4PD4K 4OZGE 1T80A 3UZEA 2WBJB 1CU4L 3C5ZA 1T66C 1FFPB 4G9FE 4LDOB 1GSMA 4BZ2L 4Y4KC 4ZO6A 4LVEA 3V7AG 1MI5D 4DVRH 3LIZH 3SO3C 4JFPA 4W6XB 2EE9A 4AIZB 3T0DA 1TNMA 1WIUA 3CZJA 3LB6C 2GJZB 3CDFA 5B38A 4NJ9H 5DVNA 1ZS8A 2FZ3A 4UV7H 1RULH 3UTTA 3V5HA 3NIFF 5SWQA 3U0WL 3RA7H 4W4OA 3CSGA 5JMRA 1EUUA 3BP6B 4J12A 1VFBA 3QCTH 4LARL 1MUJA 3WS6A 2OL3A 4HIHA 5HYSG 2XZQL 2UYLA 4X4MA 4PLJC 1NEUA 1VEMA 1CXHA 5HDOA 3VCLB 4RGNE 2IBZX 1HI6A 3V4PH 1RJLB 4GT7A 2CMRL 4N8PA 3BT2L 3CC5A 3VXNA 4XCCL 3SHSA 1JF5A 2DDQH 2AK4D 4CMMA 3TN0A 4R7DB 1A1OA 1FP5A 3NTCL 1QSFE 2B2XH 2P5WB 4ZFGL 4QRTB 2DQFB 3I3BA 5FKAB 2R1YB 4EBQH 1IKFL 1OP3K 1FZOA 1DDHA 1ZLVH 2ARJQ 1DLFL 1D5IL 4ZAKB 1CF8H 2X1QA 1FFOA 4V1DE 4YHYB 3NFNB 5J4MA 4YHNB 4S2SA 2SEBA 1A6AA 5TQ0H 4N0FA 3QJFA 5CEYA 5T1KD 4U1MA 3QDMA 4PJ8B 1KPUB 3WDJA 3WNPA 1XCQB 2BVQB 1G7LB 4TNVK 4GAJL 1UACH 1XGUB 4N0UA 1RIVH 4RNRB 3UDWC 5D7IE 4W4NA 5IFJA 2O93L 1YMME 2AJXH 3NA9L 2NY3B 3QXUA 4S1SL 3VGAC 4HIIB 2ADGB 3SGDI 4DN3H 1V3MA 4IMLB 5CD3A 1I1YB 1BLNA 3RY5A 1A21A 4OCRL 3W81A 2ERJC 5C0BA 1UM4H 3L7FA 2ITCB 4R4NC 1AE6H 1HCVA 3BP7A 2F53A 2C1PB 5JHDA 4UBDC 2BNQB 3STLA 2P45B 4D0BB 35C8L 2W0FA 4FQXC 4ZSOB 1PZ5A 3QNZB 2HTKC 3MRLB 2V17H 5DWUL 4TULL 2QQNL 3O6LH 4IOFD 1FAIL 5C08D 1DUZA 5GGVL 2P5EA 1GAFH 1TVBB 4OQTA 4LLQA 1NGQH 3QUZA 3UAJD 1KTKE 5FO7B 3VG9C 3H3BC 4GG6E 1ZV5A 3GSNH 5DJ0A 5KVEL 1JFQH 5DQ9B 1OAUH 4P5KA 3VDBA 1U2CA 2J4WH 4KH2A 2K9UA 5DVOA 2ATKB 3HE6D 4POZC 1A4JA 5AYUL 2Q8AH 2LTQB 4JCLA 2DMBA 1FRGH 4LIQE 3CU1A 4WTZA 4APQC 4PRBB 1UXSB 3NFPA 4ISVA 1ZK9A 3O3EA 2VLRB 2EZ0C 1KACB 1CZ8L 3P40A 5IHUH 3O45B 1SJXA 2K3TA 4DVBA 3QXDA 1NBYA 4ZMAT 4G6AC 4ODWB 5INCB 2HT4D 3QEHA 1SVCP 5IHLB 4WU5A 3BX7C 1YECH 1OCWL 1AJ7L 2AQ3A 4R8WL 2JB5L 5C71A 4WI6A 3ZDZE 1KTLB 5EA0H 5IGXL 2VLJB 5FYKH 2ZUVA 4KZDH 4X7TB 3FHQA 1N5YH 1HXMA 3RDTB 2M2DA 3KXFD 2WBWB 1ZANH 5K9KB 3LV3A 4MD4A 4XNZB 4EEEA 5JDJA 2DBLL 3STZA 2V6HA 4MNQB 5DRWB 2R2BA 2X05A 3RPIB 5KTEL 4N90E 2VO5A 4D8PB 3DYMA 3MRPA 3O8XD 4ODHL 1B88A 2OL3H 4HF5L 2NY2D 3MROB 2MNUA 3EOTL 2FECL 4YHLL 5IQ7L 4HKJB 4PJHE 2QQLH 4MAYB 4S1DC 3SDCB 2IFFL 3LKSB 3CVIH 3N06B 4OLXH 5F7KC 3UTSE 1AGDB 3DPBA 3VW3L 5C86A 4IEFB 3TZVD 3B2VL 4QHLB 2YD7A 4H88H 5ETUA 5FHAH 5ILTH 3BZEB 1JF6A 3NPSC 4YNYB 4AQOA 5DA0B 5D2NC 3WXVH 4LCYB 1QLRA 2V2WB 2RFXA 5E8NB 4JHZA 5J89A 5T1MA 4NKIL 1LNUA 4OZIA 4PRHA 1AHWC 3HR5A 5CP3H 2H41A 3GMMB 1AKJD 4LSPH 3NCYS 1MCKA 2WLZA 3ULVE 4H25A 3F7YB 2EE2A 2GIYA 3RVWC 3DI3B 3TA3C 2W9DH 1HILA 2FYYB 1FORL 3DXAA 1MFEL 2MKWA 3MRDB 5C0DA 2OSLA 5DTFB 3TIDA 5HDBF 1OP5K 1J9CT 1WTLA 1DBKL 3ILPA 3DUSB 1S9KC 1ORQB 5ITBH 2JJWA 3E3QE 5HYSB 3LEXB 4JZJB 2HKFH 5LG1A 3VXUA 3TCLB 3QZWA 3QPQC 2VC2L 3A67H 3QDGD 5IMMA 4M7KL 2N7BA 1S9XA 2D7MA 3RNKA 4DZ8A 3TNNA 1IT9L 4EVNB 5ACZA 3GFUA 5MI0C 2ZPKL 4QOKE 5IHZB 4PJXA 1MHHA 4CAGA 1RZ8B 1NKRA 1ZHBA 4WWID 4XMLL 1QHOA 4FQHA 4J6RL 4TRPH 3QUXC 2LU7A 3R0NA 2UVEA 2DQIH 3HZYA 5I1GH 5BVJB 3JWOL 2R2HB 4LCUA 4X7EC 4TPRH 4N0YL 1OGAD 3P4OB 2YUZA 1RV6X 2AXGA 1LO0L 4IS6B 5IJVB 2X1OA 4Y2DD 2YPLB 1CTOA 5E6YA 1KCUL 5LCVL 2JIXD 3ULSB 3VXRD 2FJFA 2XKSA 1JTTA 4PJGB 4JFDD 4EN3A 4ENEC 1C16A 4H0GA 3QEQE 3BE1L 2BOBA 5DZNA 3GM8A 3KG5A 5KN5A 3PQYB 1XT5A 4HQQL 4R9HA 1S7QB 5GIRB 2DKUA 5EIQA 5B22A 4PYHA 5DD6A 3VG0L 3OKOA 5D93C 3DIFA 3SDXA 4HGKC 3LN4B 4LAQH 4UNUA 4KGLA 5D5MA 5A3ID 4W6WB 2YN3A 5F7DB 2XA8L 2HWZH 5J1AA 1YYMH 3BAEH 1J12A 1CDJA 3IFNL 4PG2C 2WWKO 4L8SC 5L2KD 5FA4B 4P9HL 4ZO7A 4YDVA 2J8OA 3QAZC 5CSGA 2LE9A 5D7SL 3PWUA 4MJIE 5E6IA 3CH8A 3JV4B 1JYNA 4M5YH 5IESH 5MHSD 3BJLA 1IC4L 2Q87A 4X9IA 3T2OA 3MGOA 1RUQH 2XN9A 2ZCKH 4PRIA 2FHCA 4Z9KB 5C0IB 3H6JA 2BCKB 1XIWB 5B39B 2PO6B 2EKSA 1P4IL 2A38A 1I1FA 2AK1L 5DHYB 5DHVB 4NGHL 2FD6L 4CU8A 3QQNA 4JCMA 1DBBH 4XXDB 1MFCL 1CL7H 1HYSC 4YHML 5E94B 5KG9A 5FV1L 5SWSB 3OMZA 4YUEL 1CIUA 3ESUF 3P4MB 4RMWA 4DCQB 1NANI 1BQLL 4TSCH 5IMKA 5HI5C 1W72H 4DKAA 3L3IB 1P4LB 4N0RA 5F1KC 2VZOA 3MUGB 3GBNL 1J1PH 3ZE0E 1MAKA 3HC0A 4OD2A 1KCKA 1BF8A 3QYCA 3T8XB 4XCNA 5JOFA 2X1WL 3NAAL 4QRRE 3VFPB 2FHFA 3RWEB 8FABB 2CRMA 5T3ZE 4XX1E 5D70H 1K6QH 4LU5L 4Q74A 4NN5C 2OI9C 2ZJSL 5A2KH 4N1EA 4DTGL 1UH3A 4YAQB 4JY4B 4FABH 1WZKA 4LL9A 1X5AA 1UKQA 1BAFH 1HOCB 4NCC1 4KRNA 1W0YT 1WWAX 2P8PB 2EIDA 3KDMB 3B5HA 2P44B 1TIUA 4M6MH 3PL6D 3PWNB 4HBQA 3MXWL 5GGVY 2HG5B 5GRUH 1NCAL 3BD4A 2C3GA 3IF1A 4MJ2A 4ETQB 3CK0L 2CDEB 4M7ZB 3RWCB 3OHXA 4OIIH 5LKNA 4P2RE 2FR4B 4LLYA 3T0EA 5E24E 5E9DD 3WL9B 2YD3A 4YZFF 5D1QC 3MLZH 4DKDC 5AYQA 3Q2CA 3SE9H 4I9WD 1PZUB 5I9QB 1ED3B 1NCUA 1QBBA 4MJ5A 2PYEA 3IKKA 5AZ2L 4IOIA 4WIQA 1IAMA 5F7NC 4QRPA 1G7QA 3BQUB 5LGHL 5LGKA 1R3JA 1UADC 1S7TB 4HKXB 5IB4A 4DOHE 1QSVA 1ACZA 3M8OL 5F1OB 1IC5H 4LNRA 2E7LC 3MRCA 1F4WL 3DMMC 2I60H 2AV1B 2VSCA 4ONHB 3ARFA 2APTA 3D3VB 5I1KH 1OP9A 3MRKB 4PR5A 3N1PC 5FCSH 3K1DA 3M1BB 1E27A 3FQXA 3GSUA 3KPLB 3MV9D 4WHYH 4UUJA 3V6OA 1IFHH 1NUFA 1U8OB 1X5HA 5GSVA 4PJCE 1MCJA 2I5YL 1V3JA 5IBLD 1RUAL 1VGEH 5EIIA 2VYRE 1FYTD 3W82A 3JWDL 3RUGF 4HMEA 4PJ7E 2FSEB 1G7IB 2J6EL 2NXZD 1M4KA 5ADOL 4GQ9H 4LEXH 4MNGA 1QRNB 4NQEB 2W91A 5FUCC 1B0RB 5GISH 5F3HB 4HMCA 1F6AB 4KRPD 1JI1A 1QSEE 4NN6C 5I66A 4TUOA 4JY5H 4LLVB 5EZLA 1UVQA 1YMHA 1E6JH 5GXBB 1NC4D 1EO7A 3H7BB 5F1IB 5IOPA 5TDOB 5C09D 4HWEL 2ID5A 3VFMA 1SY6L 2Z0BA 3CFJB 4QRSB 3WIIL 4MVBD 4LSDA 4OT1H 4X5WA 3VGDA 4HW6A 1A6WH 5DMYA 4BSVB 4PJ9B 2DL2A 3LS5H 3PHSA 1UGNA 4P46C 3ZE1F 4KPHL 2Z4QB 4X98A 1D5MB 3WE6B 1DSFL 4MXWL 3TVMB 5JORB 3LPWA 3O6FB 1CU4H 1PYWA 1PX4A 1MJJA 4R6UA 1XGPB 4L4TA 1B6DA 4U1JA 4BZ2H 1Z5LB 1MHEA 4NO3A 4HDIA 5EORL 1UZ8B 2VN7A 1DUYB 4GW5A 2H32B 1DQQA 1YEIL 2QJDA 1LO2L 1U8HA 5M7QA 4WO4D 5CKGA 5TPWL 2EDHA 1A6ZA 4RMRA 1I8MA 1GIGL 3QQ4A 4M6AA 5CZXD 4J2XA 5CBEA 1R3KB 4M1CC 3B9KC 4TQEL 5EO9A 1WUNT 3O9WD 1A0QH 3U0WH 5IVNA 2Y25A 4O2EA 2ZSWA 4GBXA 2AKRA 4LARH 5D2LF 3LY6A 2YD4A 1CE1L 4KK6C 1G7HB 4A2LA 2VAJA 3HCVB 4GW1A 4F9PC 4MD0B 4HCRL 5F1NB 1OOAA 1QBAA 3MA9L 3PWLA 1MF2H 4NBYB 2CMRH 1RHHA 3BT2H 3OAUL 4XCCH 2ICWB 4WEUD 4I18A 2LAAA 1ZLUH 5DHXB 4L3CA 4M1GL 2FIRT 5CP7A 4NKMB 4XI5C 1HQRB 2NY4C 1X9QA 3MJ9H 3NTCH 4PLKD 1ZA3A 4UDTA 2H3NB 4KMQA 5K9JL 4ZFGH 5F7LB 2E6PA 4JRWA 4HULB 2EDFA 3I9GL 3S8WA 2BY3A 1IKFH 1I3GL 4MXQD 1A5FL 4WFGD 3HN3A 2HFFB 1DLFH 1D5IH 1T2QL 5CHNB 3VWJD 2R56L 2B20A 4U0RB 5FYKU 5HHMB 1MLBA 2HT2D 1X6LA 1I7UA 3GMLA 3TGXA 1LDPL 4GAJH 4PLOB 3QO0A 2IQ9L 4U0QB 1FPTL 4DUVA 2E9WA 3ARDA 1CFQA 4XC3L 1S9YA 3VA2C 4BFIB 4WDIA 3NA9H 3T4AA 2EIZA 4S1SH 1G7JA 2OJEA 3HPJA 2I9TB 2NX5B 1K9TA 3DO7B 4A6YL 3BDBA 1JZ3A 1UA6L 5KOVC 1GOFA 2EC9U 3KPRD 3HE6A 3FMGL 4OCRH 3T3MF 5BVPL 4EI5D 2KH2B 3TH4T 3HZVA 3UPRA 2QHLA 1U92A 2IF7A 2N7AA 3WEXA 2LFGA 3QEUA 4PJEE 3ZSSA 35C8H 4WI4A 1DQJA 4KV5E 4JQVC 4BK5A 3FB8A 3O2WL 3QHZL 4CJ1A 3OKNA 5DWUH 5GS1C 4TULH 3W0WE 2QQNH 4PJBB 1RZFL 1FAIH 1DVFA 5GGVH 4ZDHB 1P53A 2P4AB 3OJVC 2X2YA 2EYSB 1N3NB 5KVEH 1FL6A 1S8DB 1T4KB 5ID0A 1ZKAA 5ERWB 2FB4L 3IXAB 1KPRB 1E4WL 4PJ5D 2ADIA 3BISA 4L9LB 3UBXB 2GITA 3C6LC 2X5PA 3KXFA 3MRJB 5IV2A 1T20A 1T04B 5I73C 2PTUA 4LVHC 5ESQB 2R0ZL 4G8GE 4ONGL 1NSNL 4BH8A 3HLAA 2Q1EA 2Z91A 2VABB 4ZFFA 4LHUD 3IDIA 2ITDA 4WUUE 1CZ8H 4CW1A 3BPCA 3HAEG 3EFDL 3AB0C 1V8HA 32C2B 1JNLL 3PWPD 2XNAA 3GSOB 4RZCB 4PJIB 5C6WH 5D4QA 4V2BA 3TWCL 5J1TC 3JTTB 4ZUUA 1CIDA 3NGBC 4IBLT 2CK0L 4HUVA 1RIUL 5L9DL 3EOAA 3WUWB 3C8HA 4OKVA 3MSPA 5HHOB 1OCWH 1AJ7H 4R8WH 4QHNA 4X9BA 2JB5H 1FZKB 1FLTX 4OLEA 1CGYA 2BY0A 5IGXH 5IMOB 3ARBD 3WS6C 4WFEE 4JFOB 1IBGL 2IAMB 2L7UA 4X0KB 1NMCC 1SBBA 5SWZA 3SCMD 5IKCA 1VEOA 3PUCA 1MELA 2DBLH 4NNXB 2NW2A 2QADD 2AXFB 2DF3A 4HJGB 3MYJB 5KTEH 4RRPA 4X99B 1AKJA 1V05A 1H5BB 5DJ2B 1URLA 4BSJA 4ODHH 3TH3T 3O2DL 4XNUH 4QGTA 3RHWF 2APWA 3VRIB 4HF5H 1TJGL 3TN0C 1KT2A 3EOTH 4YHLH 1YY9C 5IQ7H 3FN3A 2N1KA 1CGUA 2WQ8A 1JE6A 5C6TL 1M6OB 3UZQA 4PRPA 1H0DB 3EYVA 2E27L 4G6KL 5K59E 4NZJA 3FQNB 4X9FA 4FTVB 4GS7B 3BWAA 5GS0D 3DBXB 3VW3H 3WN5C 3HC4L 5SX5H 4HFWB 2YMXL 3B2VH 5IW3A 4B0MM 2CXGA 1PY9A 2HVKA 1UJTA 4FQJL 1S9VA 1D9KB 2X44D 1AFVL 1G1CA 5DJAA 5KBNC 1KIPB 3O81A 3KS0J 4YHIA 4N8CL 4HPYH 4NKIH 1P1ZA 4NDMA 4F37F 4NZDA 1FNSH 1P2CB 4JPKL 4XHJD 4U3XA 4PJFE 1M05B 1CR9L 3IFPB 5ISZE 4HZLB 1U93A 5ELIA 2CRIA 3G5VB 3G6AB 3L5WA 3FONB 2Z31D 3CUPA 3PV6A 3OKMB 1FORH 1I8KB 1MFEH 1GGIL 4DQOH 4NBZB 1U8PB 1AP2B 2GT9B 3WO4C 2CIIA 1JYXA 1QRKA 1VERA 1DBKH 3O3BB 1OW0A 2VERN 5CEZE 3FFCB 1YEDA 4Y2DA 1UXWA 3CDGB 5EFIB 3HB3C 4NSKB 2VC2H 5BRZD 1BFSA 2JIXA 4M7KH 4HXAL 1KB5A 5HYJE 4P3CL 1IT9H 2X4UB 4QHMB 1HWGB 4GRMA 3GJFK 2ZPKH 3BUTA 1EBPA 3IU3A 3B2UC 3MFFB 3BD5A 4OCMC 4Y89A 1WC7A 3QNYA 5IF0B 4FQ1L 4ACPA 4AYFA 1F2XK 4XPAL 4I3SL 3QG6A 4XMLH 3HUJB 2Y72A 4J6RH 1RJCA 4R2GD 1UYWL 1XF3B 4QNPE 5HGHB 1Z9LA 1TPXB 4QWWD 3FOLA 3REWB 2GUOA 3JWOH 3AAZA 2DJSA 3WJLA 1LEGA 4N0YH 2NY6B 3T0AA 4GRLD 5L2KA 3IDNB 4J23A 1LO0H 1KIQA 1AQKL 4DEPC 2DQGL 6CGTA 4MMXC 1WFNA 2AV7A 1EA9C 4I0PC 3RTQD 4CADB 4WWKC 1KCUH 3N1MC 5LCVH 4Z7UB 3BE1H 4RMVA 5GRVL 4QXTA 4HQQH 3SJVD 3MREA 1I7TB 3SDDC 4LSUL 5IK3B 3VG0H 4POYA 5GSRA 3CU7A 3KLAB 4MJ6B 5C1MB 1G6VK 2F54E 3IDGA 2Y6SC 5ANMB 4JFEE 4DGYH 4ODUB 4ORGA 1T1XA 3EZ8A 5HYQB 5DD1L 1X4ZA 2XA8H 4Z8FL 4MDJA 3IFNH 3VXQA 1T6VN 5A16A 4P9HH 2ADFL 1UZ6F 4MA1C 1E0OB 5FM5M 5D7SH 5GS0L 4Z0XA 4RMUA 4P4KB 4LP4A 1M7XA 4RAHA 2V5SA 5T3XL 2A6DA 1IC4H 3BP5B 5HHQB 1INQA 2GTZB 3C8KA 2H6PA 1SY6A 1H15B 2MKLC 1P4IH 4RFNB 2AK1H 4FZ8L 4NGHH 2FD6H 4ZNEA 4OF5A 3WNKA 4PUBL 3KPSD 3N1GC 1MFCH 5DQJA 3SOBL 3BZDA 2VDML 1BQHG 3E6FA 3Q5YA 1UB5B 4YHMH 1CD8A 2FIKA 3ZE2E 1L0QA 2HTLC 4YUEH 4JKLA 5D7LE 1BQLH 4G80B 3U9PL 4U1KA 5C0GA 3PL6A 2FDBP 3HAEB 4CU6A 1KIRA 4G9FB 1NQBA 4NPYA 3GBNH 4PREB 1BWMA 3VFNB 4C58B 1PQZB 4X6DE 1F58L 1NFIB 1JV5A 3NFSL 5F3BA 3D39A 3ROLB 4GH7B 2D31A 1ZWIB 4G3YL 2R15A 3NAAH 2IBBA 3SGJA 4W68A 5DZOA 5MENE 5J6HA 1AXSB 4JFFB 4NO5A 4LU5H 2WBJD 1FV1B 2BSSA 2YXFA 4IRSB 43CAA 1PSKL 3OX8B 2ZJSH 4DTGH 2BY1A 3D0VA 1JPFB 3P73A 4HV8B 5BZWA 4JAMA 4PBXA 3QEGL 3MRRB 4N0CC 1F4XL 1ZHNB 5DD3L 2YD5A 3L5XL 2B1HL 1FN4A 2XFXB 2ZUTA 3ARWA 1BF2A 5EUKB 4XMPL 1IGTA 5J11C 3MXWH 1IQDB 4RGNB 1NCAH 4FNLL 4UB0L 3CK0H 3MFGB 4D9QD 4J7RA 4HH8A 3T65B 1XGQA 2EH8L 4ZODA 3TBWB 3KYOA 4AENA 3VJ6B 3F7QA 2MTPA 3BH8A 1R24A 1MCHA 3D87B 1QSFB 5B4MC 3EYSH 5GRXG 5AZ2H 5DMKB 5IVOA 3DRTB 3GSNB 5FK9A 4PGZA 2NYYD 1FYTA 1WVZA 4UQ3B 2AJZA 5D1XD 4Z77A 5LGHH 2BMKA 4V1DB 3GDBA 2VL4A 3QFDB 4EN3C 3FB5A 5EO1A 3BXNB 4JFXB 1LEKB 3M8OH 2I07B 3R0MA 2EDTA 2P5WD 2G60L 1F4WH 4JG0L 3T3PF 2BVTA 1JWMB 1Y6KR 5K9QG 2XZAL 5I8OL 4ZAKD 4HEPG 4YR6A 4H1LA 1YMMB 5E5MB 3U0TA 2HKHL 3UPCA 4QKXB 4U49A 3U4EA 4JM2B 1T03L 2A6KA 3WYRA 2I5YH 2XKNB 3B4NA 3U1SL 3VH8A 1A6PA 4TNVF 3REVB 1RUAH 3S34L 1GHFL 3HS0B 4CVZB 3JWDH 5E6IC 1BFVL 3VRLF 5E8OA 2NY3D 2J6EH 5DD5L 5ADOH 3FHAA 4YFLI 5FDWB 1P84J 3VI4E 1CGWA 1T1WB 3MR9B 1JZ6A 3VXPB 4Y4HB 5E8DL 3U0PA 5KOMC 2Z8VC 1WAAA 4K7FB 3PGCA 5T5FL 5J6GB 5JW5A 2Q7YA 3CD4A 3SDAB 4AM0B 5DJYB 4WO4A 4GKNB 1KEMH 4GG6B 3U7AA 5HPMB 1HINH 3EYQC 1T89C 1KLFA 2P42B 4HWEH 1MCOL 4GJTB 4XAKD 4CDGC 2GTWB 2YRZA 5AD0B 3SE4C 3WIIH 1YNKL 2VKXA 3U46A 2F9BT 1NUNB 4XCEA 4B50A 2OYPA 2X1PA 4WGWB 2IPKB 1MOEA 2NTFB 4ZUVA 3G5ZB 3TBVB 5J3HC 5FYJE 5IB2A 4PBVC 1DSFH 4MXWH 1FVEB 1YEKL 3UP1A 2PW1B 2G5RA 3T0BA 4UTAL 4M43L 2AGJL 3MNVA 3ROOA 2ICWJ 1M7DA 3L3OA 4MYWB 3BZ4B 1YEIH 2DRUA 1LO2H 5C07D 1DFBL 3K81A 5TPWH 3UTTE 4UT7L 1QEWA 1IAKB 2VJXA 1T7XA 4F7MB 1FCGA 2VLRD 2NZ9D 2BC4A 1GIGH 4S0TD 2X41A 4XVUD 43C9B 3MNWA 2A83A 5I1EL 4CVWA 3FO0L 4TQEH 3KLDA 3OZ9L 1RHFA 2A74A 1MLCA 1UWGL 4XCYA 4LRNL 3GJEA 4X4ME 3O2DA 4EDXB 3V0VB 5JUEL 3TH2T 3PGDB 3MLRH 3VFWA 3D18B 3S98A 1CE1H 3IU4L 1I8IA 5I75B 1I9EA 3RFZC 1S7UA 5KSUB 1FFNA 1WBYB 2VR4A 2VLLB 4HCRH 2VLJD 4AG4L 4RFEB 3KHOA 4LCCB 2JJTA 3HTLX 3MA9H 4FXKA 5I74B 1QPXA 4PJHB 4OFIA 3T0EC 5KZCB 4U6XB 1ROWA 3OAUH 1BQHB 5F9DC 3QP3A 3IAGC 1N4XL 3ARED 2NXYB 2LABA 4M1GH 3UTSB 1RD6A 4MNQD 2OTUA 2YBRB 4PS4L 5DXWA 1KYOK 2ICWI 3KPRA 4YFLF 5K9JH 4K7PL 2FATL 2FH6A 5F97E 1X5FA 3I9GH 1I3GH 4MAYD 3PWJB 1JN6B 1A5FH 4EI5A 4TTDD 3CFBA 3AXLA 3VFRA 3ARFC 1T2QH 3QDME 2R56H 4R96A 4K2UL 4KK8C 4C83A 4Z7WA 4JFQB 3SGDH 4AZ8A 1OM3L 3LHPL 4IRJD 4N0UE 4I2XA 1FG9C 5HHPA 3OKDB 3VXSB 1NDGB 1J86A 3V6OC 1OGTA 4LGPB 2CUMA 4OFKA 3HI6L 1JVKA 4D9LL 4XBGB 2IQ9H 3O3DB 4KAQL 3IDJA 3MMEA 1IQWL 4KMLB 1FPTH 4QF1B 4WFFD 2R23B 4XC3H 5LBSL 3VGEA 5L7XL 3NOIA 3FN0L 3RWIB 4PGBB 3C5SA 4B41A 1JZ7A 3EFFA 5C0BE 4FRWA 4A6YH 3E1F1 1BJ1J 1UA6H 1NBQA 2F53E 1I3UA 3FMGH 5JHDE 4H8WC 3BUYB 1XZ0B 2ADJA 3I3EA 4H1LH 2G9HA 3GRWL 1OAQL 3GUTA 2QR0B 3WIHL 5BVPH 2PR4L 3AC0A 1Q0YL 1LO3L 4NQXB 4QOKB 3O11B 3C87A 3FN9A 2NY1B 1N2RB 1AIFB 4NWUL 2P5EE 4X5XA 1Q94A 3O2WH 3QHZH 3VFSA 3OG6B 1HE7A 1QA9A 3V7MA 5AUMA 3ZT6A 1ADQA 1RZFH 3TNMA 2RCSL 3TYGL 5JDSB 3P4NB 1WITA 4MNHB 1CLCA 4OF8A 4TOYL 4ZFZB 4N5EC 1Q9WB 3UJIL 4DKEH 3PP3H 1PVHA 1CBVL 4Q9RL 2FB4H 1SYVA 1K2DB 2DQJL 1NEZG 1E4WH 4RBPH 3PV7A 2G2RB 3ARBA 5CZVL 1FE8L 3NN8A 2W60A 4PGCB 4JEGB 2G5BB 3ARGD 1YEHL 5BOPA 1ZLWH 4F7EA 3SCMA 3ULUF 2R0ZH 4ONGH 3QEQB 1NSNH 2QSTA 4ZOCA 3UBXI 4YHYC 3CFEA 5F6HJ 2DM3A 4WW2B 3EFDH 3B83A 2F58L 1JNLH 1RMFL 1U42A 1ZEAL 2YPLD 2BSRB 3KPPB 3EDDA 3TWCH 2CXKA 2CK0H 1RIUH 5L9DH 3V4VL 4CNIB 3ARZA 5IB5A 5J9PB 4M6OL 3QUMA 4FXGA 3PQYD 3PIQA 4D94A 4GBXC 1KFAL 5E5UB 4GRWF 1T5WA 4I13B 4MJIB 4OCYL 4I77L 5AZEL 1IBGH 5HI4C 4LMQI 3LKQB 1RIHL 1CLYL 2QL1A 2Y5TB 1WZMA 5CIPA 1AGBA 3T2NL 1D5XB 4DZBB 1EFXB 5I6XB 5L2JB 1S7RB 1LWRA 1HHJA 1KV3A 3TO4B 1MFAL 1LE5A 4I18C 1TJGH 3U9UA 1OSZA 2RIKA 2Z31A 3NABL 2IPTL 5C6TH 3QFJA 5F6HI 4Z76A 1W8OA 2E27H 2M26A 4G6KH 3CH1B 4NFBA 4HKZA 1XIWD 2PO6D 4D0DA 2YMXH 5EZOL 1RZJL 2A6JB 1VDGA 4F80A 4OFPA 3X13A 4LSVL 2EDDA 2IH3A 3MA7B 4F7PB 4Q6IA 4EIGB 4OZIE 4PRHE 2WBKA 4FQJH 5BRZA 1T0PB 4NKDB 3L9RB 3TBYB 1EEQA 3L7EB 4N8CH 4HX1B 3SPVB 3TPUA 3GIVA 3X14A 3AU1B 1NPUA 4JPKH 3VXMB 4QRRB 2VL5A 4BQBA 4PJBF 3DXAE 4XBPA 1CR9H 3UAJC 4PRAA 2CPCA 3ARDC 2OK0L 2YZ1A 1WWBX 4UMGA 4CMHC 2R2EA 1MSPA 1GGIH 4YZFE 4JVPA 4HUXA 1JWUA 1YNTA