4U6TA

Crystal structure of the clostridium histolyticum colh collagenase polycystic kidney disease-like domain 2a at 1.76 angstrom resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
NSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNKSNEENPEHSYDKVGTYTVKLKVTDDKGESSVSTTTAEIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ColH protein
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
total genus 20
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6tA00
3WIHA 5IB1A 2R0LL 4A2LA 3MRHA 4XCFH 1A8JH 2XG5A 4ZNCD 1FPTH 1U8HA 5CFHA 3ZHDA 3MLYL 1E4XL 2FO4B 3DV4B 4NRXA 3UAJC 4X6CB 4Z7UE 2VZVA 1DN0A 4HKJB 1LEGA 2ICES 4JFZL 4NKMB 5SWZB 3IAQA 2WV3A 1VFBB 2PN5A 1NPUA 1IAKB 4ZS7L 1QRNA 4P23D 5T3ZD 3QH3B 1ZLVK 3P73B 3EJZC 4FRWA 4LLWB 1FHGA 3LKSB 2VLRD 3MV8B 2UVFA 2PTVA 1DUZA 3JV4A 3QJFB 4LARL 3U7WH 4Z95L 1U8IB 1HQ4A 4KVNH 4HW6A 1D6VL 1EO7A 3IDYB 4AENB 4IDJH 5F44A 1BFVL 2VJXA 2DQUL 1FSKB 5C09B 1GC1L 4F2MA 2EH8L 4QT5A 1T66D 3ARPA 2WWMD 3KNBB 2ZPKH 3X3FH 2XKSA 4GG6B 1MCQA 4PJ8B 3IXTA 5M95B 1KC5H 3U4BH 3DX7A 3WS3A 1BFTA 5GGTH 4O2CB 3RGVC 1B4JL 2BERA 5INCA 5AG8A 2R2HB 3V6ZB 5I76B 3RPIA 2AW2A 2QJDA 1PX3A 2PO6B 2BOBA 3VXSE 5C0BA 5FF6A 5TGBA 3LS4L 1MFBH 2Y06L 2BVQA 5JO5B 1XR8B 3MRBB 4ZPVB 3C5JA 3ZDXF 1S3KH 4M6OL 2EDOA 2NW2A 3FOLA 1NFKA 1RK0A 4XMLL 4ZYKB 4BA8A 1L7IH 3ZKQD 5T1KD 1PJ9A 3B3IB 3IVKA 3NN8A 4P2OA 1QNZH 4PRHB 4L3CB 3QCUL 1F5WA 4MJIE 1HINH 3KPOB 1MF2L 3BJ91 4D0CB 4HUVA 5I71C 4QRUB 5DT1H 3QUZD 1PG7H 3FT3A 3MFGB 2D0GA 2P4AB 1J7VR 4KJPC 2GTZA 2EDTA 3O4LA 1F3JB 1XEDA 4L4VB 3BH9A 2D7OA 5ID1B 2N56A 4XX1G 2WMPA 3QQ9C 3TT3L 4RFOL 1MJ8L 1O7SA 2KDGA 1GGIL 2VLKB 2EYRA 2FBJH 1MH5B 4XP1H 1EEZB 3WHE1 5BS0A 2D7MA 4UNTA 4AJ0A 1G0YR 4PJBA 1TQBC 4XNQA 4W70A 3MOBL 4G8GA 4Q0XH 2XA3A 4KHXL 4E5XA 1AGFA 3QFJD 3U2SB 2HFFA 1YEJH 4N0CD 1NJ9B 1J0ZA 1AI1L 5AYQA 4UQ2A 1ZLSL 4DEPC 5HPMB 2VUYA 1LD9B 2DKMA 1T0NB 5TH2A 1ZLVH 1AXTH 2B20A 3MRGA 4PREA 1QOKA 5DF0A 5BZWA 1IGFL 4P49A 1VA9A 1IAIH 1IE5A 1U8OA 4DQOH 3LQAL 2VLJE 5KANG 4JFFE 3D0LB 1Z3GL 2F5AL 2VN7A 4WWID 4X4XA 1AQDB 1IQWH 1YEIL 2YD1A 3M1BB 4LLQA 2BC4A 4MA7H 1HWGB 4P9HH 5DZLA 1J86A 4L8CB 4WHYH 2VDQL 3NPSB 1MHCA 3VI4E 4LOUC 4LVNB 4PB0H 2YD9A 4P4RB 2CH8A 4ODUB 2UYLB 4F7TB 5DRWA 1E6JH 4ZMAT 1BVLB 1G9NL 2VXTH 4GSDH 5HYJD 4ZAKD 3O3DB 3RNKA 1ZWIB 1INEH 4G6JL 4FABH 3QA3B 2X05A 1KPVB 3VXNB 4HPYL 4CMMB 4M61A 1DTUA 4KXZH 2W9EH 5EBLB 2A1WL 3HMXA 3HCVB 1QHPA 3L3OA 3PGFH 3D69B 2DQJL 4APQB 1A14L 1IAOB 3BKJH 1MVUB 3JTTA 2VDKL 5GS0C 2ZNXA 4D94A 4JANA 3LKNA 4JFDD 3EYVA 5C2UB 1DBKH 4FQ1H 4MZ2A 1AXIB 3TEUA 2ADFH 3MLUH 3ROLA 4OM1L 1SM3L 3L1OH 3LEXA 1JGVH 4M5YH 5FKPB 3GSQB 2CUHA 1TJHL 3U0TB 3OKLB 2JJWA 3CLFL 3KPLB 3T1FA 4NSKA 4X6CF 2P8PB 3BW9A 2P5WA 4OZIE 4H20L 3OR6A 3BHBA 4YFLI 3SQOH 2GT9A 5HHMB 2EIBA 3UMTA 4QRSA 1EVUA 4K55A 2RFXB 4LVHB 5A3ID 4CUCA 5D2LB 5EOCL 4NM4H 3X13A 4YHOL 4AY0A 1JF5A 1HILB 2XT1B 3HC4H 5CILH 3RUGA 5IR1A 4KKLC 3GKWL 2R2BB 4OFPA 3SKJL 2ZZUT 5JHDB 1UWEH 2P49B 5DGQA 5EZOH 3ECBA 2GFBA 1WWBX 3HZMB 3MRJB 2GY5A 2NY1B 4KI5D 3S35H 2BRQA 5DTFB 1P4LB 1JPFB 1GC1C 1AY1L 2MQCA 1MRFH 1UZ6E 5GJTH 3WFBH 2ZOKB 4I5BB 1TQCC 3CDYA 3MJ9L 4XCEB 4HKZA 4LDEB 1ORSB 2W60B 2EDRA 1G7LA 3QIWC 1BGXL 2YPLB 4RMQA 3UJIH 2WK2A 5KOMC 3C9NB 1KIQA 3R06A 4MDJB 3LY6A 1J11A 4JR9H 2BNRA 3STZA 4QXUH 2X70A 3MLWH 3DBXA 4GG8A 4TPRH 1CL7L 2JELL 2AP2A 5F9JB 3ZKXB 2HJKB 4X83A 3QUKA 5C07B 5IVXB 2CDGB 3WLWC 5CEZH 1ZT7A 3MSPA 1JYNA 3LN5A 2ED7A 5HI4C 5D5MA 4U05A 3RWGB 5D7JB 3ABZA 3H3BC 4PLJC 4WGVB 2FZ3A 5EU3A 1L6XA 3GSVA 5ESQB 2D7TH 3PNWB 5HGAA 3LB6D 4UMGA 3CK0L 1QFUH 4Y2DB 2P5EE 3SKNA 5HHOB 3ARQA 4MD4A 3CFCH 1OSZB 5I30L 3IKKA 1S7UA 3MLTA 5C0EA 5JUEL 1NQBA 1QLRA 1SJXA 5BCAA 1AQKL 4JRXB 5KVFL 2UWEA 7FABH 3C60C 3DROA 4WRLA 4HQQH 1DVFA 1CG9A 4I13B 5AG9A 1MJJB 3RY4A 2FATL 3V8CA 1LP9E 4E41E 4M1GH 1GOHA 4U1MB 3E6FA 5JDSA 3U6RB 3QUXC 3O3EB 1FVEA 3ARSA 5GRVK 5C0DA 4KQ3L 1A6UH 1T3FA 2J7LA 1MFAL 1NSNH 4KROB 4JVWA 2H2SD 2VERN 4NQEA 4OFVA 3UC0L 5H2BA 2YRPA 3BPCA 4JM2B 5E00B 2H3NA 2Z35B 4HXAH 3GI9L 4I2XE 4UDUB 2XV6B 2EIEA 1LK3L 4GQ9H 4M6NL 1RVFH 3SDAC 5HYQA 2NR6D 3LQAC 5IJKC 1TZHA 1N6QL 5GRZA 3ET9F 1LNUB 2ICWA 4OCYL 5MEPA 4L5FH 2WANA 4JKLA 4IHOB 1EAPA 1N0XL 1QSFD 4KJQC 1I7RB 4H8WH 4QCIA 3B5TA 2HTKC 3DX6A 3G5XA 1RZ7H 2ICEB 1T5XB 1Z9MA 4MJ5A 3VMPA 1NUDA 4P2QE 4C57C 3DUSB 1CXEA 3FHAA 1XGUA 1PZ5B 2HVJA 3DSNA 4PRID 3PHSA 4QLRA 5E8PA 4LHUD 5DURD 5J56B 3CUPB 4PJGF 3T0WA 3TO2A 4XP6H 3VXRB 1UFUA 3VFPA 1UWXK 2AI0H 4WWKC 3WDIA 1JBJA 5INDA 4XZUB 1MFNA 1NLDL 1KGCE 3F7YB 3LKRA 4JJ5B 2YSSB 1LO3H 1H5BA 1VHPA 4ZNEA 1SVZA 2C3WA 3U7YH 3STLB 1ES0B 5ITBH 1J8HB 4TULH 3TO4C 5D96C 5D1XD 1XGRB 1D9KC 1BOGB 4Y1AD 1S7TA 5IKCB 1CGSH 1FO0L 1H3VA 5F7FA 3WSQL 4XMPL 4KFZC 1W2KT 5LAXA 4Y89A 1Q9OA 1G9MH 1SEBB 4NWTL 3F5WA 1MCHA 4NRZB 1A6ZB 2PXYC 4KK9D 2I9TA 2APTA 5FOBA 2DJ4A 3MRRA 3ZDZF 4UU9A 2AQ3A 5CEXA 2P1YA 1OTUC 1EBAA 3EDDA 1PKQA 4PRNA 3QDME 4U1KA 4PYGA 4D9LL 4PTTB 1UA6L 4K7FA 4S1DD 4UUJA 1H3GA 5I17A 4U6HA 4S2SA 5CD3B 3ULUH 3GJEB 3B9EA 4IDLA 4NT6B 5IW6B 4EEEA 5GSRA 2YKLH 4C4KO 3DYPA 3FQXA 4OSUL 4QTIL 1IL1A 1MY7A 3OJDA 4JG1H 5EORL 2R8SL 4ZTPL 3RKPA 4KUCD 3VFTB 4KHTL 1OGAA 4L9LC 3SDCD 4NNXB 3U83A 4FQHA 3RWFB 5EU6D 2CLZB 3I85A 4Z7VA 3TF7C 1TVBA 1VERA 3ZDYE 1BBJA 4HPOL 3MX0A 1G6VK 2HLFD 3SGKA 5BW7A 1BD2A 4JZJC 2CPCA 2VXSH 5C8JB 3EYSL 3UPRB 2QR0B 4IRJC 1KFAL 1UWXH 4LLDA 5DUBA 2P45B 3D39A 4NQDD 2JF1A 2V9TA 2A74B 5IHUL 4Z76A 3SE3A 2BNQE 5CGYC 4ZPTB 3OHXB 5GGVY 1ITBB 5H8DA 2OP4H 5DD3H 4U1LA 4J12A 3GSRB 4IRSA 4M7LL 5DJ8B 4HJ0D 1ZHLB 4EOWL 4KK6C 3BEWB 4CGTA 1MY5A 3O8XB 2EDKA 3MV9B 1AJ7L 4LGSB 1NLBH 3P0GB 4HIXH 4NPYA 4BFBD 5E8OA 4OTXL 2G2RB 3KYNB 3DX8B 1AGCA 2FGWH 4JPVL 5GPRA 1L7TH 5D7IB 1MREH 5T1MA 2E7MA 3I6GA 1HHKB 4ODSH 4PRAA 3CD4A 3OPZH 4AEFA 1PDKA 3PGDB 4X6FA 1H8NA 1LDPH 5GGUA 4JREB 4U6VH 1IGJB 2V7NB 2HWZL 3RVVD 4LSVH 3WXWL 2FRGP 1WCQA 1UH3A 3QAZC 3SGDH 4NQCB 5EBGA 5CJOH 2WNGA 4UB0H 3OKEB 2EO1A 2X2YA 5MHSD 2DLIA 3LQZA 4KAQH 4JAMB 4PJEA 4U3CA 4F7PB 1NC2A 4UIMB 3ZSSA 3ZE0E 3MOAH 1OCWL 1HQRB 4MAYC 1MJ7L 5DRNA 2VAJA 3K2MC 5E8DH 4LSTL 3I6KA 4TVPD 2HFEB 2LU4A 1LE9B 2BVPA 4OLYL 2EDEA 1FIGL 3MXVL 3C5ZA 4L9DA 4PRPA 4CRPA 2FEDD 2XTLA 3RY6A 2YUWA 3NGBC 1MHEB 1EFXD 4LRIA 4JQXC 4R90H 3QIUB 1WFTA 4XWGL 1F13A 3GMMB 5L8JB 3VFGL 5B4MC 4Z8FH 4PGJA 4JDZA 5E56A 4DZBA 1U95B 4PJCF 2BY1A 4QKXB 1GHFH 3LN9A 2DD8L 5HI5D 4KK5D 3JWDL 2YEZA 3WNOA 2Z93A 3IDNA 1CDIA 3O2WL 4KUZL 4P5TA 1JF1B 1EMTH 4YWGH 1XMWA 3MUGA 4KZDL 2EDBA 4YFDB 3BH8B 1VENA 3PV6A 1TTGA 3KYMA 3MCLH 5EWIH 3UTOA 3BO8A 1SYVB 5KSAB 1OARH 4K71B 1UVQA 2ZKHH 3PWLB 5EO0A 4Q9CA 1MCFA 3LH2L 1ZA3B 5DUPL 4PR5B 5E8NB 3JV6A 3LKOA 4C56B 5HI3D 2R0KH 1BX2B 3TVMC 2XWBB 5SV4A 1FL5A 5FO9A 3CPLB 1HE7A 3IS0X 3VXMA 2CMRL 1SJHB 5BV7L 3O0RL 1XF2A 4D9QD 5LXGH 3PQYD 1A3LH 2VQ1B 4CVZA 4XRCB 5E24E 3BKYL 3TWCH 4P4KA 5C0CE 1T1ZA 1UWGL 5DHYB 5GS1C 4OT1L 2QHLA 3VFOB 3FONA 3ULVH 5FYKU 5IHZA 5DJ0A 2AERT 5DD6A 3MRQB 4JDVB 4XT1C 4G6AC 3EYOA 4CVWA 4OBSA 1P1ZA 4FQLH 4DTGL 2VDML 2AEQH 1LGVA 3AAZB 3K4AA 5BO1L 2AXJA 2E3VA 3JVGC 5GGVL 2RIKA 4NHCH 5K59F 1D6EA 5KAQG 5HHPB 5C6PB 1QYGH 1T4KA 15C8L 1NCBH 4HXBL 3MXWH 5DK0A 2I60H 1P53A 4PJ5A 3QNXB 3K81A 4D0DB 3RI5K 3OKOB 4ZUVA 1ZTXL 1JTOA 2AV7A 2X4TA 4YIQB 3EZJB 2W0FA 4WV1C 4D0BA 2XXCB 5I1DB 1QA9A 3L5IA 3O3BA 2BMKB 1QR4A 4G6ML 2A6DA 1OTTD 4YPGA 2PO6D 5FYKH 5IBTH 2MQ0A 3VCLA 5CINH 2VKWA 1WBXB 1CI5A 3GSXB 5DD1H 5SV3A 5D2NA 3RGVB 4OD2A 1FJ1A 4MD0B 3U9UA 4RX4A 4PJDE 1MCLA 4ZD3H 1CFVH 1I1AA 3ARRA 5JLZA 1S7VB 3TJHC 2JJTA 4OKVA 3DMMD 1VSCA 4Y16A 4NCC1 5DMGD 2O26U 2XKNB 1KLGA 1J0YA 3C8KA 2F53A 3GSUB 4Y5XC 5IOPA 4LASL 1RJYA 1KTLA 3LEVL 1KSRA 4M48L 2DL9A 3VH8A 4YX2H 1YNLH 1UADC 1R5VA 2Z4QB 5I71B 1OAXH 4PRBB 3PWPE 2VDOL 4Q9RH 4ORGA 1FLRH 1YMHA 2HVKB 1VFBA 2X4RB 3TM6A 5KSBB 5MENE 1J1PH 3S5LG 4EUPB 4LBEB 3UTSD 3ELAT 3SQBA 1S9VB 3KPRE 4MX7B 4XH2A 2X7LA 3VD7A 5HDBE 5I15H 3KLDA 3WFDH 1R3HA 4JO2L 4RMRA 1JZ5A 3S34H 3QZWG 1TVHA 1C12A 1HH9A 2JJUA 4NO3B 1W72H 2A73B 2X89A 5KBNC 2VE6B 3TYFB 3H0TA 1VGEL 4XNYH 4ELKA 4KJWC 5I16B 2A9NH 2F9BT 4RSVA 2GJ6B 4DEPB 1KIPB 1RULL 3HB3D 4XPGL 4IOIA 3SBWA 3RZCC 3NAAH 1U0QA 4PJ8A 4ELME 3N06B 1P5VA 3RBGA 1PGRB 3OGOE 4HLJA 4QHUB 4QRPD 2J6EL 3ZTNL 4KMTH 4HKBB 3KS0H 3IJHA 3FB6B 1C08A 1UCBL 4LCYB 2UY7A 1RZJL 1R5WB 1X44A 3NCYP 4KV5F 5C92A 2J5LC 3TCLB 3BN9D 5E7FA 5I19H 4L8SC 4JCLA 3UTPD 1D5BA 4G80B 5DJ6B 5E6IB 2MCPH 1DUYB 4WI7A 4RQQA 3VD9A 3JWDC 4PD4J 1MCNA 2W59A 4JKPH 2VR4A 1XF4B 5TE6H 4D0CA 1JJUA 1VFOA 2DWEB 3O4OC 4HS3A 4APQD 4QRUA 5I8EA 5H35A 3IU4L 2VDNL 3S97C 3QEGL 1EAJA 2Q86B 4GXUM 1WC7B 4MDIB 5EC1B 4UT9H 3U46B 4JY5L 1Q0YL 4RZCB 3GIVA 1KN2L 5BV7C 4BK4A 5F6HI 1YEKL 3TA3C 3S37H 2VIRB 2IBZY 5TF0A 1N59B 1S7XB 1XIWB 3C08H 3GGWB 4K94H 4YHIA 1I85A 3FB5B 3C2AL 3DRTB 3HLAB 5FGBA 1I7TA 4OCRL 2FO1A 2KL6A 4JKWA 4NNYB 2VWEE 2NY3B 5EO1B 4F37K 1AGBA 5ALCH 3MRIB 4Z7UB 1T0NA 3LRSB 3LV3B 3NABH 4G42B 5GGQL 1NGPL 1N0LA 2AK4D 2DM3A 2Y5EA 2VXUL 3T0BA 5EZJA 3QUML 4JG0L 5C86A 1D5IL 1U6AH 1ADQA 3UYOD 1E27A 4MQ7B 4NP4H 3D0LA 4X99A 4PYHA 1J1OL 1WFOA 3RVUC 4DKEH 4PJHB 25C8L 3F12A 2OR9L 5DVMA 2P8LB 4IMLB 4QHNA 4KKBD 4LCWA 1N8ZA 2RCSL 3JUZA 4LSRL 4U1GC 5F1NB 3MNZB 4JFOB 3P9LA 1JRHI 5DDHB 1DEDA 5L88H 5D7LA 5GXBB 3PGCB 2D03H 4ISVA 2OXGA 3OJ2C 5CEYB 1MHHA 3WL9A 4NC1E 1TQCB 2EIDA 2BZDA 1U36A 1MIEL 4C83B 3T04D 5KTEL 3JXAA 2VZ3A 3QIWB 4XP9L 4KJYA 4JFXA 3DURA 3VXSB 3OX8A 4WTWA 3G08B 2V9RA 1FPTL 1GGCH 5C07D 4ZFGH 2V5YA 3FQUB 4OLUH 2R1WA 3FFCA 4C54A 4LLMB 3TZVB 3G5YB 1WAAF 4OZHA 4HAFA 4QOKE 4URTB 4H25A 1F4AA 4KDTC 3H42L 5FO7A 3GMOA 3GJFB 3LMJH 2HT2D 2LAGB 1A7PH 2IH1B 4OLWH 3D0VB 5F1KC 2DQIL 4EVNB 3KPLA 4LDOB 5K9QG 1IKFH 3MRPA 3U7WL 4MA8H 3S3SA 2FGZA 4KVNL 1HOCA 2BSRA 5DYOB 1OLLA 1LE5B 4PS4H 1XGTA 3WMSA 1U8MA 5D8JH 5EU7E 2RFXA 4GRWE 3QP3A 4J3TA 3RTQD 1HSBA 1FFRA 3X3FL 1WJ3A 4WFED 1KC5L 1CVRA 4I0CC 4QRQB 3U4BL 5E94B 1IMHC 2X4QB 5GGTL 1GAFH 1A1NB 3GMNA 4G8IA 2FNBA 2R4RH 3QEQA 5HDOA 1P4IL 1CE6A 1PW3A 3MRJA 1P84K 1WBZA 4M1CC 4FXGB 3W0WA 4LHJB 3LN4B 2DOCA 4KTEH 5EZIL 3DXAA 3DUHA 1MFBL 3V5KA 3VGFA 2UVEA 3BXNB 1IM3B 1G7QB 3SPVA 2NYYD 2WSKA 3IDXH 4B50A 4OM0H 1J0HA 1T7ZA 1S3KL 3KPSD 1A7BA 3LRGA 4LCIH 3C6SA 1A9EB 1FFNB 2VLJB 3VRJA 1L7IL 4JFFB 3BJLA 3RL2A 1GGTA 2YPLA 1Q0XH 3GDBA 1QNZL 4I3RL 3X17A 4DK6A 5F6HJ 2H26A 1HINL 3H9SE 4LAQH 1RZJC 1EHNA 4N8VG 2OI9C 1GOFA 4FXLA 5DT1L 3SDXF 1PG7L 3ZE1E 3MCG1 1LO2H 4P57B 3D3VE 3VFNB 5LGJB 3CAFA 4HUWB 1B88A 1NCAH 3SDYL 2Q8BH 2X4PA 3UPCA 5JR1H 3ESUF 2XWJB 5EO9B 2DN7A 1SVCP 3V6FB 2FBJL 5IVZB 4XP1L 4NYLA 2CO7B 4OIIH 3BZ4B 3NVQA 4NRYA 4PGCA 4WWKB 3BZFB 3NCFB 4LPXA 2VLME 3H6JA 5HHOA 1OSZA 1U8NA 5IK3A 4ZSOE 1WITA 5E08L 5DO2C 4P46D 5HYIA 5E6ZA 2NY6D 3PXJA 2CK0H 4JRXA 2FJGA 3TO4B 3IDUA 4BZYA 5D96B 3D25B 4U0RB 1D9KB 3CFIC 1EGJH 3QIBC 4I1NB 1IAIL 5SX5K 5TDOB 3V95A 1OAZH 2ARWA 1QRNE 1IGMH 3BIBX 3QUYA 4WTXA 2I9LB 4ACPA 1F6AA 2F8XC 5E2UH 1IQWL 1YDPA 5LG1A 3T0EC 4MA7L 4HWEH 4OZIB 4PJAB 4P9HL 1ZK9A 3MGOB 1Z5LA 2PXYB 5FYJD 3LRHA 2XICA 2XZQH 3QI9C 3HUJA 2W0KA 3IJYA 4PB0L 3MACL 3V6OC 2ADIB 2HT4D 2QSQA 4H5SB 4XTRC 1E6JL 4LLVA 3DOSA 2VXTL 4RMTA 4GSDL 1X7QB 3OXSB 3HR5A 1INEL 4JGUA 4FABL 2Y07H 3WNNA 2EDHA 1FNAA 1A3RH 3BWAB 3K8MA 1MCDA 4CN6A 5C08D 3FCTB 4I48A 3QQ3B 5I2IB 3PGFL 3AFLA 2OL3A 4G3YH 1CL7I 1IGCL 1EK3A 5ITFA 3BKJL 3LD8C 3EFDL 3NCCB 5HPOA 3PWVB 3A0OA 4N5EC 1AHWB 1DBKL 2PW1A 4L9LB 3MLUL 2FX8H 1S78D 1OB1B 4WI8A 3P2TA 1WCBB 1ZT1B 1A02N 2PKDA 3S96A 3EBAA 1EHLH 3TN0A 4JO4H 4Z77A 4JRYD 3P9MB 2AXFB 4QRRD 4X5WB 3CVHA 3SQOL 3HC0B 3O6LH 1ND0B 4WU7B 4N0UE 3O4LE 4L29A 3NCBB 4X9GA 3LCYA 3IDIA 3OKYA 2JCCF 3TIDA 3L7FA 4NM4L 1B0WA 3OKKA 5CJQH 1SBBA 1VFUA 5EU4B 1QLFA 3HC4L 5HDQH 4P23A 5TE7H 3IKCA 4OUUA 1CDBA 2GJZA 3S6CA 5BS0E 5JZ7C 1RIVH 3O8XD 1ZT4A 3MJGX 5FA3B 1UWEL 1R24A 4NQXB 2VLRA 5EZOL 3VXOB 4PJBE 5CAYB 3X14B 4AYFA 4JQVA 5IG7A 5FDYA 1F4XH 1WFUA 3S35L 4JO3H 5DS8B 2DJSA 3NZHL 2WINA 1KT2A 2EKJA 5SX5H 4RMWA 1MRFL 4POYA 3PIQA 1I8LA 4EXKA 5M7QA 3ARDC 1ZHKA 2PW2A 5D1ZA 1G7MA 1RJLB 1G84A 1LP9B 3IDJB 2CLVB 2XY1A 5ID0B 3VG0H 4HK0A 3D9AH 2NZ9C 2DQEH 2AV1A 3N1FC 4M7JH 1KPUB 5F3HB 5IB4B 2H8PB 4PIRF 3D2UB 4JR9L 4OUOA 5F1OB 3Q2CA 5C0JA 4JFQA 4QXUL 1QKZH 5EC2A 3MLWL 2LTQC 2ADGB 4TPRL 1CT8A 2VL5B 4RBPK 3WIFB 4LSUH 3QR2A 4XNZC 5TQ0L 5EG6C 3L3JB 3DVFA 5DJ2A 1K3ZA 5EPMB 5HGBA 5AZ2L 5CEZL 5DJXA 5JMOC 4ETQA 2F8VA 3VRIB 4YO0A 2OK0H 4M03A 3S9DB 5T1KA 5FGCE 3NFNA 3E8UH 3QEHA 3VI4F 2QTEA 2NNAA 1H3XA 5GQBA 5J9PB 4M5ZH 3VXUB 2P7TA 3MV7B 3FQRB 2BY3A 2OL3H 4MAYB 3QUZA 5EUKA 3CFCL 3GMQB 5FCUL 2X4UB 1CDJA 1T1YA 2BXZA 1WK0A 4X7DC 2FJFB 1I9RL 1KCRH 2B5IC 4ZPTA 2XFXA 4TQEL 4HQQL 3NGBB 1A6AB 3NA9H 2C4XA 1S8DB 1BAFH 4M1GL 2CXGA 3MJ8A 1SY6A 1PEZA 3MTRA 1A6UL 3QFJA 3MV11 2PYFA 1VEOA 3CVHH 4MQTB 4HXAL 1BP3B 5BJTB 1MAMH 2P5WE 5I1AA 1HI6B 4GQ9L 4QXGL 1RVFL 2OBGA 3LAFA 4WTZA 2P8MB 1FO0B 1MI5B 1FAKT 3MRMA 4MVBC 5E9DE 5F7UA 1D3CA 1EUUA 5DJYA 3BPLC 2CR6A 5T3ZH 4U1HA 4L5FL 2WWKO 3G6DH 2X4NA 4POZC 4P9HC 3LZFL 4H8WL 4ZXBD 5J6GB 4LAJH 2JIXB 5B38A 3ETBF 2Q7YA 1RZ7L 3RNQA 4ZO7A 1JNNH 3KLAA 5IROA 5GS2D 1A7OH 4IRZH 4KRMB 4Z0XA 3AS0A 4XP6L 4AIXA 4MD5A 5GS1B 2AI0L 2HAZA 1H15A 3UTTA 1T80A 5HYJA 2EIZB 1TZGH 3C09C 4JFHD 3U0PB 4GLRI 4BH8A 4RBPH 3U7YL 2BFVH 2ARJQ 2HFGH 3S5LB 2VITB 1UZ6F 4TULL 5ERWA 3V0VA 3HAEG 4U49A 1RIUH 1A1OB 2CR3A 1KUMA 5CUSH 2WLYA 4R8WH 1YN7A 4ZG1A 4R26H 3CZFB 1CDYA 2FX7H 3ULSB 2HMID 3DPBA 3NFSH 4W4OC 1CF8H 5C7XH 3QI9D 1NUNB 3QZWB 2DQHH 4PJXA 3GBNH 4YHKH 2FSEB 4KZEH 1PLGH 2LQRA 4LSPH 3SDDD 5D5ME 1KEGL 5FA4B 2WIIB 3LQMA 1NGQL 1RUAH 3Q3GA 2IH3B 2WQRA 3MMEB 4NN7C 4N1EA 3QWRD 2BNQB 4QWWD 1T83A 4X4MA 4YK4B 1BFOA 4AH2B 4U31A 3V2AR 3B5HA 4R96A 4NZDA 5CD5D 4K3JH 4BYHA 2E6QA 2DQTL 5JNYB 4HG4J 3R4DA 3V7AE 4IS6B 1HKLH 4PUBL 3ULUL 2UWEE 1KJMA 4NJ9H 2K9UA 1RMFH 1T5WA 3GM8A 4L8DA 4HWBH 5F1IB 1WZMA 3RQ3A 1KXTB 2VABA 5HHVH 5CZXD 4DCQB 5ETUA 4G5ZH 4WI4A 3EZ8A 4HJJH 4XRCA 4TVSa 1QSVA 4CMHC 5CCKH 2Y7QB 4I4WA 5D7SH 2FECI 4Y5XB 1BM3H 1UJ3B 4HF5L 4MWFA 5F9WC 2DB8A 5KJRH 4S11A 2J8OA 3G9AB 1DBBL 4NQEE 1FCGA 3VGDA 1LP9F 3W2DL 1CICD 1V3MA 3EAKA 3FOMB 2A38A 2UZIH 1YPZB 2OTUA 2X41A 1EX0A 4OLXH 1CGTA 4X7EC 3EOAB 5EULV 3VJ6B 3T1WA 1JWMB 5GRJH 4HHAB 5B3NA 4Q2ZA 2ATPA 4LKXB 5GGSY 2ZSVB 3P4NB 3WNMA 3P0VH 1OT2A 5F7KC 4AEHH 5HY9A 1KJ3H 3P30H 4HWNA 5DJCA 4K9EH 4U1JB 4HEPG 1DE4B 4DGVH 2IFGA 4OLVH 2GJ6D 2A6IB 1QRKA 4P5MB 4KH2A 4K2UL 1ERNA 2ESVA 1D5MA 1UH2A 3MRFA 3PHQA 4YIQA 1F3DH 4Y4FC 4MQXC 2VRAA 3RHWK 1QBLH 4HIHA 2X09A 2DKUA 4LNRB 3FB7B 2OP4L 3RJDA 1OGTB 1SJEA 5TDNA 4CVUA 4NFDA 1GCFA 4ZNEE 4EIGB 4L3AA 1FZJA 1GZQA 1XH3B 2QQKH 3ARFC 1YY9C 3RL1A 5KVGL 1FGVH 3VD5A 1NLBL 2FH8A 5E6ID 1I8MA 1KIRA 1N5YL 4OB5H 2XZCH 2FGWL 1FC1A 1K8IA 3F65A 1G6RH 2HLAA 1L7TL 4HFWB 1MREL 2J5LB 1S5IH 4L8SB 1FZMB 7CGTA 4NO0D 2NX5A 5T1DH 5DD5H 1ZKAA 4FTVA 4NM8H 4ODSL 4YDJA 1B0GA 5DMKA 1CZ8H 4G9FB 2ZUUA 1LDPL 1YYLH 4U6VL 2BOCA 4N8PA 4DVRH 5GJSH 2IC2A 5ABDE 1ITCA 4HUNB 1OAQH 3X12A 1A9BB 3FN0H 5CJOL 5I1IH 1U3HC 2HVKA 1PKQE 2W65A 5JPNA 1XIWD 2Y36H 3L3KB 2Y6SD 5ALBH 1OLZA 3RWCA 4H8WC 1W0WB 1FDLH 5T3XE 4JGMA 3BRGC 4BKLB 2NY3D 4HAGA 4LPVA 5E8DL 1ETZB 3WO3B 5BV7B 1PBYA 1MLBA 3WFHB 3TA3B 1HHIB 2AJZB 4MQSB 4P59H 2VE6A 1FP5A 1ZLWK 1QR1B 4PRIA 1FL6B 4FQQB 1FZKA 2OS7A 4O51B 4LHUA 4GJTB 4R90L 1S7WB 3GI8H 3MBXL 1PEWA 4Z8FL 2J8UA 1V7MH 2EXYD 1JN6B 3LEYL 4MVBD 1INDH 4Z7VE 3U36A 1G1YA 3QJHB 1IM9D 4MCZA 3FB6A 3MRNA 4MA3B 4ZTOH 1S9YB 1G7JB 5KG9A 1EMTL 1M71A 4X6BB 2LVCA 2Y5TB 1NBZA 2DQGH 4GKNA 4N0FA 1BD2E 3GUTA 1R5IA 2NTFA 3IF1A 5CGMA 1I1RA 3MCLL 4BH7A 2DLFH 3DVNB 5EWIL 5SWQB 2DQDH 3I3BA 3G5VB 1MCOH 5D1QD 4BQ9A 1G9MC 2ZUSA 3BQUD 1F4WH 3A6CH 5EUOA 5BVJB 2R0KL 4XBEL 5B21A 2KBGA 5BZDB 1N5AB 1JUFA 1UENA 3VXSD 4ONGH 3ZKNC 4JRWA 4FMFA 4PJIA 4Y5VC 1MRDH 3E3QE 5LXGL 1A3LL 4R2GD 2IADB 1KXVC 4KK8D 2ZJSH 3STBA 5FIEA 1PD6A 4UT6H 3H7LA 4NN5B 2R2EB 1LEKA 3TWCL 1KG0A 4KDWA 3OJVC 1KLUB 3TZVD 6FABH 4YQXH 5EH1A 1PYWA 3G5ZB 3GHEH 3ULVL 4P3DB 1X5ZA 4NKIH 1WC7A 4MDIA 4UQ3B 3ULUC 2DLHA 1RQ5A 5D4QA 3MLRL 4MJID 2NY5H 5IWLC 4HGWB 3THMH 3WUWA 1G0DA 4NCDA 2GW5A 2AEQL 4KKNA 3BSZL 1N6VA 4LCCC 5IHBA 1NC4B 3F7QA 3UO1H 3RWJA 2ED8A 5F7YC 1AR1C 4WW1B 3ZKMD 2ZUWA 1U8JA 1KLFA 5CMAB 2DDQH 4OFDA 4LCUB 3WS6A 2R56H 3QYCA 5IIEA 2FIRT 2I60L 4JO1H 4G42A 1BFSA 4LU5H 4NQSA 1VGKA 2CRZA 3HZVB 2OM5A 4J8RB 5D6DC 5EN2B 5I73B 1MAJA 4XWOD 4S1RH 4R4BA 4UOJA 1DCLA 4HV8B 5J6HB 1I1FA 1I3RB 5GRUH 5EU6A 4EJ1C 1FYTE 3VFUB 4WDIA 2Y1VA 4RCAA 4ZOCA 3PG2A 1TTFA 4XVSH 5IQ9A 4XPHH 5FYKL 1LK2B 3B4NA 1Y6KR 4OLEA 5IBTL 3E6HB 1K4CB 1FAIH 5CINL 3ARBD 4MNHA 3T0VA 2G9HA 1DL7L 1KN4L 3FO0H 4HS6B 3AB0B 3M07A 1RZIA 4WU5B 3WHXA 4NUGH 2VLJD 3ZE0F 1V05A 1BEYL 1IC4L 4ZD3L 5HGDB 4P2RE 4F7CB 1DDHB 4ZOAA 4HLZH 1EEYB 5CEYA 3RGHA 2WAHA 1HHJB 5DFVD 5E4EC 4X80L 1CTNA 3BP5B 4O58H 4UZGA 1BF2A 4HULB 4Y4HB 3V7AG 1AXSB 1Q94A 1V3JA 4HZAA 2CJUL 3QXWA 3MJ6A 5MEQB 4Q7DA 4GBXC 2V2XB 3T3ME 1NBYB 3MREB 1OAXL 1RK1A 3CU1A 2OI9B 3FAXA 3GSNA 5JW4N 2K7PA 1FLRL 2M8XA 1B90A 2Y23A 5IMKB 3KLHC 4NO5A 2JB6B 3AU1A 5KVMC 1NDMA 1P5UA 1KACB 3EUUA 3HNTH 1U8LB 4Y4FD 1KB9J 4V2CB 3OG6B 2PR4H 3HI5H 4JHAH 3HI6H 3WFDL 1A6WH 3VXME 2ID5A 2XYCA 3B9KD 3CDCA 5DHVA 3ARGC 4G6KH 1VESA 4EN3D 3MNWA 1W72L 1N6UA 5L9DH 4YAQB 3T2NH 2JLLA 2ZOLA 3PJSB 2Z8RA 4TSAH 5C0FB 2H45A 4YHZL 1F58L 1V3KA 2I25N 5DRXA 2AJXH 2BVOA 1CIDA 4FP8H 1T2XA 1T0PB 5DJZA 1A4JB 3QHFH 2X4QA 5BQ7A 3BT2H 3C60A 4WIQA 2EC8A 1AGEB 4KMTL 2H6PB 4XNXL 3REVA 3QIBB 1CDHA 4X7CC 1NEZA 4K7PX 4OF3A 1QTYT 1I9EA 4PJ7F 2HG5B 3QUXA 1NMAH 3DTXB 1MCPH 1VCAA 1NFDE 1T04B 3T0EB 5I19L 1LMKA 4PJ5E 3OXRB 3VG9B 4ONFL 3MBEC 1CD0A 4ZOEA 3LKQA 3F62A 3QUMB 5JW5B 3QG6A 3SDAA 1MEXH 2F54B 5TE6L 5IJKA 5EIIA 2AXGB 3MLXH 3TNMA 1YEEH 5FM4A 2Q76A 4KMQA 3H3PH 3RI5F 4ZFFB 4P5KB 2FR4A 1E28A 3UYPA 1JGEA 4LP4A 4RNRB 3SE3C 3WNPA 3O9WC 1AD0A 2ENYA 3B8SA 5DEGB 4UT9L 3ARZA 2F19L 5ESVB 5IVZA 1NAMH 4KWUA 4GMTH 4RDQF 3PP4H 3S37L 5IB3B 1DQQB 3C08L 2IQ9H 4K94L 5I6XC 2CIIA 2YD8A 4KMLB 3U82B 3PQYA 3RP1A 1GGBH 4JLRA 2F53E 1A6VH 4XNUH 1OAKH 1TNMA 3ULVC 2BVUA 4PJDF 2GCYA 3NABL 4O2FA 2ADJA 3HFMH 3GSNH 9CGTA 4Z7QF 5EOQL 1C16A 2IANA 3D25A 1D9KA 2QSCH 4QOKB 4RA3A 4ZUUA 5TPWH 1JRHH 4XBPB 5SWZE 1FVDA 3D18B 4JY6A 1U6AL 1A1MB 2P5ED 3MNVA 3JUYA 3PL6C 4NP4L 8FABB 1S9WA 4M8QB 4TUJA 5I1KH 5DHVH 4DKEL 3MV8E 2GK0B 1BHGA 3GO1H 3FQTA 4ZDHA 3FB8B 5I8CB 5K9KA 3PDOA 1K6QH 2VISA 1MNUH 2VLLA 2ADIA 4GRWB 4E41D 1GIGH 1UKQA 5HDBF 3NACL 3GZKA 5C09E 1UKSA 1AGDB 3RVWD 1JGLH 4J6RL 2M2DA 2DLGA 2D03L 4OGYH 4RWYH 4GG6E 3ARDB 3MLZH 2DTSA 4CADA 3C5ZC 4TVPH 3JV5A 3CFEB 1GGCL 5B8CB 4OAWB 5C6TH 4XPTL 3SE9H 2PYEB 4OLUL 5ICXA 4YEFA 2EDQA 1WZLA 4ELMF 3OZ9H 3SKOA 5LCVH 1PSKH 4HBCH 1OM3H 2LTQB 1IQDB 1WTGT 4LIQH 3UJTH 3MJ9A 2FHBA 4LLYB 1BREA 5HYFA 4ODXB 3DMMA 3LMJL 4P5TC 1FNSH 3H9SB 1A7PL 4OLWL 4XCNB 5F89A 4P2QD 2EO9A 4PRHE 2ICCA 2W1NA 5H37G 3RDTD 1IKFL 3D3VB 4MA8L 4OGAC 1M4KA 3KPQA 4XXCA 3TBSB 3E2HC 4JZJA 4PS4L 2AGJH 1OP9A 3OWEA 1KGCD 3T2PA 1A0QH 5D8JL 3V0WL 4IRJA 3BIKA 1CBVH 2DQFB 3VGGA 1EHXA 4L4VE 1RPQA 4NBXB 4NBZB 3L5WA 3GSWB 5FUCE 4JJHA 2BSED 4GMSH 3HAEB 3VFMB 2X44D 3O6FB 1NKRA 1IAII 2R69L 1IZKA 2R4SH 2B5IB 2NY4C 5IEKB 5F7EH 4GRLD 3RU8H 3KHQA 4WNQB 4R97B 1H3TA 2R4RL 5I1JH 5ETUB 2BNUB 5IB1B 2C1OA 3GHBH 2JB5H 2XOTA 2DF3A 3MRHB 4Z78A 1KTKE 4KTEL 3B9AA 3VFWA 4BZ2H 4NRXB 5IFAH 3VW3H 4XAKE 1AC0A 1HXYA 1QZ1A 4WHTB 5DQDL 4PBWD 1DN0B 1LEGB 4PV9A 3TESA 4PGBA 5AYUH 3QPQD 4LCIL 1ADQL 1Q0XL 1FBIH 2E6PA 3KLHD 3W39B 4QRPA 5IMLA 3VXPA 5GRYA 5IFJA 2NY0D 2EE2A 1KENH 3BPLB 3QDMD 4HIEA 4KXZI 3CFBA 2V17H 3O2VL 1DUZB 3JV4B 2YD3A 1HQ4B 2N7BA 4NHUA 4NZRL 1DBJH 1YJDL 2Q8BL 4PJGA 3ZYJA 2NXZC 5FEBA 1ZA6A 5JR1L 2APVA 3MRLA 4F2MB 4QT5B 5F7MC 1K9TA 1U9KA 4OIIL 4RIRB 5D7LE 4Z7NE 3IXTB 2H1PH 3DX7B 3WS3B 4AMKL 1A6PA 5D2NC 5INCB 1YNKH 3W5MA 2KKQA 3DNKA 3MV7A 3ZO0A 1PAMA 1QFHA 1CGYA 4H1LG 3RPIB 3FL7A 3K46A 5F7NC 2BOBB 5BRZA 5C0BB 5TGBB 1IAMA 4OF6A 1I1AC 2BVQB 2JJTC 2BHUA 4D3CH 5DUMH 2ERJB 3C5JB 4ZQKA 2NW2B 4JQXA 3FOLB 4K94C 1RK0B 3L6FA 2DYPA 3RWIB 4OZHE 3IVKB 5DQ9A 1OAZL 3NN8B 1BMGA 1FL3A 1OQOA 4HUVB 5E2UL 4LEOA 3FT3B 4TYUA 3QRFM 1KTRL 2XZQL 4OFKA 3CFDA 2GTZB 2CRMA 2AK4A 2Z91A 3BH9B 5HHME 3RWHA 1FO0A 1MI5A 4NN7B 3NBNA 5J1AA 4YDKH 2H2PD 2EYRB 4ZUTA 4JPWH 2BCKA 5FYLE 5BS0B 2Y07L 3PDGA 1A3RL 3TVMA 2YN5A 4PJBB 4X6EA 2OLDA 43CAA 5TDPB 1UKTA 5DK2A 4XNQB 5JHDE 5TQ2L 4G8GB 1BZ9B 2FBOJ 4GAGH 5SX4H 2QKIA 4E5XB 3BRDA 1YN6B 3NTCH 4JN1L 3QEQE 2HFFB 4UQ2B 4OD1H 4CMHB 3OB8A 5TH2B 1JZ3A 1LO0L 3MRGB 4PREB 4WW2F 3DVIA 4K7PY 5BZWB 3I2CL 4O4YL 3WN5A 3T08A 2VZSA 1U8OB 3UDWA 4F57H 1SHMA 2BSSA 2A9ML 2YPLE 4W6XB 5A16A 1JWSB 2DKSA 4X4XB 3S3PA 2DIJA 1FE8H 1A1OA 4CDHA 2BC4B 1CS6A 5BMFL 1U92A 3CZFA 2E9IA 4PGEA 1MHCB 1RURH 3BGMA 4QY8A 1CE1H 4TRPL 5E0QA 2YMXH 2O93L 2Z31C 4PJ9C 5E99H 5DRWB 5KSUA 5CJQL 1R0AH 1DLHA 4PJFF 1MCBA 2V5MA 5TE7L 3RNKB 1YQVH 5HDQL 3VH8G 1X5XA 4CNIA 4W6WB 3IFLH 4WV1A 2H32H 2C3GA 1RIVL 3R0NA 4XAWH 4M61B 4POUB 2IH3A 3Q5OA 3U9PH 1F4XL 3TJEL 2COQA 1RUQH 4JO3L 2IGFH 2MHAA 3L3OB 5HHOE 5ICZA 2B4CH 3S3JA 1A2YA 1WBYA 1V7NH 5E2JA 4KRNA 4WEMB 5HHQA 3QXVA 4RFNC 3JTTB 3O2DA 2HH0H 4X0KA 5JDJA 4JANB 5GIRA 4JRXE 3RTQA 3BP6A 3LKNB 1ZEAL 3ZZ1A 3EYVB 4LKCA 2XTJE 1MHPH 1Z0NA 3AUVA 3RWEA 3VG0L 1JPTH 3ROLB 5KS9A 2DQEL 2E5EA 4QO1A 2BSTA 1BF8A 4ODVH 4XVTL 4XPAH 5DWUH 1MVFA 1X5KA 3T1FB 4NSKB 3BW9B 4C58B 4LSUL 4X4YA 3OR6B 3BHBB 3HUJE 4QRSB 1MFEL 3QCTH 5EOTB 3KPSA 2OK0L 3PHOA 3X13B 3RJQB 5C0CD 3Q6FA 3RUGB 3UJJH 2CKBA 2AK1H 3E8UL 3RA7H 4LQ1A 3WEXB 3WHE0 3MOQA 3S36X 4M5ZL 4JHZA 3S7GA 3DI3B 3ECBB 2OL3L 1DE4A 2GFBB 3VFVA 2YXFA 5T1LD 3GBMH 4XC3L 5IBUB 4FQIL 4UINH 4PY7A 3GMRA 4XNMA 5JW4R 5I1EH 4HKZB 1TENA 4PJCA 2IBGA 1G7LB 3NA9L 3FB7A 5E1AA 3RZCA 5CKGA 5I8OH 3OBAA 1REIA 1KIQB 4U7SA 1U58A 2BNRB 1HNGA 2ZCHH 1GXEA 3I3DA 2X70B 4YHMH 3DBXB 5J1SC 3CVHL 1VDGA 4GG8B 4P46A 1I9JH 2IEPA 3PF2A 1MAML 1X6LA 4ALAH 5F9OL 3VFSA 3QUKB 3DRQA 5KVDH 3KPNA 4EDXA 2NPLX 1ZT7B 3FT4A 3LN5B 3UTQA 3AVEA 5D5MB 1OPGL 5T3ZL 4HWZA 4Y4KD 5CJXA 3JTSA 1Q8MA 1FN4B 2FZ3B 3G6DL 4P2CG 4QXTA 2NLJB 4G9FA 3MYJA 1INQA 3FQNA 5F7DA 5EU3B 3BDYH 2J88H 5A2IH 5HGAB 3ZE2E 1ZS8A 1JNNL 1RU9H 4Y5VB 1A7OL 4MD4B 1GGUA 4WW2C 4IRZL 3EDEA 1S7UB 3MLTB 5C0EB 1SYSA 3WO4B 1M6OA 3RVXD 4LP5A 4PV8A 2GTWB 1KYOJ 4P2YA 1DSFL 1A4KA 4R6UA 3DROB 4DKDC 1W0WA 1DVFB 1CG9B 5C3TA 1TZGL 1U91A 4BKLA 2GJJA 4TUKH 3VU2A 3EYQC 1CFSA 2BFVL 3E6FB 3WFHA 3TA3A 5JDSB 3PWPD 1E0OB 3I75A 3L9RB 5C08A 1FVEB 4LCCB 5C0DB 4HC1H 2XIDA 5MEND 1RIUL 1KJVA 1T3FB 5CUSL 1QR1A 3KPRD 4NQEB 4R8WL 4O51A 5H2BB 3BPCB 4R26L 1UACL 5DRZA 3QHZL 5CIPA 3KXFA 1MUJA 1BBDH 4XB8A 2DQHL 1EH9A 5BXFA 3GBNL 4YHKL 5HYQB 4KZEL 1TZHB 1PLGL 2YD7A 4LSPL 4DUXA 2ICWB 3REWB 1S7RA 3DV6A 2E7HA 2DICA 1JZ8A 2L7UA 4QCIB 1CXIA 1RUAL 4AG4H 2NY7L 5L6YH 4MXWH 3DX6B 5LWYH 4MJ5B 4JRYA 2NY2C 3OJMB 5JQ6H 4QRRA 3BP4A 2HVJB 5CZVH 5E8PB 4XHJD 4K3JL 1VADA 5J13C 3TO2B 4IIQC 3VFPB 1HKLL 4NJ9L 1JE6A 2VDRH 5INDB 1RMFL 5DQJA 2Q7NA 4HWBL 2IAMC 1YY8A 1H5BB 5HHVL 2HTLC 4OZFA 1SY6L 2IADA 4FZEH 4G5ZL 5ADPH 4HJJL 4OZGB 5C9JA 5E2TH 5CCKL 1F11A 4FQCH 5E4EB 2DMCA 3AREC 2PCPA 2XTJC 3SGDI 1BM3L 3W82A 5KJRL 1JNJA 3MV9E 1ZMYA 1CFTA 3N1MC 1S7TB 2X10A 3N1QC 3IDMB 4HGWA 2UZIL 3U4EA 1Z0MA 1I3VA 4OLXL 3CMGA 5J12B 4E0RA 5LAXB 1Q9OB 4ODTL 3QUYC 3RY5A 2NCMA 1E4KC 5GRJL 1T20A 3F5WB 3RVTD 3MUJA 4BSVA 2JKXA 2FLRT 2Q6WA 3DIFA 4ERSH 1P4BH 2PF6A 1OL0A 2I9TB 5FOBB 4IM8A 3P0VL 3MRRB 4YGAB 4AEHL 4H0HB 1KJ3L 2SEBA 2ZCLL 3P30L 3P4MA 5CEXB 1MCIA 3EO1A 4K9EL 5FYJH 1OHQA 2EDFA 4DGVL 4OLVL 3HZVA 4LVOC 1PKQB 4PRNB 3K0WA 1QLEL 4U1KB 2NXYC 4DW2H 1P7QB 2B1AL 5DSCA 3ARUA 4UUJB 5I17B 4U6HB 4G43A 4S2SB 5DVNA 3UTTE 4FQJH 2QV2A 4LSQH 5F70A 3L3DA 1LK2A 3O41A 5GSRB 2IMNA 3FQXB 4NC0B 2FJHA 5FO8B 3PP3K 1UYWH 4RGOH 3OJDB 1JV5A 5GISH 4JHWH 8CGTA 4Y88A 4TSCL 3DETD 1EHAA 1FGVL 1VFMA 3TNNA 3MROA 5D72H 2I07A 1SMAA 1OGAB 2WBJD 5C0ND 4LGRB 4FQHB 2XZCL 4I77L 1RY7B 4RGNC 2IWGA 2GSIA 1S5IL 4XVUD 4DKAA 1TVBB 2IPTH 1BBJB 2DS4A 5T1DL 5DD5L 4NM8L 2J6EA 3GK8H 1JCKA 1BD2B 3QEUA 2AEPH 3BD5A 2ZG2A 5GJSL 2C9AA 3GRWH 2IPUG 4LLDB 1OAQL 1UM5H 3PABA 1MQKL 5DUBB 3FN0L 4UV4H 2KQMA 3D39B 2X40A 5I1IL 4Q9QH 1HKFA 1X5YA 4MA1C 1AE6L 4P23C 4Z76B 2E9WA 5A2JH 4X4ME 3N0PB 3O9WB 1DQDH 4PG2A 3UZEA 2B0SH 3KWWA 2UUDH 4C56E 5ALBL 1FDLL 4OZFH 4Y8AA 2OZ4A 1JNHB 4MAUH 5IW1A 2HT3D 2HKFH 4IRSB 2EDDA 3I84A 1T6VN 1A7RH 4BUGA 4YHNA 3I02A 3ZHLA 3S8WA 2EYTA 4QOKD 1ZGLM 3QNYA 5CSZA 5HGHA 3T2QA 5IHLB 1H8SA 1SBSH 1T66C 4WEBH 2UWEF 3Q48A 2WWMC 3QBTB 4KI5E 2R29L 2X9WA 1F3RB 3GI8L 1SMOA 1T2JA 4NPYB 5E8OB 5F7WC 2ZCKL 1V7ML 2P46B 4J4PD 1AGCB 3CVIH 4BFGA 3M8OH 4I18A 4OQ1A 3EFFA 5T1MB 3QCVL 4M43H 3I6GB 1INDL 4DGYH 5DJAB 1CGWA 4TTGA 4PRAB 2E9JA 4GKSA 5CLTA 4X6FB 2DQGL 1E6OH 2HG5A 5GGUB 4X5XA 1CGUA 1ZVSA 2HRPL 4OQTH 4ZFZA 1FG2A 2EEDA 3SGJA 1NDGA 4GW5A 1RJZA 2DQDL 4HEME 5IBLD 1YEFH 2ZUVA 1MCOL 4PLOB 4TOYL 3MQIA 2VAAB 3UTZB 1N4XH 2ESVE 1F4WL 3A6CL 3QI9A 3LQZB 5DHXB 5TE4H 4PJEB 3V6OA 4YBQD 1UXWA 4YE4H 1NCDL 1NC2B 4KTDH 4OCSH 3SDDA 2IALA 1MRDL 5DRNB 1OW0A 3OAZK 1HYSD 5KW9H 5JIHA 4FNLH 5ECJE 5AWNH 2BVPB 4UAOB 1XZ0A 4YBHA 3EDFA 4YQXL 2XI9A 3C5ZB 4BQBA 4PRPB 4P0DA 4NKIL 3WJJC 4FFWD 2NY5L 3H9SD 1WAAA 4GKZA 5L0QC 3THML 1RHHA 4AM0A 5LGHH 4DZBB 1QP1A 1BLNA 4DOHE 1I7ZA 3UO1L 4ZO6A 3VD3A 3MCKA 1KELH 1MPAH 3LHPH 4N0CC 2YEZB 2NX5E 1C5BH 2Z93B 3HRZA 3IDNB 2DDQL 3QSKB 4P5TB 4FTVE 4CU6A 5C71A 2IG2H 3F7RA 1QBBA 3MUGB 1Q9WA 4LU5L 4JO1L 3VGAC 5JIKA 1NL0H 2X42A 4LGPB 3PV6B 3KYMB 5KZCD 3O6FD 4M62L 3BO8B 4YHPA 4S1RL 1IFHH 5L2KB 1UVQB 5EO0B 5FM5M 1CICA 4ZO8A 3E2HB 1RUPH 5JXAH 5GRUL 4FQXD 2VLMD 3JV6B 3LKOB 8FABA 4JZOA 1FL5B 1K4DA 2DTMH 4FFYH 2OQJA 5FO9B 2P47B 4I3SH 4XVSL 1KNOA 5IROC 1VACA 1XF2B 3JBG7 1VEMA 1W0YT 4K9EC 2EYSA 4CVZB 1FAIL 3SJVB 2NY4B 3FB8A 3NIDF 4P4KB 4ZFOA 1R6VA 1T1ZB 3P11H 3QULA 3FONB 5GSVA 1C8PA 4ZAKC 5IHZB 5J1TC 2OMBA 2EE3A 1QRND 5DJ0B 1QSED 5DD6B 3EYOB 3WLBA 4K07A 1U8PA 3EHBD 2CD0A 3MRDA 2CLRB 3MA7A 4JM4H 2D0HA 2JJSA 1HHGA 5DC4B 3ES6A 1I4FA 1Q72H 1DBAL 5C9KA 3SDXA 3T0DA 4J3XA 4NCC2 3GNMH 1D6EB 4OAWA 3KPPA 1T4KB 1IGYA 5DK0B 4PJ5B 4U33A 4ZUVB 1KTDA 1IEHA 2X4TB 4Z7VF 2W0FB 2NXYD 3KYKH 2AS5M 4D0BB 5AAMA 4XCNA 3FRPA 1QA9B 2X4OA 3O3BB 4QHKJ 2FCBA 4NO0A 1UM6H 3P40A 3EYUH 3OTTA 1J10A 2A6DB 1A6WL 3GFUA 1J1XH 1T83C 4G6KL 1JZ7A 4NUJA 5T33H 2MPAH 1AD9B 4OCNC 5D2NB 4I0PD 3T2NL 4OD2B 5A3IC 1FJ1B 4NZTH 5AD0A 1HEZA 4N0YH 4TSAL 3U9UB 2VSDA 4FFZH 4N8CH 4UIKH 4HKXA 1ZLUH 5H94A 1GZPA 5DFTA 5B38G 4P2OD 5DEFA 1I1AB 3ME0A 4FP8L 5JLZB 1QVOA 4OKVB 3G6JF 3BT2L 4Y16B 3QISA 1Z9OA 1KLGB 3C8KB 5IOPB 4LMQI 1A7QL 3OQ3B 1HH6A 5FHBH 1FNHA 1RJYB 1KTLB 4CVXB 1I8IA 3O4LD 2E27H 4YBLC 4DKFH 2FD6H 3VH8B 1NMAL 1R5VB 4KQ4L 4WHTA 5CZKA 3QG7L 4XP5H 5BS0D 4ORGB 1YMHB 3HR6A 1Y18A 3P9WB 3C5SA 4Y0GA 3RWDA 2C3XA 32C2A 1D7FA 5IESH 1KPRA 3W39A 4XH2B 2X7LB 1MEXL 1IM9A 3MLXL 1Q38A 2AXHA 2R23A 3C2SA 1FZOA 3H3PL 1R3HB 4M1DH 4PJHE 3QDJD 1TVHB 1C12B 1I9IH 2FDBP 1HH9B 2G5BA 4HS8L 2Q8AH 3H0TB 4KUCF 2GI7A 4ELKB 3OAUH 3ALWA 2A6KA 4Y5YA 5C0AB 5D1QA 3WFEH 4BFEA 1JYXA 5D9SA 2Y4SA 4PLKD 4OD3L 1ORQA 2GK2A 3BQUA 4MCYA 1NAML 4LF3A 4IOIB 2O5XL 5M94B 2BP3A 4RIRA 4GMTL 3PP4L 4UTBH 3LB6C 1XCQB 3TCXA 3CSYA 2QADD 4UNUA 1J18A 3IJHB 3KS0J 1C08B 4XNUL 3V7MA 4M8VA 2NY5C 3HFML 4Y19D 3GSNL 2J1KA 3BIAX 5T5NF 5D70H 4R4FL 2QSCL 5MI0B 4UT7H 4DAGL 5TPWL 1JRHL 2JCCA 4MJIA 4H0IA 1D5BB 4JFED 3RWIA 4HJGB 4W4OA 1N7ML 4RQQB 3GJFK 4PJ9B 3MRCA 3T3MF 2CIKA 2H2SC 4HS3B 2ZG3A 3QDGD 3L7EA 3GO1L 4DVBA 5I8EB 1FFPA 3X3GL 1IGTA 2OYPA 4PGZA 3KYOA 5H35B 2IFFH 4YNYA 3HZYB 3WXVH 1L0XA 1K6QL 1MNUL 2NR6C 1FNGA 3CMOL 3CNKA 1GIGL 1CFQA 3U30B 1AO7A 3VGBA 1JGLL 1FNEA 4OGYL 3R8BB 4RWYL 3GIVB 1JP5A 3S36H 4O00A 2R0LH 3C6LD 4G7YH 3CSBA 4YHIB 5IM7A 2D7NA 5TDPA 5K93A 3MO1A 2P5WD 1I7TB 1BZ9A 1E4XH 1KIUA 5DVLA 1EJOH 1X5FA 1YN6A 3CX5K 2D2OA 5E9DD 1AGBB 3SE9L 1XR9A 4Z5RA 3OZ9L 1PSKL 1OM3L 2JK5A 3HPLA 1FFOA 4LIQL 4ZS7H 1NCCL 1WUNT 2PTUA 3UJTL 5EZJB 1FNSL 1E27B 2EE6A 3HS0A 4BK5A 3SOBH 1JWSA 2O61A 4JQIH 1XCTA 5D1XC 4X99B 4MJ2A 3H8NA 3F12B 1NFDF 2A0LD 2CDEA 1D6VH 3MGTA 2IPKA 1QFWM 4QHNB 3BKCH 2DQUH 1X6NA 2AGJL 1XF1A 4LCWB 1H3PH 1VKXB 1N8ZB 2UZYB 1B2WL 3K1KC 1UGNA 1CBVL 2LAAA 4KKAD 5DZNA 3P9LB 5F72S 1WEJL 4E42A 4GMSL 1CR9L 5D7LB 4KK9C 1EBPA 2R4SL 4ISVB 5ACZA 4Y4FA 1B4JH 4U3XA 1MHHB 3WNKA 3WL9B 5F7EL 1S9XA 4KJYB 2JB5L 4JFXB 3B9KA 2ITCA 3LS4H 3DURB 4EUPG 3OX8B 4EN3A 2GSGA 4XP4L 4BZ2L 5IFAL 3VW3L 4S1DC 5ISZB 1Z2KA 1UCTA 3BPNC 4M6OH 2R1WB 3O45A 3FFCB 1M7IA 1WGOA 3ARFA 4QHMA 4XMLH 2RB8A 4WO4D 3BESR 5AYUL 2IANE 2XQYK 3SO3C 4OZHB 4H25B 5FO7B 1FBIL 3GMOB 5GS3A 3QNZA 5CBEA 1TPXB 3WS6C 4CN1A 3B2VH 1KYOK 4X6DA 4OF8A 2V17L 3FO9A 3MRPB 3MYZA 3SDCC 4PJAE 1HOCB 2BSRB 3O3UN 1DBJL 3CFKB 1XGTB 1U8MB 4OF5A 5EOTA 1HSBB 1R3KB 1T1WA 1U3HA 2LABA 1J9CT 2HLFC 2C7UA 1ZHBA 1ONQA 2H1PL 1MCSA 3WEXA 2C1PB 2XN9A 1G9EA 3MOBH 4MNQB 4JN2A 3PXHA 3GMNB 4G8IB 5A1AA 3QEQB 1CE6B 5F8RC 3QFDA 3BN3B 1WBZB 3VXQA 2VN4A 3W0WB 4YHYC 3DXAB 4X9HA 1ZSDA 3V5KB 3SPVB 2EICA 3U1SL 4LSSH 4D3CL 4GG6F 5DUML 5IVNA 1E4WL 4ODHL 4AL8L 1CLCA 3C6SB 4HJ0C 4L4TA 3VRJB 3RL2B 5L2JA 4MXVE 4OGZA 2YK1L 2H26B 2WZPD 2ZSWB 4Q6YA 4Q6IC 4X9BA 4L3ED 2AJYL 3MZTA 2VDQH 4QTHA 4ZS6D 3JWOH 3L3GA 3Q6GH 4F7EA 3WUWG 1K5NA 1JGDA 2OR8A 2VYRE 1G9NH 2X4PB 2GAZB 3VMNA 2NY2B 1AKJD 1UB6A 4YDKL 4G6JH 4CW1A 4HGMA 4JPWL 2MQ3A 1CU4H 1FN4A 1OTSD 3EYFA 4NYLB 2OXHA 4A2MA 2NLJA 4WI3A 5J13B 2D31A 4IIQB 4NRYB 4LL9A 4PGCB 3RVVC 5GZND 1WIUA 1K3IA 5FDWA 4GAGL 4Y5VA 3NTCL 1U8NB 2KZ1B 5IK3B 3O6KL 5I1CL 1T03H 3AS3A 2YBRA 3CXHK 4OD1L 1UM4H 1FCCA 4WUUD 1A64A 2FJGB 4E41A 5FUOH 1X5HA 2GTWA 2XTJB 5DXWA 2Z8WC 4OM1H 4MB3A 2Z8SA 5JW4M 1FQ9C 2A83A 5IWLA 2AKRA 1TJHH 4WI9A 4F57L 2VO5A 5E2WL 3L9RA 3QUYB 5DFWH 2FEDC 4I2XA 1F6AB 4LCCA 4G8EA 1YDPB 3LKPA 2BY2A 3KDMB 3GBLA 2EXWD 1Z5LB 3OB0K 2B2XH 1I3GL 3HUJB 3UBXI 3IJYB 1URLA 5T3XD 1T0MA 2YMXL 2HKHH 3F7VA 5EOCH 4MHHI 1BIIA 3NFPA 5E99L 4PJGE 5GZOC 5D6DA 4LLVB 1F45A 5HI5C 4KK5C 3HR5B 3REWA 1YQVL 5HJ3A 1P84J 3IFLL 3TGXA 1D5ZA 4P2QA 1C5CH 5FB8B 4X98A 5JOEA 2E7CA 2VSCA 1EFQA 1X5IA 3TBVB 3MRKA 1BZQK 4I48B 3RDTA 5JA8B 5F1SA 3VXUE 1LVEA 2IGFL 3MV7E 3RX5A 4MSWA 2OL3B 1V7NL 4OCLC 2MMXA 5ITFB 5HI3C 5BRZE 5HD8D 4K3GA 4Z7NF 2HH0L 5F6IB 4KRLB 2N1KA 3Q1SL 3UBXB 4NKQB 1DLFH 1MHPL 1S5HA 3IJSA 5CKAA 1JZ6A 1BD2D 2PW1B 4YC2B 1JPTL 1N26A 3JZ7A 4GRLA 4OZGA 4UTAH 2WWKT 1U41A 4ODVL 4U1SA 4XPAL 4HUMB 3S96B 5EFIB 3TN0B 5DWUL 2CXKA 2D4FA 2DMKA 4F80A 4Z77B 3HE7D 4LFHG 5CHNA 3CVHB 3WYRA 3IDMA 1CK0H 4GBXA 2V2WA 4GXVL 5EBMB 4Y7MA 2IMMA 3QCTL 2AK4E 1NEZG 4L29B 3IDIB 3TIDB 1MI5E 3L7FB 1IEAA 2F58L 4IRSD 3OKKB 3IU3A 4WFFE 1IT9L 3K2UL 5J06A 1DQML 1MRCL 1QLFB 4P23B 3UJJL 3IDYC 4AEEA 4MYWB 3IKCB 1CDGA 4OUUB 2GJZB 3RA7L 3KJ6L 4QEGA 4R0LA 4JFPB 1MIML 3FN9A 1ZT4B 4P9MH 3QDMA 1G7HB 5I1HL 1R24B 2VLRB 5I30H 3V6BR 4WI5A 2XG4A 1WT5C 5IG7B 2WINB 5KVFH 1BJ1H 4G6FD 3ARGA 1KT2B 1P7QA 4UINL 5D2LF 3PIQB 5E6YA 3HE6D 3QB7C 2OSLA 3RX8A 1ZHKB 2PW2B 5D1ZB 1G7MB 3T65A 4W81A 1VFAB 1OTTC 4J3SA 4R7NA 2PO6C 2Q1EA 1PKOA 1DANT 4DFIA 4Q58C 4HK0B 3T4AA 1JHKL 3OB0H 5I8OL 2AV1B 2CRYA 5FO8A 1WIOA 2ZCHL 1OF2A 1TZIA 5C0JB 4JFQB 3QXUA 5EC2B 4E9LA 3ILQD 3GI9H 4M4RA 4NKOB 1CT8B 1FYTD 1I9JL 5IT2H 3SCMD 4HGKC 4M93B 1KOAA 4ALAL 4YXLH 3DMMC 5DJ2B 5HGBB 1N6QH 5KVDL 3VWKD 5DMGC 5DJXB 4KRPD 4HIIB 4ETQB 4EI5D 1CLOH 2IF7A 2I24N 4YO0B 1N0XH 4C55A 5DC0A 1S7QB 3L3IA 4YDLB 2VC2L 3MBEA 4XCYA 5T1KB 3NFNB 4J7RA 3QEHB 4XXCC 3IGAA 2B1HL 5E95B 2XQYG 2NNAB 5IB5A 3D85D 3T77A 5E2VL 1BZ7A 2P7TB 1RU9L 4P2RD 3QUZB 5EUKB 2VR9A 5IVXF 4ONOA 1T1YB 3O2DL 2WIMA 3DX9A 4LK4A 1Q9LA 3L3HA 2VZTA 3O9WA 4OFYD 1NLDH 1P2CA 2XFXB 3HNSL 1MCRA 1JNHA 4TUKL 1RHFA 4AZ8A 5L0QB 2X1XR 2XY2A 5I1GL 3MJ8B 5KS9E 3DUUA 5FV2A 3FT2A 2VR5A 1J5OH 3UYRH 3IRPX 2IBZX 1PG7X 3QFJB 4RAUA 2PYFB 5ILTL 1J05A 4OF0A 4A6YA 4XMPH 3HB3C 5KN5A 2DM2A 1MCCA 5FGRA 3BYTA 1BBDL 1MJUH 4MXQD 5I1AB 3L5HA 1KCSH 2IQAA 1RIHH 3VGAB 3VXMD 3MRMB 2DI8A 1YPZE 5DJYB 2CKBL 5AZEL 2D3VA 4U1HB 5DJAA 3BISA 2M26A 1MLCA 4P4KD 1KBGL 2X4NB 3PL6A 2FHCA 1T89A 4JM2F 5EA0L 5B38B 5L6YL 4MXWL 2Q7YB 5LWYL 4QYOA 3RNQB 1RZGA 2FECL 4LQFL 3BN9C 3KLAB 1A22B 4JPIA 4HIJA 3V9FA 1UA6H 2QQLH 3ZLQC 5CZVL 2VAAA 3UTZA 3VWJD 4Z0XB 3PWNA 1Y0LB 4MD5B 1CD1A 1H15B 3UTTB 3HG1D 2VDRL 2AEIT 3IDGA 5HYJB 1KCUL 4XMKL 4APQC 4HH8A 1CXLA 1EUTA 4PJCE 4MLSA 3TPKA 1DEEA 4BH8B 5JOFA 5EORH 2R8SH 3O3AA 1T7XA 5E2TL 4QRTA 4ZTPH 2B4CC 4FQCL 4JHBA 4PJ5D 5AEAA 1R3LA 1CQKA 2W0PA 4PGDA 5ERWB 3V0VB 2CO6B 5F9DC 4XPBH 1YN7B 4YFEA 1FVCB 4M6MH 1XFPA 4TNVF 5HYEA 4PJXB 5FGSA 3QXAA 12E8H 3SY0A 5GZOD 4YEEA 3P77A 3H9HB 4V1DD 2QEJA 4S10A 1P4BL 4Z9KB 4G9FE 4LVHC 2EDXA 4XPFL 3Q3GB 2PTTA 5SWSA 2ZUQC 1JI1A 4BSWA 3OAYK 4D2NA 4NOBA 5L2KA 3ZT7A 4DW2L 1BFOB 1LDSA 4R96B 4Y16D 2CRIA 1LEIB 1S7SA 1X5LA 3E0GA 5HSFA 2F53D 2L4OA 1OVZA 1KJMB 3G04A 4M7LH 3K4ZA 1T5WB 4L8DB 2BDNL 4FQJL 5C0CA 4LSQL 2D7QA 2VABB 1IARB 4R4ND 4BZ1H 1W8OA 1OP3K 4KKBC 3SJVA 4J1UA 1PQZA 4KY1H 3TP4A 1FORH 4Z7WA 1AJ7H 2APXA 4I4WB 4PJ7A 3OMZA 5K59E 5SWZD 3IXAA 4A6YH 1W72A 5T1LA 4NWUL 4MWFB 1ZVYA 1E4JA 5D72L 3WN5C 1AR2A 4ZOBA 4YBLB 3KPTA 3KXFE 3UDWC 2OTUB 2R1XA 4JPKH 3MV8D 3DI2B 2CLRA 5K9JH 3PWJA 1DFBH 3GK8L 1Y6MR 4TN9A 1LO4H 2B7DT 3QO0A 6CGTA 4G8FA 4Q2ZB 2ATPB 2VH5H 2X89D 5HVGB 5HY9B 5I0DA 4W4NA 5C09D 2FIKA 5DJCB 5D7JC 3GRWL 4K3DH 5A2LH 3S35X 2Y25A 1JPSH 4UV4L 4OLZH 4JRYE 4Q9QL 1ZGLA 2YA0A 2ESVB 2FL5A 1D5MB 3MRFB 4PJ8D 4QRRE 5IGXH 3PHQB 2HT2C 5JQHC 5MEOA 4OCWL 1OCWH 1F3DJ 1DQDL 2VTFA 4QF1A 2B0SL 4HIHB 4Y4KA 1G7IA 2V7HA 4MJ6A 4LSTH 2YPVH 4HCRA 5IMMA 3IETA 2HKFL 2NQCA 1FLTX 3D48R 1SJEB 1YNTA 5TDNB 3CX2A 1MFCL 3QDAA 3QQ4A 1AD9A 4PJDA 1FZJB 4BELD 1GZQB 4WY7H 3RL1B 3RTQC 4WEBL 4XWGH 1R3JA 2MNUA 3BD4A 4F58H 1I3UA 1I8MB 4PRHD 1KIRB 1G7PA 2G60H 1NKOA 1T7VA 2VUOA 4DOHB 1K8IB 2G75A 3CVIL 3M8OL 2HLAB 2R0WH 3SKUD 4PG9A 4DGYL 2NX5B 4ZUWA 4FTVB 1Z9LA 5B39A 4YDJB 1B0GB 5DMKB 5L8LB 4ODWA 4CVXA 4KZDH 3PWPA 1E6OL 4L4VD 4DWHA 2BOCB 3HNVL 2NYYC 5MENA 4HUXA 2YZ8A 4OQTL 3INUL 4B0MM 3BX7C 5HHNA 2YXMA 3KPRA 2VLKD 2X5PA 3X12B 2MJWA 1L4IA 2I5YH 5D7IF 1N4XL 5F71A 1OP3H 2W65B 5JPNB 5TE4L 2CMRH 3IFPA 4YE4L 1RUKH 4YGVB 4OCSL 4UOW1 3RWCB 4LLUA 1QSFB 4XAKD 4YXHH 3FO2A 4N68A 1NGZB 1T1XA 1UWGH 2BRRH 1JGUL 1MLBB 5KW9L 5MP6H 4N5UA 5AWNL 4PP1D 1TQBB 4FG6C 4PRIB 3ZTJG 5C0AA 4R9HA 1FZKB 4KV5E 4LHUB 5DURB 1NAKL 4DTGH 5C6WH 1V3LA 2J8UB 5LGHL 1XCQA 1J0IA 5DR5L 5GGVH 1KELL 5JMRA 3U36B 2AEWA 1MPAL 3LHPL 1OP5K 4MCZB 4P46C 3MRNB 5KG9B 2NY6C 1M71B 1MFDL 1HNFA 1NBZB 4GKNB 4N0FB 3GUTB 1R5IB 2NTFB 3IF1B 1ZTXH 1NL0L 3M17A 4KKCD 4BH7B 5D7LD 4M7KH 4U6YA 1I8KA 2APFA 1IFHL 2Q3AA 3O6MH 5CJXC 1RUPL 5JXAL 5EUOB 4HJGA 4W6YB 4G6MH 1WFNA 2DTML 2OZ4L 3OKMA 4HCRH 2Z31A 3DJ9A 4PJ9A 4RA0C 4RGMC 1JUFB 4I3SL 4PBVC 4PJIB 1QHOA 1FFQA 4K8RD 2D0FA 5F9AC 1IKNC 2HJLA 1LEKB 4Z7OE 4Z18A 3HZYA 1KG0B 5LKNA 2HT4C 1PYWB 5EBWA 3AM8A 1ZHNA 2P44B 4GUPA 4NIKB 3BUYB 5DI8A 2E8YA 3SHSA 1YUHA 2AJ3A 5E8EA 3V52H 3WUWB 1Q1JH 4GFTB 4NZUH 4JM4L 5HHXL 4GS7C 3RWJB 4M48H 5F7LB 1Q72L 3MLPA 3FQWA 4JFHE 1U8JB 1H9VA 5HHMD 3GNML 1GVIA 5IIEB 4NQSB 1VGKB 2EC9T 3H7BA 5FYLD 2R0ZH 1NANH 3T0EE 4R4BB 2JJVA 1S78C 1I1FB 3SGEI 5EU6B 4O2EA 5JHDD 4WDIB 2CUIA 3QEQD 3V6OE 1UM6L 3QRGH 4JO2H 3EYUL 4FFVC 2NY1D 2F54E 5IQ9B 3PWUA 5IV2A 4MNHB 1VGEH 2G9HB 2R9HD 5ANMB 2MPAL 3RIFK 5T33L 1VKXA 4X7FC 1EEUA 4NZTL 5D6CA 1RULH 1RZIB 4N0YL 4XPGH 4FFZL 3WHXB 4UIKL 5IMOA 4Z0BL 1OP5H 1BVKA 2YPLD 4YHYB 4JZNA 1B0RA 5EZLA 4DFHA 1EPFA 4PY8I 3O8XC 5HYSA 1F90H 3FZUD 1RD6A 4PRDA 5FKAA 4RISH 4XCFL 2EEAA 1Q94B 4XHQA 1H0DB 2EZ0C 2E27L 3VXTA 4DKFL 4X7TA 5ISZA 1BQHA 2WBWB 3NZ8B 5D7JD 2FYYA 1RK1B 2YD2A 4XP5L 3P0YH 3GSNB 3O11B 4NO5B 1EGJA 3AU1B 4J4PA 1NDMB 5IESL 4RAVA 4NDMA 3R8QA 1ZE3C 2OTPA 4Y2DD 5FK9A 5HHOD 4NKDA 2FHFA 2Q20A 4XVJH 2VDNH 3B43A 1DQTA 4M1DL 5DHVB 4ZFOL 1I9IL 1RI8A 4JRXD 3MNWB 3CFKA 5KSBF 4IDJL 4O9HH 2Q8AL 2ZOLB 3WFEL 1KN2H 4WW2A 1R3KA 4KC3B 2ZPKL 3DVGA 1JL8A 5DRXB 2BVOB 3TC9A 3VE0A 5DJZB 2C1PA 5BQ7B 3C60B 3G6AA 4MNQA 2OR7A 4AQOA 3TPUA 3ARYA 1QSZA 3FJTA 4KROD 2YC1A 4JM2D 3REVB 5EIQA 1NEZB 3KPMA 3BKMH 5GGQH 3UEZA 1NGPH 1HHHA 3QUXB 3VFRA 3A67H 2YWZA 2PYEE 5D70L 4M3JA 3QUMH 4UT7L 4YDVA 4FZ8H 4PJFA 3W9DA 4ZODA 3LKQB 2WBKA 3CSPA 1WZ1H 1J1OH 3QG6B 4IOSD 3SDAB 2ZSWA 2OR9H 3W11D 3QT2A 5KOVC 5EIIB 3RFZC 3TNMB 2Q76B 1LWRA 3FTGA 5IEHA 4BJLA 2ITDA 2FR4B 4LSRH 1E28B 3OKNB 3BPOC 4P48A 1JGEB 2EECA 2DWDA 2IFFL 2MFNA 3VXRD 3WXVL 3TBTA 1AD0B 1JMXA 4X4ZA 4PG2C 2GAZA 3LOWA 2OX5A 2DBLH 2XZZA 4XI5D 3HI1A 4FG6D 4FQXA 5A2KH 1MIEH 3B6SA 4ZXBC 1J8HD 2FEEL 1XGQB 4IIQA 4ZSOA 4XP9H 4G7YL 3TN0D 3L95A 2CIIB 1T21A 5ELIA 1WWCA 3PQYB 2IAMA 3EJYD 4Q0XL 1EJOL 4UI2A 4JLRB 5EU5A 1YEJL 2C3VA 3K74B 4NO2B 2GCYB 4HH9A 1AXTL 4O2FB 4WFGE 2CDFB 4UDTA 4QNPE 2ADJB 3AREA 4UBDD 4I18C 1C16B 2IANB 3H42H 1VEPA 4QHLA 1QSEA 4ZUUB 2C4FU 1FVDB 3J8F7 4JY6B 5I66A 4DQOL 3MNVB 4PY8J 1JMZA 3ALPA 2DQIH 3SOBL 4JQIL 2AJUH 3TBYB 3CXDH 1S9WB 1E4KA 5FM5O 4TUJB 3SGJC 4U6XA 4Z7UF 3KDMA 4GRWH 1R3IH 4JFYA 5HTSA 3BKCL 2HMIC 4G9DA 3FQTB 4ZDHB 1H3PL 5K9KB 3PDOB 5D1ZD 4PB9H 2VISB 2VLLB 1ZANH 4EDWH 3SE8H 3SDDC 2R1YA 1OW0C 5IW3A 4PJHF 5FB8A 1P4IH 1UZ8A 4HD9A 3TBVA 4CADB 4AIZA 4CKVX 2W9EL 3ZT6A 5EZIH 4OCXH 4XXDA 4QWWC 4RFEA 3SKMB 4NQVA 5CP7A 4AEIH 5CD5C 5IF0A 5ICXB 4I0PA 1GL4B 5C0BE 1KJ2H 4LRNH 1CFNA 1M7DA 2YD6A 3SKOB 3UBXA 1L6ZA 3UP1A 1DANU 1JZ2A 2B39A 5CZXC 4FQ1L 4I3RH 1CLYH 2ADFL 2JCCE 3DMMB 3L1OL 1LHZA 1JGVL 3B2VL 3KJ4C 5F89B 4M5YL 4X8JA 5FUZH 1YMMA 2XWTA 5EFIA 3T0XA 5SX4I 4FFVD 4MMXC 4N0UA 3KPQB 3SDYH 1NBQA 1CICC 4JZJB 3HAEH 2NMSA 4M7ZC 4NQTA 5EBMA 4IRJB 3BIKB 4NQUA 1RZFH 3L5WB 3OKDA 1EO8H 4FN0A 3UTSB 1BQLH 1F6FB 5CILL 1AO7E 3WIHH 1HXMA 3V5DA 3K7UA 4JFPA 4NBYB 1G7HA 3MV9D 2V9QA 35C8H 3RBSA 5E08H 2C1OB 1GJIA 3QDJA 4Z78B 1CLZH 2EDWA 4G8GE 5I8KH 1NGYB 1QFWH 5GJTL 3VFWB 3WFBL 2EZ0D 1HXYB 4LSSL 4PV9B 5CSBA 1VFAA 4PGBB 2JJSC 4NGHH 2H9GA 1NGWA 2GUOA 3LPWA 3EGSA 5FHAH 3UJIL 4QRPB 5IMLB 3VXPB 5IFJB 4NQCD 4OGXH 4HIEB 4DK3A 3JWOL 1CXKA 3CFBB 1N2RA 5E6IC 3Q6GL 1XGYH 3TYGH 4NKOA 2O5YH 2ZUXA 3MACH 1EEQA 5JPMA 3DYMA 3FMGH 2RHEA 3HPJA 4NHUB 4Y19A 2HN7A 3MFFA 3UTTD 3IFNH 4KDVA 4PJGB 4CU8A 1ZA6B 2A6JA 4GAYA 3QAZB 4HIIA 2BVYA 3LPGA 3MRLB 5D71H 3OGCA 4JFEA 1S7QA 1CU4L 5CEZE 2GEEA 4WENB 1IZJA 2D7TL 4O02H 4GW4A 2H32B 1QACA 1QFUL 1IGCH 2ARJA 2R15A 1MCWW 3QDGA 3QIUD 4NN6C 4OJFH 1T03L 4HX1A 3EFDH 5BRZB 1UM4L 1XIWC 4DZ8A 1YEHH 7FABL 2Y6SC 5FUOL 2F5BH 3JWNC 1NFIA 5JA9A 3WJJA 2NY3C 4ZQKB 3IT8D 3V5HA 3L6FB 2DYPB 1YEDB 1HN1A 4HWBA 5DQ9B 3C6LA 1FL3B 4ENED 1X5AA 5KSAD 1NSNL 4X6DE 4LEOB 5E9DA 2HJFA 2WQ8A 2DM7A 1OAYH 2B2XL 1HK6A 3CFDB 4C56D 2AK4B 2HKHL 2Z91B 2EXYC 3RWHB 2VDLH 2ZUQB 5I1LA 5J1AB 3BWUC 4XGZA 4ZUTB 2BCKB 3CIQA 3NMEA 5CBAA 3S37X 4ETYA 5MERA 1C5CL 4OZIF 3RUGE 4MS8D 4PJAF 3FFDA 3TVMB 4X6EB 3WE6B 43CAB 2XN9E 3NZHH 5DK2B 3BUTA 1TTUA 3QXDA 3EO9H 2QKIB 4Y5YC 5B3JE 5D1QC 5DVOA 2N7AA 3BQUC 1WZKA 5GGRA 4YZFE 3FRPG 3UAJD 3RKDC 5ICYA 3LIZH 1Y0LA 5F88A 3ROOA 3F58H 1T7WA 3GB7A 5C0IA 1DLFL 3I3EA 4ZAKA 4R2GC 4RMSA 3WN5B 1LO3L 4KK8C 5JW4Q 5I18H 1EXUB 3EJZD 4R7DA 4UTAL 4L4TE 1OD7A 2BSSB 3S4SA 3TZVC 5A16B 4M00A 5ITBL 5CSGA 2O5ZH 1JVKA 2A2QT 3MZGB 1K2DB 3IFOA 5J8OA 1N3NA 2BNRE 2ESVD 5TQ0H 1JNLH 1U92B 3EDKA 1F8TH 5AZ2H 1FVCA 5FFLA 4PGEB 3BGMB 1CGSL 4QY8B 2EKSB 3SEPA 1CK0L 5IVOA 3UPAA 1EVTC 4MXVF 4WO4A 2QQQA 2XNAA 4JFDA 5T5FH 5JTWA 1G9ML 1I7UB 5KSUB 1G6RA 1FNLA 3ZKMC 4YDIH 1DLHB 1WSST 2F8OA 4CNIB 3H9HA 4WV1B 3HMXH 3RGVD 3TV3H 4P9ML 3T8XA 5TF1H 1IC5H 5FCUH 3S88H 4XWOC 2MHAB 5ICZB 2PETA 5LQBH 1A2YB 1I9RH 1WBYB 1B6DA 5HHQB 1C7TA 4JVPA 3F8UB 4TQEH 1LEIA 4X0KB 5GIRB 3RTQB 2NX5D 5GRVL 3BP6B 4F15C 4FTVD 4LKCB 4S1QH 1FC2D 5E1HB 5ENWA 3RWEB 5E5MA 4WHYG 3OF6D 3ARBC 3ULUE 5KS9B 2YKLL 2OMNA 2BSTB 1DQLH 43C9A 1ED3A 3TLRA 1MOEA 4XBGA 4OZ4B 3EOBA 4JG1L 2F74A 2D9CA 1U8KA 5HVWA 1MWAA 2Z92A 4KJPD 4QXGH 4X4YB 5IT2L 4YXLL 4S1SH 2MOVA 5DFVC 3QQ9D 3BE1H 1BQUA 3KPSB 1CLOL 3PHOB 3LZFH 4KI1A 2HFTA 3Q6FB 3KYAA 2CKBB 1SJVA 3JWOC 2DIBA 4BUHA 2MKLC 1FV1A 1IEBA 2GITB 3NIFE 1T2QH 2VXSL 4L3EA 2DL2A 1UXSA 1G9NC 3VFVB 2KH2B 5C70A 4KGLA 1HSAA 3MJ7B 3LPFA 2K3TA 4PY7B 1WWAX 3GMRB 1AKJA 1QEWA 4XNMB 1OSPH 2Q3ZA 1JTPA 2X6MA 4PJCB 4HDIA 5E1AB 5DD3L 5KSVA 3B9KC 1OOAA 3RZCB 5IQ7H 2J4WH 4EN3C 3GSOB 4U0RC 3LSOA 5AUMA 4OZGE 1U58B 2QQNH 1J5OL 2P24A 3UYRL 1TCRA 4FQPA 4P46B 4LOUD 5KAQF 2NY6B 1XF5A 1C5DA 3V4PH 4HIXL 4LDLB 3BZDA 1MJUL 1XGPA 4WUUA 2VOTA 2LFGA 3VFSB 1KCSL 1RIHL 3DRQB 3GEWB 4GW1A 3KPNB 4PBXA 4EDXB 3FT4B 1KEGH 1AFVH 3UTQB 1PZUB 4HWZB 3JTSB 2W92A 1NGQH 3OPZL 4QXTB 3MYJB 1INQB 3FQNB 5F7DB 1Q9KA 4LSVL 4RGMB 1ZS8B 2FWOA 3O4OB 3NCJH 4AQ1B 2QQLL 2DQTH 3Q0HA 5K9OA 4UB0L 1SYSB 1CD8A 5GS0D 4PUBH 1M6OB 4J3OC 4KAQL 4PV8B 4MMZC 1W0VA 1U3JA 1A4KB 1U3ZA 4YGVA 3T4YA 3MOAL 3QHTC 4HSQA 3BI9X 1UB5A 1U91B 1OWRM 1QSFA 4D8PA 1CFSB 1NGZA 3X11A 3DGGA 4GOSA 4N90E 3I6LE 3I75B 5C08B 1B6UA 4HF5H 1AHWC 3GMPA 3I50H 4GS7B 1MWAH 1QFPA 1KJVB 1DBBH 3MGAA 2X4SA 3W2DH 4XPBL 4J23A 4AT6A 5DRZB 2WUCH 4LNVA 1U8QA 5CIPB