4U6TA

Crystal structure of the clostridium histolyticum colh collagenase polycystic kidney disease-like domain 2a at 1.76 angstrom resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
NSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNKSNEENPEHSYDKVGTYTVKLKVTDDKGESSVSTTTAEIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ColH protein
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
total genus 20
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6tA00
4G9FB 3VWJB 1VHPA 3X3FL 3EYVB 5EU7E 5CJQH 1Y18A 5D7LA 3U48A 5CIPB 4XP5L 2VRAA 4P3DA 1I8KA 4JDZB 3RNKA 3CFEB 1A9EB 5F7YC 4PJFE 1QFUH 1JNHB 4I9WD 3S97C 3ARGD 4PTUB 4ZS7L 3FFCE 2ZUUA 2B39A 1FLTX 5HHXH 1KN2L 2M8XA 1XF3B 4Z0XA 4PR5A 2ZUTA 4WW1B 5DEZA 3V5DA 2YWYA 3S37L 5K59F 3I9GH 3IJYB 1C08A 4JQVC 2NX5D 4WI8A 3RWCA 5IBUB 1IEHA 4YX2L 4Z7WB 3GRWH 2NXZB 4YBQD 2V9QA 3VXRB 1P53A 1G7QB 2VDRH 3EYOA 1CK0H 5GIRA 1NGZB 1Y6MR 4L4VB 2PR4L 4ZXBC 3V7MA 5MEOB 4K71B 3VFSA 5F96L 4KVNL 5JA8B 2FZ3B 3OAZH 2DD8L 5C0GB 3NCYP 1CD9B 3WXWH 4RMWA 2NW2A 5E0QA 4G80A 2BOCB 5IG7B 5T1KB 4HJ0C 5ALBH 2QTEA 5DZOA 5IVXE 1K2DB 4K8RD 3TFKC 1G6RB 1G7MA 5ISZE 3QXAA 1FZJB 3M8OL 3R06B 4JPWL 3E1F1 1INQB 1ORQA 1G7LA 3CFBB 3SDXE 4Z7VF 3EOBA 4P5MB 3RY5A 5C0DB 3LB6D 1BM3L 1BFOB 4M6ML 4ZO9A 1DQJA 5DUBA 4NCC2 1WFNA 2G60L 3IDUA 5EWIH 1MEXL 5B4MC 4H26A 1CGSH 1F90H 5D7IA 3QDJA 5BS0D 2VDPH 3TWCH 2YZ8A 3VFVB 3F7PC 4BH8B 1IQWH 5D7JA 4P2OB 3C6LA 3LQZA 5F7WC 3IVKA 5GGUB 1IM9D 4PFEA 2QQLL 4GAYA 4Z7VB 3QAZB 4OCRH 2WWMD 4NZRH 1GAFH 3LV3B 3K0WA 3RJQB 3WCYA 2IPTH 4OLZH 2DI9A 2YBRA 4UQ2B 5JPMB 2PO6A 4QRRB 5DHVA 4XBGA 4OLYL 1MCHA 4Q2ZA 1KXVC 1CGVA 2RIKA 3N50A 1YPZE 3CSPA 3RVTC 1HHIA 1ZHLB 1ED3A 1MVUA 4MD4B 4MX7A 1OAZH 1ZSDA 4KDTA 4X4ME 2AP2A 3WE6B 1XZ0B 1QO3A 5L2JB 5EZJA 5T3ZD 3WNPA 2NY5H 3MRIA 1VGEL 4JO3H 2EH7L 4YDIL 3V8OA 3PGDA 2HVJB 1NC2D 1UWEL 4JFDD 1RURL 3NA9L 5AD0A 5T1LA 1JYWA 1RK1A 2X4PB 3ZT5A 3QA3B 2V2WA 2R2EA 2N4IA 3MCKB 5J11C 4MJIB 2EXYC 2NNAA 3VWKA 4P23B 4YXKH 4MA7H 3X3GL 1ODAA 3JWOL 4L8SA 2D2OA 2W9DH 3QJHB 3OJ2C 5FDYA 3MV7A 1A3RH 4NUGL 4WI4A 1QD0A 5C08B 4NNPL 1RHHA 5D7JC 5I18L 1EXUA 3DI2B 4F7PA 3LEVL 3LS4L 5C0AD 3RFZC 2BXZA 5I1JL 4MNQE 4LGRB 3C6LC 3HAEB 3OAZK 4M6NL 5EUOF 4KKLC 4D9LH 3WFBH 4RCAA 1FO0B 1TTGA 1JGLL 1OOAA 4UV4L 1MH5B 5EZOL 1YEFH 2DWEA 3TA3D 3NCFB 2A77H 1QVOB 4F57H 2APFA 1S7QB 2PO6C 4K3HA 4YK4C 5F7HA 2FEDC 5ILTH 1JPGB 3O8XD 4LCYA 2YKLH 1WWBX 2MPAH 3MRHA 3ZDYE 2E7HA 2ZKHL 2VXSH 3OR6A 5C6TH 3J8F7 3AU1A 4HBQA 4M7ZB 2ARJA 2Y36H 3VMNA 1U41A 3IFLH 4HDIA 5BVJB 5DEGA 5L7XH 3QWRD 1KIQB 4KK6D 4ZO8A 2ZOLB 4PV8A 2ATKB 1DN0A 2X40A 2F19H 43CAB 3V79C 1Q0XL 3LN4A 5KAQG 2WSKA 4HMDA 3LKSA 2H3NA 4UB0L 3SGEH 3O0RH 1EHAA 1BGXH 3VWKC 3GJEB 3V5HB 1XIWD 2AK1L 5H94B 2GTWB 3MREB 4TOYH 2Z91B 4JGMA 4L8SC 5AZ2L 5HD8C 43C9A 3QIUA 1OSZB 2JIXD 4D0BA 1CBVL 4JG0L 5HTSA 4KJPD 3WYRA 4ERSL 1IC5H 5C8JB 1JUFB 3WO4C 3MRCA 4PGEB 5C07E 3MNWB 5DUPL 1KIUA 2X1QA 3SDDD 1P1ZA 4NO5A 1Z5LA 5D1XA 1MAML 1RAMA 3WUWB 1QOKA 3B2VL 2YD2A 1NBQA 5F1IA 2YWZA 1TNNA 3QDGD 2ZG3A 3PWLB 4DCQB 1TZGH 3Q2CA 5DQJA 5KSBF 3JUZA 2APWA 2CMRH 4XNXL 4CN1A 3ARBC 3L3OA 3O81A 1RY7B 2GYSA 4S10A 1FN4B 1XGUA 2R15A 3OAYH 5FAAA 2D7NA 1X6LA 3D25A 1BFVL 1G7HA 4C57C 5E8PB 2Q3ZA 3TYFB 1VCAA 5DD3H 4WFGE 3PWUA 4U1NB 5CBAA 4ZS6D 3T3PF 4YAQA 4XNMB 1NGQL 4WY7H 4FZ8H 2VZTA 2ZCKH 5A1AA 2NY0C 1FCCA 1LEGB 2FBJH 1FZKA 2J8UE 3BZ4A 3N9GL 2EYSA 5MEND 5ACZB 4MJ6B 4Y4KD 3I75B 4NN7C 4MXQD 1IBGH 3IDXL 4XTRC 5C0BD 4LP5A 4DGYL 4KU1A 3ZE0F 4MXWL 5F7FA 1MY7A 4NKDA 2VZVA 2X6MA 2YD5A 4JZJA 1I1AD 1T1ZA 2AV1A 1IAKB 1KCLA 1PG7H 4XPBL 2X89D 3QG7L 4JG1L 3HE7A 5CEYA 4NQTA 2GFBA 1PY4A 4QXWA 4Z78B 4YWGH 5D7LE 1RMFL 2DKSA 2DICA 2PNDA 5DJXA 5E6IC 2X4QB 1UXWA 4LLVA 4XMKL 1HK6A 2VDNL 4JFZL 2L7UA 2FX9H 3JUYA 1XGPB 2DLTA 5BVPL 5CJOL 3IDMB 1SY6H 3ZL4H 1SJEB 3QIUC 5KW9L 3ZDXF 4F15B 1K5NA 3UTTB 1FNSH 3IXAA 4O2FA 3DMMA 5T3XE 1A7OL 1GPOH 1QRNB 4RAUA 1NLBH 4YQXL 2D4DA 2YPVH 4HWEH 3IGAB 4Y4FD 4WWID 1G7PB 2D9QB 5D1XC 4YDLC 4AQ1B 1FHGA 1R3LB 2UZIL 3JTTB 4QRQA 1AHWB 4H1LA 4TUJA 2WLYA 3RY6A 4XBPA 1MCBA 4J1UA 3GBML 3TO2B 1AGBB 1HOCB 3QNXA 4I5BA 5J12C 4MJ4A 1CLYH 3TZVB 4D0CA 1BHGA 3VXTA 3MLWL 2X4UB 1ACYL 1AXTH 3T0ED 5FHBL 3VFWB 1YUHB 1EEQA 5C0JA 2J3SA 3B5GA 2R39A 2G9HB 4FQQB 4MD5A 2H32B 3FCTB 4NDMA 3QISA 4IRSC 5DQDL 4W6WB 4MYWB 4W4NA 2VQ1B 3EJJX 2UV3A 1TJHL 2XZCL 4PBVC 4S0SD 3VCLA 1JWSB 5D4QA 1GZQB 2HG5A 4YHZL 1R3JA 1B0RA 3TJHC 3IDNB 2MHAA 3EYFB 1WAAA 3G6DL 1JWUB 3SPVB 3L6FB 1EDQA 1OGAE 2ED8A 3ZKXC 4XCEB 3HE7C 1LO3H 4IM8A 2R0ZL 3VFUB 2F5BL 4YHPA 1KPRB 4PY7B 3QZWB 2GY7B 3RP1A 4X6DA 5EORL 1MHCB 2I24N 3PL6A 4G5ZH 5AZEL 4MA3B 4JFOA 1JTOA 3Q1SH 1OPGH 4I2XB 5TDPB 1D5BB 5E56A 3OAYK 3VXUB 2YC1A 4JFFA 5F9DC 3GI9H 3DMMC 4RX4D 3PGCA 2Z35B 5IESH 4YDVA 1N7ML 3CDGA 1NKRA 2P1YA 2DJUA 3JTSA 4HIXH 5I1EH 1HXYB 3HNVL 5SV3A 1QA9A 3TEUA 4PGBA 3RY6C 6FABL 2I60H 1DBBL 4JJ5B 4Z7QE 4GAJL 4JFED 3QFJD 1S5IL 2HT4D 4PUBH 3VFGH 3BD5A 1JHKL 1DBAL 3TV3L 1B90A 1A6AA 1KOAA 3JV0A 1IGCH 4EXKA 35C8L 3EOAB 5E8DL 4EUPB 4XWGH 3T8XB 4RGOH 4PRIA 3B2UD 3GSQB 4X98A 4Y16D 4OKDA 4Z8FH 3TIDB 3B4NA 2VDLH 3O45B 1I8IA 4S2SB 3BW9A 5IEHA 1CFBA 4KGJA 2NTFB 4TQEL 4X5WB 2GJ6E 2JJWA 5FYJD 4JRYB 1JBJA 4FTVB 2I5YL 3LRSB 3T04D 2I07A 2BCKA 1G1YA 4KAQH 3VW3H 1A4KB 3F8UB 4M1DH 3MRFB 5CEXA 5HHOA 2BY2A 2ADGB 4XNYH 5KSUB 3OGOE 2X10A 5C3LD 3KPQB 4QCIB 1PKQB 1WZKA 3C2AL 5TDOB 4R96A 1QFWM 3PL6C 4HCRL 4WUUB 3SKMB 1IMHC 3LKRB 4K3GA 4JZOB 3BN9D 3PJSA 4JFXB 1DVFD 1P6FA 5F70A 4OCWL 4HKXB 4HLJA 4MQTB 3UBXA 2H41A 1IJ9A 4NQSB 2CIIA 1NAMH 4X7SH 4XP1H 1C1EL 1J12A 1I1FB 5INCB 5DJCB 4GW4A 3BHBA 1AIFB 2VXTL 3IFPA 1MHEA 3GJFH 2AJZB 3BT2H 3I50H 3KPNA 3UYRH 2W92A 5HI5D 3O11A 1B6UA 1Q94B 1MNUL 5E2VL 5D2NB 4H20H 3GHEL 3AXLB 1MCWM 1H8NA 4IOFD 3SE3A 2C7UA 1DLFL 4NT6A 3E0GA 5FYKH 2B1AH 5GGVL 3CSGA 5FA3B 5C9JA 3P3YA 3BKYH 4X4XB 5EOCH 3THMH 1DL7L 1HINH 3BPCB 1SBBA 5I73B 1UKSA 1IGJB 3HRPA 4PJEA 4D8PB 4YXHL 4X7DC 4AIOA 3KXFD 1WISA 4LCWE 2X4SB 4N0UB 4HXAH 2EEAA 2W07A 5AUMA 5T5NG 4KWUA 3BKJH 4N1HB 2VITB 4L1DA 1OCWH 5BRZB 3RX8A 3KJ4C 5GRWA 1NDGA 5C0CA 5DVOA 4M48H 4NQXA 1EO5A 4MAYA 5JW3L 2IH1A 2LU4A 1R0AH 3SGDI 4MB5A 1U93A 5F93C 3JWDH 1QSEB 1IAII 2VISA 2BNRD 2HJLA 3E6FA 4DW2H 4FQXD 1R3IH 5DJ0B 1NGWB 1A4JA 4V1DA 4JY6B 4ZUTA 1W0WB 3MRRA 3BZFB 4HFUL 2N56A 3O6MH 2OL3L 5I19L 2UWEB 4IMLA 1KB5L 1QBAA 3VXSD 4YXLL 1YQVH 2HJKA 4HPYL 4LQ1A 5EOQL 3IETB 1ZGLM 1JIBA 3V6ZB 4R2GC 3BYYA 2UYLA 2DQJH 4IRJB 5DVMA 2LABA 4W6XB 1W0VB 4RBPK 4YNYA 3WJJA 4NKIL 1I3GL 3KPRD 3UTQA 1IGIH 1RFDH 4Q6IB 3MLYH 4NFBA 5LAXB 5CD3B 3DV6B 4AY0A 3JXAA 3SE3C 3T77A 1A6ZB 4CDHA 5JQ6L 4D94A 1RIUL 4MNGB 3PHQA 2AEWA 4E9LA 4OF7A 1X4YA 1C5DA 4G8GB 3BXNA 2R8SH 4TUKH 1HHGA 2DWDB 2NY4B 5J8OA 1CVSC 3MOAL 5CEZE 4BQ9A 4E0RB 3ARGB 3EGSA 1YECH 3QH3B 2ZUQB 3LRHA 2FO4B 3T0XA 2LU7A 1NUGA 1T7VA 2F54D 3P9WB 2KH2B 3WXVH 3U7AA 2O5ZL 4RMUA 4XNQB 4M7KL 4TTGA 2YR3A 3ES6A 3EFDH 4GKZA 3QO1B 2ZPKL 4NQCE 3IDYB 1MJ8L 5EIVA 3TNMB 5DD1L 3CLFL 1TIUA 2FJFA 1QFHA 2CUIA 1DANU 4K3DL 4PG9A 4TPRL 1RSFA 3B9KA 2EEBA 1YNKL 2EXWC 4KQ4H 4NBXB 5EFIA 5B3JF 3DRTA 4NNXB 4JGJA 4P3CH 1R6VA 4ZD3L 4HH8A 1V3JA 3OKKA 3VFRB 4PJ7F 2FX7L 5J6GA 1MWAA 5TH2B 3U0TB 4K7PX 2GY5A 2APBA 3WD5L 5C7XH 4IS6B 4EOWH 2QL1A 2N7BA 4EI6B 4X0KA 4UOW1 1GGCL 2EDJA 3AB0B 5HHPB 3AROA 5HHNB 5F6HJ 2NY1D 3ZZ1A 3RA7L 2VZUA 1EFXB 4BQCA 4G43A 1MLCB 3GBNL 3HR6A 4LVHB 1KJVB 1JZ8A 3WJJC 6CGTA 2JK5B 1U8NB 3T3MF 3QQ9C 1AJ7L 1QBMH 3QUXB 4APQB 2C26A 5IOPA 2QADB 4IDJH 4MDJA 1F58L 3OPZL 5BS0B 3SO3C 4AM0B 1XEDA 2I9TB 1GHFL 4XZUB 5HHVL 3NA4A 4QRTB 1NFDB 5F1NB 1NMBL 2QHRL 4OCSH 2L4OA 4LMQE 4OM0H 3T65A 3O2DL 4EVNA 4MNHA 1H8SA 2XA3A 1CT8A 4LSSL 3OXSA 3N85H 3P4MB 4NIKB 4HK0B 5IB4A 3MRLA 3LH2H 1FIEA 2BY1A 4R4BA 2CXGA 2GAZB 2VR4A 1CXLA 2E6JA 1TMCB 1IE5A 4KXZH 4LSRL 1G7JB 1TVHA 4JB9H 1EK3A 2R0KL 1CZ8H 3B9KC 2AK4E 2BMKA 4OIIL 4PP2A 5IVNA 3DXAA 4ETYA 1BLNB 4XVTL 5CGTA 4D9RE 2W91A 4LNRB 2ZCLH 1JNJA 4UNUA 1DBKH 2CO7B 1MRCL 1P4IL 3BJLA 5AYUH 3GSUB 1TCMA 2V17L 5FYLH 2HKHL 4WNQA 2P4AB 1A0QH 2BY0A 1WBZA 3ZTNL 4FZEH 3AFLA 5TDNA 1EIBA 5EO9B 3SE8L 4JFDB 2BVTA 3N0PB 2NXYD 4LFHD 3TVMA 3BUYB 1ZT1A 3C60B 3PE9A 5LXGH 2X4RB 1RJYB 4HX1B 3GSNH 4PRIE 1DZBA 2VLMD 1QYGH 2P45B 4NBYB 4EDWL 2AXFB 2P5EB 4W68A 5IF0B 1MCWW 4FFYH 3OKLB 4RMSA 1T2QL 3QNYB 4MCYA 1G0YR 5C0AB 2BERA 1PLGH 5E24E 3U30C 5MI0C 2VLJB 2VLRE 4O58H 2BVEA 3RVWD 3QQ4B 1R3HB 5DSCB 3C6SA 3ELAT 3P9MB 4HWUA 5ERWA 3W11D 1BOGB 4A6YA 4Z0BH 3PDOB 1OTTC 3CMGA 5DA4A 5KS9A 3KVQA 1R5IB 2ATPB 2VL5B 5C70A 5KVEL 4Y2DA 5AAMA 3W9EA 3HUJF 2ENYA 1FNEA 1SJVA 1Z2KA 2V7HB 1T4KB 3VRJB 5IMKB 4JO1L 3TYGH 3BUTA 4MA8L 4PGDA 5SWSB 3CDFA 4Z7UF 1NBZA 4M8QA 3H0TA 4R6UA 3OKOA 5CSBA 2D3VA 4YPGA 3MJ7A 5F97E 1RZIA 4LARL 5CILL 4HUXB 5BXFB 3MUGA 1P69B 5TJWK 3DX9B 1KLGA 3DUUB 3U7WL 2P8PB 1KCSH 5LBSH 3SKJL 3GM8A 5GGQL 3W5NA 2BX5A 3NIGF 5JIPA 1RZGA 4NPYB 2DI8A 4OIBA 4L9DA 1FG2A 5EU3A 3FQUA 4PJIA 3UJIL 4C56A 3VMPA 3D2UD 4AIZA 1D5XB 1FVCB 5ADOH 1AD0B 4M1CC 3WSQL 4QRPB 3OGCA 2J6EH 5L88L 3FHAA 5GJTL 1N64L 5GGSB 2G5BB 4CN4A 1XIWB 2PYFB 2ERJC 1E27B 4KK9D 1BZQK 1ORSB 4LP4A 2VWEC 4HC1H 1GXEA 4GUPA 3IFNH 4LLDB 4Z7UB 2FD6H 5FO8A 2D31B 2FJGB 4G42B 2JIXB 2RQ8A 4FHBD 1T03L 1TNMA 3SOBL 3MV8A 1SJHA 2JCCF 4YHKL 4P9HC 4LLYA 5KG9B 2X2YA 4W70A 5I8KH 5I1GH 4ZO7A 1D5IH 3SDDB 4RAHA 2Y5TA 4XBEH 1YEGH 4M7JL 3ESUF 3DX8A 2DJ4A 1N5AB 3HNTH 4HKBA 1NCNA 3F58L 3HE6A 3FO2B 4JY5L 5ADPH 3MJ9A 3QDGB 4FQ2H 5HDQH 5IMOB 1XGYL 5I1IH 4HCRA 3WFZA 3RUGE 4GG6B 4K23L 1MCLA 2R4SH 4S1SH 1PSKL 3DWTA 1NGYA 1MFDL 1S7XB 4MSWA 5LGJB 3ULUD 1BX2A 3D39B 4OZ4B 4F58H 4JO4L 1FV1B 1KLUA 3HC0A 3RAJL 2JJUA 4L8CA 1A6PA 5HGBA 5DRNB 2XQYK 4Y2DC 4RFOH 3OMZA 4CU6A 1F13A 1GL4B 1HXMB 5I74C 4V1DE 4XPAH 3N1PC 1MRFL 1YMHB 5IB5A 2A2QT 1MI5E 4XCYB 4LVOB 1U95B 2IAMA 1NCBH 3HMXH 1IGFH 2PXYA 1KG0A 4HUKB 1SM3L 2YPLD 4PBWD 3BFOA 5HGHB 2CDEA 3TO4B 3TBWB 5HVWA 4Y4KB 1TTFA 1M05B 5I9QB 5EIIB 1ZV5A 2IQ9L 1EGJA 3ZHLA 3MUHL 3KPSD 4U3CA 2KZ1B 3DTXA 4NM4H 5BRZA 4G9FA 2EKSA 4DEPB 3VWJA 4R7DB 3MLTB 5D5ME 1HSBA 4IJ3B 1QLRA 3B9VA 5IW1B 1NC4B 5C07D 3BP4B 2DDQH 4EBQL 4NP4H 5D8JH 5EU5B 2AJSL 3F7YB 5EZLB 5F6HI 2FJHA 3CFEA 2P8MB 2D7MA 3L5WB 3VD3A 1PX4A 1RU9L 1CXHA 2C1PA 1H3PH 3VXOA 4PRHE 4PTUA 1HIML 1XF3A 4ZXBD 4WCYH 1H3TA 4WW1A 1F3RB 1S9YA 1NFKA 3LKNB 3NFSH 1HHJA 4Y4FB 4QHMA 3KLHC 1X5GA 4J6RL 1PBYA 3IJYA 4YEFA 3IXTB 4OZHE 1NCUA 3HE6C 5FXCH 5CJ8A 4N0YL 3S37X 4C55A 3Q6FB 3MFFB 3VXRA 1G7QA 4LLMA 3TFKD 4L4VA 4M93C 4JVWA 4QT5B 4GOSA 5CJQL 4EXPX 3QIBB 5C0GA 3RVXC 4I48A 1NMCB 3LEXB 1QR1B 3MJ6A 2HLAB 1KB5A 3EDDA 2HYMA 1UB6B 2BOCA 5T1KA 4WFED 4PRNB 4BFBD 1QFUL 1G6RA 1U2CA 4J8RB 1FZJA 3R06A 2V7NA 2IAMC 3G6JF 5B4MD 3V0VA 5HHXL 2PXYC 1INQA 3OTTA 5LWYH 5E2WH 4AK1A 1F45A 4YZFF 5KVMC 4I3RH 3HLAB 1OT2A 4ONFH 1FL6B 5D7LD 1IEAA 3A6BH 5HVFB 1VB9A 1DQLH 1W8NA 3A6CH 3GRWL 2IQAA 3VXME 4J4PA 3CD4A 1T0MA 5KZCD 5EOTB 4H1LG 3CFJA 2VDRL 1G9NH 5BV7C 3E2HC 5FM4A 3VI4E 5EZIL 1CK0L 3VWJC 1I7ZA 3PP3H 2RHEA 3GMMB 3UZEA 5T3XD 3VFVA 2YD7A 4DK3A 3HR5A 2NLJB 1VENA 1QZ1A 3WXWL 1RQ5A 5JXEA 3NCYS 5ALBL 4P2OA 1A6VH 2HRPH 3NIFF 5GGUA 5GRZA 3G6JB 2BVOA 3DOSA 1Q0YH 1OQXA 4Z7VA 5KANG 4FQHA 4AH2B 3V4UH 3RVTD 3LV3A 4HBCH 1W8OA 2EZ0C 2A74B 4UQ2A 1FLRL 1I9RH 3JV5A 3U9UA 1WQVT 3JWNC 5EWIL 3QUZB 1DANT 3PABB 1N3NA 4YE4H 3RWEB 2IC2A 3QFJB 1CGSL 1F90L 2Z92A 3DXAE 5JPNB 4K71C 1ZHLA 2D7PA 2FLBT 2VDPL 4RISH 4MD4A 4OF0A 3TWCL 1M7DB 3FB6B 2E6QA 2DMCA 3BIKB 1NBYB 1H3WM 3ARZA 4P59H 3L9RB 3BEWA 5LCVH 4U4BA 5L2JA 3UMTA 2EXYD 5H37H 2OCFD 1CTOA 4UIKH 1P7HL 5K9KA 3P2TA 3LQAH 4POUB 5HI4C 2WWKT 3QDJD 4OCRL 4NZRL 4YHYB 5HY9B 3MV9E 5L9DL 1KJ3H 4EZMA 3MCKA 2IPTL 4RRPA 3S3JA 1A1NB 1J8HE 3KYMA 3CGTA 1GC1L 5C0FB 4K2UH 4P23A 5D7JD 4NHCH 3C6LD 4W4OA 3QJHA 4YEEA 4TRPH 3O4LB 4LKCA 4KKLD 4HK3N 1OAZL 5C08A 4UU9B 5EBLB 3TPKA 1JYXA 4BFIA 5JXEC 2E6PA 4P2OC 3CC5A 3BGMA 2PO6D 3DROB 3HAEA 4R3SA 1DVFB 3I84A 3ZKSD 5SWZE 2NY5L 3LSOA 4U0RB 3C09B 3EUUA 1JF1B 4X9FA 3B5HA 2IJ0C 2PTUA 1OHQA 1MH5A 2KPNA 5L0QC 5GS0H 1QVOA 1F3JB 5HGDB 1S7QA 3QDME 4E41A 4UNTA 2Q1EA 4MXVF 4YXKL 4MA7L 1HZHL 2IF7A 5EDXA 1IQDB 1O7VA 1A3RL 3L3JB 1ZOXA 4RGNE 5IEKB 3QUKA 7FABH 4XP6H 3RPIA 5T1LD 1IGTB 3REVB 1E28A 3PP3K 3MNZA 3HRZB 3QO0B 2J1KA 3BE1H 3BQUB 2PN5A 3VWKD 3D69B 5EUOA 4X6FB 4PY8J 1KIQA 2KQNA 2ZOLA 3QG6B 5DXWA 5I66B 4D9LL 1S7UA 2ATKA 5HD8D 1NDMB 2GK0B 3D9AH 4TTDC 3MV7D 5D2LB 1VSCA 5DHYB 3UBXG 1YEFL 4PV9B 3KXFB 3UYPA 1VESA 3GJEA 3V5HA 3RPKA 2WBJA 2AQ3A 4M9OA 3BOVA 4P23C 2GTWA 4V2CB 1A7BA 3DYOA 1NUFA 5ILTL 5GSRA 4W4OC 3RVUC 2YKLL 3BPNB 4HG4K 1OSZA 4DTGL 1RULH 2MPAL 3TBTB 4GSDH 5C8JA 3GHBH 3GB7A 2VZ3A 2JELH 2VXSL 3Q5YA 1KIPA 4FQJL 4OZIB 5C6TL 1ADQH 1IGYB 1Z3GH 4UINH 4DKDC 1AKJB 1G84A 1U8MB 4LPWA 2Y36L 3WUWA 2XICA 4FQXB 1VPOH 3IFLL 3TIEB 5L7XL 3PWLA 4DCQA 4GRWE 5IK3A 3VXSB 1U0QA 2KQMA 2OM5A 4PJ5A 4XVJH 3LKPA 1TVBA 3BDBA 3FRUB 5ICXB 3P77B 1DTUA 3CVHH 3WFEH 3KLSA 3O0RL 1CGWA 4L4JA 1BGXL 4ONHB 2NY0D 5BJTB 3CLEL 1E6JH 4KRNA 4TOYL 1RUKH 1HDMB 4XTRD 1MHHB 3C87A 5E8PA 3L1OH 1AGEB 3TYFA 4LRIA 4NN5B 2NZIA 1IC5L 1U58B 4XNMA 1Q9WA 1T7YA 5HPMB 5T5FL 1UWXH 5ACZA 1Y6NR 4MJ6A 2BOBA 2ZSVB 2EDXA 2DAVA 4K8RH 1XGQB 4K7PY 1WBXB 5C86A 3MRQA 3QXTA 3W82A 4FFWC 4FQ1L 1TZGL 5KSBA 4QO1A 3S8WA 1IAKA 2CMRL 3QIUD 1X5YA 2F15A 1T83A 2H9GB 2XPGB 4GFTB 1RIHH 3Q0HA 1IARB 3S7GA 5D1XD 5HYSA 3IDMA 1ZHBA 4YHNA 1DCLA 5JW4N 1MY5A 4DWHA 1A9BA 1SJEA 4XPGH 1OGTB 2XG4A 1K6QH 4ZNEA 1OD9A 3UTTA 3I2CH 4MD0B 2HTKC 3T1WA 2CLRB 4ZQKB 1HSAB 4WY7L 3OL2A 2VXUH 4PJCB 2P47B 4FFVC 4LMQI 2FBJL 3IGAA 4F37K 1QFOA 3QQNA 1R3LA 1IBGL 2CUMA 1AHWA 2WUCH 1C16A 4K55A 1I85A 1S7WB 1VACB 3EOYG 1I1CA 1NLDH 3TZVA 3H9SE 2XTJC 1UCBH 4YWGL 1VEOA 4BZ2H 4K7PH 5HDBE 1KT2B 1Y0LB 3H3KA 3MCG1 2BSRA 1YUHA 4OSUH 1SY6L 2EO1A 3KG5A 4JVUA 4M9PA 3ZL4L 4PJFB 4LRIC 2G9HA 4FQQA 1JRHH 3TJHD 2JB6A 2H32A 3FCTA 3EDFA 3FFCB 1FNSL 2OXHA 2AJVH 1KACB 2VQ1A 4P2CG 1H3VA 1NLBL 4G6AC 2FR4B 5LQBH 3SDXF 3HE7D 2YPVL 3B9DA 1J5OH 5I8CB 1XF2B 5F3BB 3R1GH 1JWSA 1AGFA 1GZQA 4M5ZH 1RZJH 4QOKE 3IDNA 4M6AA 3EYFA 4XPTH 3S96B 4CGTA 4WEBH 2QQKH 4ODTH 1JWUA 3SPVA 2HLFC 2VKXA 4F7EA 4XCEA 1L6XA 2CDGB 4LSVH 2IWGA 2CPCA 1T83C 1TJIH 3DMMD 1KPRA 4J3OC 5JO5B 4G9DA 1AXTL 2VDKH 1P2CB 3CFCH 1OTSD 1N0XH 2MCG1 4P9MH 4MA3A 5HYFA 3ZE2E 2WP3O 1J8KA 3WDIA 1MFAH 4I2XA 5IVXB 2AABH 4Y5XB 5TDPA 5ESAB 4OTXL 3VXUA 4F15C 5ISZB 2F53A 1F2XK 4JZNB 1ZKAA 1YQ2A 4N68A 2R2BB 1A64A 2IANE 1CU4H 5TE4H 1JP5A 3V9FA 1VKXA 1AHWC 2PCPB 1LO4H 3CX2A 1I85C 2BP3A 2QHLA 1UWXK 2DQGH 1IT9L 5DJAB 4JPIA 3FMGH 1LO3L 3T0VA 1MCOL 2V2TB 3TZVC 1R24B 4ZOBA 2NXYB 1HN1A 1NGPH 3EOAA 1J10A 2V5SA 3B9EA 4G5ZL 4EUPA 3T8XA 1OPGL 3GSQA 1I9IH 4UQ3A 1NAKL 3EDEA 4WHTB 3HZVA 3TIDA 3MMEB 2JE8A 3GI9L 3K46A 3O45A 5IESL 3ZMRA 3CXDH 2A6JB 2NTFA 2CRYA 8FABB 4HIXL 4JRYA 4FTVA 5CZXC 5I1EL 3TBSB 2H8PB 3LRSA 4ZUWB 2I9LB 3PL6D 3U2SA 2I60L 3BO8B 3MRFA 4PUBL 4PJBE 1U8QB 2HFGH 1YPZB 5KSUA 4JFFD 1EEZB 3SKOB 3KPQA 3LN5B 2VLLB 4IHOB 4QCIA 1PKQA 5TDOA 4PY8I 5FCUH 1IGCL 1T04A 1CDCA 2FGZA 3RWHB 5J06A 1EUUA 1YJDH 1WGOA 4XWGL 2VDOH 3O3BA 3LKRA 4KI5E 2XNAB 4RGOL 4ACPA 4JZOA 5K93A 1OB1A 3MO1B 3L5IA 2DQCH 1RZ8A 1QSFE 4HKXA 4Z8FL 3S6CA 3WNNA 2VDLL 4NQSA 2FGWH 5DD6B 3RWJB 4NGHH 1I1FA 3CNKA 3LZFH 4LPXA 2ZCHH 4QY8B 1K4CA 2W0FA 2AJZA 4U1MB 3VW3L 3HNSL 1BEYH 1JZ2A 4M1DL 3HCVB 3TF7C 4PRID 2HKFH 5IFHH 3GUTA 2AEPH 1U8OB 4EDXB 4JN1H 4XNYL 2OMBA 3WFCL 3VG0H 3F5WB 3D2UB 4N9GA 3AXLA 4NSKB 2M2DA 3B5TA 4MLIA 5A2FA 1D9KB 5FA3A 1WITA 4KK5C 4X4XA 4O2EB 4MNQB 4QF1B 3BPCA 2DS4A 5DMJB 3DURB 2XOTA 5HHOD 3KHQA 3ARSA 15C8H 1IGJA 1NAML 4X7SL 4XP1L 4D8PA 3UZQA 2DLIA 5CEZH 1F6FB 1FORH 4HWZA 2X4SA 4N0UA 1QLFA 3BT2L 2VABB 3H2WA 3FJTA 1YYMH 4M1GH 5H35B 5IQ7H 1IAIM 1ZVHA 3RRQA 4H20L 5DFVC 1VEPA 5FHAL 1QSEA 3HI5H 3P40A 1A14H 5FYKL 2B1AL 4UIMB 1I1RA 2ENSA 3T09A 1HKFA 5IHBA 1TZHB 3KYNB 3BKYL 4R2GD 5EOCL 2FHFA 5DJ0A 3THML 1M6OB 1HINL 3OKNB 4JY6A 2YA1A 1W0WA 5DURD 3BZFA 2AJUH 2YD4A 4QYOB 4OI8A 5E8NB 4PJ5E 4UAOB 3WLWC 2YPLB 3IETA 3V6ZA 4UMGA 1ZA3B 4F37F 5LKNA 2QQQA 4HXAL 4IRJA 4H8WH 4NFDA 1W0VA 3BKJL 1YEJH 1AQDB 5DO2C 4ZTPH 5TE6H 2VE6B 5GS2D 1OCWL 5E1HB 5C0IB 4M48L 3D87B 4CVZB 5CD3A 3DV6A 3QWQB 4OKVB 1R0AL 1A6ZA 2VC2H 3JWDL 1CLZH 3RKDC 5C07B 4RAVB 1NQBA 4G8GA 2J8UF 4DW2L 5BZWB 3VXQB 4JM2F 3OKDA 3ZDZE 3K8MA 3AAZB 3O6ML 3QH3A 3NCEB 4J3SA 5I73C 5KSBE 4PREB 1F4YH 4OFVA 4JFHE 1BZ9B 2NY6C 3FQWB 1YQVL 5C0CD 4MAYD 3CZFB 2EXWD 4ODSH 1L7IL 4XNQA 4QXTB 5FKAB 2CKBH 2CLVB 2DQJL 4JQIH 1OP3H 2DLEA 4FFZH 4B50A 5GGRY 5IMMB 1IGIL 4V1DD 1RFDL 4N90E 3MLYL 4WFHE 4FMFA 3S34H 4NNXA 2NY5C 3U0PA 1KN2H 1T3FB 5JUEL 3VFRA 3DARA 1BIIB 2J8UB 4ZFOL 5TH2A 2R8SL 4PBXA 4TUKL 1ULVA 3U0TA 4LHQB 3A67H 2H2SC 1P5VA 4E5XB 3ZE0E 4EI6A 5FB8B 1A5FL 1YECL 1UKQA 4XVSL 5HHMD 3VMOA 5HHNA 1UEMA 4LF3B 2AGJH 2Z31B 1EFXA 1NCWH 3WXVL 3MZTA 4NQDE 4X6CE 4HGWB 4KVNH 1MLCA 4FP8H 5D7LB 3EFDL 4IRJC 2R0LH 4HS3A 2CGRH 3KWWA 3V7AE 4P3DB 1I8KB 4P46B 4OFDA 2JK5A 4KC3B 1U8NA 4HJJH 5LVEA 3ZDXE 3QUXA 4APQA 4M7LH 4Q6IC 3SN6N 2FNBA 3HI1B 3M8OH 5IR1A 1VERA 5CZVH 5A2LH 1V5JA 4AM0A 4P3CL 1A7RH 3W9DB 5I8OH 1H3UA 4PR5B 4CJ1A 1NFDA 3MLSH 4F9PA 3CX5J 2NY4C 2XZQH 4MHHG 3VU2A 4MWFB 2OTWB 2VUYA 2CLZB 2D7TL 2BSTA 4XNZC 3B9KD 3CU1A 4S0TD 5GIRB 3MA9L 5I71B 2OR8A 1V7NH 3IDYC 3N06B 4PJ9A 2EICA 3FRPA 1DQMH 1E4KA 4XCCH 3E3QC 3V4PL 3EZ8A 3DECA 1QBML 2OI9C 1G7IB 3IDJB 1C12B 5IHLB 3MNVA 4ETQB 1FGNL 4WRLA 3TH4T 1ORQB 2X9YA 1JYNA 1EHXA 3F7RA 5HYIA 4OCSL 4PJAF 3P73B 4PG2A 5DUBB 1T6VN 3QB7C 1TZIB 3AB0C 3KPOB 4Z7QF 3TP4A 3N85L 2EC8A 1OGAB 3FN3A 5EO9A 5C3TA 1G6VK 3LH2L 1X7QB 3BUYA 4HF5H 4HKZA 3N1QC 2X5PA 3C60A 4MQSB 2X4RA 4LVHC 1LEIB 5AYQA 5BW7C 3SJVE 3OHXB 4JB9L 4EN3B 3QUXC 4APQC 1CZ8L 2QADC 5DMIH 4JDVA 4YUEH 2GEEA 5ACLA 2AXFA 2P5EA 1OP3K 1YEEH 1QLEL 5CSZB 4YDIH 1ZS8A 4BK4A 5IF0A 1FYTE 4X4ZA 1RURH 5EU6A 3HZMA 4F9PC 2ZCLL 5D7KE 1OTTD 4LIQL 1DBKL 1UZ6E 2VLKE 2VLJA 2YBRB 5AYUL 2E3VA 2PO6B 2YA0A 5FYLL 4XBGB 5BO1H 1A0QL 1UWGL 1A6UH 1EAPB 1R3HA 1MCEA 4FZEL 4EEEA 4P2RE 3DXAD 3P9MA 2EDKA 2WWMC 1BOGA 4I0KA 1ED3B 1PAMA 3QSKB 4MX7B 2DYPB 1R5IA 2ATPA 2VL5A 3HFMH 4LKXA 4PJ9C 1ZSDB 1Z9SA 1E4KC 2OZ4H 1QO3B 2V7HA 3VRJA 1X44A 5IMKA 1QYGL 1G9MC 5SWSA 5DTFB 1S9WA 4AEIH 1IAOA 1B4JH 4FFYL 5BXFA 5AD0B 3QXDB 4M1CD 2GJ6B 3TVMD 4OV5A 3DX9A 1CGXA 1PLGL 3DUUA 3MRGB 2P8PA 3H9HB 4I0CC 4PG2C 3VWKB 3I6LE 1H8OA 5J0BA 4O58L 5ECJE 1A7PL 4ODBD 5I30H 1JV5B 4PJDF 2A1WH 1D5XA 1MJJB 1FVCA 2BVUA 2VOTA 1AD0A 4Z0BL 4QRPA 3MV11 4O5LH 3WO4B 2H6PB 5GGSA 2DL2A 2G5BA 3C60C 3HUJA 3LN9A 3FFDB 2PYFA 3NABH 4MMXC 1E27A 1EXUB 1UJTA 1ORSA 3MQIA 4Z7UA 3TYGL 2VXVL 2D31A 3E6HB 3TH2T 4N8CL 5F6IB 1R5WB 3DUHA 1Q0XH 5KVFH 2O61B 5DMYA 1P84K 2YEZB 2D0HA 1RZ7H 2WANA 2Y72A 4UB0H 1W0YT 1KCSL 4Y2DD 4OQTA 5LBSL 2AK1H 4NZUL 4JO2L 1KCRL 5IMOA 2OR9H 2C3XA 3V52H 5AZ2H 4GG6A 5IB1A 1S7TA 3ME0A 1I4FB 1CBVH 1S7XA 5LGJA 3MRHB 1JWMB 3D39A 4OZ4A 2J6EL 1FV1A 1QKZL 2B20A 2WW8A 5DRNA 2BZDA 5FOBB 4JDTL 2BNUB 2VDQH 3AU1B 4NC0B 3DNKA 1UCTA 2MKWA 2ARJB 3FOMA 4HC1L 4GLRI 1B0WA 2R1WA 4NN7B 1HXMA 5HI3D 3IFNL 3QP3A 2FD6L 5IWLC 4MCZA 3OR7B 5DEGB 2P48B 5T1DH 1U95A 4M02A 2JCCA 4BA8A 4PV8B 3SQOH 4WWKB 3WHXA 4C56D 5I8KL 5I1GL 1D5IL 5HGHA 1VGKB 4XBEL 3TO4A 3TBWA 1YEGL 3RL1B 1BF8A 3HNTL 3IS0X 4YIQA 1ZTXH 5CMAA 4BSWA 5EIIA 4U7MA 1DQQA 3Q6GH 5ADPL 1KV3A 4FQ2L 5HDQL 3WUWG 3MACH 3DVGA 5I1IL 2FBOJ 2Y7QA 5A2KH 2R4SL 3QIUB 4S1SL 4R7DA 3MLTA 5L8KB 3MV8D 4BH7A 3CK0H 5D93B 4H0HB 4F58L 1NC4A 1CFQB 4NBZB 3BP4A 1XIWC 4RFOL 4QEGA 1NAMA 3F7YA 5EZLA 4HZLA 4NO5B 2P8MA 4YDLB 4BZ1H 5CSGA 3HE6D 4XPAL 5F71A 4DGYH 5F1IB 4O4YH 1NCBL 4MXWH 5E08L 3HMXL 1IGFL 5I75B 5HBBA 2RJMA 2NY7H 2BVYA 3F6IA 4JG1H 3L3OB 4JQXA 3SDDC 5J12B 1K8IB 3BI9X 4EI5A 1TTUA 3RVXD 3IXTA 1FG9C 4XMKH 3KNBB 4JFZH 4RZCB 1GYAA 4DQOH 4TSAH 2CRZA 4NM4L 2EDBA 4RFNC 1G7HB 1GGTA 3HG1E 4QT5A 1DN2A 2IAMD 3PWUB 4L5FH 2PXYD 1A7OH 5CBAB 3QIBA 1V3MA 3CSYB 1GGIH 1DEEB 3LEXA 4J23A 1QR1A 2DDQL 1A1OB 2HLAA 1ZLUH 2Y9RT 1UB6A 2FDBP 5D8JL 3FZUC 1FZKB 1BWMA 1EVTC 3BZ4B 1MRDH 2EYSB 3EIFA 4PRNA 4NRYB 5DVLA 4DN3H 3IU3A 2J7LA 5J1SC 4LOUC 1H3PL 1UJ3B 4LDEB 1AC0A 4LVOC 2APXA 5HYSG 5B8CB 3GMOB 3MGTA 4JZJB 5IQ9A 5BRZD 4AENA 1T1ZB 4G9FD 3STLA 3TESA 2AV1B 3VWJD 5DRZA 4WCYL 3HLAA 1UM6L 3TO4C 4Y4KC 1ACYH 4R4FH 4TVPD 4ESKA 5I9QC 5DJXB 4Z5RB 3C08H 1UVQB 4CW1B 5EOTA 5KVDL 5JW4Q 4DEPC 3CH1B 1Z6JT 4UBDC 1K5NB 3OWEA 4PJ7E 5SX4I 1TJHH 4XC1H 3VH8A 1FDLH 3CCHB 3TCLA 4LPCA 3BRGC 2RFXB 2EZ0D 5MP6H 4QRQB 2Y6SC 1K9TA 4UOJA 1YMME 3G6JA 5DS8B 3S5LA 3VXRD 4OD3L 2JLLA 3AM8A 5E7BA 1X5AA 5LWYL 4AH2A 2VB5A 4WU7B 5E2WL 1YEIH 3QNXB 4L4VD 5FGSA 4I3RL 1U8LB 3K7UA 3NTCL 4D0CB 4ONFL 4DKAA 5IUSA 1KGCD 3OJMB 5EORH 4NWTH 3A6BL 2V2XB 1DQLL 3A6CL 5T1KD 3QUZA 3T3ME 5HXMA 3RWEA 3BX7C 4XVUC 1KJ2H 5ITFB 1G9NL 5C0JB 4XNUH 1CD0A 1QG3A 4WDIB 4MD5B 5JPNA 3W0WA 4L8DA 3WMSA 4FQIL 4P5KB 1CL7H 1PEZA 3QIBC 1NMCC 5HI4D 1NBYA 2VO5A 4NHUB 5E4IA 1N7MH 1RUQH 1WTLA 2XQBH 1LD9B 1QNZH 1H5BA 3X11B 2GT9B 3VCLB 5E5MB 3VDBA 1A6VL 2HG5B 3T08A 3K4AA 6FABH 2HRPL 4M8VA 4J4PD 4GAJH 1Q0YL 2EIBA 4ORZC 3V4UL 5E7FA 1XH3A 4OZFH 1H15B 3SE9H 5DUMH 3NBNA 1BVLA 1A1NA 1I9RL 5JXED 4NNYB 3QRGH 5GS1A 4P2OD 3BZEA 4MS8C 4YE4L 3TPUB 4ZO6A 3O4LA 2AK4B 3OZ9L 4NO0A 1BQUA 2YC1B 4JFFB 4LEXH 4KV5F 4RISL 3K2MC 5EBLA 1BQSA 5FA4A 4LCUB 5EU6E 4P59L 2Q86A 3FB7B 4YDVB 1NBVL 3JTSB 3MTRA 1H3XA 3MLRH 1QA9B 3BESR 3DBXB 4PGBB 5E9DE 1A2YB 1U8HA 4Z6AT 4UIKL 1ZLUK 1JF1A 3AM8C 5KJRH 1UENA 3LQAL 5C09A 3FAXA 3I3EA 2P46B 5IHUH 4KGLA 4P5TB 1KJ3L 1AQKL 4ZFFB 4LCIH 5HGDA 2XWBB 5A2JH 1V05A 4JFPA 4MZ2A 3QUZC 4NHCL 3WS6A 4PRIB 4ODVL 1ZLWH 1UH4A 2DL9A 5IM7B 4TRPL 1I8LA 3ULUH 1T7WA 4NZDA 4HGKC 5IEKA 1I8IB 1P7KB 1WFTA 3MXVH 4TTDD 5IEHB 2VAAB 1IGTA 1BF2A 1H5BC 3REVA 3QUMH 5FDWB 2ITDA 3HRZA 1FE8L 3B2UC 3BQUA 3D69A 3FOLA 4X6FA 4P23D 1LGVA 2VLRB 3EYUH 5I66A 3QG6A 4NKMA 5I2IA 3FO9A 2XN9E 5CEXB 5E2VH 1NDMA 2GK0A 4OUOA 4WHYH 3NVQA 5D2LA 5DHYA 4XT1C 3JBG7 4JM4H 4PV9A 1JN6B 5J1AB 5C08D 1MCIA 2AEQL 4R96B 5A16A 2Q20A 3HUJE 1F6AA 5GGVH 3RWDB 1WEJH 5IJKA 2MQ0A 3K3QA 3PJSB 1XGTA 3NACH 3P11H 3ULVC 4RWYH 3DVNB 2CIIB 3IYLW 4JREB 4OZIA 7FABL 1IGYA 3ZKMC 4XP6L 1AKJA 1U8MA 1AP2B 2C4XA 1RD6A 4B7LA 3BE1L 1MHEB 3TIEA 4E41D 5E1AA 3NIGE 1BBJB 4JRWA 2R69H 5DURB 3O4OB 3C09C 2I27N 1PD6A 1A6WL 5D6CB 1J0IA 3GSNA 3L3DB 1TPXB 3D9AL 3LHPH 3FRUA 4OQ1A 5JOFA 5ICXA 5JW3H 3EHBC 4H5SB 2C7UB 5IW3A 4ONHA 5KAQF 2H2PC 3ZYOA 5BJTA 1ZA6A 4KFZC 5FUOH 3BAEH 1MHPH 3WS6C 1HDMA 3BVNB 5TGBA 1HQ4A 1MHHA 1AGEA 1I8LC 5HGAB 1SYVB 3B6SB 1RULL 1LVEA 2YN3A 3GKZA 4GSDL 4KMQA 2JCCE 1SVZA 2OL3H 1J88A 3GHBL 4FFWD 4NJ9H 2MNUA 5ELIA 5I19H 5AG9A 1U58A 4YXLH 4WW2F 1KEMH 1Z3GL 4PJEB 4WTWA 1MLBA 2FEEL 2ZSVA 3BQUC 4GJTB 1AO7A 1CE6B 3UX9B 2WBJD 4I3GA 3RUGB 2EECA 4XVJL 4RA0C 5E95B 3BIBX 4MAYB 2HTKD 2IH1B 3CVHL 3WFEL 4RMRA 5D5MF 4B7IA 5JQ6H 1U93B 1AGCA 4FFVD 3MUJA 1E6JL 1MVFA 2W1NA 2IBZY 2DTMH 3E6FB 4GMTH 5IJKC 1RUKL 3FN0H 3BPNC 3L1OL 3DGGB 1OGTA 2HH0H 1VADA 4V1DB 5EC1A 2IMNA 4G6JH 5F9AC 3GEWB 4HAGA 1UC6A 1I1YB 4IMLB 1F4AA 1SYSB 4PJ5D 1RUMH 4PTTB 3U4EA 4RMVA 2F58H 1ZLWK 2HJKB 4Z7NE 4NQEE 3MGOB 1HNGA 2XTJD 4JHWH 4K8RL 3Q3GA 2DF3A 2ZPKH 1E4XI 3NCCB 2J6EA 4OZHF 1EERB 5FYKE 4BUGA 1YEHH 5GSVB 1CXFA 4H0GA 1OM3H 5FO9A 1YNKH 5C0EB 5D5MB 2KBGA 3SO3B 1MCRA 4YFEA 2P5WA 1UB5B 4XGZB 4G6AD 1RIHL 5F89B 2Z93B 1KT2A 3PHQB 4RQQB 3FHQA 2OTUB 3G6AA 1JHLH 3BXNB 3K4ZA 5EO0A 5F3HA 3L95A 4U1SA 3FQRB 4PJFA 1IC4H 4R26H 4XPGL 1BPVA 1K6QL 3GZKA 4NN5C 4PRHB 3LMJH 3I2CL 4N8VA 3FFCA 4U6YA 1JGDA 2HLFD 2ZZUT 2ARWA 3MRPA 5GZNC 4PJGE 4YFDB 1Q8MA 2VXUL 2FR4A 3V5KA 1T89A 5I8CA 1XF2A 2ZNWA 5F3BA 4P99A 1K4DA 4FQCH 2YMXH 3D48R 1I9JH 4FS0A 5DWUH 2WUCL 4OZHB 5I8EB 3FL7A 3FB8A 4RGMB 3U79A 2VKWA 3B9KB 4UUJA 1NLDL 2CDGA 3OPZH 3UTTD 3NCJL 1AH1A 3ALWA 1UCBL 3C2SA 5F9JB 1RK0B 4BZ2L 4K7PL 3RTQA 4DVBA 5F8RC 2OMNA 5J6GB 1MWAB 3RWGA 4F80A 4Y5XA 5ESAA 2J5LB 1JRHL 1MIEH 2X1XR 5ISZA 2MCPH 1JPSH 4ZDHA 4JZNA 4Z7WE 3FQTB 4LSSH 1UFUA 1HNFA 1RV6X 3SDXA 1YA5A 4J7RA 5LQBL 2R2BA 3TZVD 1J5OL 3BKML 1YEDA 5LJYH 4UILH 4G43B 4JHBA 3R1GL 1WTGT 4KPHL 1X5FA 2PCPA 5DHVH 2Y23A 5CCKH 4M5ZL 1RZJL 5EO1A 2A73A 5FV1L 1KTRL 4P2YA 3S36L 4XPTL 2ICEA 2QQKL 4ODTL 4FNLH 3VXMB 5DJAA 5C0NC 5EPMB 1EO8H 4LSVL 5BZDB 2V2TA 1R24A 1TJIL 1EA9C 5EU7C 1QHOA 1XCQB 2AVGA 2VDKL 2D9CA 4P9ML 4PGCB 2DQTH 3OF6A 5CZXD 2Q8BH 1VFBB 1MFAL 2W60B 3U30B 2AABL 4WHTA 2APTA 3FRPG 5E70A 1N59B 1U42A 4N8PA 4DGVH 1U2HA 1K3IA 3MMEA 4U49A 1Q9LB 3RZWA 3ZTNH 4BK5A 3OXSB 2IPUK 1S9XB 2A6JA 3VGHA 5IB4B 5BMFH 1T89C 3MRLB 8FABA 1PYWA 2APVA 1CU4L 2O26U 5TE4L 4R4BB 5CHNB 2H8PA 4FRWA 3P9LB 1FNFA 1LO4L 4ZUWA 2I9LA 5L2KA 4GQ9H 1DLHB 4ODHH 4J12A 2DQGL 3CVIH 1MAKA 4LSQH 1EZVX 1CN4A 2ESVE 4CVXB 3ET9F 2BMKB 4EDWH 2PYEA 3VXUD 2F53D 3DVFA 3DXAB 3EJZC 3SKOA 3LN5A 4Z77B 2VN7A 4IHOA 5K33A 1BOYA 1QEWB 1NGPL 3RWHA 3RTQC 2XV6B 2XNAA 2VZOA 3INUH 4HV8A 3VGEA 2R0WH 1I9IL 4Y5XC 7CGTA 1CXKA 1I7RB 3KYOA 4U1IB 4LDOB 5C09E 3NCBB 5DD6A 1WBZB 3RWJA 4ELKA 2R2CA 1OAQH 3VA6A 3P4NB 3CXDL 4AQOA 3MV9B 2CR6A 1A02N 3TVMB 2Z4QB 5KVEH 5FK9B 4WFFE 1ZT1B 3HZYA 3HCVA 1YC8A 4KK5D 5I16B 5CGMA 4EDXA 4JO1H 2W9LA 1TFHA 4UV7L 4MA8H 2HFGL 3KPPB 4Y5YB 1X5IA 2QJDA 5MHSE 5FCUL 2YHGA 4HUUA 1D9KA 4U1JA 1YJDL 3CUPB 4JRYD 4MCYB 5D7KD 2NY2D 4FTVD 5CD5C 1U3HB 3JZ7A 5D70L 1ZWIB 4O2EA 4MNQA 4QF1A 4MJIE 4YGVB 4GMSH 2DQCL 3CXHJ 5FF6A 2CR3A 4XAKD 5SWZB 4XP9H 4WHCA 5J13C 3C8DA 3WHE1 3IDGA 2FGWL 3QWOB 4NGHL 5ERWB 4IMKA 4MZ3A 3BJ91 3U7YL 1BJ1J 4AEHL 5KS9B 1N64H 4L3EE 4LVEA 3QDMB 3W9EB 1BEYL 2VJXA 5IFHL 3FONB 1FNEB 1HH6A 3T0BA 1KULA 4JFQB 2AEPL 2DN7A 4O02H 4JN1L 5GQBA 2LQRA 4QHLB 3DLQR 3VG0L 4LIQE 2H26A 1MCPH 3H0TB 4LVNC 5FYLE 4RGNB 3OKOB 3KYAA 3CFDB 3MCLH 5I76B 2A9MH 4F2MB 1RZIB 2W9EL 1TZHA 4HAFA 1M6OA 3OKNA 4GH7B 2K7QA 3KYKH 3KS0J 8CGTA 1RUPH 1ZVSA 4NO2A 3RGVA 4Y5VB 5DO2D 1RZGB 3R8QA 3BP7A 15C8L 3FB5B 5EU3B 2HTLC 3FQUB 4GRWF 3V4VH 1CFNA 4NFCA 1MFDH 4ZNCD 1FORL 1ZA3A 3FAWA 3FTGA 4XXDB 2M26A 2R23A 3RKDD 3ULUF 2MQCA 2P43B 1YYML 3MPCA 4M1GL 3DSNA 5IQ7L 2YD9A 3WJLA 2VE6A 1AE6H 1CDGA 3V6OA 2A9NH 1MRFH 4DZ8B 4CVZA 4OKVA 2EE2A 1FVEB 3MV8B 1JNNH 1KPUA 1YY9C 2NY6D 3QEHB 1A14L 4CUCA 1GSMA 1D9KC 3L7EB 1T22B 3TBYB 5JNYB 2EDEA 4ZAKA 3T2PA 1T0NA 4I77L 5CINL 5BZWA 4KK9C 1S78C 5EBMB 5BOZG 1AO7E 4P4KB 4KHXL 4HKBB 5I15H 3HE6B 2AJUL 1DBJL 3AAZA 2E27H 4PREA 3PQYE 4GRWB 4X9BA 2GW5A 3NPZB 4YC2B 4M93B 3TT3H 3CZFA 4IMKC 4Q9CA 4PJXF 1QSED 1W72H 4WI6A 5FKAA 5HGBB 5FGCE 1CFSA 4H8WL 1LQSR 4TNVK 3MX0A 5IMMA 1YEJL 4ZTPL 3GMLA 3ARWA 2H2SD 5JHDE 4FQLH 3GSOB 5IB5B 1HIMH 3O6LH 2VC2L 4OUUB 4IOSD 5JORA 1KG0B 5EOCJ 1CLZL 4NWUH 4WGVB 3ETBF 3EDJA 2J8UA 4QGYA 4UTBH 4GKNA 4H1LH 1JGVL 4IRJD 2BDNH 4U05A 3RGVC 2BNQE 4FA8A 2XY1A 1F4YL 1INEL 4U6TA 3CZJA 4UAOC 1MFBH 4LF3A 1FIGH 2EKSB 2Z31A 4F8QA 3X12B 1HSBB 4ODSL 1OAYL 3GSWB 4HGWA 1QLRB 2P5WE 4F7MA 4Q9QH 4ELME 2CKBL 4F33A 4JQIL 2XKUA 2ILLA 4FFZL 4G8GD 5HDBF 4P46A 1OTUC 2NY4D 3UPRA 1NCTA 2FJHB 3WJLC 1ADQA 1WT5C 2C1PB 3V6OC 3HI1A 3RHWK 1J11A 3VXOB 1P9MC 1N4XH 1N0LA 3S34L 1ONQA 3W9DA 3H42L 4PGZA 1S9YB 4ZAKC 1HHJB 4BELD 4QHMB 1L6ZA 1T0PB 4MWFA 3WDHA 1IZJA 2OTWA 3A67L 5AAWA 5GS0C 3CVHA 2CLZA 2ZUYA 1PJ9A 3SBWC 2VMFA 4L3CB 4NUJA 3KPMA 1E4WH 4NYLB 4WV1B 1UM4L 3UAJC 1J1XH 1FJ1B 5I6XC 4LLMB 3HG1D 5EZIH 5AG8A 4U6XB 2AGJL 1NCWL 4LCCB 5D1QB 3H9SB 3I02B 4FP8L 5KN5B 4NC1E 4HWBA 4I48B 1JK8A 1EBPA 2R0LL 1JGEA 1N6VA 1KB5B 2CGRL 3KPLB 5DK2B 5CBEB 1NEZB 2XFXA 1BAFH 1CDUA 4HJJL 3ZE2F 1RZFH 4M7LL 5E6ZA 1UYWH 1G7IA 3IDJA 1IRAY 1C12A 5GHWL 1T1YA 4U1LB 2V7NB 5CZVL 4ETQA 3V0VB 3ILQC 1A7RL 4OGYH 5I8OL 1EFXD 3MLSL 2WLZA 5FYKU 3F12B 2XZQL 3L3IA 1IEAB 3P73A 1FLRH 3VH8G 1RJLA 2CO6B 2DLFL 5GZOC 5DRWB 3IB4A 4QOKB 3RNQA 1UT9A 2IQAB 1TZIA 3H9YA 1QPPA 3QUXD 4APQD 1T0MB 3KPOA 2QADD 3CFJB 3UXFA 1OGAA 2Z31C 4P2QE 1I7ZB 3S5LG 3B83A 1X7QA 4KY1H 3PWPE 3MLVH 1V7NL 1FNHA 3HR5B 3GGWB 1ITCA 1LEIA 1DQML 4P46C 4XCCL 5DK3A 5LGHH 3OHXA 4EN3A 4KZEH 2DIAA 4HK3J 4I18A 4XHJC 3QXWA 5CSZA 2VERN 5JDSA 2BVOB 3BWUC 1F8TH 4FQHB 5L9DH 5J89A 4PJAA 5L0QB 2IANB 3BPLB 3GMNA 4PJ9D 1GC1H 1LWRA 5L2KE 3U9UB 4QXGH 5DFTA 2B0SH 2Z8VC 3G5VB 1EAPA 1N3NB 4WI2A 1F3DH 2K9UA 2PYEE 2Z92B 5D1ZB 5I71C 4PJBF 4Y19E 4DKFH 2EDNA 5ICZB 3TH3T 2DYPA 4HF5L 1K8DB 4GQPH 1MFCH 5ETUB 5KVGH 3BEWB 3MYJB 3RZCB 1HI6B 4KI5F 3C8KA 4KJYB 5EA0H 5DMIL 4JN2B 4YUEL 4MMZC 5DTFA 5IFAH 1YEEL 3X13B 3WNOA 1CF8H 5K9KB 1U36A 3M1BB 5F44A 4RFEA 5H8DA 5F7NC 4ONGL 3QXDA 2GJ6A 3MRGA 3HPLA 3H9HA 3TGXA 3WV0A 3C60D 3KYMB 2PTTB 5BO1L 4OJFL 1HEZA 5KSVB 1JV5A 1HZHH 1A6UL 5DYOB 3O2VH 4MJ5B 1T20B 4PJBB 3W5MA 1MJJA 2P5ED 1KTLB 2DQDL 3O3EA 4LKCB 5KSAB 1JTTA 5BQ7A 2H6PA 3HFML 3S9DB 5EU6D 3FFDA 4BFIB 2OZ4L 5F21B 4R90H 1S7SB 3MROA 4EN3C 1ZT4B 3CC5B 2VLJD 4AL8H 3BGMB 1KCVH 4R3SB 4I18C 3LSOB 4LBEB 2FYYB 1QSFB 2GTZA 3HC3H 3E6HA 1QP1A 1R5WA 4AEIL 1B4JL 4D3CL 2O61A 2D7QA 2YPKB 1LHZA 4QTHB 2YEZA 2W65B 1X9QA 2C4FU 4JKWA 1C7TA 3J7HA 4E41B 4R7NA 3WFHB 4WUUE 2Y07L 2YUVA 1WIUA 5I30L 4PJDA 4CU8A 5FCSH 5SWSD 1G1CA 4DTGH 2A1WL 1I4FA 2C3WA 3ZTJH 1JWMA 5E6YA 5JQHC 3EFFB 4OBSA 5DJ6A 2C5DC 3ZSSA 3QUKB 4O5LL 4JLRA 4FQJH 4Y2OA 5FOBA 1TDQA 2BNUA 3NABL 4KDTC 4U3XA 3RPIB 3BZDA 5IHZB 4Y1AA 1E28B 4TNVF 3MNZB 5DJ2B 5EUOB 3OR7A 2HWZH 2GK2A 2Z8RA 2P8LA 4P4RB 1S7UB 4WWKA 1CDBA 4D9QE 1EV2E 5KVFL 1ZHKB 3WNMA 3MXWH 4OBRA 5D2NE 1HILA 1DQDL 1VGKA 1RZ7L 4QRPD 3RL1A 2YD8A 5J1TC 3GO1L 3LIZH 4LCWA 2XQYG 5D9SA 2WBJB 3CLEH 2Q6WA 2OR9L 2LE9A 4WI3A 2Y25A 3V52L 5GSRB 5HGGS 2Q8AH 3LQMA 3V6OE 3IAGC 3LCYA 3RY4A 3RWFA 3PXHA 3GM0A 3GB7B 2O93L 1CFQA 1KIPB 2VDQL 3BEVA 5T5FH 3D0VB 4G8FA 3QT2A 5SWQB 4EIGB 4NQVA 1OLZA 4OCLC 5T1DL 1X3DA 3ZDZF 3RHWF 5F6IC 4FQ1H 4LGSB 3SQOL 5IK3B 5DEFB 4XX1E 4PJ5B 2UUDH 3LKPB 1TVBB 1K8IA 4ZOAA 3D39D 3BISA 2G5RA 2XTJB 1R5VB 2ZOKA 1WZ1H 2JJVA 1ZTXL 2X42A 1YYLH 3FZUD 5B22A 3KNBA 4RZCA 3Q6GL 1O7SA 3MACL 4LOUD 2FO1A 4QHNA 2OLDA 4HFWA 3EOTH 3CK0L 2CXKA 1Q9WB 3CSYA 4MAUH 1DEEA 1A1OA 2BSSB 1EHLH 3WDJA 1PGRB 3TO4D 4NRYA 4JVPA 3ARUA 2BOBB 4BZ1L 1UJ3A 2OJEA 1CI5A 3MRQB 1OF2B 1I3RB 4O4YL 1UA6H 3Q5OA 5KSBB 3HB3C 5B8CA 4R97B 3GMOA 4WWKC 5DC9B 3ZSTA 4K9EC 2NY7L 4UBDD 1MREH 2OQJB 1LO2H 4G8IB 4IDLA 1NC4D 2AQ2A 4X6CF 1H9VA 4NQCA 2YRPA 4Z5RA 2FECL 1UVQA 4UT7H 4CW1A 4DQOL 4TSAL 1WJ3A 1RZKH 5HYSB 1ZHBB 3JV6A 3L5HA 2Y6SD 4J3WA 4YHNB 4CVWA 1A9BB 3GSVB 3BH8A 3CH1A 1QPXA 4R0LB 2YRZA 1J1PH 4L5FL 4I9WE 1VFAB 5D93C 3SDAB 1GGIL 2RCSH 3RDTA 3CCHA 4Y89A 1MRDL 3RGHA 4EI5D 2RFXA 4DN3L 4Q97A 4WGWB 4OD1H 4PS4H 4PB9L 5TQ2H 1C16B 2NX5E 5DS8A 1WZMA 4XVUD 5I75C 2QLVB 4WU7A 4UNVA 4EJ1C 4YH6A 1U8LA 4N8VG 1MCJA 5A43C 4C4KO 4NQDB 1EVUA 3QIBD 4R4FL 4Q74A 2V2XA 5D71H 3C08L 2BSRB 2NCMA 4GG8B 1MCFA 5ITFA 1EZVY 3ARQA 4PRBA 3LD8C 3WUZA 4WDIA 5IMLA 4JANB 4OTXH 4UTAH 2JB6B 4HUNB 4P5KA 2O5XH 4NHUA 4XC1L 1FDLL 1J9CT 1LD9A 3OJDB 3X11A 2GT9A 2YD3A 3PV6B 5E5MA 3SCMA 3X14B 2WNGA 5MP6L 1AGFB 1UJ3C 4EKXA 5HDLA 4MS8D 5B8CC 4JZJC 1IT9H 4F7EB 1YEIL 4ZUVA 1MCOH 1H15A 2DOCA 3LKQA 4X6BB 5BS0E 5F7EH 4G9DB 4NNYA 4NWTL 4PJHE 2UUDK 1XR8A 5JZ7C 3TPUA 1KJ2L 1NAKH 4XNUL 2AK4A 1BECA 3LS5H 2F53B 1U92B 2UVEA 3QUYA 3S88H 3ZO0A 3QCUH 5B39A 1CL7L 5KTEH 4LCUA 1WAAF 1OTSC 4PPTA 3RDTC 3UYOD 3FB7A 3KLAB 3BRFA 1RUQL 4PJAE 2XQBL 1QNZL 5I1KH 3DBXA 4KXZI 1VKXB 2BRRH 1UZ6F 1A2YA 3QUZD 3HPJA 1BJ1H 4X6DF 3MOBH 2HP4A 4HIHB 5JIHA 4JPIB 4LAJH 1FQ9C 3I6GA 5FOJA 3W0WD 5JW4M 4A6YH 2NYYC 4PJ8A 4P5TA 4WU5B 4ZFFA 3SE9L 1ACZA 5DUML 2XWBA 3VFMA 4PB0H 5I1LB 2PW1A 4TVSa 3KR3H 5I1AB 3QRGL 3GIZL 3OQ3B 3SJVB 5IM7A 4UQ3B 4HIJA 1T1XB 5E2UH 3HZVB 4LEXL 3VE0B 3KS0H 1P7KA 2VAAA 5GGTH 3ARTA 4JFDE 4L1HA 3IRZA 4ZG1A 5HVHC 2NY2B 5F1KC 5FDWA 3SCMC 3MLRL 2VLKB 3U4BL 2BC4B 3HNSH 3U2SB 2VLRA 1LE5B 3PV7A 3SY0A 1J18A 4HG4J 5KJRL 3O4LD 3ULVD 3WFCH 4P2RB 3ZE1F 2FSEA 4NO0D 5IHUL 1JN6A 5J1AA 4LCIL 1DE4B 1XT5A 3ZKMD 1T04B 3RWDA 2XYCA 1M71B 1C5BH 3HTLX 1LK3H 3O3BB 5TE7H 1OB1B 2QQNH 1RZ8B 4I1NB 3ULUL 4LLWA 1Q9OB 3QUYC 4FG6C 3DVNA 1KIRA 1U8PB 3OG6B 2E9BA 5C09D 1KFAH 1WBYB 1L0XA 3MXVL 5A3ID 2OTPA 1ZANL 3EHBD 1CDYA 1AP2A 3QUML 3O3DB 1HQRB 2H2PD 4KHTH 1K4CB 2W0FB 1BBJA 3VFPA 3MJ9H 4HH9A 3EYUL 4LASH 4PJDE 3GUTB 4I8DA 3D6GA 4O00A 5D6CA 4UT9H 1VEMA 3L3DA 1AD9A 4JEGB 3MFGB 4N9GB 4PJ8C 4P5TC 1CGTA 4H5SA 4JM4L 3KPTA 5MHSD 1CS6A 5FHAH 3O3AB 3ECBA 1WEJL 4Y1AE 3BVNA 3I6KA 4CVUA 3BQUD 1U3YA 3SKNA 2EYRB 1DJSA 1YY8A 3NACL 5HGAA 1SYVA 3B6SA 3P11L 4OFYA 4RWYL 4WENB 2NY6B 3H7BA 3MR9A 1D6VH 4FABH 2OK0L 1PQZA 4X9HA 1N6QH 4HWZB 5A2IH 1CE6A 3LRGA 1QLFB 2R69L 3CXHK 5BV7H 2UY6A 4BJLA 5J9PB 3KDMB 2P24A 3RUGA 1EJ6A 3LHPL 4Y88A 5FYLD 5CIPH 4Z76B 3HMWH 3T0AA 5CS7A 1AKJD 5FUOL 3BAEL 1IEBA 1MHPL 4ORGB 1BJ8A 2DTSA 4X7CC 3DGGA 5SV4A 3QIWB 1MI5A 5CJXA 4NJ9L 1I1YA 5CP3H 4WW2A 4RDQF 1SYSA 1J05B 2GSGA 3LPGA 4JREC 4PTTA 4YO0B 4YGAB 1INDH 1KEML 3MGOA 1L7IH 2C4FT 2DQUH 5JOPD 3GMPB 1NJ9A 1SQ2N 5TF0A 3O4OC 1M4KA 5GSVA 4U1GB 1ITBB 3F6LA 1TPXC 4M61A 5C0EA 5D5MA 3S98A 5A40E 4KUZH 5GZND 4XX1G 1UB5A 4XGZA 5CKAA 5F89A 5JUEH 2Z93A 3UROR 1ZGLP 4RQQA 2HVKA 2OTUA 3RU8H 2K1MA 2DTML 4GMTL 2HT2C 3VXPB 5MENE 3FN0L 1AO7D 1G6RH 5DMKB 3FQRA 1GZPA 2ZUSA 2HH0L 3OKDB 4G6JL 4PRHA 4G7YH 1GCFA 5C0BE 1A5FH 4XNZB 4XVSH 5IW6B 2FB4H 1RUML 3B3IA 2F58L 3JWOC 4Y8AA 3T2NH 4GBXA 4JHWL 4PIRF 4PD4J 3ARPA 4OZHA 2LVCA 1NCDH 4JHAH 5I8EA 4DKEH 1YEHL 3M45A 4QTIH 1OM3L 2OI9B 3HG1B 1TVDA 5EBWB 3AREA 4MAYC 3TC9A 3GJFK 1TENA 5F9JA 1RK0A 3U0PB 1UGNA 12E8L 5ABDE 2AI0H 1JHLL 5IB3A 2IH3B 4NOFA 1IC4L 4R26L 4ZSOE 2D7TH 5F7LB 5FECB 2W0LA 5IT2H 3LMJL 5CJXC 3FQTA 4RIRB 5C71A 1AY1H 4WW2C 2AXJA 5C0ND 2FATH 5FUZH 1G0XA 3MA9H 2WIMA 3TM6A 4XPFH 1JF6A 4D0DA 1L9NA 2KZWA 2ZP0T 2P5WD 4FQCL 2YMXL 3NAAL 1GGUA 1I9JL 2AJYH 4LRNL 5DWUL 1LP9F 5ID0A 4KROB 4HS3B 3KWWB 3V4PH 3T0EE 2F8OA 5IVZB 3VXMA 1OP9A 4GRLB 5EPMA 1G9EA 2C1OB 2PTVA 4NRXB 3S36X 4HW6A 5BZDA 3FFCD 5IR1B 4QRUB 1FGNH 1I7TB 1XCQA 2BVQB 5DZNA 4PJ7B 1RUAH 4PGCA 1VFBA 2W60A 1N59A 1MIEL 1S8DB 4QLRA 1ZT7B 2MCPL 1JPSL 1YMMB 2BSTB 4ZPTA 1A3LH 1Q9LA 3UTSA 1S9XA 3DETC 3EJZD 4UILL 5CHNA 1HKLH 2JF1A 3P9LA 5CCKL 3RTQD 4PJ9B 3WKML 1DLHA 3IJHB 4FNLL 4RGMC 4XI5D 3T4AB 4CVXA 3RQ3A 4HLZG 2E7LA 5ISZD 1EO8L 4Z77A 3AREC 3MNVB 1QEWA 1QLEH 4Z95H 4Z7OF 2K7PA 3EYQD 4J3XA 4I0PB 2DQTL 5CZKA 4NKOB 2Q8BL 4U6VH 4LIQH 5DRXA 3HAEH 2J5LC 4CU7A 1J86A 2XKNB 1I7RA 4U1IA 4DGVL 1MCCA 1FO0H 1UWGH 4B53A 2FL5B 3P4NA 2OJZL 4JFEE 5BMFL 3MV9A 2Z4QA 3G08A 3DYMA 2HJFB 1OL0A 5FK9A 1J8HA 4HKZB 2GHWB 3V6FA 3OF6D 3PUCA 5CD5D 2A6DB 4GQ9L 3LPWA 5I16A 1I3UA 4KUCF 4ODHL 3CVIL 3S3PA 4LSQL 2F9BT 5IB2A 2RB8A 4JDVB 4KV5E 2XT1B 3KPPA 4Y5YA 1CICA 1A6TA 4G3YH 3O9WB 1ZS8B 1K3ZA 5EU6B 3CUPA 3HZMB 3INUL 4JPKH 1U3HA 2QR0A 2R0WL 1ZWIA 4JRXA 4JY4A 4DZBA 4YGVA 4POYA 1CQKA 4U7SA 1XF4A 5E9DB 3QEUA 5L2KD 5SWZA 1A7PH 1NEUA 4GO6B 4URTB 1CXIA 3HZKB 3QWOA 2VXQH 1OAQL 2PYED 2YS4A 4CADB 2M1KA 5I17A 4TUOB 1RIVH 4C59B 1YDPA 3PHOA 5DD5H 4LKXB 3QDMA 2XWTB 4HS6A 4U1KB 3ROOB 2Q7NA 3U0WH 4R4NC 3FONA 3IKKA 3D1MC 1LO5B 4WI9A 4JFQA 3TLRA 5J7CC 1X5XA 3FT3A 2VXVH 4QHLA 5FKPA 2EE6A 4BFEA 3ALXA 1X5HA 5FGBA 1I3VA 3MRMA 4N8CH 1GGYA 1S9WB 5I76A 1IAOB 5D96B 3CFDA 4KRLB 2HTLD 4P48A 4F2MA 2NR6C 2VUOA 5GJSH 4OV5B 4HIIB 4GXUM 1PZUB 4L3AA 1BVKB 4GMSL 3EO0B 4NZUH 4JO2H 4Y5VA 1KCRH 3Q48A 4XP9L 2EIDA 5TPWH 2AJ3B 3FB5A 2D0FA 2XN9B 4L4TA 2DIJA 1YN6A 5EN2A 1JHTB 3LDBC 1NFIA 3TVMC 1H0DA 1YY9D 4LSDA 2VZ1A 4XXDA 1QKZH 4NCDA 4P49A 1D9KD 4JDTH 1YN7B 3HUJB 5IP4A 1S78D 4MNQD 4QXUL 4O02L 3OKYA 5ANMA 3MGAA 4ODUA 5K9QI 4DZ8A 4Y5YC 4YFLF 1CICC 3ILPB 1MCPL 1FVEA 2OS7A 3C5ZA 1VDGA 3QEHA 3MCLL 2GIYA 5E03A 3HN3A 1YEKH 3L7EA 1T22A 3TBYA 2X4OB 2A9ML 1QFWH 2GI7A 5F7DB 5JNYA 4ZPVB 4JHZA 4PJIF 1CLCA 1U3HC 5CWSA 5EBMA 3C5JA 1J0ZA 3L3KA 4P4KA 1CGUA 3KYKL 1RUPL 3D85B 4DUXA 4CNIB 4RFNB 3IFOB 4NOBA 5IB1B 1S7TB 3E8UH 4GKSA 3V4VL 3ARVA 1A1MB 1KF9B 1LO0H 4Q0XH 2IFFH 4L9LB 2FEEI 1HWHB 2HFFA 3M07A 3BMVA 2BNRE 3FOMB 1AE6L 2R1WB 3RIAK 3GSOA 3RGVD 2A9NL 4MCZB 5FGBC 2X09A 4F7TB 2JCCB 3U6RA 5E08H 2DBJA 1JNNL 3B8YA 4OUUA 4RGNC 3MRNB 5JW5A 2X4NB 3VXSE 3WHXB 5IKCB 2CSPA 1O0VA 4N9OB 3VDCA 4Z7NF 3UJJH 1FNGB 3DHJA 1GGBH 4AT6A 5HI3C 5CMAB 4YIQB 4BSWB 2QSTA 4QRSA 5I15L 4Y5VC 1DQQB 2FH8A 4N5EC 3PDGA 1OTUD 1M7IB 2E27L 3ZT7A 3DVGB 3MJGX 4UT6L 4F9LA 5DQ9A 3KPRE 2Y7QB 3BP5A 4PRPA 3X12A 4OLVH 3TT3L 3VD9A 4KJWC 3GSWA 4BH7B 4PJXA 2VQTA 2X4TA 1W72L 3QEQA 3O6FB 1PEWA 1KC5H 4AEFA 4ZAKD 1NAMB 4HZLB 2ZUVA 1IAMA 5I1DA 5GS0D 5MEPB 2H32H 4FQLL 5F7MC 4B41A 5JXAH 3UAJD 1T5XA 3GJFB 3O6LL 3C5ZC 2EDLA 1JZ7A 2P42B 4NWUL 1MJUL 1AR2A 1D5MA 1UM6H 1KB9K 4PJGF 2F54E 3QNZB 4UTBL 4NQEB 3EW3B 2BY3A 3H6JA 1KTKE 4EI5B 4P4KC 3PWNB 2BDNL 1WZLA 4L3CA 4NYLA 4WV1A 4OGXL 2XZZA 2AJXH 1FJ1A 4YC2C 1MFBL 4YDKH 5KVDH 3CFIC 4U6XA 1FIGL 4WFGD 3G04A 3ILQD 4LCCA 5D1QA 3H9SA 3I02A 2YOCA 4X99A 5KN5A 4Q9QL 2YD6A 2ARJQ 2OL3A 5D72H 3KPLA 5DK2A 4PJCE 1U6AH 3RWIA 5CBEA 5B38B 1NEZA 2R56H 3IU3B 2D03L 5FO7B 5KBNC 5GZOD 3DO7B 4U1LA 1FL5A 4HT1H 4OD3H 1N4XL 4BQBA 3FO0L 4Z7WF 1NGXA 1U8KA 3MGTB 4AENB 5IQ9B 3STLB 2Z31D 5C9KA 2IBGA 5DRZB 5IGXH 3NTCH 3F12A 4K94H 2WP3T 2H45A 2VL4A 4WIQA 3EKCA 1QRKA 4XWOC 5DRWA 4QOKA 4P46D 1E4WL 3AGVA 1J1XL 2AXGA 4DOHE 4F9LC 1JRHI 4BZYA 4RSVA 2XWJB 1EJOH 3CJJA 2VZSA 4XHJD 4FQIH 5HHQB 4EUPH 3GGWA 3VH8B 2DM2A 3TCLB 1JI1A 4O2CA 3QCVH 1BAFL 1RZFL 1UYWL 1AFVL 4JCLA 4B0MM 3BMWA 4FXKB 4M6OL 9CGTA 2X9WA 3S5LB 3UTSE 1NKOA 5L6YH 4OGYL 1CFVH 2IANA 5JDJA 3CAFA 2BRQA 2DJSA 2KL6A 4WV1C 4X7TA 3QCTL 3G5VA 2HFEB 2YSSB 1GOGA 4ZFOB 5D1ZA 3O2WH 3OZ9H 3W0WB 4L8DB 32C2B 5ICZA 1QBBA 2CH8A 2A6IA 4LCCC 5D1QC 1B2WH 4KY1L 1BD2A 3MLVL 1K8DA 3B8SA 5ETUA 1NBVH 3EO9L 5LGHL 1MSPA 1CE1H 4M5YH 3MYJA 4P57A 1H5BB 3D18B 3RZCA 1HI6A 2Q7YB 4KJYA 4KZEL 3NGBB 4JN2A 4MLSA 3X13A 1F8TL 1OGAD 3M1BA 1QFPA 1AQKH 1XH3B 5B39G 3UC0H 1EEUA 1BVLB 3O3UN 1CGYA 4M43H 2R4RH 5DJ8B 2PTTA 4QXGL 5DA0B 2GUOB 5GS1B 4HS8H 5KSVA 2B0SL 4EN3D 3P0VH 4ODVH 4J4PC 5DYOA 3BZEB 1CQYA 3IDIB 4MJ5A 1T20A 1X5JA 2VLME 2E8YA 2ESVB 4PJBA 1KTLA 4NO0B 4DKFL 5KSAA 3O2DA 3O41B 3SDYH 1YZZA 5FA4B 1P84J 3K2UH 1MFCL 2MTPA 3OV6A 2Q86B 5KVGL 1CDHA 1S7SA 4JRXE 4HJGA 1ZT4A 1F4HA 1FE8H 1HH9A 4X4YB 2OSLA 5EA0L 4L29B 1MF2H 5DJDA 4LBEA 2FYYA 2WM0A 1QSFA 1U8HB 5IFAL 1CF8L 5C09B 3TN0B 2VH5H 2YPKA 4QTHA 2W65A 2CK2A 1HHHB 4HD9A 1FAIL 2DYPD 2AEQH 3BPLC 2E7MA 4FMKA 4HIEA 4YDJA 5D7SL 1U91B 4JFPB 4M3JA 3WFHA 2EDYA 2GITB 3NFNB 2NY3B 5DJYB 3GNMH 3O2VL 2CJUH 5D1ZC 3L5JA 3EFFA 5CFHA 4N1CA 5FIEA 2MMXA 5IHZA 4F7CB 3V2AR 2XRAH 3G5ZA 2GJ6D 4R90L 5FM8A 1T5WB 3M17A 3RZCC 2ITDB 1UH3A 5DJ2A 4AL8L 1KXTB 1KCVL 3FOLB 5DR5H 3RIAF 3TT1H 1WLHA 3HC3L 3W81A 2ITCA 4NKMB 5I2IB 4P4RA 1A6WH 3FO9B 4L4TE 5DZLA 1ZHKA 5E4EB 4LAQL 2VIRB 1P4LA 1MJ7H 5A16B 1F6AB 2AERT 1DUYA 2C3HA 4L3EB 3VRIA 5GRYA 2EIZB 5ANME 1XGTB 3X17A 3VXNA 5HYJA 3S35L 5KSAC 1WCQA 1A22B 2X70B 4DUVA 5FYJU 5IBTL 1QSZA 1EFQA 4NQUA 3D0VA 5SWQA 3ARBA 4KI5C 5DD0H 1PG7W 3HI6H 4ENEC 4PLOB 5E1AB 1J0HA 1LMKA 2HWZL 4S1RH 2SEBB 1F11A 4XP4H 5DEFA 2V9TA 4O9HL 3GSNB 3RVVC 3MXWL 2JTDA 5JOFB 1ZLVH 4UI2A 3VFNB 1R5VA 3ULUE 3LIZL 1U8JA 1ZA6B 3P4OB 4Y1AD 5E00B 1KELH 4OZGE 3BWAB 5TGBB 4LLQA 1HQ4B 2Q8AL 2MSPA 5HJ3B 5IV2B 3VI3F 5CJBA 5BCAA 2EYTB 3HB3D 4WWKD 3JV4B 4X5LA 2A83A 2BSSA 2F74A 3DIFA 4J3VA 2YPLE 1MLBB 1FFPA 4PLKD 1FZMA 4LCWD 1AO7B 1Z9LA 4QHKJ 2GKIA 1OF2A 5E6IA 1I3RA 4QHUA 5JTWA 4UOW0 1IKNA 1KNOA 3KPSE 2WV3A 3PQYB 4PRPE 3RX5A 5JIKA 2OQJA 1CD8A 1CIUA 2E9WA 3PWVB 5I1HL 4CL7A 4PJXE 4G8IA 3U1SH 3QEQE 4AEEA 4JJHA 1AGCB 1WZ1L 4N0FB 3MRDA 2WBJC 1YYLL 3UDWA 4ELMF 4KKAC 4RA3A 1M7XA 4Y4HB 5FGCB 1WWAX 1TCRB 3BRDA 3GSVA 5JHDB 5EC1B 1VADB 4R0LA 3QULA 3EOTL 4ZUSA 1P7QB 1VFAA 5E5UB 3SDAA 1DFBH 2RR3A 4MAUL 3U4EB 4TSCH 1OP5H 4WTZA 1EHLL 1MWAL 3RKPA 3WIIH 3T1FB 1XFPA 5AWNL 4C58B 3G9AB 3Q3GB 2MJWA 2OYPA 2GCYA 1FH5H 4G8EB 1L0YA 1UA6L 2BNQB 2FRGP 4M4PA 1C8PA 3N1GC 5FO9B 1MREL 2Q76B 3NCJH 3HHRB 4NQDA 1LO2L 4X6CA 2IG2L 1R3KB 1YNLH 2P5WB 4IRSA 3DRQB 1NSNH 4ELMB 3BGFB 3LOWA 2FIKA 3FQXB 3WN5A 2ZSWB 4Q7DA 4UT7L 3G6AB 4GG8A 3PHSA 1RZKL 4WFEE 5EO0B 2AXHA 5F3HB 3L95B 5CEZD 1G9MH 5ID1A 4U1SB 4JANA 4KMLB 2DIBA 4K3JH 5TQ0H 1J1PL 4N8VB 3OSKA 4U6YB 1JGDB 1UKTA 4N5UA 3NCMA 1J7VR 3AVEA 3MRPB 4YHOL 2RCSL 1OAKH 3D0LB 3V5KB 3OJDA 4MQ7B 3BKMH 1CVRA 4BQ6A 3PV6A 1K4DB 3X14A 4KPHH 3SDCA 5MEQB 4OD1L 2Y06H 5T3ZH 3EBAA 4PS4L 4NQCD 1L9MA 5TQ2L 4CJ0A 1FNAA 1W72A 3S36H 3CIQA 1JZ6A 4Z9KB 3GMQB 5IFJA 2LAGB 3NZ8A 5JZ7D 1IKNC 3FB8B 4R97C 4WUKH 3ULSB 4UUJB 2E9IA 3L7FB 4X80H 1P4BL 4X6BA 3BH9A 4PD4K 3RDTD 1Q9KA 3RTQB 3UDWC 2XA8L 3FQNA 5D71L 4DVBB 3QI9B 1S9VB 3RWGB 1IM3B 1CR9H 4ZODA 1ZLVK 3OB8A 2UY7A 2DQEH 3PP4L 4R0LC 4UTAL 2J8OA 3TNNB 1U92A 4ZDHB 3SDAC 3AS1A 2O5XL 2LVEA 3SDXB 2NYYD 3KLAA 2IGFH 2DQHL 1YEDB 3LY6A 3U36A 5GGSY 4KKCC 3GSRB 5C6PB 3AS3A 4LDLB 1JL8A 5EO1B 2A73B 2ICEB 3IAPA 2K3TA 4HIHA 1L0QA 1QBLL 4KRPB 5F7UA 4ZFGH 1CYGA 4QGTA 2ADJB 3HA0A 4P2QB 4X9GA 4R8WH 4ONOA 4WU5A 1BD2E 1OY3B 5F7EL 3PWPB 5LG1A 5I1LA 5I1AA 3ARFB 3WN5C 3BIAX 3RIFK 3SCMD 3SJVA 4GAGH 1T1XA 4IIQA 1MQ8A 3LS5L 3S88L 3VE0A 3STZA 5J13B 2QEJA 5L8LB 3QCUL 4P9HL 1T1WA 3RI5K 5KTEL 2X05A 3GRWA 4DVRH 4LPVA 1FYTA 5D7IE 1CDIA 1PYWB 3MODH 3QDJE