4U7EB

The crystal structure of the complex of lip5 ntd and ist1 mim
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
163
structure length
163
Chain Sequence
SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 66
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4u7eB00
2RKKA 2LXLA 5H7PA 4TXQA 2LUHA 4TXPA 4U7EB 4TXRA 2LXMA
chains in the Genus database with same CATH superfamily
5FIOA 3E37A 3DXKG 3CR3A 4KT6B 3P2BA 1BU9A 4GA2A 5CMWA 3W9GA 1SW6A 2IJGX 3NB2A 3KD7A 4GYWA 3IV0A 1AP7A 5ANRA 3OAWA 4UI9J 1H2TC 2R17C 2XCBA 3FH5A 3KS2A 2QYJA 5KNHD 2JEKA 4GZ5A 3SFZA 2F37A 3CVXA 3MV2B 1K3ZD 2GRLA 2J08A 2VSNA 4QFVA 5CBNA 2A4ZA 1XNFA 3U66A 4F3VA 3NOGD 2L6JA 4U04A 1N9AA 1B89A 3L82A 3DPYA 5G04C 2VTBA 3CK7A 3ONKA 4KZCA 3HIZA 3PZ3A 4EQFA 2ETBA 3FTYA 4HOUA 4U7EB 5JMND 3ML8A 2GGFA 2HM8A 1JWGA 2JLBA 4TUUA 3KSQA 4AVXA 4HLLA 3SFXA 4UWKA 2YHEA 2VGEA 4NQ0A 2L0IA 5FZRA 3TGOA 3LY8A 2NC9A 2P9UG 3QDNA 1OT8A 3SO8A 2OVBA 3S7FA 3Q49B 4N5CA 4ILGA 2RG8A 3ABME 5T8IA 2WMNA 3Q7FA 3KEZA 1YCSB 4KVOA 4GA0A 5ITZF 3LY9A 5KNGA 4F1PA 2WXNA 4NRHB 3LCAA 4I17A 3APDA 5B1AE 4NURA 4BY6A 4M7CA 1UJJA 4U0SA 4HVBA 2LAIA 1H6PA 4JPSA 4MBGA 3RO2A 3FUDA 4BSZB 3EHQA 4TUMA 5FQ8A 1OXJA 3MEKA 1OUVA 2M63A 4WWPA 3OXFA 2IOSA 2BKGA 3DEOA 3NQPA 2H6IA 4X8QA 2GRNB 2VSOE 3D3MA 1KT0A 3PNLB 4GYYA 3L22A 5LP0A 3ZPJA 3JXJA 4FHJA 3D9KA 4RVBA 3ZYKA 2R02A 2VSXE 3ZFWA 2WXIA 4G8KA 3EIJA 2KM4A 4J8FA 3TWTA 5BV1A 2J4BA 2WVIA 2GRRB 3CVLA 3BU8A 4A1GA 4QQIA 2IY0C 2QC9A 1Z3YA 2IFUA 3ZW3A 2I1KA 3CKBA 3EJNA 1EDUA 2J9QA 2XPYA 2HO1A 5FZQA 5D66A 3ESLA 4OAVB 4CDNA 2WXGA 5D2MC 4EECA 1OCOE 4O1PA 1X81A 3Q47B 2EILE 3KSLA 1EYHA 2XRZA 3AG2E 3JYSA 3PZ1A 3FDHA 3PE4A 1FVHA 1UN9A 4UWHA 3B7UX 1LTXA 1S64A 1Z5SC 2OV8A 3CHQA 2AJAA 4HFGA 5FQ4A 5HI7A 1TJFA 5CCMA 3PEVB 2WQHA 4DPRA 3DXMG 5JHAA 1O1RA 5EYLA 4GZ3A 4XI0A 3HVEB 4C48B 3FP3A 2F0YA 1H0AA 2QYUA 2P9IG 1WY6A 4ANXA 2QY7A 1INZA 4BTBA 3OXGA 3UMVA 2Y4UA 4M3OA 2DYSE 1HF8A 1MYOA 2E2EA 3LEWA 3ONLA 3FHEA 4YDYA 3TWRA 5LFAA 4O6FA 1JCQA 3CLJA 2A5EA 3TXNA 4MLPA 2WXMA 5ENQD 1UN8A 1X5BA 4N5QA 2NYJA 4HRLA 2DWZA 2PM7A 1E8YA 2EQXA 2XZDG 5HS0A 2J49A 2LSVA 1HG2A 1IQUA 3C72A 1IQRA 3UI2A 2I6HA 4G11A 1EPUA 1N0QA 2AXUA 4HNAD 1TNBA 3LVRE 1FT1A 1TJCA 2X6HA 3NAWA 4BSXA 2DZNA 4HRNA 3FUNA 4Y6WA 3QC1A 4WNEA 2DCPA 3ULEG 3NOCD 4EBAA 4J8DA 2HR2A 4Q94A 4F7AA 4Q96A 1TNZA 5JA4D 2L6BA 4XX5A 2FBNA 1TNUA 1E96B 3AG1E 4I6EA 4UUCA 3FUMA 2XEEA 1XGWA 3D9IA 2GRQB 2XGOA 5AYWD 4ACLA 1Y8MA 1YA0A 3ZYMA 3D9LA 4AOFA 4AY5A 1Q2ZA 4L7TA 3UM1A 4HOTA 4APOA 5HKPA 2KC7A 1H19A 3FUFA 4H7XA 3E4BA 1MZCA 5EYPF 1WG0A 1E7UA 2KCLA 2BTDA 4W9RA 4J0UA 2WB2A 2OOEA 3PRZA 1TN8A 2R59A 3B7SA 2IO3C 4BT8A 2V0PA 4FP7A 3CHPA 5KCMA 4JC8A 4HXIA 3E32A 4GCNA 4HB5A 4XKBA 5FTPA 2DIWA 4BESA 1MQSA 4CT4A 3VLFA 4FULA 2PZIA 2XEVA 5KJLA 2P9SG 3ZYLA 1G3NB 1HX8A 4AM9A 3FUHA 2CHXA 4CEMA 5B3SE 5ANLA 2UY1A 4BWRA 3EU9A 2PL2A 2XRYA 3Q73A 3C3QA 5FWQA 1NZNA 2J8SD 5ARFA 1GW6A 4JEHA 4EBAG 1TNYA 1UG3A 4GAAA 4UWGA 3ULYA 3IHVA 3S7DA 2RFMA 4DUIA 4JXTA 2PNNA 5G04J 3ASFA 3RRMB 3U64A 1OCZE 4JEUA 2F8XK 1AWCB 5KWDA 4TXQA 3QARA 4JB8P 2ZGGA 1NI1A 2C0MA 2XS8A 3APFA 5AQBA 1N0RA 1UW4B 3ASOE 3CVUA 4XKCA 3S7BA 2X6IA 1E90A 4AIFA 2PQNA 5A7DB 4LCTA 5H7PA 3WG7E 5D0QD 4EZJA 1TEZA 4DX5D 3RRUA 3AS5A 3ZU7B 4JL0A 1W3BA 2UY1B 3ZIMA 4J8SA 2GW1A 4JZYA 2P9LG 4U8VD 5T4YA 4LNBA 1SZAA 2GRPB 3LY7A 1IHBA 5G2NA 3Q78A 2ZXWE 1IHGA 4YDEA 3MCXA 5AAOA 2LO6A 2OEWA 3GZ1A 2XQ0A 1O1TA 2VSYA 2FF4A 4F6RD 4UQZA 4NIKA 1HZ4A 3QOUA 2R05A 3QK0A 4WNGA 3BEEA 3VTYA 3R7RA 5CRVA 3MV3B 1ELKA 3UKUG 3X2QE 2FO1E 4RSYA 4ANWA 3ZUVB 5JJTA 1Z6TA 4R7LA 2IOLA 3K9IA 3UQ3A 5IY5E 4B94A 5AENA 1DNPA 2LXLA 3V79K 4RG6A 1TR4A 1EF1C 2P58C 3I3NA 2RKKA 3ZXSA 4I6JA 1H2UA 2CFUA 2YHCA 3C3OA 3Q75A 2P9KG 3NZUA 5AARA 1WAO1 1N4QA 3L13A 4PDXA 3D9NA 4WWNA 3ZKJA 4L1BA 2VGXA 3AU4A 2WXKA 3L6AA 3PDNA 2WXLA 4U63A 2WXJA 4GTTA 4L9PA 2XZTG 1OWMA 4GMLA 2Y69E 4URKA 5AQ9A 4AY6A 5BNWA 4AXHA 3CVWA 2L9BA 1ELRA 1KPSB 1NA3A 3CQGB 3CSFA 1S63A 2IF4A 3SNXA 4U8YD 4BX9A 1DCQA 2WM9A 4KZ0A 1JPLA 3ZEFA 4FJYA 4DX6D 5HRYA 4U95D 1HU3A 3DSUA 3DSXA 4LRZA 4YVQC 4B0ZA 5ENOD 3HG0D 5J08A 4PH4B 2HE0A 1JCRA 3FU5A 4ANUA 4EZKA 2MRIA 3DSVA 4GU5A 2V4LA 4ILIA 4Z68A 1N4SA 2VGXB 5D0OD 5DIZA 2C2LA 3HXDA 1HG5A 3PZ2A 3VTXA 4G25A 1HE8A 2ONDA 3G2SA 2P9PG 3S7JA 3FTWA 2LNIA 4WAFA 3ENEA 3CV0A 4EZLA 3AJIA 3IEGA 1U3DA 2GRMA 3Q15A 4FHKA 3ZGQA 5AIJA 4N39A 4DX2A 1LD8A 3DPDA 1MHQA 5LCWJ 2F8YA 4DK5A 4JA9A 4A1SA 3PUJA 1TNOA 3LDZA 4GZCA 2XEHA 3MA5A 4B8AA 4GTMA 2AW6A 2IEJA 3HVEA 1QQEA 5AN8A 5FQ6A 5BXOA 4N3BA 4OVVA 5CEDB 3TWQA 1HH8A 3J5PA 1P5QA 4P29A 4DI4A 4I1AA 1FVFA 1HS6A 3FTXA 2PQRA 3R9MA 3FH7A 1WDYA 4RQIA 1KZOA 3UPVA 3RSEG 4PS3A 4HI9A 3QWWA 5FQ7A 3IKOB 3Q7AA 3EDTB 4I9CA 4IULA 3P1UA 4HORA 3ZXPA 3F6QA 3TG4A 4U0UA 1BI7B 3T5XA 1HFAA 4ZHBA 4HOSA 3ULQA 3SZ7A 3ASHA 3CSTA 2VJ8A 3FTVA 2R5SA 1S0PA 3HXBA 2X6FA 1OWPA 3UINC 2Y0BG 4PUCA 4TXRA 2DBAA 2ZU6B 4J7WA 4WWOA 3EHRA 5KJNA 4IYPA 1OCRE 4CGWA 3QNKA 3ASDA 3JXIA 4UQYA 4BEPA 2UWJG 4OVUA 5E75A 3DRAA 3PREA 4JW1A 1TN6A 1NA0A 5AQAA 3PEUB 3JUEA 4CT0A 4K5AB 3TWUA 5G05J 5T3RA 3C98A 4K0RA 5CEAA 5ARGA 4UQXA 3TL5A 2C0LA 4B93B 5LCWC 3WXXA 4FADA 2V5FA 4IN3B 3G2UA 3TWVA 2R2LA 5HQ8A 5DBKA 4OYSA 1OWOA 5ENSD 3GW4A 3HHMA 1S70B 3CKCA 4O1OA 3JQ1A 4GTRA 5LX8A 2LXMA 3TG5A 3DSWA 3NF1A 5FJYA 3UKRG 4GCOA 3LJNA 3RRNB 1IKND 3VLDA 4JA7A 4PS7A 4Y6CA 3T5VA 1L5JA 1YMPA 3DEPA 4MRUA 5CMYA 3QB2A 1E8WA 4AEZC 3UXGA 5CBOA 4GTQA 4HBDA 1MX6A 3S2AA 3RJVA 1FCHA 1OWNA 3PE3A 4RLYA 3ML9A 1D8DA 2DVWA 1DC2A 3TXMA 3CK9A 3SI5A 4HRMB 2X3MA 3UM2A 2XHEA 3RAUA 2WXOA 2ETAA 3L54A 1DVPA 2ZIRA 3W9FA 3N71A 4Q69A 2NSZA 4GB9A 2XS1A 4RG9A 4UI9K 1QZ2A 4OAUC 1MJ0A 4TXPA 3JCKC 4WUYA 5ENRD 3R7QA 3SBSA 3DSSA 1NP7A 3MGBA 2V8SE 4DJAA 4G24A 5G05C 4DRXE 5JJ7A 4L23A 5CHEE 4I1OB 2B0OE 3LKUA 2KCKA 3HXEA 4JHKA 5A23A 3C3RA 4AJWA 2LUHA 3B7RL 3MKQA 4J6IA 3ISMC 4LNGA 2XGSA 1NL4A 4UWLA 1N52A 2PM6A 4BX8A 2YNQA 1SA5A 4N3AA 4JVSA 5EILA 5KJKA 4AV7A 1U3CA 3CVNA 2YINA 4FLHA 1OWLA 4CCAA 3B7BA 3R9AB 5EIDA 2CHZA 2V4HC 3I5PA 2GROB 4BERA 2E0IA 5E76A 5BW8C 4GA1A 2KZTA 4A3TA 4ANVA 4I43A 1H6KA 3U4TA 4BETA 2WXHA 3FTUA 2X6KA 3EU5A 2FO7A 3URZA 2ZGDA 2HYZA 3QWVA 4C9BB 3MKQB 1N11A 2I9CA 4KVMA 3Q4AB 3PZDA 1ZU2A 3GYZA 4G1TA 3L9TA 4U96D 2FEZA 5FINA 1SVXA 3OTNA 4ACKA 3B13A 1SA4A 3FUJA 4CGVA 4GYOA 2FULA 1MX4A 3QWPA 3KEAA 3NBNB 1RZ4A 2CG3A 2QFCA 3OXLA 3Q79A 4I2ZA 2WXPA 5J90A 2XPIA 2JABA 3FUEA 3HDXA 4D10C 3QKYA 3JQ0A 3I4RB 4IRUA 3ZRHA 3IHYA 3QJZA 2BF0X 1PY1A 2KZTB 1H2VC 1LD7A 1MX2A 1BPOA 2KXPC 5CRUA 3ASGA 2X38A 3ZHEA 2H6FA 4XEIG 4G8LA 4TRQA 5FZSA 1BI8B 5CCLA 1RW2A 4MS6A 4LG6A 2I1JA 3D9JA 2Y1LE 1K1BA 4I2WA 3FWVA 4F53A 2I2OA 2KBXA 5ENNA 3V31A 3IBEA 3CQCB 2L0TB 5BUZA 5FT9A 1N4RA 4JD2G 3UIOC 1V54E 4L2YA 1K1AA 5CECB 3T8KA 3G2TA 3D9HA 4GMJA 3FU0A 3CHMA 5EX3A 4YVOA 3EIQC 3APCA 5CERB 2VGYA 2DYRE 2VQ2A 5G55A 3ZHEB 1SZ9A 2Y3AA 2CG2A 2H6GA 3ZVVA 2WXFA 1ZB1A 5C2YA 5M72A 4U0ZA 1D8EA 4B89A 4N2SA 4LUNU 3FUIA 4H7YA 5AQ7A 1A5EA 4G26A 3LXUX 2VYIA 2YQ8A 4UWFA 1K8KG 2VTBB 3PVLA 4EHMA 3SGHA 5EDSA 3T9KA 2RD0A 2DZOA 3ESKA 2WXQA 4HI8A 2XENA 3BUAA 4FLBA 4B8CB 2OCCE 1OCCE 2LAHA 2EIJE 3EHNA 3RKVA 5C1DA 3FUKA 2CHWA 5LOZA 4E6HA 3MKRA 3L08A 1YYHA 4XIFA 3MX3A 3BQOA 4UI9C 2RFAA 3SFYA 4GTOA 2WMOA 3DSTA 3IXEA 3G2VA 3U9WA 3B95A 4GTPA 2IONA 4JHJA 3O48A 4YNDA 4DLQA 3UM3A 2AXZA 3LPZA 2AWIA 3LYAA 1D9SA 4CRWA 3FEYA 4XE0A 3CVYA 3RO3A 4FU3A 4I9EA 1QNFA 2IQCA 2XCCA 3FEXA 1H6OA 5BPPA 2ZISA 3CIAA 3V2OA 3LJ3A 3TWSA 3GZ2A 4N2QA 4DI3A 4WNFA 3HXFA 1Z3XA 3MYVA 3G2WA 3E33A 3UUXA 4GMRA 3UX4A 2MYOA 5BV0A 1TYQG 3RU0A 4J8YA 1FT2A 3CVPA 3MJWA 4GZ6A 4J8EA 1IYGA 4HLEA 4FC8A 3DBSA 5EX0A 4GZDA 4KXKB 4F1SA 3UTMA 4CDRA 3LS8A 4ME2A 5BXUA 5B1BE 4ILHB 3TJPA 2KCVA 1HXIA 3AG4E 4C0MA 4MKTA 2B6CA 2AXVA 2ETCA 5KJMA 3CHRA 4KBQA 4BTAA 2A5UA 4U8HA 3NZSA 3CHSA 4LSZE 4CDMA 4O60A 1N94A 1KZPA 3BG1B 4DLOA 3CVQA 1Y6IA 4CZ2D 5JHBA 3UT7A 4PS8A 4AP2A 3AS8A 1V55E 4YDOA 2BKKB 5EN5D 2XGMA 3SHFA 4I6GA 3PZ4A 1JUQA 3FH8A 1SQMA 1VDYA 3LVQE 3UT4A 2P2CP 4BFRA 3UIPC 3ASNE 4LERA 4L2LA 2WQ7A 3Q9NC 3PH0C 4KYOB 3CVVA 1N95A 3TWXA 4GTVA 1DCEA 3FY4A 3KAEA 5AJLA 3CGHA 1N4PA 2X6JA 5ENPD 2MHKA 3PNTB 2WPVA 3AAAC 3D9OA 1ELWA 3TAXA 1ZBPA 3V30A 4LEUA 1QYMA 2P9NG 4K03A 3CEQA 2AVPA 2EINE 3PUKA 3T8MA 3E30A 2QZAA 2WQ6A 3PS6A 1E7VA 4U07A 3FU6A 3Q5MA 3SY2A 2BUGA 1IXVA 2ILRA 1TN7A 4ATZD 2EIKE 3I4GA 3SD5A 2WXRA 1JCSA 2MOWA 4FA6A 1BLXB 3E34A 2H6HA 4CYMD 2FI7A 1HO8A 2XPZA 1O5MA 4NACA 4YDWA 3BG0B 3UT8A 1KT1A 5JJ6A 4HQDA 4K5CA 2R03A 4GTSA 3AU5A 3ZYQA 4DX7D 1NFIE 2V5QC 3HYMB 3TWWA 2J09A 3O4ZA 3JUIA 3FTZA 1FPPA 3DWLG 1LF8A 2BEDA 5A6CA 3EHMA 4DX1A 4TV3A 5KBAA 4HS2A 1WM5A 3HRAA 4XI9A 2Q7FA 2EIME 5ENTD 3V2XA 3J5QB 2NXPA 1JWFA 3ZNGA 3VLEA 4ATGA 1UJKA 1U2VG 3HXCA 3ZN3A 1KLXA 3C5RA 3FU3A 3Q9UC 1N54A 4I1MA 4WNDA 3FULA 3L17A 4N3CA 1QBQA 4E85A 5AJDA 1E8ZA 2J07A 3ABLE 4A63B 3RIBA 5EIBE 1O1SA 4GPKA 4G23A 4C0EA 3CK8A 5EKQD 4ZFHA 2KATA 3SQVA 3SF4A 4G2VA 3FFLA 4BT9A 4A55A 2Y4TA 3D9PA 1BD8A 3AS4A 4EPZA 1A17A 4LNUD 4K5BA 3SBTB 4A3VA 3D9MA 4V3IA 3B7TA 1PAQA 1OY3D 4ABNA 3L16A 2IU1A 1E8XA 3QAQA 4GPMA 3MZLB 4HOQA 2IO2C 4APFA 4FJZA 3ABKE 2OVFA 3AG3E 1UOHA 1PC2A 3EUVA 4KMOA 3UM0A 2J4DA 3CHOA 2LSUA 2OEVA 3RK6A 3FTSA 4XZ4A 4JHRA 5BT1A 2CFZA 3U3WA 3GZSA
chains in the Genus database with same CATH topology
2RKKA 2LXLA 5H7PA 4TXQA 2LUHA 4TXPA 4U7EB 4TXRA 2LXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKK A;  2LXL A;  5H7P A;  4TXQ A;  2LUH A;  4TXP A;  4U7E B;  4TXR A;  2LXM A; 
#chains in the Genus database with same CATH topology
 5FIO A;  3E37 A;  3DXK G;  3CR3 A;  4KT6 B;  3P2B A;  1BU9 A;  4GA2 A;  5CMW A;  3W9G A;  1SW6 A;  2IJG X;  3NB2 A;  3KD7 A;  4GYW A;  3IV0 A;  1AP7 A;  5ANR A;  3OAW A;  4UI9 J;  1H2T C;  2R17 C;  2XCB A;  3FH5 A;  3KS2 A;  2QYJ A;  5KNH D;  2JEK A;  4GZ5 A;  3SFZ A;  2F37 A;  3CVX A;  3MV2 B;  1K3Z D;  2GRL A;  2J08 A;  2VSN A;  4QFV A;  5CBN A;  2A4Z A;  1XNF A;  3U66 A;  4F3V A;  3NOG D;  2L6J A;  4U04 A;  1N9A A;  1B89 A;  3L82 A;  3DPY A;  5G04 C;  2VTB A;  3CK7 A;  3ONK A;  4KZC A;  3HIZ A;  3PZ3 A;  4EQF A;  2ETB A;  3FTY A;  4HOU A;  4U7E B;  5JMN D;  3ML8 A;  2GGF A;  2HM8 A;  1JWG A;  2JLB A;  4TUU A;  3KSQ A;  4AVX A;  4HLL A;  3SFX A;  4UWK A;  2YHE A;  2VGE A;  4NQ0 A;  2L0I A;  5FZR A;  3TGO A;  3LY8 A;  2NC9 A;  2P9U G;  3QDN A;  1OT8 A;  3SO8 A;  2OVB A;  3S7F A;  3Q49 B;  4N5C A;  4ILG A;  2RG8 A;  3ABM E;  5T8I A;  2WMN A;  3Q7F A;  3KEZ A;  1YCS B;  4KVO A;  4GA0 A;  5ITZ F;  3LY9 A;  5KNG A;  4F1P A;  2WXN A;  4NRH B;  3LCA A;  4I17 A;  3APD A;  5B1A E;  4NUR A;  4BY6 A;  4M7C A;  1UJJ A;  4U0S A;  4HVB A;  2LAI A;  1H6P A;  4JPS A;  4MBG A;  3RO2 A;  3FUD A;  4BSZ B;  3EHQ A;  4TUM A;  5FQ8 A;  1OXJ A;  3MEK A;  1OUV A;  2M63 A;  4WWP A;  3OXF A;  2IOS A;  2BKG A;  3DEO A;  3NQP A;  2H6I A;  4X8Q A;  2GRN B;  2VSO E;  3D3M A;  1KT0 A;  3PNL B;  4GYY A;  3L22 A;  5LP0 A;  3ZPJ A;  3JXJ A;  4FHJ A;  3D9K A;  4RVB A;  3ZYK A;  2R02 A;  2VSX E;  3ZFW A;  2WXI A;  4G8K A;  3EIJ A;  2KM4 A;  4J8F A;  3TWT A;  5BV1 A;  2J4B A;  2WVI A;  2GRR B;  3CVL A;  3BU8 A;  4A1G A;  4QQI A;  2IY0 C;  2QC9 A;  1Z3Y A;  2IFU A;  3ZW3 A;  2I1K A;  3CKB A;  3EJN A;  1EDU A;  2J9Q A;  2XPY A;  2HO1 A;  5FZQ A;  5D66 A;  3ESL A;  4OAV B;  4CDN A;  2WXG A;  5D2M C;  4EEC A;  1OCO E;  4O1P A;  1X81 A;  3Q47 B;  2EIL E;  3KSL A;  1EYH A;  2XRZ A;  3AG2 E;  3JYS A;  3PZ1 A;  3FDH A;  3PE4 A;  1FVH A;  1UN9 A;  4UWH A;  3B7U X;  1LTX A;  1S64 A;  1Z5S C;  2OV8 A;  3CHQ A;  2AJA A;  4HFG A;  5FQ4 A;  5HI7 A;  1TJF A;  5CCM A;  3PEV B;  2WQH A;  4DPR A;  3DXM G;  5JHA A;  1O1R A;  5EYL A;  4GZ3 A;  4XI0 A;  3HVE B;  4C48 B;  3FP3 A;  2F0Y A;  1H0A A;  2QYU A;  2P9I G;  1WY6 A;  4ANX A;  2QY7 A;  1INZ A;  4BTB A;  3OXG A;  3UMV A;  2Y4U A;  4M3O A;  2DYS E;  1HF8 A;  1MYO A;  2E2E A;  3LEW A;  3ONL A;  3FHE A;  4YDY A;  3TWR A;  5LFA A;  4O6F A;  1JCQ A;  3CLJ A;  2A5E A;  3TXN A;  4MLP A;  2WXM A;  5ENQ D;  1UN8 A;  1X5B A;  4N5Q A;  2NYJ A;  4HRL A;  2DWZ A;  2PM7 A;  1E8Y A;  2EQX A;  2XZD G;  5HS0 A;  2J49 A;  2LSV A;  1HG2 A;  1IQU A;  3C72 A;  1IQR A;  3UI2 A;  2I6H A;  4G11 A;  1EPU A;  1N0Q A;  2AXU A;  4HNA D;  1TNB A;  3LVR E;  1FT1 A;  1TJC A;  2X6H A;  3NAW A;  4BSX A;  2DZN A;  4HRN A;  3FUN A;  4Y6W A;  3QC1 A;  4WNE A;  2DCP A;  3ULE G;  3NOC D;  4EBA A;  4J8D A;  2HR2 A;  4Q94 A;  4F7A A;  4Q96 A;  1TNZ A;  5JA4 D;  2L6B A;  4XX5 A;  2FBN A;  1TNU A;  1E96 B;  3AG1 E;  4I6E A;  4UUC A;  3FUM A;  2XEE A;  1XGW A;  3D9I A;  2GRQ B;  2XGO A;  5AYW D;  4ACL A;  1Y8M A;  1YA0 A;  3ZYM A;  3D9L A;  4AOF A;  4AY5 A;  1Q2Z A;  4L7T A;  3UM1 A;  4HOT A;  4APO A;  5HKP A;  2KC7 A;  1H19 A;  3FUF A;  4H7X A;  3E4B A;  1MZC A;  5EYP F;  1WG0 A;  1E7U A;  2KCL A;  2BTD A;  4W9R A;  4J0U A;  2WB2 A;  2OOE A;  3PRZ A;  1TN8 A;  2R59 A;  3B7S A;  2IO3 C;  4BT8 A;  2V0P A;  4FP7 A;  3CHP A;  5KCM A;  4JC8 A;  4HXI A;  3E32 A;  4GCN A;  4HB5 A;  4XKB A;  5FTP A;  2DIW A;  4BES A;  1MQS A;  4CT4 A;  3VLF A;  4FUL A;  2PZI A;  2XEV A;  5KJL A;  2P9S G;  3ZYL A;  1G3N B;  1HX8 A;  4AM9 A;  3FUH A;  2CHX A;  4CEM A;  5B3S E;  5ANL A;  2UY1 A;  4BWR A;  3EU9 A;  2PL2 A;  2XRY A;  3Q73 A;  3C3Q A;  5FWQ A;  1NZN A;  2J8S D;  5ARF A;  1GW6 A;  4JEH A;  4EBA G;  1TNY A;  1UG3 A;  4GAA A;  4UWG A;  3ULY A;  3IHV A;  3S7D A;  2RFM A;  4DUI A;  4JXT A;  2PNN A;  5G04 J;  3ASF A;  3RRM B;  3U64 A;  1OCZ E;  4JEU A;  2F8X K;  1AWC B;  5KWD A;  4TXQ A;  3QAR A;  4JB8 P;  2ZGG A;  1NI1 A;  2C0M A;  2XS8 A;  3APF A;  5AQB A;  1N0R A;  1UW4 B;  3ASO E;  3CVU A;  4XKC A;  3S7B A;  2X6I A;  1E90 A;  4AIF A;  2PQN A;  5A7D B;  4LCT A;  5H7P A;  3WG7 E;  5D0Q D;  4EZJ A;  1TEZ A;  4DX5 D;  3RRU A;  3AS5 A;  3ZU7 B;  4JL0 A;  1W3B A;  2UY1 B;  3ZIM A;  4J8S A;  2GW1 A;  4JZY A;  2P9L G;  4U8V D;  5T4Y A;  4LNB A;  1SZA A;  2GRP B;  3LY7 A;  1IHB A;  5G2N A;  3Q78 A;  2ZXW E;  1IHG A;  4YDE A;  3MCX A;  5AAO A;  2LO6 A;  2OEW A;  3GZ1 A;  2XQ0 A;  1O1T A;  2VSY A;  2FF4 A;  4F6R D;  4UQZ A;  4NIK A;  1HZ4 A;  3QOU A;  2R05 A;  3QK0 A;  4WNG A;  3BEE A;  3VTY A;  3R7R A;  5CRV A;  3MV3 B;  1ELK A;  3UKU G;  3X2Q E;  2FO1 E;  4RSY A;  4ANW A;  3ZUV B;  5JJT A;  1Z6T A;  4R7L A;  2IOL A;  3K9I A;  3UQ3 A;  5IY5 E;  4B94 A;  5AEN A;  1DNP A;  2LXL A;  3V79 K;  4RG6 A;  1TR4 A;  1EF1 C;  2P58 C;  3I3N A;  2RKK A;  3ZXS A;  4I6J A;  1H2U A;  2CFU A;  2YHC A;  3C3O A;  3Q75 A;  2P9K G;  3NZU A;  5AAR A;  1WAO 1;  1N4Q A;  3L13 A;  4PDX A;  3D9N A;  4WWN A;  3ZKJ A;  4L1B A;  2VGX A;  3AU4 A;  2WXK A;  3L6A A;  3PDN A;  2WXL A;  4U63 A;  2WXJ A;  4GTT A;  4L9P A;  2XZT G;  1OWM A;  4GML A;  2Y69 E;  4URK A;  5AQ9 A;  4AY6 A;  5BNW A;  4AXH A;  3CVW A;  2L9B A;  1ELR A;  1KPS B;  1NA3 A;  3CQG B;  3CSF A;  1S63 A;  2IF4 A;  3SNX A;  4U8Y D;  4BX9 A;  1DCQ A;  2WM9 A;  4KZ0 A;  1JPL A;  3ZEF A;  4FJY A;  4DX6 D;  5HRY A;  4U95 D;  1HU3 A;  3DSU A;  3DSX A;  4LRZ A;  4YVQ C;  4B0Z A;  5ENO D;  3HG0 D;  5J08 A;  4PH4 B;  2HE0 A;  1JCR A;  3FU5 A;  4ANU A;  4EZK A;  2MRI A;  3DSV A;  4GU5 A;  2V4L A;  4ILI A;  4Z68 A;  1N4S A;  2VGX B;  5D0O D;  5DIZ A;  2C2L A;  3HXD A;  1HG5 A;  3PZ2 A;  3VTX A;  4G25 A;  1HE8 A;  2OND A;  3G2S A;  2P9P G;  3S7J A;  3FTW A;  2LNI A;  4WAF A;  3ENE A;  3CV0 A;  4EZL A;  3AJI A;  3IEG A;  1U3D A;  2GRM A;  3Q15 A;  4FHK A;  3ZGQ A;  5AIJ A;  4N39 A;  4DX2 A;  1LD8 A;  3DPD A;  1MHQ A;  5LCW J;  2F8Y A;  4DK5 A;  4JA9 A;  4A1S A;  3PUJ A;  1TNO A;  3LDZ A;  4GZC A;  2XEH A;  3MA5 A;  4B8A A;  4GTM A;  2AW6 A;  2IEJ A;  3HVE A;  1QQE A;  5AN8 A;  5FQ6 A;  5BXO A;  4N3B A;  4OVV A;  5CED B;  3TWQ A;  1HH8 A;  3J5P A;  1P5Q A;  4P29 A;  4DI4 A;  4I1A A;  1FVF A;  1HS6 A;  3FTX A;  2PQR A;  3R9M A;  3FH7 A;  1WDY A;  4RQI A;  1KZO A;  3UPV A;  3RSE G;  4PS3 A;  4HI9 A;  3QWW A;  5FQ7 A;  3IKO B;  3Q7A A;  3EDT B;  4I9C A;  4IUL A;  3P1U A;  4HOR A;  3ZXP A;  3F6Q A;  3TG4 A;  4U0U A;  1BI7 B;  3T5X A;  1HFA A;  4ZHB A;  4HOS A;  3ULQ A;  3SZ7 A;  3ASH A;  3CST A;  2VJ8 A;  3FTV A;  2R5S A;  1S0P A;  3HXB A;  2X6F A;  1OWP A;  3UIN C;  2Y0B G;  4PUC A;  4TXR A;  2DBA A;  2ZU6 B;  4J7W A;  4WWO A;  3EHR A;  5KJN A;  4IYP A;  1OCR E;  4CGW A;  3QNK A;  3ASD A;  3JXI A;  4UQY A;  4BEP A;  2UWJ G;  4OVU A;  5E75 A;  3DRA A;  3PRE A;  4JW1 A;  1TN6 A;  1NA0 A;  5AQA A;  3PEU B;  3JUE A;  4CT0 A;  4K5A B;  3TWU A;  5G05 J;  5T3R A;  3C98 A;  4K0R A;  5CEA A;  5ARG A;  4UQX A;  3TL5 A;  2C0L A;  4B93 B;  5LCW C;  3WXX A;  4FAD A;  2V5F A;  4IN3 B;  3G2U A;  3TWV A;  2R2L A;  5HQ8 A;  5DBK A;  4OYS A;  1OWO A;  5ENS D;  3GW4 A;  3HHM A;  1S70 B;  3CKC A;  4O1O A;  3JQ1 A;  4GTR A;  5LX8 A;  2LXM A;  3TG5 A;  3DSW A;  3NF1 A;  5FJY A;  3UKR G;  4GCO A;  3LJN A;  3RRN B;  1IKN D;  3VLD A;  4JA7 A;  4PS7 A;  4Y6C A;  3T5V A;  1L5J A;  1YMP A;  3DEP A;  4MRU A;  5CMY A;  3QB2 A;  1E8W A;  4AEZ C;  3UXG A;  5CBO A;  4GTQ A;  4HBD A;  1MX6 A;  3S2A A;  3RJV A;  1FCH A;  1OWN A;  3PE3 A;  4RLY A;  3ML9 A;  1D8D A;  2DVW A;  1DC2 A;  3TXM A;  3CK9 A;  3SI5 A;  4HRM B;  2X3M A;  3UM2 A;  2XHE A;  3RAU A;  2WXO A;  2ETA A;  3L54 A;  1DVP A;  2ZIR A;  3W9F A;  3N71 A;  4Q69 A;  2NSZ A;  4GB9 A;  2XS1 A;  4RG9 A;  4UI9 K;  1QZ2 A;  4OAU C;  1MJ0 A;  4TXP A;  3JCK C;  4WUY A;  5ENR D;  3R7Q A;  3SBS A;  3DSS A;  1NP7 A;  3MGB A;  2V8S E;  4DJA A;  4G24 A;  5G05 C;  4DRX E;  5JJ7 A;  4L23 A;  5CHE E;  4I1O B;  2B0O E;  3LKU A;  2KCK A;  3HXE A;  4JHK A;  5A23 A;  3C3R A;  4AJW A;  2LUH A;  3B7R L;  3MKQ A;  4J6I A;  3ISM C;  4LNG A;  2XGS A;  1NL4 A;  4UWL A;  1N52 A;  2PM6 A;  4BX8 A;  2YNQ A;  1SA5 A;  4N3A A;  4JVS A;  5EIL A;  5KJK A;  4AV7 A;  1U3C A;  3CVN A;  2YIN A;  4FLH A;  1OWL A;  4CCA A;  3B7B A;  3R9A B;  5EID A;  2CHZ A;  2V4H C;  3I5P A;  2GRO B;  4BER A;  2E0I A;  5E76 A;  5BW8 C;  4GA1 A;  2KZT A;  4A3T A;  4ANV A;  4I43 A;  1H6K A;  3U4T A;  4BET A;  2WXH A;  3FTU A;  2X6K A;  3EU5 A;  2FO7 A;  3URZ A;  2ZGD A;  2HYZ A;  3QWV A;  4C9B B;  3MKQ B;  1N11 A;  2I9C A;  4KVM A;  3Q4A B;  3PZD A;  1ZU2 A;  3GYZ A;  4G1T A;  3L9T A;  4U96 D;  2FEZ A;  5FIN A;  1SVX A;  3OTN A;  4ACK A;  3B13 A;  1SA4 A;  3FUJ A;  4CGV A;  4GYO A;  2FUL A;  1MX4 A;  3QWP A;  3KEA A;  3NBN B;  1RZ4 A;  2CG3 A;  2QFC A;  3OXL A;  3Q79 A;  4I2Z A;  2WXP A;  5J90 A;  2XPI A;  2JAB A;  3FUE A;  3HDX A;  4D10 C;  3QKY A;  3JQ0 A;  3I4R B;  4IRU A;  3ZRH A;  3IHY A;  3QJZ A;  2BF0 X;  1PY1 A;  2KZT B;  1H2V C;  1LD7 A;  1MX2 A;  1BPO A;  2KXP C;  5CRU A;  3ASG A;  2X38 A;  3ZHE A;  2H6F A;  4XEI G;  4G8L A;  4TRQ A;  5FZS A;  1BI8 B;  5CCL A;  1RW2 A;  4MS6 A;  4LG6 A;  2I1J A;  3D9J A;  2Y1L E;  1K1B A;  4I2W A;  3FWV A;  4F53 A;  2I2O A;  2KBX A;  5ENN A;  3V31 A;  3IBE A;  3CQC B;  2L0T B;  5BUZ A;  5FT9 A;  1N4R A;  4JD2 G;  3UIO C;  1V54 E;  4L2Y A;  1K1A A;  5CEC B;  3T8K A;  3G2T A;  3D9H A;  4GMJ A;  3FU0 A;  3CHM A;  5EX3 A;  4YVO A;  3EIQ C;  3APC A;  5CER B;  2VGY A;  2DYR E;  2VQ2 A;  5G55 A;  3ZHE B;  1SZ9 A;  2Y3A A;  2CG2 A;  2H6G A;  3ZVV A;  2WXF A;  1ZB1 A;  5C2Y A;  5M72 A;  4U0Z A;  1D8E A;  4B89 A;  4N2S A;  4LUN U;  3FUI A;  4H7Y A;  5AQ7 A;  1A5E A;  4G26 A;  3LXU X;  2VYI A;  2YQ8 A;  4UWF A;  1K8K G;  2VTB B;  3PVL A;  4EHM A;  3SGH A;  5EDS A;  3T9K A;  2RD0 A;  2DZO A;  3ESK A;  2WXQ A;  4HI8 A;  2XEN A;  3BUA A;  4FLB A;  4B8C B;  2OCC E;  1OCC E;  2LAH A;  2EIJ E;  3EHN A;  3RKV A;  5C1D A;  3FUK A;  2CHW A;  5LOZ A;  4E6H A;  3MKR A;  3L08 A;  1YYH A;  4XIF A;  3MX3 A;  3BQO A;  4UI9 C;  2RFA A;  3SFY A;  4GTO A;  2WMO A;  3DST A;  3IXE A;  3G2V A;  3U9W A;  3B95 A;  4GTP A;  2ION A;  4JHJ A;  3O48 A;  4YND A;  4DLQ A;  3UM3 A;  2AXZ A;  3LPZ A;  2AWI A;  3LYA A;  1D9S A;  4CRW A;  3FEY A;  4XE0 A;  3CVY A;  3RO3 A;  4FU3 A;  4I9E A;  1QNF A;  2IQC A;  2XCC A;  3FEX A;  1H6O A;  5BPP A;  2ZIS A;  3CIA A;  3V2O A;  3LJ3 A;  3TWS A;  3GZ2 A;  4N2Q A;  4DI3 A;  4WNF A;  3HXF A;  1Z3X A;  3MYV A;  3G2W A;  3E33 A;  3UUX A;  4GMR A;  3UX4 A;  2MYO A;  5BV0 A;  1TYQ G;  3RU0 A;  4J8Y A;  1FT2 A;  3CVP A;  3MJW A;  4GZ6 A;  4J8E A;  1IYG A;  4HLE A;  4FC8 A;  3DBS A;  5EX0 A;  4GZD A;  4KXK B;  4F1S A;  3UTM A;  4CDR A;  3LS8 A;  4ME2 A;  5BXU A;  5B1B E;  4ILH B;  3TJP A;  2KCV A;  1HXI A;  3AG4 E;  4C0M A;  4MKT A;  2B6C A;  2AXV A;  2ETC A;  5KJM A;  3CHR A;  4KBQ A;  4BTA A;  2A5U A;  4U8H A;  3NZS A;  3CHS A;  4LSZ E;  4CDM A;  4O60 A;  1N94 A;  1KZP A;  3BG1 B;  4DLO A;  3CVQ A;  1Y6I A;  4CZ2 D;  5JHB A;  3UT7 A;  4PS8 A;  4AP2 A;  3AS8 A;  1V55 E;  4YDO A;  2BKK B;  5EN5 D;  2XGM A;  3SHF A;  4I6G A;  3PZ4 A;  1JUQ A;  3FH8 A;  1SQM A;  1VDY A;  3LVQ E;  3UT4 A;  2P2C P;  4BFR A;  3UIP C;  3ASN E;  4LER A;  4L2L A;  2WQ7 A;  3Q9N C;  3PH0 C;  4KYO B;  3CVV A;  1N95 A;  3TWX A;  4GTV A;  1DCE A;  3FY4 A;  3KAE A;  5AJL A;  3CGH A;  1N4P A;  2X6J A;  5ENP D;  2MHK A;  3PNT B;  2WPV A;  3AAA C;  3D9O A;  1ELW A;  3TAX A;  1ZBP A;  3V30 A;  4LEU A;  1QYM A;  2P9N G;  4K03 A;  3CEQ A;  2AVP A;  2EIN E;  3PUK A;  3T8M A;  3E30 A;  2QZA A;  2WQ6 A;  3PS6 A;  1E7V A;  4U07 A;  3FU6 A;  3Q5M A;  3SY2 A;  2BUG A;  1IXV A;  2ILR A;  1TN7 A;  4ATZ D;  2EIK E;  3I4G A;  3SD5 A;  2WXR A;  1JCS A;  2MOW A;  4FA6 A;  1BLX B;  3E34 A;  2H6H A;  4CYM D;  2FI7 A;  1HO8 A;  2XPZ A;  1O5M A;  4NAC A;  4YDW A;  3BG0 B;  3UT8 A;  1KT1 A;  5JJ6 A;  4HQD A;  4K5C A;  2R03 A;  4GTS A;  3AU5 A;  3ZYQ A;  4DX7 D;  1NFI E;  2V5Q C;  3HYM B;  3TWW A;  2J09 A;  3O4Z A;  3JUI A;  3FTZ A;  1FPP A;  3DWL G;  1LF8 A;  2BED A;  5A6C A;  3EHM A;  4DX1 A;  4TV3 A;  5KBA A;  4HS2 A;  1WM5 A;  3HRA A;  4XI9 A;  2Q7F A;  2EIM E;  5ENT D;  3V2X A;  3J5Q B;  2NXP A;  1JWF A;  3ZNG A;  3VLE A;  4ATG A;  1UJK A;  1U2V G;  3HXC A;  3ZN3 A;  1KLX A;  3C5R A;  3FU3 A;  3Q9U C;  1N54 A;  4I1M A;  4WND A;  3FUL A;  3L17 A;  4N3C A;  1QBQ A;  4E85 A;  5AJD A;  1E8Z A;  2J07 A;  3ABL E;  4A63 B;  3RIB A;  5EIB E;  1O1S A;  4GPK A;  4G23 A;  4C0E A;  3CK8 A;  5EKQ D;  4ZFH A;  2KAT A;  3SQV A;  3SF4 A;  4G2V A;  3FFL A;  4BT9 A;  4A55 A;  2Y4T A;  3D9P A;  1BD8 A;  3AS4 A;  4EPZ A;  1A17 A;  4LNU D;  4K5B A;  3SBT B;  4A3V A;  3D9M A;  4V3I A;  3B7T A;  1PAQ A;  1OY3 D;  4ABN A;  3L16 A;  2IU1 A;  1E8X A;  3QAQ A;  4GPM A;  3MZL B;  4HOQ A;  2IO2 C;  4APF A;  4FJZ A;  3ABK E;  2OVF A;  3AG3 E;  1UOH A;  1PC2 A;  3EUV A;  4KMO A;  3UM0 A;  2J4D A;  3CHO A;  2LSU A;  2OEV A;  3RK6 A;  3FTS A;  4XZ4 A;  4JHR A;  5BT1 A;  2CFZ A;  3U3W A;  3GZS A; 
#chains in the Genus database with same CATH homology
 2RKK A;  2LXL A;  5H7P A;  4TXQ A;  2LUH A;  4TXP A;  4U7E B;  4TXR A;  2LXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...