4U7EB

The crystal structure of the complex of lip5 ntd and ist1 mim
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
163
structure length
163
Chain Sequence
b'SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 66
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4u7eB00
2RKKA 4TXPA 4TXRA 2LXMA 4TXQA 5H7PA 2LUHA 4U7EB 2LXLA
chains in the Genus database with same CATH superfamily
4LUNU 4GTOA 5BW8C 3ESKA 3SGHA 2QFCA 1MHQA 1BLXB 5HI7A 5FTPA 4RSYA 2A5EA 3DSTA 4TXQA 3JQ1A 4G24A 3UX4A 1VDYA 4KZ0A 3FU6A 3ZKJA 3HIZA 5C1DA 3LXUX 3R9MA 4N3CA 3ZYLA 4FHJA 3U4TA 4G11A 4DX1A 4U0SA 1Z3XA 2E0IA 4CDNA 3CHMA 3EU5A 2WXNA 1K8KG 1H2VC 5ENPD 4HS2A 4Q94A 1JCSA 4KVOA 3ISMC 4IYPA 1JWFA 3CKBA 2I1JA 1TJCA 4I2ZA 3G2WA 1SZ9A 1DNPA 4GYYA 1OWNA 2XCBA 5EIDA 3ZYKA 4HOQA 3CHOA 4NURA 3FY4A 3DEPA 4E85A 2RFAA 2V0PA 2WXQA 4AY6A 5T8IA 1S64A 3TWVA 1N11A 5EN5D 4HVBA 1H2UA 2R02A 2WXOA 4HI8A 3G2UA 3E33A 4AVXA 1HS6A 4GCOA 2NYJA 3ASDA 2ETCA 4N39A 4RQIA 4R7LA 5BXUA 4CDRA 3EIJA 4QFVA 1V55E 2WXMA 4LEUA 2H6HA 2WQHA 3HXCA 1TNBA 4WNDA 4XEIG 3HXEA 5LOZA 1UN9A 3C3OA 3TWQA 4GZ6A 2FULA 4F3VA 3HXDA 5D0OD 3ZRHA 1ELRA 3TG5A 2UY1B 3D9OA 2EINE 3LY7A 1IXVA 3ZHEA 1UW4B 2XS8A 3GYZA 4BSZB 3ML9A 2EIME 3ABME 2R2LA 3UXGA 3Q47B 4KBQA 3UT7A 3ZU7B 4AY5A 1BPOA 1TR4A 2WPVA 3TWXA 3UKRG 4KT6B 3QWVA 3UI2A 4EHMA 1P5QA 1KZPA 4K5AB 2ZXWE 1Z5SC 2KZTA 3OXFA 3DSXA 3FH7A 5BV0A 4I17A 3DBSA 2IU1A 3LJNA 3MKRA 1YA0A 4A55A 3WXXA 4I1OB 3SBSA 3UKUG 4QQIA 3APCA 3CVWA 4I9EA 1QBQA 4B94A 2ZIRA 4EZKA 3ZPJA 4GCNA 3SQVA 4ILGA 1Y6IA 1EPUA 2Y4TA 2GRNB 1NA0A 4AIFA 4LG6A 4ANWA 3ASGA 1IQRA 4ZHBA 1S0PA 3GW4A 4RG6A 3PH0C 1KLXA 4CDMA 5KNGA 2F8XK 3LY8A 3AAAC 3CV0A 3Q9UC 3D9NA 1KT0A 5IY5E 3RK6A 2VSNA 4XX5A 4EPZA 3GZ1A 3DXKG 4A1GA 4GTSA 1N94A 2Y1LE 2L6BA 1E8XA 1WM5A 5HKPA 2XEEA 4ME2A 3S7BA 3PDNA 1ZB1A 3IHVA 5EYLA 3CVYA 4KXKB 4CCAA 5LX8A 4Q96A 5JJTA 2J4BA 2BEDA 4I9CA 1WAO1 3FULA 3J5PA 4M7CA 2F8YA 1KT1A 2V5FA 4ATGA 2WXPA 3DRAA 1YYHA 3LS8A 4B8CB 4MKTA 2IY0C 3ZIMA 2X38A 2HR2A 2OEVA 2WXIA 3TWSA 5ARFA 4U0ZA 2VSYA 4U8HA 4IN3B 1WDYA 4GZ3A 3CVVA 4WUYA 3UM3A 1Y8MA 1TNZA 3FU5A 4UWGA 3V79K 3MJWA 4M3OA 4YVOA 1HG2A 1RZ4A 1TN8A 2GRMA 4FADA 3QDNA 2NC9A 5CBNA 3MKQA 3CQGB 2P2CP 4H7YA 1OXJA 3Q75A 3RO2A 5KJKA 3S7JA 3RU0A 4JPSA 5KNHD 5G55A 3PE3A 2JEKA 4F53A 4BWRA 3TAXA 5B3SE 3D9JA 3L6AA 4L2LA 4HNAD 5CCMA 3HXFA 3SNXA 4HLEA 2H6IA 2I2OA 4XI0A 3S7DA 3ZVVA 3D9MA 4TXRA 2PM7A 4HRNA 3DEOA 3FTXA 3SO8A 3B7BA 3L16A 3Q79A 4PDXA 4U7EB 4UI9C 2P9NG 3IV0A 3C5RA 4GTTA 2P9SG 4V3IA 4I1AA 3PE4A 3UTMA 5JMND 2ZGGA 2Y0BG 5FINA 3UT4A 1HH8A 2PQNA 4JZYA 2H6FA 5AYWD 2HYZA 2ZU6B 4JEUA 3AG3E 1PY1A 2P9KG 4F6RD 2R05A 3K9IA 4DI3A 3V31A 1NP7A 3D9IA 3U66A 3L82A 4HOTA 3L13A 5BV1A 3B7RL 2J4DA 4ILIA 2UWJG 4TRQA 3ASNE 3KSQA 4YDYA 3GZ2A 1N4SA 4WWOA 4GPKA 3JQ0A 3NB2A 2NSZA 3FUKA 5KBAA 1DVPA 3RJVA 2AVPA 2PNNA 4J8YA 1Q2ZA 4BT8A 4XKBA 3NZSA 2LO6A 5EX0A 1HO8A 3C3RA 3HRAA 4YDOA 1IQUA 1MQSA 1OWLA 2X6IA 5KJMA 4I2WA 3O48A 3JXIA 5AQ9A 2LSVA 2VQ2A 3WG7E 4GYWA 3L08A 4DX6D 2ZISA 3PZ2A 3TL5A 4Z68A 1HXIA 1TJFA 2A5UA 4APOA 4CEMA 2CG3A 4CGWA 3FP3A 3MV3B 4JL0A 2BTDA 3ULEG 3CVXA 4GZDA 3E4BA 3EIQC 1JCRA 1V54E 2KM4A 3EHNA 3MKQB 5AJDA 3ZYMA 2DCPA 2L9BA 5G2NA 1H6PA 3PZDA 2UY1A 3RRMB 2PQRA 3S2AA 5B1BE 1Z6TA 2J09A 2VYIA 4J8SA 1H19A 3JXJA 3AS5A 2LSUA 2WXKA 4EZLA 2HE0A 3MEKA 1BI7B 1U3CA 2JABA 3APFA 4MS6A 3I4RB 1N54A 4HQDA 2IQCA 4GZCA 4GTPA 4LERA 3KAEA 4FJZA 1EYHA 2PZIA 2QYUA 3CHQA 2AWIA 3B7SA 3PEVB 3FEYA 3APDA 3QAQA 2GW1A 1HX8A 2XGOA 2AXUA 1QQEA 4OYSA 2KXPC 3AS4A 5EDSA 2YINA 1B89A 1MJ0A 1K1BA 3VTXA 5J08A 3FUDA 4KMOA 4LNUD 1DCEA 1IKND 3CIAA 1FVFA 2XEVA 3FUIA 5BUZA 4F7AA 5E75A 1H2TC 1SZAA 3ASHA 4DJAA 2ZGDA 2IEJA 3LY9A 3SZ7A 2KCVA 4L1BA 4AOFA 3CSFA 5DBKA 4HB5A 2WXHA 4J8EA 2P58C 3F6QA 3VLEA 1AWCB 4ANXA 1E90A 3CVUA 2BKGA 1HG5A 1U3DA 1L5JA 5LCWJ 3C98A 1E8YA 5B1AE 2OEWA 1LTXA 1U2VG 4WWPA 3Q78A 5CRUA 4IRUA 3UMVA 2XENA 3T9KA 2J07A 4NQ0A 3DSSA 3R7QA 4FLHA 1UJKA 2BKKB 3IKOB 5EX3A 1X81A 4HXIA 3LVRE 1UG3A 3Q4AB 3D9PA 5FT9A 3LJ3A 4BY6A 2V4LA 3TXNA 2DZNA 4P29A 3QWWA 3LDZA 4O1PA 4EECA 3CK7A 3CSTA 3E32A 5ANLA 2IOLA 1HZ4A 4K5BA 2XQ0A 3T5XA 2Q7FA 4YVQC 2L0IA 4UQZA 4GA1A 1TN6A 5A23A 1W3BA 2H6GA 3JUEA 1HE8A 3QARA 3AG4E 5EYPF 1JWGA 4DX7D 4AXHA 5FZSA 4GMJA 3URZA 3FTWA 2V8SE 3UPVA 2B6CA 3CKCA 2X6KA 3QK0A 4L7TA 4AV7A 3JUIA 4G8LA 1MZCA 4HOUA 3LCAA 4UQXA 4GTRA 2P9UG 4PH4B 4AJWA 5FQ8A 2WXLA 3NZUA 2FF4A 2HO1A 3SFZA 3G2TA 3KEZA 5ITZF 3FUEA 2F0YA 3NF1A 3NOCD 4TXPA 3T8MA 3IHYA 3P2BA 3NAWA 3G2VA 5AQAA 4H7XA 3U64A 1N52A 2VTBB 1H0AA 2CFZA 2XZDG 1NI1A 1MYOA 2KCLA 4J7WA 3FTYA 4FP7A 3BG0B 4F1PA 4NACA 3RO3A 2CHXA 2FO1E 3ZYQA 3Q49B 1N95A 3D9KA 4WWNA 2AXVA 3SFXA 3UM1A 1INZA 1N4RA 5ANRA 1A17A 5CBOA 3DWLG 3CLJA 1N4PA 3L17A 1N0RA 1G3NB 3V2OA 1OWPA 1TNYA 1BU9A 2WQ6A 2I1KA 1TEZA 4GA2A 2C0LA 3UINC 1DCQA 1IHGA 2WXFA 2IOSA 3ONLA 2E2EA 4HI9A 3C3QA 3SY2A 2XEHA 4AEZC 3D3MA 4J8DA 4U04A 4L9PA 3KS2A 1SVXA 1OY3D 4N2SA 1EDUA 1OCRE 5JHBA 5FQ7A 4UWLA 4XI9A 4GTQA 4UWKA 4G23A 1SA4A 2A4ZA 4BTAA 3Q7FA 3SF4A 3HVEB 1Z3YA 2BF0X 2YNQA 3PZ1A 3I4GA 3QWPA 2Y3AA 5ENOD 1OUVA 2GRQB 3Q7AA 2IF4A 4C48B 5C2YA 4NRHB 4KYOB 2LAIA 2XPIA 3QNKA 5LP0A 2X6JA 4C9BB 2R5SA 2VSOE 4TUMA 3B13A 4URKA 4RLYA 3UT8A 4XZ4A 4JHRA 4LSZE 4JC8A 5CEDB 1AP7A 4PUCA 4GZ5A 2QC9A 5A7DB 5JJ7A 3B7TA 3AU5A 4JA9A 5FQ4A 2R17C 2IJGX 1XGWA 1O1SA 2V5QC 2DBAA 3DXMG 3FFLA 5ENRD 3B7UX 5CECB 3N71A 2Y69E 4PS3A 4J0UA 3OAWA 5FZRA 2VGXA 3B95A 4BX8A 4W9RA 4J8FA 1PC2A 1TYQG 4E6HA 3PREA 3RSEG 2R59A 2YHCA 3FU0A 2YHEA 2RKKA 3RAUA 4N2QA 5KJNA 4ACLA 2KC7A 4HRLA 4DLOA 5AJLA 2C0MA 1DC2A 4OVVA 4MLPA 5HRYA 1ZBPA 4BERA 3FH8A 4U96D 3ZW3A 3EHMA 3U3WA 4GA0A 1QNFA 2Y4UA 1YMPA 1QYMA 1OWMA 3PVLA 4U0UA 5ENTD 4WNGA 3ABLE 2FBNA 4JEHA 5JHAA 3BEEA 2X6FA 3KSLA 3DPYA 4EBAG 2DVWA 2I9CA 4BTBA 5JA4D 3FWVA 2ETAA 4K5CA 3RRUA 3NOGD 2OV8A 4Y6CA 3HYMB 1FT1A 4I1MA 3Q15A 4JA7A 3DPDA 4CZ2D 4ACKA 3FTUA 2P9PG 1IYGA 4NIKA 4OVUA 4XE0A 3BG1B 1D9SA 3CHRA 2PM6A 5AAOA 4U07A 5M72A 3W9FA 1XNFA 3SD5A 4JHKA 4XKCA 2FO7A 4RVBA 2XZTG 4TV3A 4GYOA 2OVFA 3U9WA 3L9TA 2MHKA 4A1SA 4GMLA 3Q73A 4DX5D 1TNUA 3QKYA 4GPMA 3CHPA 4U8YD 4J6IA 4BSXA 3ABKE 1ELWA 1TN7A 3SHFA 1LF8A 3QC1A 4DUIA 3FHEA 3G2SA 4B0ZA 5HS0A 1ELKA 4N3AA 1O1RA 3TG4A 1FT2A 4DRXE 2DZOA 2WMOA 1HF8A 3T8KA 4JW1A 2QYJA 4WNFA 3CVPA 1SQMA 3C72A 5LFAA 2VGXB 3HG0D 1E7VA 3CVLA 2DYSE 2CG2A 4C0EA 5BXOA 3FUJA 5D66A 3TXMA 3VLFA 2XGSA 3PNLB 4HBDA 5T3RA 4BETA 5DIZA 5LCWC 4I6JA 4YDEA 5AQBA 2VSXE 3LPZA 1QZ2A 4DI4A 2I6HA 5ENQD 1EF1C 2XS1A 2C2LA 3E34A 4N5CA 3UIOC 4GTMA 3ZUVB 4B93B 4ABNA 1E8ZA 4KZCA 5CRVA 1S70B 2XCCA 4CRWA 5JJ6A 2EIKE 3QOUA 2VGYA 2VTBA 3BQOA 1BI8B 3OXGA 5AENA 3V30A 2IFUA 4YDWA 4WAFA 3IEGA 2WXJA 5HQ8A 1NL4A 1MX6A 2LNIA 3EUVA 3TWWA 3AG1E 1WG0A 3FH5A 1JCQA 4ILHB 4GU5A 4Y6WA 4BT9A 3VLDA 2MOWA 2KATA 3KD7A 3RRNB 2VJ8A 3CEQA 4UUCA 1PAQA 2XRYA 3ZN3A 3GZSA 2JLBA 4UWHA 1TNOA 2ONDA 1D8DA 3FU3A 3ML8A 4MBGA 4BFRA 3FUMA 1NZNA 4LCTA 3PZ3A 5BNWA 3HVEA 2HM8A 1ZU2A 4HOSA 2WXGA 3D9LA 5EIBE 4A3VA 5AIJA 2LXLA 3AU4A 4JXTA 5FIOA 3UM2A 5EKQD 4TUUA 4CT4A 3DSVA 3SBTB 3BU8A 3LKUA 3PEUB 3TGOA 3E30A 4KVMA 3QB2A 4UQYA 2KBXA 3HXBA 2DIWA 4N5QA 2YQ8A 4O6FA 2EILE 3EHRA 4HORA 4BX9A 3NBNB 3CGHA 4UI9K 1K3ZD 2ILRA 3D9HA 4DPRA 5FZQA 4CYMD 4EZJA 4U63A 1YCSB 1OCZE 3IBEA 3UQ3A 4ZFHA 2LXMA 4FA6A 3MV2B 3LVQE 5KWDA 1HFAA 4FC8A 5BPPA 2BUGA 5CERB 2NXPA 2F37A 3E37A 2FEZA 1NFIE 3EHQA 3MA5A 4L23A 4ANVA 4I6GA 4B89A 3ESLA 5FWQA 5CEAA 1JPLA 4APFA 2XGMA 4FJYA 3L54A 3MGBA 2AW6A 3AJIA 5CCLA 2WXRA 1K1AA 3AS8A 2P9LG 4XIFA 3ULYA 3VTYA 3R9AB 1HU3A 4G8KA 5G05C 4MRUA 1OT8A 4YNDA 5BT1A 3J5QB 4K03A 1JUQA 3KEAA 3HDXA 2P9IG 4C0MA 5ENSD 4G25A 2FI7A 1MX4A 2ETBA 1FVHA 3Q5MA 4OAUC 1FCHA 3X2QE 1SW6A 4BEPA 3FTZA 3JCKC 2EIJE 1E7UA 5KCMA 3FUNA 3JYSA 1D8EA 2XHEA 2VGEA 3PZ4A 3ASOE 2GGFA 2X6HA 3PNTB 2LUHA 5G05J 3I5PA 4U8VD 5T4YA 3R7RA 1UJJA 4O1OA 3Q9NC 2J49A 3CVNA 3TJPA 3MYVA 1O5MA 5CMYA 1O1TA 5FJYA 1N9AA 2CFUA 4GAAA 3P1UA 4WNEA 3LYAA 5ARGA 3OTNA 3PUJA 4G1TA 5AN8A 5EILA 1S63A 4FHKA 5A6CA 3HHMA 3PUKA 4G26A 3FDHA 4HRMB 4I6EA 3CR3A 3ZHEB 3ZEFA 1FPPA 4AM9A 1UN8A 2IONA 5KJLA 5ENNA 4IULA 2OOEA 3CQCB 4GMRA 3FUHA 4G2VA 3ZFWA 4FU3A 4A63B 2AXZA 3I3NA 3FUFA 3FTVA 4ATZD 4F1SA 1WY6A 2KZTB 2WM9A 3AG2E 3EDTB 5D2MC 1OWOA 3CVQA 3UM0A 2KCKA 4FLBA 2B0OE 3S7FA 2WB2A 3PS6A 1H6KA 3SFYA 4I43A 4EBAA 2OVBA 4L2YA 4ANUA 3TWUA 3ASFA 1OCOE 2EQXA 3MX3A 4LNGA 2RG8A 3FEXA 2QY7A 4PS8A 2L0TB 3TWTA 2XPZA 2GRLA 4PS7A 2RD0A 3RIBA 3DSUA 3V2XA 4JVSA 3ENEA 1IHBA 3CK8A 5J90A 2MYOA 4EQFA 5CHEE 1E96B 3RKVA 4X8QA 3ZGQA 4A3TA 2XPYA 2GROB 2X3MA 2J9QA 3MZLB 5G04C 3ZXSA 2GRPB 1N4QA 3ONKA 4RG9A 2LAHA 2L6JA 3CHSA 3PRZA 1MX2A 4DK5A 2WQ7A 1X5BA 3CK9A 3FTSA 1SA5A 4B8AA 2XRZA 2IO3C 3EU9A 2DWZA 4HLLA 5AARA 4U95D 4UI9J 1GW6A 4CT0A 3UUXA 4JHJA 4UWFA 1KZOA 4GTVA 2DYRE 2GRRB 4DLQA 1A5EA 1LD8A 3IXEA 1N0QA 5FQ6A 1OCCE 5H7PA 4DX2A 3DSWA 5G04J 3LEWA 1NA3A 3BUAA 5E76A 2AJAA 5CMWA 2CHZA 4CGVA 2J08A 4AP2A 3QJZA 4D10C 2J8SD 2PL2A 1KPSB 3TWRA 1LD7A 4JB8P 3EJNA 4LRZA 3ZNGA 3O4ZA 4GB9A 3L22A 3MCXA 1RW2A 1E8WA 3W9GA 2RFMA 5AQ7A 2OCCE 2M63A 3UIPC 4BESA 3SI5A 4JD2G 2QZAA 5D0QD 4LNBA 3OXLA 4O60A 1BD8A 4N3BA 1H6OA 3NQPA 2WVIA 2V4HC 3T5VA 1UOHA 2WMNA 3ZXPA 4Q69A 4FULA 3ULQA 2MRIA 2IO2C 4OAVB 2R03A 4K0RA 2CHWA 4HFGA
chains in the Genus database with same CATH topology
2RKKA 4TXPA 4TXRA 2LXMA 4TXQA 5H7PA 2LUHA 4U7EB 2LXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKK A;  4TXP A;  4TXR A;  2LXM A;  4TXQ A;  5H7P A;  2LUH A;  4U7E B;  2LXL A; 
#chains in the Genus database with same CATH topology
 4LUN U;  4GTO A;  5BW8 C;  3ESK A;  3SGH A;  2QFC A;  1MHQ A;  1BLX B;  5HI7 A;  5FTP A;  4RSY A;  2A5E A;  3DST A;  4TXQ A;  3JQ1 A;  4G24 A;  3UX4 A;  1VDY A;  4KZ0 A;  3FU6 A;  3ZKJ A;  3HIZ A;  5C1D A;  3LXU X;  3R9M A;  4N3C A;  3ZYL A;  4FHJ A;  3U4T A;  4G11 A;  4DX1 A;  4U0S A;  1Z3X A;  2E0I A;  4CDN A;  3CHM A;  3EU5 A;  2WXN A;  1K8K G;  1H2V C;  5ENP D;  4HS2 A;  4Q94 A;  1JCS A;  4KVO A;  3ISM C;  4IYP A;  1JWF A;  3CKB A;  2I1J A;  1TJC A;  4I2Z A;  3G2W A;  1SZ9 A;  1DNP A;  4GYY A;  1OWN A;  2XCB A;  5EID A;  3ZYK A;  4HOQ A;  3CHO A;  4NUR A;  3FY4 A;  3DEP A;  4E85 A;  2RFA A;  2V0P A;  2WXQ A;  4AY6 A;  5T8I A;  1S64 A;  3TWV A;  1N11 A;  5EN5 D;  4HVB A;  1H2U A;  2R02 A;  2WXO A;  4HI8 A;  3G2U A;  3E33 A;  4AVX A;  1HS6 A;  4GCO A;  2NYJ A;  3ASD A;  2ETC A;  4N39 A;  4RQI A;  4R7L A;  5BXU A;  4CDR A;  3EIJ A;  4QFV A;  1V55 E;  2WXM A;  4LEU A;  2H6H A;  2WQH A;  3HXC A;  1TNB A;  4WND A;  4XEI G;  3HXE A;  5LOZ A;  1UN9 A;  3C3O A;  3TWQ A;  4GZ6 A;  2FUL A;  4F3V A;  3HXD A;  5D0O D;  3ZRH A;  1ELR A;  3TG5 A;  2UY1 B;  3D9O A;  2EIN E;  3LY7 A;  1IXV A;  3ZHE A;  1UW4 B;  2XS8 A;  3GYZ A;  4BSZ B;  3ML9 A;  2EIM E;  3ABM E;  2R2L A;  3UXG A;  3Q47 B;  4KBQ A;  3UT7 A;  3ZU7 B;  4AY5 A;  1BPO A;  1TR4 A;  2WPV A;  3TWX A;  3UKR G;  4KT6 B;  3QWV A;  3UI2 A;  4EHM A;  1P5Q A;  1KZP A;  4K5A B;  2ZXW E;  1Z5S C;  2KZT A;  3OXF A;  3DSX A;  3FH7 A;  5BV0 A;  4I17 A;  3DBS A;  2IU1 A;  3LJN A;  3MKR A;  1YA0 A;  4A55 A;  3WXX A;  4I1O B;  3SBS A;  3UKU G;  4QQI A;  3APC A;  3CVW A;  4I9E A;  1QBQ A;  4B94 A;  2ZIR A;  4EZK A;  3ZPJ A;  4GCN A;  3SQV A;  4ILG A;  1Y6I A;  1EPU A;  2Y4T A;  2GRN B;  1NA0 A;  4AIF A;  4LG6 A;  4ANW A;  3ASG A;  1IQR A;  4ZHB A;  1S0P A;  3GW4 A;  4RG6 A;  3PH0 C;  1KLX A;  4CDM A;  5KNG A;  2F8X K;  3LY8 A;  3AAA C;  3CV0 A;  3Q9U C;  3D9N A;  1KT0 A;  5IY5 E;  3RK6 A;  2VSN A;  4XX5 A;  4EPZ A;  3GZ1 A;  3DXK G;  4A1G A;  4GTS A;  1N94 A;  2Y1L E;  2L6B A;  1E8X A;  1WM5 A;  5HKP A;  2XEE A;  4ME2 A;  3S7B A;  3PDN A;  1ZB1 A;  3IHV A;  5EYL A;  3CVY A;  4KXK B;  4CCA A;  5LX8 A;  4Q96 A;  5JJT A;  2J4B A;  2BED A;  4I9C A;  1WAO 1;  3FUL A;  3J5P A;  4M7C A;  2F8Y A;  1KT1 A;  2V5F A;  4ATG A;  2WXP A;  3DRA A;  1YYH A;  3LS8 A;  4B8C B;  4MKT A;  2IY0 C;  3ZIM A;  2X38 A;  2HR2 A;  2OEV A;  2WXI A;  3TWS A;  5ARF A;  4U0Z A;  2VSY A;  4U8H A;  4IN3 B;  1WDY A;  4GZ3 A;  3CVV A;  4WUY A;  3UM3 A;  1Y8M A;  1TNZ A;  3FU5 A;  4UWG A;  3V79 K;  3MJW A;  4M3O A;  4YVO A;  1HG2 A;  1RZ4 A;  1TN8 A;  2GRM A;  4FAD A;  3QDN A;  2NC9 A;  5CBN A;  3MKQ A;  3CQG B;  2P2C P;  4H7Y A;  1OXJ A;  3Q75 A;  3RO2 A;  5KJK A;  3S7J A;  3RU0 A;  4JPS A;  5KNH D;  5G55 A;  3PE3 A;  2JEK A;  4F53 A;  4BWR A;  3TAX A;  5B3S E;  3D9J A;  3L6A A;  4L2L A;  4HNA D;  5CCM A;  3HXF A;  3SNX A;  4HLE A;  2H6I A;  2I2O A;  4XI0 A;  3S7D A;  3ZVV A;  3D9M A;  4TXR A;  2PM7 A;  4HRN A;  3DEO A;  3FTX A;  3SO8 A;  3B7B A;  3L16 A;  3Q79 A;  4PDX A;  4U7E B;  4UI9 C;  2P9N G;  3IV0 A;  3C5R A;  4GTT A;  2P9S G;  4V3I A;  4I1A A;  3PE4 A;  3UTM A;  5JMN D;  2ZGG A;  2Y0B G;  5FIN A;  3UT4 A;  1HH8 A;  2PQN A;  4JZY A;  2H6F A;  5AYW D;  2HYZ A;  2ZU6 B;  4JEU A;  3AG3 E;  1PY1 A;  2P9K G;  4F6R D;  2R05 A;  3K9I A;  4DI3 A;  3V31 A;  1NP7 A;  3D9I A;  3U66 A;  3L82 A;  4HOT A;  3L13 A;  5BV1 A;  3B7R L;  2J4D A;  4ILI A;  2UWJ G;  4TRQ A;  3ASN E;  3KSQ A;  4YDY A;  3GZ2 A;  1N4S A;  4WWO A;  4GPK A;  3JQ0 A;  3NB2 A;  2NSZ A;  3FUK A;  5KBA A;  1DVP A;  3RJV A;  2AVP A;  2PNN A;  4J8Y A;  1Q2Z A;  4BT8 A;  4XKB A;  3NZS A;  2LO6 A;  5EX0 A;  1HO8 A;  3C3R A;  3HRA A;  4YDO A;  1IQU A;  1MQS A;  1OWL A;  2X6I A;  5KJM A;  4I2W A;  3O48 A;  3JXI A;  5AQ9 A;  2LSV A;  2VQ2 A;  3WG7 E;  4GYW A;  3L08 A;  4DX6 D;  2ZIS A;  3PZ2 A;  3TL5 A;  4Z68 A;  1HXI A;  1TJF A;  2A5U A;  4APO A;  4CEM A;  2CG3 A;  4CGW A;  3FP3 A;  3MV3 B;  4JL0 A;  2BTD A;  3ULE G;  3CVX A;  4GZD A;  3E4B A;  3EIQ C;  1JCR A;  1V54 E;  2KM4 A;  3EHN A;  3MKQ B;  5AJD A;  3ZYM A;  2DCP A;  2L9B A;  5G2N A;  1H6P A;  3PZD A;  2UY1 A;  3RRM B;  2PQR A;  3S2A A;  5B1B E;  1Z6T A;  2J09 A;  2VYI A;  4J8S A;  1H19 A;  3JXJ A;  3AS5 A;  2LSU A;  2WXK A;  4EZL A;  2HE0 A;  3MEK A;  1BI7 B;  1U3C A;  2JAB A;  3APF A;  4MS6 A;  3I4R B;  1N54 A;  4HQD A;  2IQC A;  4GZC A;  4GTP A;  4LER A;  3KAE A;  4FJZ A;  1EYH A;  2PZI A;  2QYU A;  3CHQ A;  2AWI A;  3B7S A;  3PEV B;  3FEY A;  3APD A;  3QAQ A;  2GW1 A;  1HX8 A;  2XGO A;  2AXU A;  1QQE A;  4OYS A;  2KXP C;  3AS4 A;  5EDS A;  2YIN A;  1B89 A;  1MJ0 A;  1K1B A;  3VTX A;  5J08 A;  3FUD A;  4KMO A;  4LNU D;  1DCE A;  1IKN D;  3CIA A;  1FVF A;  2XEV A;  3FUI A;  5BUZ A;  4F7A A;  5E75 A;  1H2T C;  1SZA A;  3ASH A;  4DJA A;  2ZGD A;  2IEJ A;  3LY9 A;  3SZ7 A;  2KCV A;  4L1B A;  4AOF A;  3CSF A;  5DBK A;  4HB5 A;  2WXH A;  4J8E A;  2P58 C;  3F6Q A;  3VLE A;  1AWC B;  4ANX A;  1E90 A;  3CVU A;  2BKG A;  1HG5 A;  1U3D A;  1L5J A;  5LCW J;  3C98 A;  1E8Y A;  5B1A E;  2OEW A;  1LTX A;  1U2V G;  4WWP A;  3Q78 A;  5CRU A;  4IRU A;  3UMV A;  2XEN A;  3T9K A;  2J07 A;  4NQ0 A;  3DSS A;  3R7Q A;  4FLH A;  1UJK A;  2BKK B;  3IKO B;  5EX3 A;  1X81 A;  4HXI A;  3LVR E;  1UG3 A;  3Q4A B;  3D9P A;  5FT9 A;  3LJ3 A;  4BY6 A;  2V4L A;  3TXN A;  2DZN A;  4P29 A;  3QWW A;  3LDZ A;  4O1P A;  4EEC A;  3CK7 A;  3CST A;  3E32 A;  5ANL A;  2IOL A;  1HZ4 A;  4K5B A;  2XQ0 A;  3T5X A;  2Q7F A;  4YVQ C;  2L0I A;  4UQZ A;  4GA1 A;  1TN6 A;  5A23 A;  1W3B A;  2H6G A;  3JUE A;  1HE8 A;  3QAR A;  3AG4 E;  5EYP F;  1JWG A;  4DX7 D;  4AXH A;  5FZS A;  4GMJ A;  3URZ A;  3FTW A;  2V8S E;  3UPV A;  2B6C A;  3CKC A;  2X6K A;  3QK0 A;  4L7T A;  4AV7 A;  3JUI A;  4G8L A;  1MZC A;  4HOU A;  3LCA A;  4UQX A;  4GTR A;  2P9U G;  4PH4 B;  4AJW A;  5FQ8 A;  2WXL A;  3NZU A;  2FF4 A;  2HO1 A;  3SFZ A;  3G2T A;  3KEZ A;  5ITZ F;  3FUE A;  2F0Y A;  3NF1 A;  3NOC D;  4TXP A;  3T8M A;  3IHY A;  3P2B A;  3NAW A;  3G2V A;  5AQA A;  4H7X A;  3U64 A;  1N52 A;  2VTB B;  1H0A A;  2CFZ A;  2XZD G;  1NI1 A;  1MYO A;  2KCL A;  4J7W A;  3FTY A;  4FP7 A;  3BG0 B;  4F1P A;  4NAC A;  3RO3 A;  2CHX A;  2FO1 E;  3ZYQ A;  3Q49 B;  1N95 A;  3D9K A;  4WWN A;  2AXV A;  3SFX A;  3UM1 A;  1INZ A;  1N4R A;  5ANR A;  1A17 A;  5CBO A;  3DWL G;  3CLJ A;  1N4P A;  3L17 A;  1N0R A;  1G3N B;  3V2O A;  1OWP A;  1TNY A;  1BU9 A;  2WQ6 A;  2I1K A;  1TEZ A;  4GA2 A;  2C0L A;  3UIN C;  1DCQ A;  1IHG A;  2WXF A;  2IOS A;  3ONL A;  2E2E A;  4HI9 A;  3C3Q A;  3SY2 A;  2XEH A;  4AEZ C;  3D3M A;  4J8D A;  4U04 A;  4L9P A;  3KS2 A;  1SVX A;  1OY3 D;  4N2S A;  1EDU A;  1OCR E;  5JHB A;  5FQ7 A;  4UWL A;  4XI9 A;  4GTQ A;  4UWK A;  4G23 A;  1SA4 A;  2A4Z A;  4BTA A;  3Q7F A;  3SF4 A;  3HVE B;  1Z3Y A;  2BF0 X;  2YNQ A;  3PZ1 A;  3I4G A;  3QWP A;  2Y3A A;  5ENO D;  1OUV A;  2GRQ B;  3Q7A A;  2IF4 A;  4C48 B;  5C2Y A;  4NRH B;  4KYO B;  2LAI A;  2XPI A;  3QNK A;  5LP0 A;  2X6J A;  4C9B B;  2R5S A;  2VSO E;  4TUM A;  3B13 A;  4URK A;  4RLY A;  3UT8 A;  4XZ4 A;  4JHR A;  4LSZ E;  4JC8 A;  5CED B;  1AP7 A;  4PUC A;  4GZ5 A;  2QC9 A;  5A7D B;  5JJ7 A;  3B7T A;  3AU5 A;  4JA9 A;  5FQ4 A;  2R17 C;  2IJG X;  1XGW A;  1O1S A;  2V5Q C;  2DBA A;  3DXM G;  3FFL A;  5ENR D;  3B7U X;  5CEC B;  3N71 A;  2Y69 E;  4PS3 A;  4J0U A;  3OAW A;  5FZR A;  2VGX A;  3B95 A;  4BX8 A;  4W9R A;  4J8F A;  1PC2 A;  1TYQ G;  4E6H A;  3PRE A;  3RSE G;  2R59 A;  2YHC A;  3FU0 A;  2YHE A;  2RKK A;  3RAU A;  4N2Q A;  5KJN A;  4ACL A;  2KC7 A;  4HRL A;  4DLO A;  5AJL A;  2C0M A;  1DC2 A;  4OVV A;  4MLP A;  5HRY A;  1ZBP A;  4BER A;  3FH8 A;  4U96 D;  3ZW3 A;  3EHM A;  3U3W A;  4GA0 A;  1QNF A;  2Y4U A;  1YMP A;  1QYM A;  1OWM A;  3PVL A;  4U0U A;  5ENT D;  4WNG A;  3ABL E;  2FBN A;  4JEH A;  5JHA A;  3BEE A;  2X6F A;  3KSL A;  3DPY A;  4EBA G;  2DVW A;  2I9C A;  4BTB A;  5JA4 D;  3FWV A;  2ETA A;  4K5C A;  3RRU A;  3NOG D;  2OV8 A;  4Y6C A;  3HYM B;  1FT1 A;  4I1M A;  3Q15 A;  4JA7 A;  3DPD A;  4CZ2 D;  4ACK A;  3FTU A;  2P9P G;  1IYG A;  4NIK A;  4OVU A;  4XE0 A;  3BG1 B;  1D9S A;  3CHR A;  2PM6 A;  5AAO A;  4U07 A;  5M72 A;  3W9F A;  1XNF A;  3SD5 A;  4JHK A;  4XKC A;  2FO7 A;  4RVB A;  2XZT G;  4TV3 A;  4GYO A;  2OVF A;  3U9W A;  3L9T A;  2MHK A;  4A1S A;  4GML A;  3Q73 A;  4DX5 D;  1TNU A;  3QKY A;  4GPM A;  3CHP A;  4U8Y D;  4J6I A;  4BSX A;  3ABK E;  1ELW A;  1TN7 A;  3SHF A;  1LF8 A;  3QC1 A;  4DUI A;  3FHE A;  3G2S A;  4B0Z A;  5HS0 A;  1ELK A;  4N3A A;  1O1R A;  3TG4 A;  1FT2 A;  4DRX E;  2DZO A;  2WMO A;  1HF8 A;  3T8K A;  4JW1 A;  2QYJ A;  4WNF A;  3CVP A;  1SQM A;  3C72 A;  5LFA A;  2VGX B;  3HG0 D;  1E7V A;  3CVL A;  2DYS E;  2CG2 A;  4C0E A;  5BXO A;  3FUJ A;  5D66 A;  3TXM A;  3VLF A;  2XGS A;  3PNL B;  4HBD A;  5T3R A;  4BET A;  5DIZ A;  5LCW C;  4I6J A;  4YDE A;  5AQB A;  2VSX E;  3LPZ A;  1QZ2 A;  4DI4 A;  2I6H A;  5ENQ D;  1EF1 C;  2XS1 A;  2C2L A;  3E34 A;  4N5C A;  3UIO C;  4GTM A;  3ZUV B;  4B93 B;  4ABN A;  1E8Z A;  4KZC A;  5CRV A;  1S70 B;  2XCC A;  4CRW A;  5JJ6 A;  2EIK E;  3QOU A;  2VGY A;  2VTB A;  3BQO A;  1BI8 B;  3OXG A;  5AEN A;  3V30 A;  2IFU A;  4YDW A;  4WAF A;  3IEG A;  2WXJ A;  5HQ8 A;  1NL4 A;  1MX6 A;  2LNI A;  3EUV A;  3TWW A;  3AG1 E;  1WG0 A;  3FH5 A;  1JCQ A;  4ILH B;  4GU5 A;  4Y6W A;  4BT9 A;  3VLD A;  2MOW A;  2KAT A;  3KD7 A;  3RRN B;  2VJ8 A;  3CEQ A;  4UUC A;  1PAQ A;  2XRY A;  3ZN3 A;  3GZS A;  2JLB A;  4UWH A;  1TNO A;  2OND A;  1D8D A;  3FU3 A;  3ML8 A;  4MBG A;  4BFR A;  3FUM A;  1NZN A;  4LCT A;  3PZ3 A;  5BNW A;  3HVE A;  2HM8 A;  1ZU2 A;  4HOS A;  2WXG A;  3D9L A;  5EIB E;  4A3V A;  5AIJ A;  2LXL A;  3AU4 A;  4JXT A;  5FIO A;  3UM2 A;  5EKQ D;  4TUU A;  4CT4 A;  3DSV A;  3SBT B;  3BU8 A;  3LKU A;  3PEU B;  3TGO A;  3E30 A;  4KVM A;  3QB2 A;  4UQY A;  2KBX A;  3HXB A;  2DIW A;  4N5Q A;  2YQ8 A;  4O6F A;  2EIL E;  3EHR A;  4HOR A;  4BX9 A;  3NBN B;  3CGH A;  4UI9 K;  1K3Z D;  2ILR A;  3D9H A;  4DPR A;  5FZQ A;  4CYM D;  4EZJ A;  4U63 A;  1YCS B;  1OCZ E;  3IBE A;  3UQ3 A;  4ZFH A;  2LXM A;  4FA6 A;  3MV2 B;  3LVQ E;  5KWD A;  1HFA A;  4FC8 A;  5BPP A;  2BUG A;  5CER B;  2NXP A;  2F37 A;  3E37 A;  2FEZ A;  1NFI E;  3EHQ A;  3MA5 A;  4L23 A;  4ANV A;  4I6G A;  4B89 A;  3ESL A;  5FWQ A;  5CEA A;  1JPL A;  4APF A;  2XGM A;  4FJY A;  3L54 A;  3MGB A;  2AW6 A;  3AJI A;  5CCL A;  2WXR A;  1K1A A;  3AS8 A;  2P9L G;  4XIF A;  3ULY A;  3VTY A;  3R9A B;  1HU3 A;  4G8K A;  5G05 C;  4MRU A;  1OT8 A;  4YND A;  5BT1 A;  3J5Q B;  4K03 A;  1JUQ A;  3KEA A;  3HDX A;  2P9I G;  4C0M A;  5ENS D;  4G25 A;  2FI7 A;  1MX4 A;  2ETB A;  1FVH A;  3Q5M A;  4OAU C;  1FCH A;  3X2Q E;  1SW6 A;  4BEP A;  3FTZ A;  3JCK C;  2EIJ E;  1E7U A;  5KCM A;  3FUN A;  3JYS A;  1D8E A;  2XHE A;  2VGE A;  3PZ4 A;  3ASO E;  2GGF A;  2X6H A;  3PNT B;  2LUH A;  5G05 J;  3I5P A;  4U8V D;  5T4Y A;  3R7R A;  1UJJ A;  4O1O A;  3Q9N C;  2J49 A;  3CVN A;  3TJP A;  3MYV A;  1O5M A;  5CMY A;  1O1T A;  5FJY A;  1N9A A;  2CFU A;  4GAA A;  3P1U A;  4WNE A;  3LYA A;  5ARG A;  3OTN A;  3PUJ A;  4G1T A;  5AN8 A;  5EIL A;  1S63 A;  4FHK A;  5A6C A;  3HHM A;  3PUK A;  4G26 A;  3FDH A;  4HRM B;  4I6E A;  3CR3 A;  3ZHE B;  3ZEF A;  1FPP A;  4AM9 A;  1UN8 A;  2ION A;  5KJL A;  5ENN A;  4IUL A;  2OOE A;  3CQC B;  4GMR A;  3FUH A;  4G2V A;  3ZFW A;  4FU3 A;  4A63 B;  2AXZ A;  3I3N A;  3FUF A;  3FTV A;  4ATZ D;  4F1S A;  1WY6 A;  2KZT B;  2WM9 A;  3AG2 E;  3EDT B;  5D2M C;  1OWO A;  3CVQ A;  3UM0 A;  2KCK A;  4FLB A;  2B0O E;  3S7F A;  2WB2 A;  3PS6 A;  1H6K A;  3SFY A;  4I43 A;  4EBA A;  2OVB A;  4L2Y A;  4ANU A;  3TWU A;  3ASF A;  1OCO E;  2EQX A;  3MX3 A;  4LNG A;  2RG8 A;  3FEX A;  2QY7 A;  4PS8 A;  2L0T B;  3TWT A;  2XPZ A;  2GRL A;  4PS7 A;  2RD0 A;  3RIB A;  3DSU A;  3V2X A;  4JVS A;  3ENE A;  1IHB A;  3CK8 A;  5J90 A;  2MYO A;  4EQF A;  5CHE E;  1E96 B;  3RKV A;  4X8Q A;  3ZGQ A;  4A3T A;  2XPY A;  2GRO B;  2X3M A;  2J9Q A;  3MZL B;  5G04 C;  3ZXS A;  2GRP B;  1N4Q A;  3ONK A;  4RG9 A;  2LAH A;  2L6J A;  3CHS A;  3PRZ A;  1MX2 A;  4DK5 A;  2WQ7 A;  1X5B A;  3CK9 A;  3FTS A;  1SA5 A;  4B8A A;  2XRZ A;  2IO3 C;  3EU9 A;  2DWZ A;  4HLL A;  5AAR A;  4U95 D;  4UI9 J;  1GW6 A;  4CT0 A;  3UUX A;  4JHJ A;  4UWF A;  1KZO A;  4GTV A;  2DYR E;  2GRR B;  4DLQ A;  1A5E A;  1LD8 A;  3IXE A;  1N0Q A;  5FQ6 A;  1OCC E;  5H7P A;  4DX2 A;  3DSW A;  5G04 J;  3LEW A;  1NA3 A;  3BUA A;  5E76 A;  2AJA A;  5CMW A;  2CHZ A;  4CGV A;  2J08 A;  4AP2 A;  3QJZ A;  4D10 C;  2J8S D;  2PL2 A;  1KPS B;  3TWR A;  1LD7 A;  4JB8 P;  3EJN A;  4LRZ A;  3ZNG A;  3O4Z A;  4GB9 A;  3L22 A;  3MCX A;  1RW2 A;  1E8W A;  3W9G A;  2RFM A;  5AQ7 A;  2OCC E;  2M63 A;  3UIP C;  4BES A;  3SI5 A;  4JD2 G;  2QZA A;  5D0Q D;  4LNB A;  3OXL A;  4O60 A;  1BD8 A;  4N3B A;  1H6O A;  3NQP A;  2WVI A;  2V4H C;  3T5V A;  1UOH A;  2WMN A;  3ZXP A;  4Q69 A;  4FUL A;  3ULQ A;  2MRI A;  2IO2 C;  4OAV B;  2R03 A;  4K0R A;  2CHW A;  4HFG A; 
#chains in the Genus database with same CATH homology
 2RKK A;  4TXP A;  4TXR A;  2LXM A;  4TXQ A;  5H7P A;  2LUH A;  4U7E B;  2LXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...