4U7TB

Crystal structure of dnmt3a-dnmt3l in complex with histone h3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
187
Chain Sequence
b'FMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGVRVWSNIPAIRSALVSEEELSLLAQNKSSTKLVKNCFLPLREYFKYFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (cytosine-5)-methyltransferase 3A
publication title Structural insight into autoinhibition and histone H3-induced activation of DNMT3A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase regulator
total genus 46
structure length 187
sequence length 203
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4u7tB00
4YUWA 1D2GA 5GINE 4P7KA 1P1BA 3K0BA 3MCTA 1RJDA 1P39A 2FK8A 2FYTA 4EKGA 4GOOD 1BKYA 2VDUE 5DTRA 3KR0A 2PXCA 1RJEA 3FPEA 3CVOA 2OO3A 3DH0A 4KVZA 1QZZA 3I64A 1RI5A 3KPJA 5CVUA 2GLUA 1RI2A 2YQZA 4PYLA 2IPXA 3EGIA 4GC5A 2YVLA 2IFTA 3DXXA 3G88A 4FSXA 5CD1A 4ZTBA 1JG2A 4FZVA 2EJTA 3C3PA 2PSSA 4E2XA 4OA8A 4MHTA 3DUWA 1R00A 2VS1A 3HCEA 5CVVA 4F85A 4RTJA 2PX4A 4PYJA 3ORHA 4RVGA 5GM1A 4E30A 4EKIA 1NW3A 1KR5A 1JQDA 3OU7A 2NXEA 4HTFB 3EEYA 2QE6A 4GQBA 3LBFA 3LL7A 3FTFA 4U7TB 5E2AA 3GWZA 5GM2A 2GPYA 1WXXA 2Z6AA 2AOUB 5EKUA 1M0EA 1WS6A 1YZ3A 3LECA 1JR4A 4QTUB 4HRAA 4GEKA 1EAMA 3UJDA 2GA9A 5EEHA 5BP7A 3TM5A 1JG1A 2P41A 4CKCA 2ONZA 2PBFA 2PKWA 2ZWAA 3E8SA 1KP9A 3UJBA 2ZBPA 3TQSA 2CL5A 2IIPA 4M36A 4AZWA 4X1OA 1B42A 2Z6QA 3ELWA 3P9CA 2NXCA 4OQDA 3B89A 2O57A 5K0CA 3BKWA 1NKVA 1TPYA 3PB3A 1G55A 3C6KA 3VC1A 3VYWA 1IM8A 1SKMA 2FCAA 3I5UA 1FP2A 3R24A 3T7SA 1IY9A 2YR0A 3GRYA 1FP1D 1T43A 1EJ6A 4XCXA 1R8YA 2PVCA 4BP3A 2AOXA 3G8AA 5DM0A 3SGLA 5K0JA 1ORHA 4CTJA 2AOTB 3PVCA 4E2ZA 3KQYA 1ORIA 3V8VA 5K01A 5E9JA 10MHA 5EIFA 3HA5A 3E05A 4CKBA 9MHTA 4C05A 3P2IA 3V97A 5EOVA 5GOZA 4DMGA 5LSAA 1X1DA 1YZHA 1VIDA 5H02A 3R6TA 2WA1A 4P7JA 1RI1A 2PX5A 2AZTA 5K0LA 3FYCA 2GS9A 3HA7A 4HC4A 2P40A 4AUKA 2EG5A 4E70A 3I53A 3ANXA 4X63A 4RTRA 3MCZA 1G38A 3C0KA 5K0BA 4KRGA 1JG3A 4P7GA 4C08A 5HIMA 5IKMA 3Q7EA 4E33A 5DTMA 1INLA 2G8NA 4FSDA 1R18A 3CJTA 2UYHA 2C7PA 4KDRA 3FPJA 2ESRA 2AOUA 4P58A 4V0QA 3A26A 5DTQA 1JTEA 5EZSA 4ER3A 4M7RA 4C4AA 4DKJA 3DOUA 2AN4A 4MTLA 3BT7A 1L3IA 3HCFA 3M6XA 4LWPA 1UWVA 2F8LA 4NECA 2I62A 4QDJA 5DM4A 2PWYA 5FA5A 2FPOA 2C7OA 2HWKA 1X1AA 4RVDA 4PWYA 3OU2A 5FA8A 3S68A 1D2CA 1M6YA 1F3LA 3ERCA 3OFKA 3A4TA 3FTCA 4GC9A 2XVAA 3FRHA 2VZ9A 3DLCA 4YV0A 1RI3A 2Q41A 3OZTA 4R6XA 3DMGA 2EFJA 3X0DA 5FADA 1MHTA 2ZIEA 4KDCA 3UJCA 2HR1A 2BM9A 3UWPA 4E2WA 3FRIA 4AX8A 5CVJA 2O0LA 3KPVA 4RV9A 4R8SA 3EGVA 5LQKA 3DXYA 4GUAA 2AN5A 4PYKA 3GRVA 4ER7A 2AOTA 3DR5A 4GOND 2QYOA 2JH8A 2ZULA 4GOLD 2CMGA 1XDUA 3NWBA 5FWAA 4BLWA 4RTSA 2PXAA 5DLYA 2NXJA 1RI4A 4YV1A 3BZBA 1F38A 2JHPA 3JWGA 2O05A 2O06A 3CJQA 3CBGA 4R6WA 2ZFUA 4HH4A 4RX1A 4XUDA 5FHRA 2AVDA 2AS0A 5IH3A 5JR3A 5CCXA 4PIMA 3LDGA 1JG4A 3CJRA 3QOWA 2ZIGA 5DX0A 4L7VA 3G5LA 3GIWA 3I58A 4IV8A 4YV2A 3HCBA 4PYQA 1SQGA 4LWOA 3MERA 2QM3A 1NT2A 3KQSA 1PJZA 2PV0A 3B3JA 3I9FA 2H11A 1X1BA 4DF3A 4BY9E 2JH9A 4K6MA 3FUVA 1XCJA 3KQTA 5HEKA 3GRRA 2DPMA 3A25A 4PGHA 4BLVA 4R8RA 5DSXA 2H00A 5E1OA 1SVUA 3OCJA 4E2YA 4HGZA 2JHAA 1AF7A 2B78A 4QQNA 3EMBA 4PYOA 2GAFA 3ER8A 1KHHA 4X61A 3EGEA 3P9KA 3L8DA 3PS9A 4POOA 2UYCA 3RIEA 3HVHA 5EHGA 5FTWA 4RTQA 5DRTA 5CUQA 3BWBA 3NWEA 4HGYA 5KYGA 3AWIA 1ZKDA 3CGGA 4DA4A 3DP7A 3FPGA 3IV6A 3KPWA 3G8BA 5ICEA 4H0NA 1BOOA 1H1DA 1O54A 3LSTA 5K8VA 1QAMA 4OBWA 5CVDA 5CVEA 2OPBA 5E9QA 5EVJA 3UJ8A 5LQRA 1VBFA 5LQAA 3GRUA 2C7QA 1EQAA 3KHKA 2HNKA 3NVKI 3EVZA 3NDJA 3LCUA 2BH2A 3FYDA 5KQSA 1AQIA 2OBFA 4AZTA 5KS2A 4DM3A 1NBIA 2FRXA 5EEGA 1Z3CA 1U2ZA 3G2OA 3P2KA 4HG2A 3KPYA 3G7UA 4RVHA 3SXJA 3KU1A 2HV9A 2CKDA 3VC2A 2A14A 2PXXA 2XYVA 1BC5A 3THRA 4AZSA 2DULA 5BXYA 1QAQA 2P1DA 5DM2A 2P3OA 2P7IA 4KWCA 5DX1A 5EIWA 5C9ZA 5D1HA 3RODA 3P2EA 3TFWA 3P9NA 4FGZA 3LKDA 3FUWA 2EX4A 2C7RA 2IH5A 2P8JA 1G60A 2V7EA 1N7JA 3ELYA 2JJQA 5ICGA 2NP6A 2XYRA 4ATNA 4PINA 1XDSA 3UJAA 2GB4A 3B7PA 1NBHA 3GO4A 3K6RA 4PONA 1R74A 5FULA 1TW2A 5EPEA 3SSOA 3LBYA 2ZBQA 3BGVA 1G6Q1 5HFJA 3PX3A 2CMHA 5EMLA 3P8ZA 4B17A 4ISCA 5E1DA 3G89A 4FP9A 3MTEA 5EMKA 1XVAA 3SX0A 3TM4A 5EMJA 1BHJA 1NW8A 3B3GA 3JWJA 3OU6A 1X1CA 3E7PA 1NW7A 4QPPA 1X19A 1XJ5A 2PJDA 3FUUA 3G5TA 3OE4A 3T0IA 1L1EA 4MWZA 3U81A 2ZZNA 4IKPA 5T67A 3CCFA 3G2PA 4X41A 2AR0A 3T7TA 3ME5A 2IDJA 2Y1WA 2ZWVA 3RW9A 5LQJA 4FS8A 1KPGA 1RJFA 3DXZA 4EVIA 4XUEA 3HP7A 3KQMA 4Z2YA 3AY0A 3EEOA 5EZQA 2LD4A 5ICFA 1VE3A 3IHTA 1EJ0A 3GXOA 5EKXA 1M6EX 2AOVA 2ZIFA 2IDKA 4A6EA 4Y2HA 4RSRA 4U7PB 3TMAA 2PGXA 4V0RA 3AXTA 3KQQA 5CM2Z 4DZRA 4OBXA 2B9EA 1VPTA 3LCCA 1KIAA 5K09A 4KIFA 4XUCA 2ZLBA 3D2LA 1UFKA 5B1SA 4PYNA 5LQNA 3SM3A 5EGSA 3TKAA 5HILA 3BKXA 2KW5A 3F4KA 1P1CA 5KVAA 2B2CA 1Q0TA 3IYLW 2Z6UA 5T64A 2GH1A 3R3HA 4IV0A 2ZCJA 2FK7A 4PCAA 5DPMA 1PRYA 2NYUA 3AJDA 5FQOA 5CIYA 4RTPA 1NE2A 5E1MA 3QV2A 4PGGA 4OA5A 4RYLA 2PWPA 2JG3A 3M6WA 3TKYA 1VL5A 5EQJB 4QPNA 5U4XA 3UFBA 2OZVA 3M4XA 1VP9A 5E2BA 4YUVA 2P7HA 4EQZA 5LQUA 4GOMD 3EVCA 2CWWA 2B3TA 3HM2A 1RJGA 2XBMA 4P7FA 3SMQA 3C6MA 1SQFA 3P71T 3UBTA 1ZGJA 2OB2A 4YUYA 4QVGA 4QVKA 2E5WA 3EVGA 3MB5A 4YMHA 3TRKA 5LQCA 5DWQA 8MHTA 3CC8A 3KQVA 4FT2A 5FWDA 3NDIA 3CKKA 3HVKA 2B25A 1N2XA 2UYOA 5FHQA 5FQNA 4F84A 3EVDA 3LGAA 2PX8A 4G56A 3DULA 5E1BA 4ER6A 2I6GA 4QTTB 1MJFA 2BM8A 3BWCA 5E9WA 3BXOA 3C3YA 1NW5A 5DM1A 1VLMA 1WY7A 4OQEA 3UA4A 5BW4A 2IGTA 2IP2A 3ELUA 2WK1A 3SSNA 1JQ3A 3HVIA 3DTNA 2OB1A 2XYQA 4RVFA 2YXDA 3EVFA 3HCAA 3IEIA 2QY6A 5F2KA 3TLJA 3NMUF 3A27A 3AXSA 2PLWA 2PT6A 3NJRA 3A7DA 3OE5A 2PT9A 2P3LA 5EMMA 1YFJA 1UIRA 2VP3A 1JSZA 5DXJA 1XTPA 1KXZA 4DCGA 4ER5A 5DT2A 5EHIA 5P8WA 2ORED 4RTMA 5D1NA 3G2QA 2EJUA 1O9GA 5E8RA 3DLIA 1I9GA 4EMSA 3KR9A 3OPNA 4WVLA 2NNWB 3GRZA 3KQWA 1XDZA 2BZGA 2N47A 2YTZA 5KQRA 3FUXA 2AN3A 4E31A 1QAOA 2OY0A 3M33A 4GBED 1AV6A 1Y8CA 4WXHA 2JHCA 1R6AA 2VDWA 3B3FA 3MGGA 4Y30A 1XCLA 4M38A 2OYRA 4O29A 1QYRA 5K0GA 2OKCA 4RTOA 3R9XB 2IH2A 3B5IA 2UYQA 3HVJA 5EC8A 5K0NA 5GIPE 1FJXA 2YXEA 3MQ2A 2I7CA 2NP7A 5C0OE 3LHDA 3NVMB 2OXTA 2BR3A 3G2MA 1ZG3A 1JTFA 3OZRA 3KQOA 5HIIA 5GIOE 3O31A 2UZ4A 1V39A 2P3QA 4UOEA 2YXLA 3BGDA 3SR4A 2AVNA 1YUBA 3TOSA 5C1IA 3Q87B 4C04A 1R8XA 4FR0A 1KPIA 1SUSA 5DRYA 5DX8A 3KKZA 3M6VA 2O07A 3PT9A 4HSGA 3TR6A 2ZZKA 2ZW9A 4CWAA 5CCBA 1YF3A 5DXAA 3HCDA 1ZHFA 1XXLA 2AOWA 3MAGA 3GDHA 4LG1A 2ZZMA 1WZNA 1G8SA 3NTVA 5K0EA 4IWNA 3FTDA 4RWZA 5HIJA 4A6DA 4EK9A 1AQJA 3UJ6A 3LDFA 1FBNA 3M6UA 1I4WA 1L3BA 1NV9A 4MIKA 4F86A 2G1PA 2ZVJA 5DSTA 2FHPA 7MHTA 1P91A 1QANA 4YUZA 3NW9A 5JUWA 3ID6C 4FT4A 2ONYA 2IBTA 4PCLA 1VP3A 2BR5A 3REOA 5K05A 2IBSA 3BUSA 3A7EA 2IH4A 3O4FA 4YMGA 4DQ0A 3UJ7A 1DL5A 3GU3A 5F2OA 2YUIA 4M37A 1YFLA 5ERGB 1L3CA 2QRVB 2R6ZA 3GJYA 3HCCA 5BW5A 5MHTA 3GNLA 3KR2A 1VQ1A 4QQKA 4E32A 3HTXA 3H2BA 1G8AA 4GF5A 3FZGA 3LPMA 5HIKA 3OZSA 5E8JA 3BWMA 1KYZA 3ELDA 4X60A 5GWXA 2BR4A 2H1RA 3QOXA 1D2HA 3THSA 3P97A 1JSXA 4KIGA 4HTFA 5EG5A 1DCTA 3EMDA 1FPQA 3FPFA 4JXJA 4YUXA 2G72A 3BWYA 4RTNA 3PLAE 1EG2A 1L9KA 1O9HA 3ER9A 1HNNA 5ICCA 2R3SA 4AZVA 4CKEA 3UZUA 5T6BA 4CTKA 2HMYB 1ZQ9A 3FTEA 1Q0SA 4QDKA 3SVZA 3PTAA 4PYMA 4PNEA 3EVAA 3HNRA 5HOQA 3GCZA 2ERCA 4C07A 5LR6A 3LCVB 1N7IA 4MQ4A 4R05A 1KPHA 1ZGAA 1HMYA 2Y1XA 3DMHA 3HA3A 4PYIA 3SSMA 3JWHA 1JQEA 4RTLA 4C03A 1WXWA 3T7RA 2PY6A 1SUIA 2G70A 3WSTA 3EVEA 5K03A 4DCMA 1EIZA 2HTEA 3PFGA 2ZSUA 4RTKA 2WA2A 2I9KA 2K4MA 2XVMA 3OFJA 5HZMA 3UJ9A 2V74B 1OR8A 3PFHA 3EPPA 4LECA 4BLUA 1SG9A 2ZBRA 3JWIA 3KR1A 2VDVE 3GGDA 3P9IA 4PIPA 1NW6A 4KW7A 1DUSA 2NXNA 3KPUA 3LDUA 3BGIA 1YB2A 5G02A 1NV8A 2ADMA 3LKZA 2YX1A 3PX2A 5FUBA 3DMFA 3VSEA 4BP1A 3MTIA 4C06A 5F2NA 3E23A 3UA3A 5M5BA 3KQPA 3FPHA 5GP1A 2ZTHA 4CXMA 3FUTA 2PX2A 1I1NA 3EVBA 3TPZA 2QRVA 4OX9Y 2G71A 1KYWA 2P35A 3LX6A 5FCDA 3M70A 5K0FA 3R0QA 3MHTA 1WG8A 4ER0A 1TW3A 3HEMA 1IXKA 3O7WA
chains in the Genus database with same CATH superfamily
1NJSA 1V1RA 4LVCA 4BN0A 3ABZA 1XTRA 4G5QA 4GOOD 1VXOA 4LYJA 1CNMA 1YCHA 3L93A 3QOFA 1DCFA 1G63A 4BVHA 2HO4A 1X8LA 3WYFA 5J2UA 3D7LA 1G5QA 3IQDB 5A4DA 1UPCA 5ESRA 3C5HA 3EWNA 1Y4DE 2EZUA 3IPRA 3QWIA 2ROQA 3TAHA 5A0FA 4UTZA 4FSXA 3A32A 4AKSA 3WIUA 4E09A 4I46A 4EGCB 1XD9A 3L4BA 1E2DA 1LFAA 3F71A 4G0MA 4P0TA 1HYGA 1AUQA 4TZ6A 1TZMA 5E7JA 2XGGA 3FCSB 2IC5A 4FZVA 4E2XA 3EQZA 1TECE 1VSQA 1V95A 3DZIA 3I5AA 4DT1A 5BSEA 1H0HA 1RXSA 1FUUA 1X1QA 4NJEB 4DSOA 1CETA 1N0VC 1L4KA 1GADO 1DI0A 1HDIA 1HT3A 1YT5A 2EKPA 3TIXB 1O03A 1Y3BE 3NR2A 3PCTA 1KAEA 1NW3A 2FN4A 3H9EO 4LSMA 721PA 4U7WA 1KR2A 3AT1A 3F6SA 5EJMA 4BE9A 4EFNA 2E4ZA 1GSIA 4NH4A 2O8VA 2PUCA 3P19A 4LGCA 2QXYA 2EBHX 5ALRA 1Z22A 3KE8A 4WDRA 1NXTA 4P4UA 2PRSA 2Y9MB 4MQ6A 4ND4A 4US0R 3E9DA 1T91A 1KSHA 3P0EA 4GPBA 3IFSA 1QWSA 4YJFB 3WHLA 4CV1A 1KWKA 2PBFA 4K05A 3A6EA 5AYVA 3ZBPA 2ZRJA 2NUAA 2Z8YM 3GLHE 1MEEA 4C22A 1FRVA 2QAGA 4NHOA 4BB9A 1EWQA 2DMRA 3LHFA 4K28A 4LY6A 3E81A 5JQGA 3U19A 2ZE5A 4PSAA 2D2IA 1TPYA 1TMYA 1AQYA 2HF7A 3L7CA 1BRMA 1G55A 2L18A 4QQRA 3W06A 1KJ8A 1YHZA 1E7RA 2V5VA 3V4FA 4L27A 1FP2A 2PHZA 5D85A 4B44A 4BKQA 1IULA 1FP1D 4E21A 2PU5A 2R6HA 4G1CA 1R8YA 4PPYA 2VI5A 3FDIA 4WH0A 5ILGA 1BIFA 3K7EA 4M1QA 4R9NA 1Q91A 2FG7C 2WE7A 4E2ZA 2C3OA 3Q6NA 3AH8A 5K01A 2AZXA 1PJTA 5SYAA 1I0IA 1Z6YA 3BOSA 5IXYA 1M34A 2IEGA 1GILA 2B30A 3ZHUA 4CMBA 2HXGA 4ZIRA 3CWZA 3K6SB 1GR0A 5LUAA 3MPOA 4EF5A 1YR1A 3HP1A 3T54A 2D3WA 3PFNA 5JXWA 3AVPA 4BMSA 2IELA 3PD0A 1M1YB 3GGSA 3D4OA 4JYBA 4ARBA 4G25A 1QR6A 4XSHA 2JEOA 3H13A 1Z26A 1SPXA 1A7KA 1B00A 1ZY2A 4TWZA 3VUFA 3LLCA 1T8UA 2H1OA 4JASB 1YJ5A 4J0GA 2JD1A 4B3FX 2V9PA 1OAKA 4IQGA 5EPOA 4A03A 1XCGB 1CIPA 2R68A 1DEKA 3UT5A 2FUEA 1VM6A 1KP2A 4BNFA 2OC4A 1FFWA 1MDFA 4HQRA 3UPUA 2C8JA 4CM6A 2BL4A 2C7PA 1KI6A 3VPBA 4ZJZA 3MWKA 4FYHA 5E6UA 3UFXB 3AIKA 1GPAA 4GWGA 4IUYA 2FZKA 3IKVA 3AGPA 1PWZA 2GKSA 4Y0VA 4RK7A 3GJ6A 3EULA 3IALA 1JFLA 3OETA 5LDGA 3REQB 3RV4A 5LQMA 3C3KA 4BMNA 2I4RA 1QHGA 3I28A 5J4LA 5FOXA 2QMEA 2Z57A 3OF2A 4IRXA 1OIVA 1OX4B 1N7HA 1RI3A 1D4ZA 3ILVA 4KQ6A 1G5TA 1UPAA 1FSZA 2C58A 4R8VA 1JAYA 1OI3A 4C1NA 4CFSA 2MR5A 3RYCB 4BIIA 4LEIA 4QO8A 3ZC3A 1L4EA 1PWHA 4LGVA 3EGVA 5FWXA 1HI9A 3HABA 4GUAA 3V4PB 3RCBA 1N3BA 4IQ4A 3PE3A 4Y6LA 2JH8A 3JASB 3I2YX 1U3UA 3WL5A 2Z5FA 2EP7A 2QQGA 1KOGA 2WJWA 3ELBA 1UDAA 4YIHA 4INPA 2I99A 4FM9A 1RI4A 1JHXA 3O8LA 2J45A 4QTXA 5IC5A 2FFRA 3WLLA 4LGYA 2Z2XA 5A5GA 3L4JA 2J3LA 1CG6A 1D09A 1I3OA 2NO4A 3LV8A 3GEIA 1O0SA 4TMTA 4MJXA 5EUBA 2RD2A 2AS0A 4FK8A 2I9PA 2QL6A 3GMTA 2VSQA 4IV5A 3B9QA 4TROA 2QRPA 3M2TA 3WLFA 5AW3A 1XZAA 4WAUA 3R6LA 1CUHA 1LJLA 2XRFA 3R8CA 3X1YA 3UUFA 1TZJA 5JFOA 1N57A 1OKKA 2RHOA 3IIKA 3N87A 4WFJA 3WP0A 4HAIA 1T4GA 3MLEA 1AMUA 1BS1A 1ZEJA 3CZMA 4HEA1 3OCJA 2C2YA 4X6LA 4MZXA 4DARA 3D81A 4NATA 2BGLA 2J46A 2RJNA 1U9YA 1DKMA 2PH1A 3QELA 3HSSA 3AONB 4KO3S 4LISA 4LWQA 4UEOA 5K3EA 2CNWD 2QP3A 3AK4A 3LRTA 4V39A 5FNVF 5ULLA 2IUEA 3KSMA 1JHRA 4M8IA 4XGKA 3FOEC 1IEWA 3BA1A 3ILHA 3HU2A 5BN4A 2J4FA 3H11A 2IYVA 2Q3FA 4C4RA 3FR8A 1BEUB 3DP7A 3Q3IA 1Z5WA 3G8BA 3X44A 4CMEC 1RM0A 1PX0A 1GUBA 2YIMA 2CMKA 5A62A 4BO2A 5IFKA 1IJKA 1UH5A 4BMDA 2Q9UA 4ARIA 1UMBA 2B6NA 2HNKA 3HKEB 4TQUS 3SIPA 3WLKX 3I3OA 1D5CA 4R1OA 1OE0A 3PPVA 3R09A 2GF9A 4QUIA 1RYDA 2H9IA 5AKJA 5EEGA 2JCSA 2VYCA 1U2ZA 5KJFA 3F0TA 3EA0A 4NYMQ 1C1YA 3PSAA 3SXJA 3K31A 3LSYA 1E9BA 4OLAA 1Z4QA 5BUCA 5JI3E 4A0RA 1NR1A 4J8PA 4WZAE 1TD1A 2P1DA 4BQQA 5BXYA 4G09A 4MWBA 1YIOA 2R8EA 2CN1A 2ZYWX 3LDHA 3TTTA 2WWGA 1NATA 1WR8A 3H86A 4MO2A 5JSUA 3KELA 2P5YA 3ND9A 1PD1A 4JT2A 1NBME 1G60A 1HFWA 3OZCA 4HPXB 4TLAA 1OBHA 5CYPA 1GNTA 1RR6A 3VR5H 1XD2A 1NVTA 2WLSA 1A7UA 4U5QA 4EMUA 7REQB 4AKGA 2CXHA 2JVKA 3H83A 4J2TA 2Y0EA 1A5BB 1K6JA 4FFDA 1NUPA 4YK7A 3VO9A 3NHSA 4B3MB 2GN0A 3NCTA 3TM4A 4FMDB 3RHFA 1RZ3A 1RXYA 3B3GA 1W8DA 2M6RA 3KLBA 3M5PA 3CKMA 1LSSA 4A82A 5HDBB 2XKAA 4GEGA 4GNKA 3ROEA 5JAIA 1B16A 1BFKA 1UIMA 1PV2A 5J1SB 3ZVMA 1GRNA 1RJFA 1XN1A 2PSDA 4PCVA 5ICFA 1YR3A 2CGEA 2YJGA 2JC3A 3A6GA 4UEKA 4AJEA 4M55A 3EW9A 1UQTA 4L5IA 3TQTA 3OEYA 1IDOA 1T6NA 1S0UA 3VOSA 2GVNA 1KVRA 3IKLA 1V47A 5HJ2A 4LYGA 3TR0A 1EP3B 1FP7A 1YDMA 2RI6A 1OSNA 2HWUA 1E3QA 3IVRA 5IZCA 3A6DA 1LPAB 2QTLA 3IC5A 3QF4A 4HDCA 1E3IA 4EG6A 1R0YA 4DA6A 5D87A 1LC0A 4JWTA 4DNFA 5K1ZA 3IDFA 4AKHA 1ZD5A 3AYXB 4HDOB 4ML3A 2BTEA 1RWVA 1WD7A 2GM3A 3G7SA 4F3TA 1QVAA 1KHTA 2Q99A 5CIYA 2QOEA 5DASA 5H0IA 3RG2A 4DMCA 4QNNA 3KZCA 4WACA 4JLNA 4PHFA 5KAMA 4AJIA 4POAA 1WDTA 2DM6A 1DEXA 2VF7A 4BNIA 2GO7A 3UCEA 2OZVA 2DUUA 4FMCF 4M98A 4LAFA 2XMDA 2JJ1A 5I7FA 5JNWA 5LQUA 5CA1F 4JP2A 5JEEA 2J5BA 4I1VA 3U3ZA 3U3JA 2VATA 3D8HA 4ICIA 3AY6A 3OKPA 4ZO8A 3NC4A 3AI1A 3ILSA 5IH7A 1NJ5A 2ISCA 1GQQA 1MH9A 1NNLA 2D5BA 2Q1YA 3EVNA 4WCFC 3RH0A 4DSAA 1J56A 3QQPA 3WX0A 3H7AA 5ISMA 1RXVA 2QVLA 1DBWA 3DFUA 4TLDA 4YI5A 4YYEA 1N8KA 2KMLA 3AUUA 3VR4D 1B8OA 3GDFA 1SC6A 5CM8B 4EM6A 2ZRQA 3EQ9A 1VSUA 5FHQA 3GUYA 4R2XA 1KVTA 1JX6A 3SJ7A 3WLSA 1ZESA 2IYQA 1EDZA 4IH4A 4LDQA 1CZNA 3I32A 4IFBA 3ROMA 3WGMA 3IDSA 1DB3A 4BO1A 4Q6WA 4IAOA 2VPXA 3A04A 1K66A 1WUJS 1P1KA 4LCEA 3L6CA 4RCYA 1XRRA 4ESVA 4Z9XA 3R8XA 1AGXA 2FSVA 2V7GA 2DHEA 4LIPD 3TLJA 3JYQA 3Q12A 4DJJA 4KGZA 5CFNA 1Y3HA 1XE3A 4K6HA 4X1KB 1F60A 4IIUA 5DXJA 4L4ZA 2VHQA 3NXKA 1GCAA 4OIMA 2GM9A 4Y3UA 5P8WA 3T5CA 1QHHA 3G2QA 3HNPA 4UDYX 2PKXA 2WB2A 1QH8B 3SYMA 1LRKA 4Y6QA 3PPWA 4GPD1 4QNRA 3NEJA 3OA2A 2ZXUA 4K1LA 3E53A 2H16A 3EBLA 4E31A 3NV9A 1YQDA 1Y8CA 2NV6A 2XECA 2X9VA 4J0FA 3KVVA 4Q5IA 4PG4A 1F9EA 5CGQB 4F2PA 1H4TA 1Z2PX 3CF2A 2BSQA 4KK4A 1W0KA 4FYYA 4RTOA 2GM4A 2DP4E 5B6JA 5MN4A 2INGX 3DNMA 4JI5B 4C5CA 3V2IA 2NACA 4R1PA 1ZH8A 1J24A 4DLKA 4NMHA 4RMGA 3KALA 2Q7OE 1B0UA 4XGRA 4KODA 5CM9C 4JUCA 1T1GA 3SZMA 3ZU6A 2JGIA 2ZPUA 4O3FA 5FUVA 4MS3B 5HIIA 1KH3A 4PG6A 1E3WA 3UV6A 4CMHA 1XP8A 5DJ5A 2VRNA 4GUDA 4OBEA 4B8WA 4CKEB 3AF2A 1YA8A 1F2TA 1HSOA 1PV1A 1VHTA 2QG6A 5IAKA 1YUBA 1B1CA 3FFTA 1U2DA 3EXEB 1I7SB 4MUKA 2ODBA 4O4LF 1BG6A 3VVLA 1B6TA 3K9NA 4DTCA 3C2QA 4F71A 5JANA 4KUEA 1J00A 2UVPB 2YIJA 4UEWA 4C7MA 2IE0A 2WV9A 2DY1A 1TQHA 2BFOA 2ZM5A 3LQ2A 4M1MA 1QV9A 2CB9A 1G8SA 4DDHA 4YLEA 4MWDA 4P7BA 1W48A 4LDPA 2R60A 1O0CA 1QO0A 3K71B 2PGLA 3TH5A 2G1PA 2GCOB 3O8NA 2IX3A 4FNGA 3H17A 1P4AA 2B1QA 2H4HA 3BMOA 3LRXA 2L2QA 3DONA 4U7GA 1M72A 3AVQA 3TTUA 3C14C 1I51A 2RHGB 4ZTZB 4HNGA 4S1PA 3Q15C 2V5UA 3SEFA 1E5TA 2BR5A 4HRVA 1WNTA 4OHWA 3GF4A 4YJ2F 5J4KA 1L5HA 3DM5A 3B1VA 3NH6A 5D00A 2DQYA 2BONA 3O8QB 1C1XA 1DPFA 3SDBA 1LK7A 4ZKDA 3IMCA 3EXIA 1K75A 3P0RA 5EIEA 1P0FA 4QQKA 2A0KA 4JI7B 1AKUA 3DT8A 4GWKA 1SVWA 3G7NA 2AG6A 2V7QD 3KOYA 5ERYA 4WY5A 4WTOA 3DE1X 2AJBA 3WOVA 3HSYA 5BSTA 1XBTA 4KR7A 3FYTA 3Q6IA 3FROA 2MR6A 1WHTB 2E82A 2Z4RA 4IMRA 2MSKA 1FDIA 1TU3A 4ZO4A 4Z9BA 2G72A 4B48A 1IUNA 1FS4A 4F3RA 2HU8A 4REOA 1Y1PA 1VG1A 2OCXA 1GD1O 3ER9A 1Y33E 4PXYA 4QUJA 1FTYA 1NF2A 4CTKA 4BPRA 3SNHA 1U1GA 3HI4A 4TLLB 3EVAA 1M34E 4JNCA 4AJOA 1JEOA 2DYKA 1N7IA 1W0CA 8ADHA 3NAQA 3JWHA 4KI7A 5DFAA 1SQ5A 5FX2A 5DV9A 3OPYI 3UAGA 5F76A 1XZDA 1SVIA 4FE4A 3WSTA 5IMSA 1OB5A 3RRNA 1JVNA 3DVAB 2X1HA 3Q7SA 4R2JA 2NIPA 1OFTA 1OH8A 5ALWA 4HRYA 4IVQA 3UJ9A 1TGVA 2PJUA 3PXXA 3V9PA 4ZREA 3ZHCA 4LZPA 2I4NA 2D0IA 2PD4A 3D3KA 3KJFA 4MVJE 1PL0A 4A91A 1H8EA 4MUFA 4G2NA 1DAEA 3UG7A 4EUNA 1U0SY 2ADMA 3GVCA 1MVNA 2WTEA 4YVFA 4JXKA 5TMDA 1P2SA 1WTAA 2NADA 1NI5A 2QD5A 2GF0A 2QN3A 2HJVA 1WCV1 2MSNA 3FUTA 1KI2A 1I1NA 3EVBA 3ISVA 4R8MA 5I4CA 2P35A 4DOMA 4CCAA 4L22A 3V00A 1W7AA 3CMCO 4PO1A 5FTKA 5BO5A 1TEHA 1JEQA 1XT6A 1UZLA 3LLUA 2NYAA 1VIMA 1FNBA 4ZEVA 4QVIA 5DEIA 5IJ9A 4M87A 2C77A 4AJ4A 4D9BA 5BYBA 2VJAA 2V7VA 1DX6A 4J3NA 2PXCA 3FPEA 1BDJA 1DMSA 4HNSA 1HTWA 1MABA 3CUWA 4UNQA 1GQSA 2FW1A 2JASA 1EUYA 4YJHB 1KO7A 1HDGO 3RV3A 2YVLA 1JIIA 2QQ0A 2WJ4A 4AWAA 4BRZA 4X65B 4Z0HO 3HGTA 4IJKA 5HMLA 3ZTYA 1DO8A 3Q7IA 3ZHSA 1TXGA 4F4CA 4CE6A 3NHBA 2I7VA 1YZUA 5LVAA 2AB0A 1E9CA 3SICE 1PFVA 2QLMA 4HDRA 4IIGA 5CVVA 1L7RA 1MF7A 4MYHA 1EE9A 4BEBA 2CLHB 3CUYA 3AMVA 4BZXA 5GV8A 3S2YA 4H18A 4L95C 3P52A 4HAUA 4E5KA 1SXJD 4B09A 2HHLA 5LOVF 3AR4A 1TOAA 3FTFA 4YAJA 3EUEA 3L0OA 2AOUB 4ZEXA 2PS9A 3P9QA 3HCNA 2H92A 4N8SA 4F3NA 2TMDA 1LS6A 1F6DA 2HUPA 2Q07A 4PO3X 4BMPB 5A03A 1F8FA 1WEHA 3ZHQA 1JG1A 2QL5A 1V43A 3GFQA 1EVKA 2JIDA 2QLFA 1QVZA 4OSPA 4B6OA 5C53B 3K0AA 4D8TA 3BQNB 1JSCA 3WDMA 3WTBA 1K2VN 4ZVPA 4ZOLF 4EJFA 4G0ZA 2M1XA 4K46A 3Q8MA 3DHVA 1P1RA 1YS2X 4GSLA 2AG5A 2NZXA 2ZAMA 4G5RA 4GH5A 4JA0A 4WNYA 3SHVA 2XDAA 1VJDA 5ALPA 3AO0B 1SBCA 1O8CA 4G3XA 5JCJD 4K9MA 4MCJA 4EQ6B 3OX1A 2JZNA 4JDPA 1EDBA 4QKQA 3SGLA 4C7JA 3AHCA 4LQ4A 3KJGA 2JANA 4P82A 4YH1A 3PC6A 2D8MA 3S2UA 3TBFA 3WGZA 4ZJPA 4B87A 4UNSA 3E05A 5AW4A 3AVWA 2IV2X 3WNQA 1WXEA 2A5LA 2UYGA 2GUWA 3AM4A 2QX6A 4P54A 4UM5A 5CT4A 1IN1A 3LFTA 3QKRB 4JLUA 2DB3A 4UHBA 4DNOA 1XKTA 1WSBA 1ZN9A 4P81A 1U04A 2YWJA 3CNLA 4YDRA 3ISJA 4B31A 1MVLA 4BEJA 4ETWA 1ZAKA 5KB3A 3HUTA 1S3SA 2BN4A 2J67A 1REQB 1BMTA 1EBBA 3FKQA 3S2SA 4BB0A 4BVGA 2CMDA 1URPA 1JLLB 2FE4A 5KWEA 2ORIA 2IYLD 3BFPA 4UCFA 3BSYA 3ZDQA 2CUNA 4A7PA 1N2ZA 3CJTA 4L72A 1KU0A 1S8AA 4PHTA 1A8QA 2QX8A 1W85B 3RANA 3S1AB 3AZQA 3BT7A 4K8OA 4TL6A 3AF4A 3DZCA 4DL9A 1GM5A 4X00A 2PL3A 1KMQA 2V96A 1Y89A 3MBKA 1X1AA 1XCBA 2C4KA 2GAOA 3O4GA 3MS2A 3IBSA 2NVUA 4HDMA 4TQGA 3E4CA 2DTDA 2ZWPA 3BH7A 4MPDA 2H1SA 4YJ3F 3ZCSA 3OZTA 4N65A 5CPBA 2GRAA 5EERA 4AN4A 4W5RA 1I2MA 1Z47A 1DT3A 2BM9A 4V0MA 5KX5A 4M9RA 3UUEA 1XTZA 1ECPA 4RV9A 3TIGA 1YCFA 4E3ZA 2H18A 1R0KA 2G5TA 4M6WB 3ZWKA 3TMYA 1KIFA 2IUYA 4BL5A 1SKUA 4U00A 4EMBA 2GEKA 5KVQA 2GHTA 1IZ8A 2CNDA 4P3PA 2J3JA 1A9OA 2E6KA 5COBA 4NZ9A 1ESCA 2JAXA 4GRDA 5LKRA 3DTVB 3EE6A 4NU6A 1J0CA 4E5SA 2WUGA 1IEQA 2PSFA 4QSMA 3QJGA 2YJ3A 1H9CA 4PAMA 3JAWA 4E88A 5IZ4A 4AQ7A 1V9CA 4ND3A 1OHHA 3U7IA 3JCZA 3P4XA 2DJ5A 1A9XA 3DHWC 1D4OA 1DJNA 3ND6A 3QPAA 4KAFA 2FWIA 1W25A 2NU8A 1X3LA 2V6FA 5G3YA 1KYTA 3WVNA 1HY3A 2Q3LA 3ULKA 4B47A 5CK4A 4WGFA 3VC3A 2OGSA 2A5DA 3IMFA 4PFSA 5KYUA 3OKAA 5EJ7A 2JPDA 4HS4A 5LFAA 4TVOA 1O0BA 3I9FA 1G3RA 2M98A 3LQ4A 5AM3A 1Y8RB 4HZUB 1GARA 4L9AA 2J5KA 5FF9A 3WZLA 5H9WA 3GRRA 4DIUA 1CBUA 5L3SB 1S2NA 3L84A 3BQMB 5AM0A 2HADA 1FLVA 3HR8A 2PVPA 4AN0A 4D5EA 1ZD3A 4FZ5A 2L0XA 1GYRA 2O4CA 1CIVA 1ZFNA 3P9KA 4KK3A 3MAJA 1QIDA 2VHYA 4UBJA 2AJDA 3F3SA 1NMZA 2G1AA 3Q3HA 2ZJ1A 1Q15A 4FFWA 1U7WA 4OU4A 5E7MA 4BO4A 1RAIA 5JTTA 2AMLA 2PMFA 3H6GA 4PS0A 1GZ5A 3NWEA 2OA0A 3DLHA 5KYGA 2JJ8A 3CH4B 1ZKDA 3IAEA 1R4NB 4H6PA 4WJLA 5K8IA 1W5BA 2BMDA 1VFPA 3BN3A 1JZTA 3G6WA 5K8VA 3IUBA 3ORSA 3GH3A 2OPBA 3KYDB 1W19A 4OHRA 4WOKA 3CPJB 4M8SA 5KKAA 4P5DA 1XEAA 1GXSA 2J87A 3CSUA 4LW8A 1JHZA 2VSNA 5KQSA 4MKHA 1O94A 3BTVA 4IXTA 4J0QA 5BNWA 2GXQA 3WQBA 3ORYA 5EQTA 4BNYA 5LYYA 2IZ7A 3SIRA 2DWCA 5EHNA 3EPKA 4LGMA 5CW2A 2O7NA 2AEMA 2IHYA 4FR2A 3FHTA 4TXJA 3ZV3A 1SCNE 2DULA 3C4VA 1QAQA 3IOCA 3L07A 3OF3A 2P3OA 3QX7A 1MGOA 2C7BA 4AY5A 1L1RA 3JZIA 3G0BA 5ES3A 4JJGA 3CVVA 3P2EA 1T4CA 2GK7A 4JI1B 1DKLA 1I1HA 4X7RA 1X0XA 1XDSA 3JQ9C 3B7PA 4OL0A 3GO4A 3K6RA 4TX1A 3GPCA 4KQ1A 4HH3C 4RKRA 3B7GA 4R9SA 1FJ2A 1Y8QB 2AMYA 3A1DA 3GL9A 4IHAA 1CUGA 3QPWA 4RKEA 2Y0BA 1EX6A 1KQNA 4YAKA 3LZ6A 4J4BA 3RJMA 5I7SA 3UNXA 1RJ9A 1TUGA 1CS0A 4Z99A 1KY5A 4TS1A 4BC0A 5H4GA 3GNTA 3JWJA 3E6AA 4WCFB 4P9NA 2B20A 4F2HA 1ORVA 4IWXA 4OAQA 3M1IA 4HGNA 2OSBA 1Y63A 3ZV4A 3AILA 3G2PA 3ZE9A 1QRRA 3T7TA 2ZB3A 3CH5A 3KUCA 1EFPB 5M04A 4L0CA 3O9VA 1IYZA 1C9KA 2HMUA 3WRWA 3DXZA 1DXHA 3FPKA 3QKWA 3RIGA 1D2RA 1VKJA 4Z2YA 3AFMA 4ZI7A 5L6MB 2R1TA 2FN3A 1E62A 1EE1A 3U49A 3A14A 5LNK6 4K5QA 4E5DA 4NQRA 1H2HA 3TQQA 3KK0A 2VBCA 5F3RA 1JVBA 2ZI4A 4PG5A 1T8YA 1F0PA 4RSRA 2RARA 1E2QA 2A5FA 1ONNA 3KQQA 2R8YA 1GU0A 1JFRA 1XTBA 4RQUA 4GL4A 3E9MA 3RS8A 4CN8A 4LNUB 1U3VA 2ON6A 3D2LA 2HCFA 1IZ9A 2WSSA 2X3FA 2X5OA 3E7DA 4MQBA 3OLCX 2J4DA 4KXWA 5CPFA 2Y0PA 4EPXA 1KEEA 2E1PA 2E87A 4WJKB 2R5FA 3LXMA 3HEAA 5BSUA 4YRKA 2ZCJA 4BO8A 4Z53A 4Y9SA 1AE1A 1JLSA 1TO2E 1NF8A 2W2KB 1FW6A 1SUPA 1W75A 2QIOA 4MW7A 3L7BA 2J3IA 1T5HX 5FQOA 3Q3GE 3QV2A 4TVBA 2VYNA 4I3HA 3SE7A 3IPYA 1RAGA 1CDDA 4JU9A 4TV9B 3C1AA 4ERNA 5AUPB 5JBNA 4D02A 5EWLB 2UYYA 2WUFA 1FTGA 2BIFA 2YN2A 1Q2UA 1A8IA 4G5FA 2NZVG 3BA6A 3AP1A 1A2QA 1U65A 4BVBA 1EINA 1AS0A 3RC1A 4KHPB 4BC1A 4W7IA 3ZI4A 5FEMA 5JW6A 4Q1CA 4BQIA 1CUVA 4F11A 1W6UA 1VE6A 1QH9A 1XLWA 3MB5A 2CEAA 4O0MA 1CLUA 2YHAA 2G63A 2I7DA 3CC8A 3DL4A 1KOLA 2PTGA 4FT2A 1T0PA 4Q1BA 3MINB 1BDIA 2IEDA 2DUJA 3RRZA 3U5ZB 4TQ9A 1DTWB 1GRVA 2OHHA 2YHIB 3N0VA 2GJAA 1FVFA 3B12A 4G1UC 1DUIA 3UAXA 1YDWA 4ER6A 3IUNA 3W2FA 4P6VF 5I6DA 3BWCA 4IVPA 2HA5A 4M46A 1PN3A 2HM7A 4KBGA 4UE3S 4Z0NA 4MUYA 4AUNA 1P1JA 3IQZA 4QJ4A 4OQEA 4H4CA 1E9RA 3BCHA 1TYBE 2H17A 2WM2A 1XOIA 3N7TA 2B4KA 1LPSA 2X9QA 4KH1A 3V80A 5J23A 2UXCB 4CIBA 1NYTA 4HGPA 3OX4A 2Q8QA 5EXEA 2JAHA 2E7ZA 3D7NA 1E98A 4FFVA 4IQ8A 4RD4A 3TYXA 1V7QA 1VJ0A 1MOQA 3KVOA 4ZO9A 5FTMA 3WBJA 2VF8A 1YDFA 2EYQA 2RGDA 2Z83A 1FYXA 2C2MA 2EU8A 3JQGA 4XH9B 2J30A 4ZQHA 4ER5A 1H23A 1I1OA 3E18A 5D7NA 3TL6A 2BLNA 4RUKA 1E1MA 1L8OA 3PHGA 4JVNA 2GQ0A 3PYMA 1NRWA 1EFRA 1B74A 3FDXA 5C7IO 2C2WA 3KKEA 2Z3WA 4UBOA 2AE2A 2N47A 2YJ5A 2VTBB 2IEIA 4J2OA 3RSLA 2P9TA 2OY0A 2HI0A 4UUPA 1EK2A 2VH2A 4RPLA 2CXUA 4QPDA 2XUDA 2P1ZA 1JE1A 1RQGA 1V5GA 4P8RA 5AVJA 5IT9A 5DM70 3D1VA 2BEVA 2X86A 1XJCA 4RCZA 4WEQA 2FPPB 4YBRA 1IVNA 1J09A 4JU8A 4HFRA 3ROZA 4Z7QB 4RVNA 2I2DA 3JWEA 3OOJA 1QPGA 4N7MA 4MH0R 4ZZ1A 1V5EA 2GBLA 5I8PA 1GOTA 3A4MA 5FBVB 2R1VB 2I7CA 4UMEA 4FW8A 5CB0A 2G82A 3ZKAA 3EH1A 1LI5A 1NUSA 4Q4DA 2YDYA 3IKJA 3OZRA 3PSHA 2LBPA 4PRKA 4Q9JA 4CZ2A 1UBLS 4F5WA 3L0CA 3C24A 3RT9A 3RKUA 1PFQA 3KJHA 1W5AA 1P8AA 3QUTA 3F9RA 4XASA 5CH3A 4BFYA 3N2NA 3H4TA 1IZ7A 4A36A 1XC7A 4O4IA 1UWCA 3U3KA 5EJ9A 4MRNA 4ZZ2A 1GGEA 1E1CB 1V4VA 3H6KA 1X8XA 1YB5A 3V7NA 2Q2QA 4Q4LA 4EEXA 3MJSA 2ZZMA 1ZJZA 4D9IA 1OH6A 2X6RA 4ZARA 4RY9A 2O4UX 1WL8A 4PZCA 1T24A 4M7OA 4NYIR 2Q1TA 4FOSA 4C6SA 5JRZA 4JUDX 4TTTS 1N2EA 1RWPA 1M7GA 1YJQA 2WG0A 4LXHA 2B8WA 2MYPA 3LFUA 3AC0A 2QZJA 1HLPA 3SHOA 2P6UA 4IXWA 3ILYA 3K4PA 1DSSG 1KO5A 2GHRA 1P5JA 2NSHA 4IDOA 2I8LA 4Z4CA 5C34B 4UKDA 2H59A 1T2CA 2DPXA 3EQ2A 4XUGB 1Y7HA 3IJPA 3LTNC 2YUIA 1XKQA 2QRVB 2NWQA 2R6ZA 5K3FA 4KR9A 1JSLA 2DH6A 2EVWX 3GNLA 3KR2A 1XA3A 2REOA 5FD8A 4B4VA 2FMUA 3MJVA 4ENPA 1T2DA 3EZNA 4PN3A 3BF7A 1YQUA 3BE8A 5IYZB 2YHUA 3R2JA 3QVGA 2HDNB 1RRMA 3P97A 1XRMA 2GVZC 1J2JA 2LCIA 3BORA 1KA9H 1OLSB 2PRYA 2PMDA 4TT8A 2C2HA 5BSFA 2HT6A 3D8UA 1K89A 3OTWA 1HA3A 5A9SA 2F1OA 1XMXA 3T1OA 5ICCA 4MGKR 3DFIA 4CQLB 2NQ2C 4U2KA 1V35A 2C97A 4JB3A 1Q0SA 5KSWB 5JCOA 3PTAA 1CKEA 4PYMA 1W36D 2BGNA 2DFLA 4LK2A 4TTSA 2I3BA 4LHVA 2QL9A 1T0BA 3G49A 4DLYA 4Y2XA 2OD7A 1KZGB 3OZIA 5FFMA 4LJ6A 1G98A 5DNYB 4KWTA 3WDKA 3SQLA 4MI3A 3CW2A 2QAIA 3IOMA 2PGIA 2YJ4A 2QL7A 4ZZ3A 1LPNA 4XB1A 4G8CA 1XMSA 3A9TA 2IS4A 3KM0A 3HP4A 1I2AA 2W5UA 1G4HA 3OFJA 2R0QC 4JWKA 3Q0IA 2HF9A 4P33A 4BLUA 2YFKA 5EZ5A 5B4VA 1MTZA 4C6TB 1IM2A 4QOSA 3CEMA 3QBTA 2BKLA 3D0KA 4MPPA 2HJSA 3I4LA 1RYMA 3LHSA 5FFFA 3RVOA 2NXNA 3OJFA 1ZH6A 2BZ0A 3KPUA 4ROSA 1G4UR 2EZ8A 3BIWA 4ZHQB 3QEOA 1C50A 2JKVA 4HTAA 2BTQA 2W7TA 4UTXA 4F12A 5F21A 5FV4A 2XB9A 5M5BA 3KQPA 4AZ3B 3EGWA 2B1RA 1EXWA 4I4NA 2JAWA 3OZXA 3N07A 4ZOBA 4U2GA 1NZDA 3OT1B 1GGMA 1Q0LA 2VCEA 3UOWA 3S44A 3ZJ5A 4ER0A 4QZVA 3HUFA 2XUHA 1MEOA 2CDBA 1P39A 3TOCA 1DUVG 1PJBA 4L0DA 5IK2A 1PG2A 4RZ3A 3ESYA 3JYNA 1VXRA 1J0XO 5J5VA 4DRXA 4EKGA 3PENA 3TE6A 1KTVA 1K8YB 2I1QA 4FDLA 3WK9A 5JZSA 1EZ4A 4V0ME 1UBTS 5B7GA 5BOSA 3G9ZA 4CM3A 2WD7A 3B1WA 3KS9A 4CG0A 3PNMA 2EGGA 1J9GA 2W6ID 3I4FA 4K9LA 2VP6A 5ALUA 2OFFA 1ZM2A 3FGOA 3NYQA 4HAOA 3VPHA 5FUMA 4CM5A 1XTUA 1K3TA 1G8PA 3HI6A 1JBKA 2NVBA 4EAQA 2IU4A 4F85A 1AGNA 1SUAA 2X0NA 2C8LA 5IW8A 3LA6A 2Y1EA 4U3JA 3V1NA 1ZUWA 3AHJA 2IEBA 2IP1A 3T4EA 4EUSA 1T1SA 2CYBA 2GARA 3CLTC 1ZAYA 1J8VA 1YQTA 3EJWA 4FMPA 4XGQA 5HUQA 3KOZA 2HF8A 5A3VA 3AF5A 2ZXFA 3FKSD 1ODCA 5GM2A 4BCDA 4LBWA 4ZV4A 4JP3A 2PDAA 1TGYA 1WS6A 5CXXA 2HHCA 3TSAA 2Q5LA 2QUIA 3FIUA 4Q66C 3CO0S 3QI2A 3D2BA 1RQ7A 2ZEJA 1FCJA 3R5HA 3LYAA 1AZWA 2A88A 4PX9A 5DKFA 1GPDG 3AL3A 4XPIB 3A3OA 2OP1A 1P17A 1PUXA 5F4ZA 2M1ZA 1YZTA 1CD5A 3WAGA 3PEWA 1FTNA 3BKWA 3A2NA 3GJ0A 1JXQA 1HM5A 1KMCA 1Z3IX 2CNBA 4NFHA 4LE0A 4DJ5X 2JH3A 4WINA 1EFVB 4PPFA 3TQCA 5ALXA 4ALJA 2BEUB 5A7GA 1MAAA 1PJQA 3CA8A 3IQWA 4DTIA 2OLJA 4U7DA 4H7PA 2R00A 3QEJA 3H1EA 4OKSA 2AOTB 2CXQA 4I50B 3T15A 2G83A 3LCJA 5IKOA 3TRJA 4OI2A 3K53A 4QICA 5EJGA 2W70A 3LKVA 3TNLA 3MD0A 3PNSA 4W8GA 1X1DA 2AG0A 3IQEA 2GXSA 1VL8A 5K2OA 3J81A 3UK2A 5CDFA 4D9NA 2HWXA 2PX3A 1TDJA 1QGUB 4OUKX 5KNBH 1DCKA 1NRXA 3QKSB 1EB9A 2AZTA 1A82A 1G21B 3HLYA 3WIVA 4RTRA 3IO5A 3AX6A 1FXWF 4D92A 1NDHA 3EAFA 3T94A 1OF1A 2R6FA 3ZWVA 2XHEA 5D01A 4AF7A 1GWNA 1NVBA 1VCOA 3N2EA 3OPYB 4MYSA 2FSGA 1V1MB 4WASA 2AMFA 3A6PC 1TUEA 1Z16A 2V7XA 3BBLA 1Y0BA 1M75A 3DQPA 2V3WA 1W96A 4ZT3A 2WFMA 2V5AA 1LLUA 4XI9A 5DN6A 1KY4A 2PGOA 4Y2PA 5KIAA 4EY5A 2OM6A 4NE9A 4IG4A 5FL7D 3HB4X 1MX3A 1P0MA 1PNQA 4H7EA 1F3LA 4EHKA 1BW9B 3GFPA 2APJA 1BVUA 2XVAA 2YUTA 4ND8A 4C88A 2QRJA 2JGJA 3DXFA 1MHTA 1DWOA 1U0OC 3BCUA 4P3XA 1X70A 4YRTA 4XWWA 2BMWA 4IDAA 2FFAA 1P62B 2ZSBA 1SBIA 1QIJA 4FFLA 4ER7A 3ET4A 3WWEA 4YRDA 1E0AA 2QYOA 3H9GA 2ZULA 3SFZA 3ZHBA 2IS1A 1OD6A 2GNOA 1OQAA 3CVWA 1VA4A 3DKKA 3FAKA 4L3VA 1R0RE 2VT2A 3Q8XB 4UXJA 2J0EA 4ZOEA 1CJCA 2ZUUA 3F6RA 5DLYA 3WZ2A 3K0SA 3RIXA 1ZGCA 4V24A 1H1LA 3DDWA 2QLNA 4WLNA 4HH4A 3PUKA 4UTVA 1UZNA 3CZQA 4G4SP 4J7CA 2WJIA 5EN4A 4QUHA 3JZFA 1HT2E 3KE9A 3CRQA 3P9SA 4HYEA 2PFKA 1PGPA 2OZEA 2XA1A 4YGXB 3ZWXA 4ZYWA 1EUCB 4LWOA 4B32A 3JTEA 1NULA 3V4SA 4C43A 5D5QA 1O6FA 3KQSA 3QU5A 1YRHA 2VWQA 1I24A 4I55B 4DLLA 4ZYTA 5FR2A 3KJQA 3DKPA 3A25A 1I14A 3QGMA 1KVQA 4GRIA 1NN3A 2NPOA 3K3PA 4H1VA 4HGZA 4R41A 5DGXA 4AK9A 1PZGA 2VG8A 1QGZA 3JD3A 3CVYA 3ZS8A 1GTMA 4C2AA 1R10A 4L8GA 5EWJB 2JK1A 2RG7A 4H1TA 2P2DA 3H2JA 3BWBA 3O3NB 2P79A 3L77A 4QU0A 1DQYA 1RLTA 1LWOA 4JJ7A 4ONEA 1AHNA 4RQAA 3RFUA 4CIVA 1HR0B 4QYTA 4M89A 1O54A 2WDZA 5E9QA 1SA0B 5A3JA 3ICCA 3IP3A 4AJ9A 3GAFA 3W2HA 2O5VA 1DIAA 1J8MF 1FFDA 4KCGA 3EDOA 3IV9A 3NBZC 3DEFA 2BH2A 3O92A 4KGDA 2GDZA 3BERA 4ETMA 4DLVA 1CR0A 3PPIA 1F9AA 1VYHA 2BFMA 2H0QA 821PA 4BX3A 2RIRA 1M0SA 4BOYA 2OQIA 3I1FA 3L3BA 4PBTA 2HSZA 5G53C 1Y4AE 2EJBA 3K0HA 5HKKD 3MM4A 4HD8A 4M9ZA 2SECE 2WLTA 2BKUA 3T9BA 3Q88A 1ISMA 2QRLA 1PT8A 3HV0A 1XP5A 1UFVA 3OEHD 4C9BA 4UUMA 2HWWA 3RUHA 4JI2B 5C52B 2DBZA 4LZLA 4RESA 1UEXC 3TFWA 4NMMA 4NBWA 4NZMA 3U3DA 2RIPA 3PTLA 4LMPA 1AUOA 5BRJA 5KVCA 4Q7JB 1G66A 5BQOA 3DBHB 5JAMA 4DADA 1NU8A 1VGVA 1KEWA 2OORC 3FVRA 5BRNA 1CZUA 2BC9A 1V0JA 3VHQA 2EX0A 3CX8A 1K92A 5BUZA 4PG7A 3JTMA 1KDTA 1JIKA 4RL6A 3LBYA 2CWDA 4IIHA 4YJ2A 5EIOA 4FYVA 2CNOA 3PKJA 1SY7A 4LQLA 4CF5A 4BKOA 4E7PA 3GRAA 2Y93A 4P0PB 1H3FA 4RZHA 2JIZD 1KZ6A 2VHWA 3UF0A 1PJAA 2JLCA 1EM8B 1XJ5A 2ZZNA 2QNBA 3AKCA 3VNAA 3C48A 2VPQA 1L1EA 3WB2A 3GLFA 1Z17A 3OBBA 4OJTA 1ITZA 1P2VA 1WQ4A 2FQYA 3ADKA 2W8BB 3QXSA 3RRBA 1M6HA 3PFCA 1ACJA 2FMXA 3FETA 1CULC 1JI0A 3OIVA 4CMGA 1Z0KA 3CR3C 4KIWA 3A9CA 5HFNA 4D3SA 4MUHA 4L2IB 1ZMXA 1LZKA 3FFWA 1CX9B 1YU9A 3ONVA 1PW7A 2P67A 5K09A 4QYSA 5DHUA 2HDOA 3UAVA 4B73A 4EMTA 5KYYB 1UKEA 4LF9B 4ZHSA 1E99A 3RVQA 1PYDA 2HK9A 3KEGA 4TMYA 2JLWA 4BIMA 3NM6B 2A9PA 3TO5A 5LZ7A 3G9TA 3QX8A 1QZTA 1AUXA 3WOHA 3K9GA 3BTOA 4CR6A 3KFVA 3LNCA 4JC8A 3FTQA 3WL6A 2PO5A 4EHFA 5I4IA 1M2JA 3EEIA 1ZMOA 1VL5A 2IIVA 1LD3A 2PWAA 3EFEA 2L19A 3SX2A 5AW8A 4CQMA 3UM9A 5ED0A 4LPKA 1XZFA 3M81A 2YW2A 2OV4A 3DB2A 4I1SA 1DCMA 4DV5B 2ZJBA 3C5EA 4C78A 3ETGA 3L4SO 1UINA 3WMWA 2A35A 1P6XA 4YMTA 3P71T 5B6PA 1SCJA 1TFUA 2WIFA 3EVGA 3ZLUA 4YMHA 1TFRA 5LQCA 3P94A 3AEUA 4UBLA 1CC1S 1DRUA 2OCLA 4YP1A 1L1QA 2CFCA 1T9AA 3ND8A 4KQXA 1E0SA 5LBUA 3O2NA 1SGWA 4LSWA 3HLTA 1JHMA 5TQ2B 1KFKB 3WADA 1LPMA 4EW3A 2I6GA 2A1TR 3EY4A 3ONDA 3NBYC 4HAZA 2XW6A 3GQVA 3QTLA 2XWPA 4FJ0A 4OFBA 1KGSA 3EDQA 5EXTA 4BQRA 1V8BA 4KXUA 5DVZA 2O3TA 1G5IA 1YC2A 4RLHA 1RCTE 3FTNA 1ZP6A 2MSLA 3VR0A 5F2KA 1AK9A 1NVKA 3A27A 3IMEA 5LP6A 2PT6A 1EXMA 4NMLA 1P6UA 4IDGA 3ZLBA 2R84A 1JSZA 3VPFA 2QSZA 1OI7A 4YMWA 1QFZA 2P2CA 4GR9A 1QRUA 1UJ4A 4YMIA 4WZZA 1D6MA 5LOVA 1R4MB 4GM4A 2AFIB 2WAAA 3UW3A 2TSYB 3W6OA 1U8XX 3GRZA 4LYEA 4ZCPA 1GTG1 3CY6A 2HMTA 1Y6ZA 2VBGA 1W4LA 5DBHX 2BI4A 3V2GA 3W1VA 4BECA 1IWPB 1ZRSA 1GGVA 4TKLA 3DAPA 2I78A 1KNXA 1F2VA 2XE6A 3GJ3A 3I45A 3SEQA 4ZI3A 1A8PA 4Y30A 5E4TA 1SCIA 5AR1A 2FDCA 2QPLA 4IF4A 3LBHA 1W34A 2JEZA 2GFIA 4FHEA 1ZJ5A 1FVOA 2CE2X 1DZ3A 4G0QA 4RABA 5REQB 2ZBGA 4PZPA 1DIOB 4B71A 1RAFA 3L7JA 5EC8A 2UVDA 1QIFA 4KO8A 3KAJA 1WCIA 2YXEA 3V7UA 1C29B 3NVMB 4D4KA 4Q4HB 1JTFA 3TB6A 2PH3A 2DFNA 1KNQA 3FBWA 3FYUC 1VG9B 2VHEA 3NVAA 3PUZA 3QP9A 4INZA 5D5PA 5JDCC 3O31A 4GXRA 4CCYB 4LDRA 1C80A 1Z34A 4AKTA 1HSZA 1X7DA 2Q5OA 1AS3A 1NOJA 1Z2AA 3BHIA 3DCYA 4EW2A 2ILTA 3FR7A 5HVNA 2GJ9A 1HE3A 3EDRA 4MAMA 3V5NA 3ZZNA 5DX8A 2FWNA 4IKEA 1XNHA 2J7PA 1LV7A 1NMYA 2GESA 1G7SA 5E3IA 3R8FA 3CRMA 2TECE 2HU7A 3N86A 4OFXA 1YMVA 2FTKE 2IHJA 2PL9A 3R6DA 1LBHA 1YONA 4EARA 3U7QB 5BV7A 5JWOA 4MGIR 2A9OA 5B5SA 5K6TA 1NV9A 2HTFA 3OQNA 4IMPA 5INTA 4Q03A 4RHFA 3T3IA 4LI3X 3IBFA 4NAHA 1IN8A 2W4MA 3FLAA 3M1YA 1OIWA 2AYYA 3JU3A 2B36A 3I01M 4DYVA 1N3IA 1NUAA 5C8YF 1OXMA 1CUIA 5CLFA 1OFGA 2A58A 2C4UA 2ZS8A 4CNQA 1R2QA 2K7ZA 4NKRA 2P8SA 2JK0A 4KX5A 4UD2A 3UJ7A 2I8CA 1AXRA 3EIXA 4I3GA 4GLJA 1NPTO 1BKSB 1L3CA 1XZPA 2KI5A 4ENTA 2OGUA 1UKZA 4G1MB 1H9AA 1VQ1A 5HA5A 1Z37A 3NM5A 3G8YA 3NOQA 3BRSA 4MDHA 1Z5VA 3TZCA 2FQWA 4Z3DA 1G8HA 3OM1A 4YAOA 3TLEA 4IPTA 5ECWA 2GETA 4AL4A 2YCBA 2O54A 1TQDA 4J6EA 4MLDA 3WGTA 5KQPA 3KKKA 5AKLA 3K2IA 1T8PA 3EGDB 4H16A 4M8NE 5IARA 3RAJA 4WN9A 3JQBC 2HSJA 4Y6PA 3VH1A 2XI4A 4S35A 5L9AA 1K7SN 4Y98A 3F9CA 1OZHA 2TMGA 1XV5A 2C0PA 4TWJA 3WNZA 3SVZA 3AIIA 3HHPA 5KNDH 4FE3A 3G0HA 1EHYA 4DV4B 5HOQA 5I9IA 2O1WA 2NUTB 1N36B 4CG3A 4R05A 5TPWB 3I61A 1YS7A 2Y1XA 2VXOA 3CZ5A 3OIYA 3SK0A 4PYIA 2GUGA 4DLAA 1GUAA 4AF6A 3TLGA 3F1LA 1BDHA 1IN7A 3U4MA 4EFMA 3MT9A 5HHTA 1T2EA 3E8MA 2AXNA 4G65A 4OLHA 1OZGA 2ANBA 1G5HA 2PL5A 2PXHA 2XODA 3M6MD 3OUTA 4IXDA 4BFWA 5IABA 2H29A 3WA7A 5ES4B 5I3CA 4R1UA 3UCFA 3ZWYA 4ARCA 1GAQA 2XXBA 4UFNA 2XQFA 1BCSA 4I6JA 1JRLA 4MB2A 3GAMA 1NJ2A 4OLFA 5KOHA 2JFYA 1OC2A 2W2LA 2OUIA 4OJKA 4W9NC 2ARKA 3GCXA 2GEVA 1YVRA 2YX1A 3RYIA 3TECE 4KYUA 3C7TA 3CR7A 3H7IA 3U4DA 4O1IA 3KTDA 4C06A 4DABA 1P0CA 4UE2A 2ZTHA 1WW2A 1P0PA 3DEZA 1KK2A 4UHEA 3RFCA 3M70A 1A72A 3LC7O 1PYGA 1DG9A 2HBQA 2VJBA 2V45A 3CSDA 3DEYX 4NJMA 4X3OA 4Y18A 4Y8VA 3KXIA 5IBQA 1J0DA 1F06A 1GLVA 1NMQA 2IVZA 4C3ZA 2ONKA 1DE0A 3FCEA 5TRTA 5AVUA 1PAUA 3KLPX 5GONA 5TGZA 5JEDA 4WUTA 3B8EA 1Z28A 1A71A 1WA5A 3R5TA 3W7VA 3W9YA 3WRXA 4BAGA 4EO7A 2AD5A 4FSHA 4EA9A 3I9NA 4FOTA 3UHOA 2IPXA 2CSUA 4PTYA 4KQJA 1YE5A 2I6XA 5F5LA 4X8HA 1FNCA 4KLZA 4RANA 4UUBA 1SB8A 1XN4A 1TC2A 2MMGA 1PK9A 4RGQA 5KNBD 2ZRDA 1N2IA 1Z8FA 3TIVA 4XVUA 1ADFA 3HKCA 4EY7A 2CLLB 2QN6A 1C2YA 1CUCA 1HFJA 2OBXA 3DWIA 4HVCA 4PYJA 5CITA 3KB1A 4E30A 5JSZA 4OHVA 3D8TA 3G2HA 4D79A 5E4JA 1Z29A 4JLVA 5BWBA 1HLGA 1M2NA 2X6QA 3OCCA 3VJMA 5IMBA 3OJEA 4RQBA 3W2TA 3TDNA 4BNTA 2AI3A 3CRNA 4Z3OA 3AB3A 2GX6A 1ZUIA 2JCVA 3OQBA 3WDSA 4Z4EA 1WXXA 4K1XA 1O95C 1DC4A 2LPMA 4EGAA 3GGGA 1YZ3A 3LL4A 5AOCA 4CLEA 2PH7A 2X15A 1S3GA 4F3YA 1EBUA 3UJDA 5KWJA 2KB0A 3NJ4A 3NM4A 4BZWA 4BKUA 4CGYA 5CXUA 2PKWA 5JJBA 2ZUSA 1JH8A 2XXAB 3Q7QA 2CL5A 1YBVA 1WKBA 1UXIA 3FPSA 4QOFA 3TI7A 1G291 3NFRA 5LCXA 1YR7A 1NYQA 2PAFA 4UW9A 3WJAA 1Z2CA 1Z6TA 1SD2A 5FRDA 2QMZA 5LXTA 3QX3A 4JJ8A 2H4ZA 4CU5A 3UOAB 2ZSAA 2OCGA 3JVVA 4HJRA 1IMJA 2BP7B 3GNSA 5LIPA 2AMJA 3CRVA 2OCPA 1PT5A 4OJNA 4P4NA 2IA5A 5CDTA 4H1WA 5HSGA 4UHKA 3ZBTA 3L02A 1MXFA 3KQYA 2QYHA 3TAXA 2BZSA 4FINA 5E9JA 3WTCA 3IOEA 3WLPA 1Z8HA 2NNLD 3VAYA 5AXCA 3IHLA 3Q2IA 5HKBA 1ZR4A 4YCBA 1Q1EA 4F5EA 1C0EA 3CXRA 5JCJA 3AYZB 2YINC 3GLTA 1V6CA 4FGUA 1YJAA 3IB3A 3SJBA 5M34A 1A5ZA 5HF6A 4RD6A 2QUKA 4AC9A 4D26A 2VTEA 4C0HA 1LFDB 1RWBA 4HC4A 2P40A 1DX9A 3FGZA 3VR1A 2HCJB 3ANXA 4HXGA 2DU8A 4ID3A 2BMJA 2P4QA 2X23A 1H0KA 4NH0A 5B55A 2EZ9A 1W4CA 2YWDA 2CYCA 3RBZA 5TNXA 3PQ8A 2VQSA 3JQ7B 2YZMA 4XEUA 3ONEA 3QE4A 4PS1A 1QE3A 2JVJA 3EXHB 2WZDA 1X7YA 2ZT6A 2QUZA 2VDRB 2DPGA 3RVDA 5DTQA 2B7BA 1IOZA 3MJTA 5DDIP 4MZDA 3S5JA 3D3JA 2Q3CA 4LWPA 4Q1DA 4XSGA 3G0DA 2GPBA 2I62A 2Y68A 4GPIB 4ZYLA 4YCLA 3G2NA 4MSUA 2Q6TA 4PWYA 3EXFB 4N8EA 3S68A 2Z3VA 1N1MA 4H1UA 4TYNA 1MNQA 3OOEA 3F5DA 3T95A 1ZIDA 3QWAA 2Q41A 1DTEA 1RHQA 3HDHA 5B6IA 2FQ1A 1Z9BA 3PYXA 3DTYA 3UWPA 3ASZA 5L8VA 3WSWA 4D81A 1CUXA 3WFZA 4WFKA 2O0LA 3BX1A 4AX8A 1HG0A 3IGFA 3KL2A 4UCQA 3KKPA 2AN5A 1FMLA 3FPLA 1I4TD 5CR9A 4GOND 1Y9EA 1N6IA 2X2OA 2VA9A 3OIFA 3MZ0A 4FKMA 3B6KA 3QWBA 4BLWA 2PXAA 1XLTA 1QS0A 3FY4A 3PT5A 1GAWA 1JFVA 4OFZA 3UY4A 1PTJC 1AX9A 4I1OA 4EB8A 2RK3A 1COZA 4IL5A 1L7XA 2AQKA 2Q4DA 5ELXA 2O06A 3CBGA 4R6WA 2OMKA 4RX1A 4HX5A 3D4NA 4TTIA 5IUKC 1V71A 2B8NA 1O7JA 2R8ZA 3NHZA 4KSBA 4UNNA 3OHSX 5JCXA 4JJZA 1N5IA 2EBWA 3HXKA 1FRZA 2IV7A 4WOJA 3NV7A 4YV2A 2QBYA 3FMFA 2YVQA 1DXYA 2AK2A 4ZT4A 2CXNA 3L0DA 1WOMA 2G5CA 3E1GA 5G2OA 3WQRA 3BMNA 4EUHA 4KXYA 4V1CB 4MV1A 4AG6A 2FA9A 3I9LA 4X1YB 3U7EB 4EVRA 5JZMA 2ZSKA 2XWBF 5EIBC 3KUDA 4TT3D 4GGOA 4R8RA 5AIAA 3L4BC 1X2BA 2ET6A 2CF5A 4A73A 2ZU6A 3HDGA 1H5NA 3F6PA 3PLNA 1SU8A 4H9GA 4W7SA 1O97D 4WNAA 1TQ4A 1L8LA 2QS9A 4MOWA 3DTVD 3LXXA 1NQVA 3TG8A 4JC5A 4C4OA 3EWAA 3GRCA 4YAIA 1KAMA 4N9QA 3CVXA 1R0XA 4H0NA 1KEZA 4XRRA 3V8BA 4QT4A 4A27A 4MR8B 3HO8A 1U0GA 4G41A 1D6NA 1M2VA 3DOJA 3RU9A 2VPZA 2YRWA 4IJVA 1F7UA 1DGQA 2QXTA 4MQ5A 1Z0IA 4Q4JB 5JS2A 3O8RA 2JHGA 1NL3A 4DCOA 3GLIA 1JAIA 2Q9CA 3VSCA 3K1YA 2BW0A 3IVCA 3LX4A 2Q2WA 3ZK7A 1PUJA 2QAGC 1J22A 2F48A 2HHAA 4KAAA 2C4HA 1RPNA 1ATZA 4X5OA 1O58A 1V7PC 2WICA 3THRA 2JFHA 3KYJB 1HE1C 2P0EA 3ASUA 4PVDA 4RHCA 2P7IA 4EABA 4JQCA 5K3DA 1JFSA 1X87A 3RODA 1S7GA 2GBIA 3NGXA 2WT9A 5ER9A 3AY3A 2ASEA 3HYTA 1E8MA 1UODA 2HC9A 4EW6A 4W1QA 1DRKA 3P96A 2QV7A 4GOXA 3PGXA 16PKA 1OGJA 4L75A 4U2EA 1CF4A 1GG5A 3ZWWA 4X97A 3NI2A 4OK5A 1XQYA 3PDCA 3LYUA 5KDDA 1LBTA 4CT5A 1PKEA 2OAGA 2PL1A 2JCYA 4XOIA 3V3TA 4F8JA 3ZHVA 4MRPA 4L08A 3FDZA 3CINA 3NTQA 2VK8A 1UP4A 1LSJA 1U94A 4FFOA 5ALLA 5EMLA 4B17A 4CMIA 3DHYA 4D96A 4B7AA 4H60A 1NF3A 2XSZD 3ABRB 4EKYA 2QORA 1IXRC 1SMKA 1E6EA 2UZ1A 4DG8A 5CT8A 3OX3A 1OFHA 4N49A 3WBFA 3T7SA 2JIRA 1BTOA 3HWRA 4MIOA 5GGXA 4MWZA 3MTJA 3W9UA 1Z6XA 1ZK1A 2YV4A 1E2KA 4M83A 3OECA 1QFJA 3QUSA 2BE7A 2Y76A 1VBKA 5A3SA 3N2GB 1UWKA 1E1QD 5A4KA 4GLBA 4HMPA 2O1SA 2OP0A 4BMCA 2QT0A 3N75A 1SCUA 2YV2A 2CE7A 3PC8A 1L7AA 1YCDA 2IYTA 2DBQA 3R5XA 3GLHB 5T41A 4E03A 2IT1A 3KQLA 2GT1A 4YEDA 3NHWA 1C9YA 2J8ZA 1E96A 1ZK3A 4X6YA 2W2QA 4EUEA 2BFCB 4D8XA 4QASA 1SK8A 2I8AA 4UBNA 4XOUA 3WKBA 3NTOA 2JDIA 1UFKA 2C5BA 3FWPA 3AIMA 4I5EA 4QARA 4A0QA 5FWYA 3G9QA 5FUXA 3RDPA 3ZCPA 4BGIA 3L4KA 1FRNA 2PUHA 4MPTA 2PZEA 1WETA 3RWBA 1GQRA 5BR1A 3UV7A 3VTFA 4P4SA 4EX7A 1JMYA 3Q9NA 4TMVA 3V32A 1M3SA 3MJCA 5TS3A 3UWKA 4OSEA 3WYBA 1YD7A 4HLCA 3F8TA 5BRAA 4TTJA 2EOAA 1YVDA 4M0FA 1D2AA 2QQFA 1X1RA 1GDHA 1B3RA 3LT5A 3QTBA 4PLZA 2LZ0A 3RC3A 1WZCA 2VDWB 2AR9A 3HXTA 4DC9A 1NF9A 3INYA 4D74A 4ZALA 2E49A 3RSFA 1R16A 4MARA 1J23A 3OA0A 3ZDFA 4DJEC 1M1XB 1R6TA 1ZIYA 1U6KA 2P65A 3L7YA 1ST2A 3ROQA 4U63A 3HNOA 2QR3A 1XTVA 2CL7X 1RZVA 2DPYA 5DWQA 1VCNA 1TLTA 3W7BA 3SEZA 2NZUG 2H31A 2NO9A 1W1UA 1UPTA 4E46A 1RWQA 2C5HA 2E0IA 5D51S 4URVR 2B25A 5JNVA 2DLNA 1NBEA 4KYTA 1XMQB 4NOKA 1NZJA 4GGPA 5TGTA 2GAAA 1FNSA 1FP4B 1NJ6A 2A9FA 2D1YA 3IAM6 3IP5A 2C3UA 3PA6A 4ZDJA 3VOAA 3IUEA 4CIDA 1RKQA 4WD3A 1GG8A 4B6QA 1VB3A 2AC2A 1T5OA 2B4RO 2DJIA 3HKBA 1X7XB 3STHA 5LYJB 2C82A 4TYYA 3ZEAA 1V7ZA 2Z3ZA 3HYCA 3D9QX 1G9XA 3DTNA 1G8YA 1ECCA 1Y37A 5EJIA 1HKHA 3OLXA 3AXSA 4LWZA 1JKJA 3VR4A 4G0VA 1UT5A 1XJWA 4Z4GA 2QYTA 4MUXA 5EMMA 3TQRA 2BF4A 1L5QA 4JKIA 1RAEA 4MQUA 4ZAVA 4FN5A 4CKWA 1M10A 4O2BF 5J4VA 3D4BA 4K0KB 3KYBA 5DHSA 1EQ2A 5E3HA 4UTRA 5EJ5A 3WWCA 4EHLA 1O89A 1V16B 2IXTA 3PXUA 2G9UA 4YQZA 4OO3A 4JH0A 4OM8A 4RY8A 4BJ6A 2RHLA 1JEYB 1FU4A 1Z4NA 3CT4A 2C61A 4R69A 2EW2A 5BYAA 4LV5B 4YAFA 1JR3A 1QAOA 3K15A 1SOAA 1W9MA 5I4KA 1SHZA 2FJPA 4KACA 5I8ZA 3Q7TA 3DM9B 1HURA 2VHZA 1MO3A 1U8AA 3MGAA 4DLSA 3KQKA 2WSYB 1QKIA 2V8OA 3N53A 5IXSA 1NM5A 4L28A 2BH9A 4Z51A 1WV0A 3H05A 2PKCA 3MQ2A 2P6RA 2UXDB 9ATCA 3L8EA 3K70B 5IF9A 4Z5XA 1EK5A 2YV1A 5GIOE 3PPXA 2UZ4A 1G64A 3D3QA 3U9TA 1OLUB 4OXYA 1UBSB 5FBLB 1QO7A 2QRUA 2OM2A 1PG0A 3KVNA 2AZDA 1TTTA 4EWLA 4X90A 2P11A 4O8ZA 2ZS7A 4PRZA 3RFVA 4QLAA 4MO9A 5IPFA 2O07A 3AUYA 3MOGA 3HO1A 3SF0A 1JJ7A 3PEYA 1FFEA 1Q20A 1XMPA 4W5JA 1UDCA 1XXLA 2ZJYA 3BTUA 3MAGA 2GJKA 4LG1A 5JAHA 2K87A 2BFBB 2LRHA 5ANRB 5K0SA 4H6WA 2OCKA 1UMCA 2R25B 3AETB 3EA4A 4OIFA 2JL1A 1QRTA 1TT5B 4Q4AA 4M9CA 5C3UA 1FXWA 3MG9A 4NZPA 3M1LA 4Y6RA 2WNIA 1AKEA 1WHSA 4OI1A 3MGBA 4IVRA 2DXIA 7MHTA 1CUBA 3NBQA 3I2GA 5FLEX 4E11A 1XZQA 2NV0A 2RHWA 3VSBA 3IRUA 5CEJA 5KREA 1VPVA 1KO1A 1UQRA 3IO3A 1OUMA 4J0JA 4KDFA 4LTDA 5BV0A 3BUSA 4IGFA 6REQB 5K05A 2IH4A 2OECA 2QTRA 2GRJA 4EG1A 3GU3A 5IG2A 5KU7A 1RXWA 4CEHB 1JUDA 1JPNA 3DZ8A 2P9YA 4U9HS 1GV1A 4BP9A 3JZAA 3UB4A 4GYKA 3VU9B 3PDJA 4P1ZA 5T8KA 5JJ5A 2JJMA 1I80A 4N76A 4ESOA 3RUEA 5IZCC 3HL0A 5G40A 2VYFA 4EG8A 2O8DA 2OFWA 1X86B 3T7EA 3FZGA 3BCSA 2II6A 5GWXA 1Q1ZA 3EG9A 1C4XA 2W2NA 3MGCA 3THSA 2G06A 2J07A 3R0ZA 1CF9A 4B6EA 2R7LA 5EG5A 4QLBA 3FSEA 2PGJA 4DG9A 3PDIA 2LCQA 3EUAA 3EAGA 4AY2A 3LFHA 4LS3A 4RC9A 4WLOA 3LUFA 4GNRA 2F2TA 3E9EA 4P31A 4KPEC 1QTQA 4PZAA 1U8EA 2VBFA 1U1EA 3GQBB 3WK5A 2E6UX 1SWWA 5AD1A 2IY9A 4YCSA 1SPBS 3ZDAA 4KNYA 4YQFA 2FLKA 1FNMA 2ODPA 4NFYA 3THWA 1N3YA 3GCZA 4C07A 2JGLA 3PGLA 3Q7PA 5CB4F 1MTOA 3KOXA 3HA3A 2EG9A 2FX5A 3B6ZA 4QBFA 3PI7A 4HLDA 1OLXB 1R8JA 5HS4A 3LBIA 1P0QA 5ITVA 2PY6A 3I76A 3PEUA 3WYAA 2BM1A 4LYHA 2IHBA 3C4JA 2CMFA 1Y5LA 5AXDA 4AWBA 4FUQA 4O08A 2I9KA 3M83A 3QRWA 3W5HA 2V74B 4NBTA 3IOBA 1K9VF 3LQKA 2QSYA 1S01A 3RR2A 4RIEA 5I7HA 4FILA 5KNDD 2HA0A 2QVZX 1DUSA 2VAPA 4LTNA 2FR8A 1T9GS 5CG1A 4MRMA 3LDUA 2Q1WA 3L7NA 3DLAA 1JU3A 1XVIA 2KBFA 1USVA 4YYZA 5AW2A 4XR4A 1PGOA 4FDTA 3UA3A 3H5IA 3JVDA 2D62A 3HU3A 5EZYB 3VAZA 1RVV1 1L4HA 3TPZA 2FSVC 4EGSA 3MHTA 4R83A 4DSNA 4TOIA 4OI0A 3HEMA 5T4BA 2RAPA 1PQPA 5GINE 2O48X 4KXMA 5KSZA 1GJRA 1NMEA 1NUTA 2FYTA 4N82A 1T34A 2QN2A 4REQB 4CVNA 1ZD8A 5F2EA 1CUAA 2QZ4A 5EKSA 4F6RA 4FB4A 1X38A 5CLLA 4R98A 2KLBA 4J0DA 3F8SA 3OIGA 2WYHA 4FS3A 2QN9A 2GLUA 1ZA2A 2YQZA 4KLNA 3EGIA 5E7QA 4PX5A 4DBZA 3O21A 4B6FA 4ANFA 2BM0A 4J90A 1I01A 1JPVA 5HE8A 5TQ0B 1Q50A 4RORA 2JFVA 3W78A 1JG2A 5EP2A 2I65A 3ON5A 4FC7A 4CQJA 4CIAA 5K2MA 5EXSA 1T1EA 1O8BA 2OLEA 3O8BA 4F3CA 3BE6A 4RTJA 4E14A 1SRRA 3MRVA 1JEEA 1ACMA 4EHAA 4EKIA 1KR5A 2YOGA 4I5DA 2NXEA 3PTZA 5TPZD 3RWOA 4EZBA 4JI4B 1UK9A 3FKJA 5C1DA 4X44A 4KVAA 5IVHA 5C37A 4DUPA 4QPZA 3D6FA 1ZNXA 3KEOA 5CA0A 3GWZA 4L9WA 3KQUA 1HT0A 2GPYA 2EC5A 3HKDA 3FE2A 3B8HA 5FXMA 2EFEB 4QM6A 4LCJA 1JR4A 4R9RA 1U2DC 4BKPA 2HRBA 4JCOA 2H3HA 4KE9A 4N7JA 2X0IA 5CYFA 3WQQA 5BYKA 3TM5A 2YWCA 1O5OA 5A04A 2P3SA 1Q17A 4YP6A 3RSOA 3TQSA 1H0SA 3DC7A 1RE0A 4XFKA 3V3KA 3EIHA 4KRYA 5CNIA 1LSOA 2ZDHA 4BNHA 2JEYA 3FWKA 1NI4B 3C6KA 4OHMA 3ABQB 2VUSA 5J59A 2OLKA 2EWMA 2O2EA 2FN7A 3T1QA 2CHFA 3MWLA 4IMIB 2FPXA 1FK8A 2CNLA 2OOSA 3E2PA 4JX9A 3TD2A 2PQMA 1UKAA 4E5UA 1WVMA 1AB5A 1ORHA 1WDLA 2IY8A 2ATCA 2GBCA 2XMGA 1HOTA 5EIFA 3KG2A 1QP8A 9MHTA 3T1VA 2Q7DA 1Z6ZA 3VJKA 1JQBA 2QD2A 3FTPA 2GZ3A 1SXIA 2GHQA 1VLHA 3LCRA 4HGQA 4K9KA 1K8QA 1Q11A 2DRIA 4IDEA 1R27A 4J4TA 5ADHA 3IUQA 3B9PA 3IPLA 4IICA 2VZEA 3K9HA 1II0A 2SNIE 4FEYA 4PNHA 4PLPA 1L4YA 1NQXA 1NJ1A 1V1RB 3R23A 4WEOA 1U1DA 3T9CA 1KQGA 4WZBA 2IHNA 4XJTA 3WIDA 4X95A 3N8DA 1QLJA 4TL7A 3WYCA 4QJ5A 3F5FA 1QTRA 4NVRA 3Q7EA 5L95A 2C9DA 4GI3A 4G9BA 4GD3Q 1Z82A 4X54A 3TLAA 2YOHA 2X77A 3IT0A 1RYZA 5J2UB 2BFPA 1NW9B 2NAFA 2X5KO 5JPIA 3FPJA 3UT0A 4O4JB 5B7NA 2G7MC 5JJIA 1J97A 3M49A 3A3PA 2ZDQA 4COOA 2L17A 2XUKA 4CHTA 1W2GA 2G28A 1X7ZA 1FLDA 2QRKA 4R2IA 4UNIA 1A77A 5FA5A 1VJTA 2F9FA 4CTOA 1Q57A 2HX1A 2X9NA 3GEBA 3K0FB 3O91A 3QU7A 1XVTA 1D07A 3HYSA 4EF4A 3LBAA 1M74A 3FTCA 3VR6D 4IY1A 3NEYA 2P91A 2POCA 2VNJA 4IIDA 4CEJB 2JBAB 3QY0A 2A94A 1EEHA 2I71A 3MFQA 2WJZB 1QGED 4NENA 3TI9A 2FZCA 4Y9DA 5ERXA 4MVCA 2H06A 2R1ZA 3H65A 2I6FA 4XWYA 4UOZA 4JMLA 3U7RA 2GKOA 3DFZA 4OQXA 5K8UA 4LTMA 3MCAA 1DJMA 5ALEA 3AHGA 4IWYA 3HXPA 4GOLD 1N0HA 1PLJA 2DFVA 3C3BA 4G8DA 4JYPA 3RVJA 4BEVA 4X62B 1B2RA 1E6WA 3A1EA 2HIAA 3VBEA 2K2WA 3KOOA 3D3WA 5CT5A 3CZ4A 2JHPA 3B9BA 2QAGB 3EVTA 2UV8A 3PLRA 4BWVA 4BTLA 3F4BA 3N8NA 4D3DA 5JCOC 5JQGB 1Q1BA 2VHUA 1HWYA 4ZICA 1WXDA 2HBYA 1ZMRA 3FCXA 5FBWB 5KC8A 1HYEA 2K5UA 5D8DA 5D6NA 1PUIA 2HEIA 2NZ2A 1M1NA 3S2IA 4AB1A 1M8PA 4FYKA 2IZ0A 3U4IA 3L9WA 3C15C 3MVEA 3PK0A 5FAKA 3I23A 5FEUA 3TRHA 1NT2A 3LUCA 4WSOA 2D0DA 3U3OA 4CMKA 4F4JA 1ST3A 1B3BA 2WF7A 2PJZA 3FUVA 4H4EA 4O2AA 2I4TA 1P5FA 2WJ6A 1AKQA 2HJRA 3P7MA 5CEFA 1ZICA 5IC6A 1C3LA 4Y2UA 4FXPA 1F6BA 3E1KA 3RUAA 5EUCA 5DTEA 4QREA 2R7KA 4PYOA 4YRSA 3AFNA 3ER8A 4X61A 3EGEA 1J33A 4F5DA 3OCVA 4DUGD 1HDRA 2KQUA 4L76A 4BJ1A 1RQLA 3D1JA 4I5FA 4J3FA 5CDUA 3WLRA 2N3ZA 4RHEA 2EBUA 2XB4A 3K2QA 3O75A 1JG6A 5TJ9A 2R7MA 2W58A 1Q6YA 1E4OA 3N76A 4DA4A 4D57A 2OCBA 2PBZA 1H1DA 3GV0A 1LBEA 5ECYA 5ARDA 3SC3A 4XVHA 3UT5B 3W4KA <