4U7TB

Crystal structure of dnmt3a-dnmt3l in complex with histone h3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
187
Chain Sequence
FMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGVRVWSNIPAIRSALVSEEELSLLAQNKSSTKLVKNCFLPLREYFKYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into autoinhibition and histone H3-induced activation of DNMT3A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase regulator
molecule keywords DNA (cytosine-5)-methyltransferase 3A
total genus 46
structure length 187
sequence length 203
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4u7tB00
3IEIA 5CVEA 5E8RA 2CWWA 2P8JA 1B42A 3SMQA 3M6VA 5F2KA 1RI1A 4H0NA 4YMGA 5CD1A 1NT2A 2O0LA 3OU6A 3AXTA 2JHAA 3BXOA 2BR5A 4G56A 2BM8A 4OQDA 5M5BA 2UYCA 3EMBA 2BR3A 2O05A 2PX5A 4C4AA 3EEOA 3BKXA 5KQSA 3KU1A 3DP7A 4V0QA 3KQOA 3JWJA 4RTKA 5B1SA 4EKIA 2OYRA 4MQ4A 5DXAA 2E5WA 3P71T 5K0FA 4GOLD 3EVEA 3DXYA 3NW9A 3DMHA 3G8AA 3EMDA 1R8YA 2QM3A 3UJDA 1KHHA 2GLUA 1X1AA 3EGIA 4R6XA 4C08A 2B3TA 2WA1A 3LCUA 3SR4A 3KR9A 5K09A 3UJ8A 2F8LA 1RJFA 4NECA 2YTZA 3LKZA 3HCEA 2NYUA 1R6AA 4KW7A 3ER8A 3GRYA 3THRA 3TLJA 2IPXA 3FPEA 1X1BA 2ZW9A 1YZHA 2ORED 3KPVA 3EGVA 1NE2A 3LHDA 3Q7EA 4EMSA 1EQAA 3LL7A 3LECA 2ZBQA 3P9NA 4CTJA 3G2PA 3BGDA 3H2BA 5EGSA 3PX2A 2GAFA 5EKUA 1IY9A 4CWAA 5EVJA 3IYLW 3JWIA 1D2HA 4PYOA 2FHPA 3NJRA 2IIPA 4KDCA 4GOOD 4QTUB 2ZSUA 3FTFA 4POOA 3HA5A 1KPIA 1N7IA 4PNEA 1ORIA 3FPFA 1Q0TA 4ER3A 1JTEA 1PJZA 2VDVE 3B89A 4OBWA 3VC2A 3TM4A 1Z3CA 4DCGA 4EKGA 2DULA 1NW5A 4FT4A 1X1CA 5K8VA 3VSEA 3FRHA 1EG2A 4FSXA 5EG5A 3DMGA 4AZWA 1V39A 2P35A 1JQEA 2ZZKA 2FRXA 3AXSA 5IKMA 1O9GA 1R18A 4LWOA 5K05A 2VZ9A 4OBXA 2IH2A 3OE5A 2G70A 2ZCJA 3KPJA 4RSRA 2IDKA 1KIAA 3HVKA 2OO3A 2VDWA 4PCAA 2ZWAA 4OQEA 1EJ6A 5ICCA 1XTPA 3P9KA 3EVDA 4KIFA 3GIWA 5E8JA 2IH4A 2JG3A 3G89A 4E30A 3QV2A 1ZHFA 5FQOA 2VS1A 2AOTB 5DTRA 4RTQA 4CTKA 4RWZA 2B9EA 5DM0A 4RTNA 3NWEA 5EMKA 2KW5A 3I9FA 1ZQ9A 2OZVA 4B17A 2I62A 2JJQA 2AVDA 3ORHA 4EVIA 4P7KA 2PY6A 3EEYA 4M7RA 5T64A 3SSNA 1L3CA 5T67A 4ER6A 1YFJA 4L7VA 1VBFA 5LQNA 2ZIFA 2XYVA 5E1OA 5CM2Z 2B78A 4P7FA 1SVUA 2YVLA 5FHQA 4ER5A 3OZTA 3B7PA 2CKDA 3V97A 4BY9E 1D2CA 2Y1WA 4DF3A 3R6TA 3HA7A 1OR8A 3E23A 3FRIA 4U7TB 4OX9Y 4JXJA 5K0CA 2FYTA 3HVHA 2OY0A 3KQPA 4HH4A 3DLCA 1X19A 3LDFA 3GGDA 3T7TA 2ERCA 2HWKA 8MHTA 3MAGA 3V8VA 1RJGA 2UYOA 4RTOA 4FGZA 4HSGA 5IH3A 3OCJA 5GWXA 2OB2A 1NW6A 2AOVA 1YB2A 2ZTHA 3DUWA 1FP2A 1SQFA 4DMGA 2NXEA 2GH1A 2YXLA 3C0KA 3KHKA 4MIKA 1YFLA 1M0EA 1L3IA 2GPYA 2N47A 2HR1A 4F84A 1BOOA 2PGXA 3HCBA 3VC1A 2AZTA 3TFWA 4EQZA 5K01A 1R74A 2PXXA 3UFBA 3LCVB 2ADMA 3ID6C 3TRKA 5FADA 1MJFA 3A25A 3FTCA 1M6YA 4YV1A 3UWPA 1L1EA 5BW4A 4QVGA 3C6KA 5LQRA 1EAMA 3GWZA 3KR2A 2G71A 3GRVA 3G2MA 3P97A 4RTPA 2FPOA 4PYKA 1L3BA 2P3QA 3OE4A 3DLIA 5HIKA 3UZUA 3UA4A 2EFJA 5EEHA 1XCJA 2O57A 2BR4A 3O31A 4YV0A 5FWDA 5CVDA 5FTWA 1KP9A 4KWCA 2PWYA 3UJAA 4RVGA 4YUWA 3KPYA 1UWVA 2ZLBA 3CCFA 3FPJA 5K0BA 2NXJA 4BLUA 2CL5A 3FYDA 4PINA 4C06A 1P1BA 1Q0SA 4Z2YA 2OPBA 2IDJA 2DPMA 5JUWA 5GIPE 1G6Q1 2P7HA 5EPEA 3SVZA 4F86A 2YX1A 2AOUA 3LSTA 3PS9A 3LDGA 3P2IA 3QOWA 4LWPA 3RW9A 1FJXA 2P7IA 3P2KA 2PBFA 2ZWVA 5EHIA 2IBTA 1WXXA 2XYQA 3KQWA 1QAMA 5DX8A 4A6DA 3GRZA 4C04A 5LQKA 3R0QA 4KRGA 4M36A 2AS0A 1JG1A 1IXKA 3EPPA 3JWHA 4CKCA 3FTEA 1L9KA 4X63A 4PGHA 5LQJA 5DX0A 3B3GA 3GJYA 3P8ZA 4OA5A 1JG2A 1RI2A 3LBFA 3GRUA 5K0EA 1WG8A 4WXHA 1HNNA 1KYZA 2AN4A 2AVNA 3MGGA 3OPNA 2OB1A 4GOMD 1X1DA 5EIFA 2QYOA 5FA5A 2B2CA 2I9KA 3MERA 7MHTA 5DLYA 4IV0A 2PX8A 2IGTA 1UFKA 3I53A 3ELYA 2PX4A 2IFTA 1KXZA 4MWZA 5KS2A 2HNKA 1NW8A 4RTMA 2I6GA 4M38A 4P7JA 5HIMA 3PT9A 3FZGA 4YUYA 2BM9A 4ZTBA 5HIIA 5K03A 3HCAA 4X60A 5BW5A 1F38A 3MHTA 3BZBA 3M6UA 3A26A 3CVOA 5DRYA 1NV9A 3DTNA 3HVJA 4DA4A 5FUBA 1JQDA 1O54A 1DUSA 3M4XA 3MQ2A 3KR1A 4MTLA 3SSOA 1KYWA 4HG2A 2OXTA 3BGVA 4RVHA 3HVIA 3HNRA 3QOXA 3SM3A 1FBNA 5EZQA 3S68A 1SG9A 2YR0A 3EVCA 4P7GA 3BWMA 4XUDA 5GP1A 3TKAA 4E31A 3BT7A 3FUTA 2HTEA 1VPTA 3DOUA 5U4XA 5EMMA 4AZTA 1YF3A 4DM3A 3ANXA 4O29A 4PYQA 1NV8A 4KVZA 2P3OA 2G8NA 4OA8A 2YUIA 1VP3A 1JSXA 2PLWA 1HMYA 2NXCA 4FSDA 4FS8A 3C6MA 3ME5A 4BLVA 3KQSA 5LQAA 3G8BA 2NP7A 3PLAE 4PGGA 1VP9A 2H1RA 3LKDA 5FCDA 2G72A 4A6EA 1VQ1A 3PX3A 3E05A 1AQJA 5EKXA 5HEKA 3TQSA 4LECA 3NDJA 3L8DA 5E2AA 3RIEA 3UJ7A 2PT9A 3R24A 3E8SA 2XVAA 2XYRA 4HGZA 3KQTA 4PIMA 4E32A 3K6RA 3T0IA 1JQ3A 4RX1A 2EX4A 2Y1XA 3ERCA 2R6ZA 3IV6A 3R3HA 5EHGA 2ZZNA 3HCFA 4E70A 3F4KA 1JR4A 2ZBPA 5K0NA 3AJDA 3CGGA 4AUKA 2JHCA 1I4WA 1RJEA 3MCTA 5E2BA 4HTFB 5CCBA 3B3JA 3DH0A 1NW7A 5CVVA 4GC9A 5E1DA 3FUWA 4DCMA 3BWYA 2HMYB 3GCZA 3O7WA 2NNWB 4QQKA 3NDIA 4PIPA 2P3LA 3DR5A 3OU2A 3OZRA 2FK7A 1ZKDA 5D1NA 3P9CA 3LGAA 4KDRA 4YUZA 5FA8A 4R05A 3THSA 2EJTA 4X41A 1AV6A 1DCTA 2LD4A 1WXWA 4FP9A 3EVAA 5DSTA 3NVMB 1NKVA 3A4TA 1BKYA 5BXYA 5DM2A 4PYJA 1SKMA 1XJ5A 3SX0A 3KR0A 1RI4A 2Q41A 4PCLA 5H02A 4WVLA 5E9QA 5EZSA 2IH5A 3E7PA 3OFKA 4V0RA 3NWBA 2ESRA 3I58A 3OZSA 3U81A 3DXZA 2PWPA 2PXAA 5T6BA 1G55A 4HGYA 1QAQA 4QVKA 4EK9A 3KPWA 3HTXA 5DXJA 5DWQA 1ZG3A 2PJDA 3G7UA 3NVKI 3R9XB 1ZGAA 5G02A 5KVAA 4GC5A 2PKWA 5K0GA 4RVFA 3KQVA 3LBYA 5F2NA 5DM4A 5DX1A 3SSMA 3PFHA 4XCXA 3O4FA 4LG1A 3P9IA 4DQ0A 4Y30A 2G1PA 2CMGA 2NP6A 4C05A 1WY7A 5EC8A 5LSAA 3ER9A 4PYMA 4X61A 5KYGA 1QYRA 4QTTB 3GXOA 3NMUF 3NTVA 2QE6A 1XDZA 2ZZMA 1ORHA 2CMHA 1ZGJA 4IV8A 4PYIA 1D2GA 4FZVA 2GS9A 2V7EA 3CJTA 3UJBA 3UBTA 4ER7A 3GRRA 5BP7A 4QDJA 4E2XA 2QRVA 2QRVB 3DXXA 1G8SA 2VP3A 3CBGA 9MHTA 1BHJA 4PONA 2FK8A 2PXCA 2WA2A 3FUXA 3HM2A 5DTQA 3GNLA 2ZULA 3T7RA 3A7EA 4C03A 2YQZA 2A14A 3BKWA 4UOEA 1KR5A 1XCLA 3AWIA 3M33A 3Q87B 2PV0A 5FWAA 2Z6QA 4RYLA 4RTJA 5HFJA 4R8RA 3TM5A 3X0DA 5ICGA 4BLWA 4ER0A 4DKJA 3FPGA 2PX2A 4QQNA 1EJ0A 4M37A 4E2WA 1O9HA 5E1BA 3UJ6A 2UZ4A 5GINE 3AY0A 4U7PB 1XDUA 4YV2A 4RV9A 1RI5A 4RTLA 5DSXA 5FHRA 1VIDA 3B3FA 1TW3A 3EVBA 3BUSA 3C3PA 3KQMA 3PVCA 4YMHA 1F3LA 2ZFUA 2FCAA 3G5TA 3DULA 5DT2A 4Y2HA 2YXDA 1U2ZA 2C7PA 3PFGA 4GEKA 3BWBA 1IM8A 1I1NA 1N7JA 4PYNA 1SUIA 3OU7A 5ERGB 1MHTA 1XDSA 5K0LA 1R00A 3BGIA 1H1DA 4QPNA 4P58A 5HZMA 3A7DA 1SQGA 5E9WA 1XVAA 4ISCA 1JG4A 2WK1A 3C3YA 2EG5A 3I64A 3TPZA 5LR6A 5FULA 1YZ3A 5C0OE 4R8SA 3WSTA 4HC4A 4FR0A 3SXJA 2AOWA 2OKCA 2V74B 4KIGA 2UYQA 2OBFA 3UJ9A 5HILA 5DPMA 1YUBA 2QY6A 3MTEA 1NW3A 1NBHA 2HV9A 2JH9A 2PT6A 3IHTA 4QPPA 3HP7A 1N2XA 2EJUA 2ZBRA 5EQJB 2VDUE 4XUCA 5ICFA 3TOSA 4RTRA 3HEMA 1INLA 1FPQA 4HRAA 3G88A 3CC8A 1FP1D 1VE3A 3M6WA 4PWYA 2I7CA 3ELUA 1P91A 3FTDA 1QANA 2NXNA 3I5UA 3M6XA 4K6MA 5EEGA 5DM1A 1JTFA 2AN3A 1BC5A 3KQYA 2P1DA 3P2EA 4ATNA 5E1MA 5GM1A 4GUAA 1DL5A 4XUEA 4YUXA 3FUVA 3G2QA 2PVCA 2ZIGA 4F85A 2JH8A 5CVJA 4BP1A 4CKBA 3LPMA 5C9ZA 5K0JA 2AR0A 5E9JA 1VL5A 5CIYA 1RI3A 3MCZA 2O06A 3CJQA 3OFJA 5DRTA 3TR6A 3LCCA 4QDKA 3TKYA 1VLMA 3PB3A 4AZSA 3HA3A 4CXMA 1PRYA 5EOVA 1AQIA 1EIZA 2P40A 4E2ZA 2AOUB 1AF7A 2BZGA 5CUQA 3GDHA 5C1IA 2C7RA 4CKEA 3ELWA 3M70A 4GOND 3G5LA 2AOXA 4PYLA 5P8WA 4AX8A 1UIRA 3EVFA 1JSZA 5HIJA 3UJCA 3CJRA 1XXLA 2YXEA 3FYCA 4BP3A 1G60A 3LDUA 3KQQA 4GQBA 3KKZA 4IKPA 1P39A 3GU3A 1RJDA 5LQUA 5GOZA 2C7OA 1SUSA 3B5IA 4E33A 3EVZA 3D2LA 1I9GA 3TMAA 3A27A 2B25A 3KPUA 3CKKA 5FQNA 2BH2A 4E2YA 4YUVA 4C07A 1TPYA 2XBMA 1TW2A 4GF5A 3JWGA 2IBSA 4RTSA 4MHTA 3REOA 3T7SA 5DTMA 3BWCA 3MTIA 3FUUA 5LQCA 2ZIEA 1JG3A 4GBED 4IWNA 3RODA 3EGEA 5GM2A 3GO4A 4X1OA 1G8AA 3PTAA 1G38A 3MB5A 4FT2A 1T43A 2AOTA 3SGLA 5D1HA 2P41A 1WZNA 2JHPA 2O07A 4R6WA 5CCXA 1R8XA 3EVGA 5F2OA 2XVMA 5HOQA 5KQRA 3FPHA 1NBIA 5EMLA 4DZRA 3HCCA 1QAOA 3LX6A 2K4MA 2PSSA 10MHA 2ONZA 3HCDA 3G2OA 2H00A 3DMFA 5GIOE 2H11A 1P1CA 2GA9A 2UYHA 2C7QA 5MHTA 2GB4A 2Z6AA 2ONYA 3UA3A 5JR3A 1KPHA 2IP2A 1WS6A 5CVUA 1QZZA 5EMJA 2AN5A 2Z6UA 5EIWA 3ELDA 4RVDA 1Y8CA 1KPGA 4HTFA 5ICEA 1M6EX 3VYWA 2ZVJA 2R3SA 4AZVA 3K0BA
chains in the Genus database with same CATH superfamily
3GLSA 3GRFA 4JT4A 2CHEA 4R3UC 3A4YA 4IX9A 3I2GA 3HS3A 3TJMA 4B4KA 2JHAA 3R3VA 3RO7A 3ZW9A 3GCXA 2FNAA 4HXFB 1C3VA 1A4RA 2WILA 1BA3A 5REQA 821PA 2JLQA 3D6MA 1MB3A 5DYIA 3RS7A 4N5HX 4OBEA 4KXNA 3KU1A 4QSMA 4PVDA 1WLSA 4V0QA 3RNLA 3D6FA 3AJEA 1DV1A 1GGEA 4CW7A 3KYDB 5B1SA 2IHVA 4HS9A 4LDZA 4KR3A 3WGHA 1MDFA 5AXBA 5KTKA 1E92A 2X4DA 1T5BA 2FR8A 3I73A 4FE4A 5JDIC 1SB8A 4F12A 3LCUA 4DCSA 5AVUA 5K09A 2A0KA 3ZR4B 4FFLA 4Q03A 1OLUA 1XCBA 2RGUA 1R6AA 1ZAYA 2DQSA 5I4IA 3VR5H 1FSSA 2XODA 4LRUA 1XZNA 4UE2A 2QD3A 4EB3A 1NM5A 3KEOA 1SEPA 4KQJA 2ZW9A 1AO3A 3A1CA 3TE7A 1NE2A 2P9FA 1XNJA 2PZAA 1XFDA 4NG5A 2DFKB 2Q0HA 1Q74A 3T1QA 4I6GA 5EGSA 5JYBA 3GWGA 2H54A 1XP8A 3IEXA 4N41A 4UHCA 1JDUA 1JKFA 2VG8A 4HJXA 3RM3A 2JLWA 4DR4B 1A97A 3PEEA 3RIYA 5HJEA 1XTUA 5KWJA 4J0HA 2EP7A 2DHEA 3V7FA 2J9FB 5HQ3B 4BNXA 4RXMA 3K15A 3LFTA 2IXEA 5E6UA 1U7XA 2NTJA 4AZ3A 5EJ5A 1ZVVA 3FPFA 2P75A 4OHBA 2QAJA 5SY4A 2G3YA 1CJMA 1N9GA 4EKGA 1RQ2A 2HLPA 3GAFA 3TVDA 1PVOA 4OXXA 3OHPA 3AT1A 2QXTA 5DNUA 2BMEA 2CXQA 3OG9A 1BDBA 4FSXA 4G1EB 4MLDA 3VSAA 2EGUA 4V0LA 5DU2A 4G2NA 2PZLA 1CJKC 1YONA 1QIGA 4ZYLA 5CLIA 5AUQA 1S2DA 3ES9A 1K2WA 3N59A 1KOGA 4RSRA 3WGKA 2W2LD 3KKQA 2A8YA 4EMUA 1P5RA 3A1NA 5J3JA 3OFVA 4QPDA 3PR3A 2ZWAA 4ND6A 2J59A 4JT9A 4MS4B 4QUJA 5K0TA 5IEBA 3W9SA 4H15A 2OC9A 4IGEA 1QIKA 4EELA 4Z9YA 4F96A 3N5CA 4JJAA 1OCEA 1U9YA 2GEVA 3L5OA 5JVDB 4UU1A 1ZNXA 5G2OA 4DYHA 1A82A 3N3AC 5C31A 1EK6A 3ZKWB 1QQ7A 1GT6A 2DY0A 3VDQA 3Q3HA 2C4HA 1NFRA 1IDOA 3NWJA 3NLLA 5F1OA 3NOOA 3ULKA 3GGPA 5G0TA 1PJTA 2QRLA 3GEEA 4A16A 3OX4A 4PSKA 3QVMA 3NG1A 1UBOS 3SP1A 3TPCA 2ONKA 2DGDA 5CP8A 4AMYA 4AIRA 5I3CA 4JC5A 1XLWA 4FDUA 2DSTA 4OB6A 5I4KA 1T8UA 1Y8AA 5CDYA 1M2WA 3L1KA 4N18A 4JI2B 4RVNA 4EY3A 1RLUA 1KO8A 3OZTA 1FU7A 2B1RA 3H1AA 4LQLA 4BNIA 1UQUA 1OAOC 1S7CA 5ARCA 3GNTA 1VXOA 4LZJA 1A5ZA 3JD0A 1UFRA 2GXAA 4MEAA 2WU1A 2IV3A 4JI0B 4PPQA 3H9EO 4CGZA 2GZRA 3N0XA 3A6EA 4FYVA 4HGOA 2VAMA 3JS5A 5F52A 1T9DA 1Q83A 4L02A 3MMNA 4PBSA 4RTOA 3AW9A 2P27A 2Z3ZA 1FRFS 3F67A 3QRWA 1N2IA 1PJ8A 2Q6IA 1ZVQA 1I6MA 1JLKA 1WV1A 2B8WA 5AVVA 5CB4A 1J42A 1Z22A 2HZ7A 3UWDA 3AEQA 1JZQA 4DM4A 4X97A 2I1QA 4M1QA 2R86A 5LN1A 1P3DA 1L3IA 1E3MA 4PPNA 5SZKB 3W1EA 4KKVA 3HCBA 2NAFA 3NONA 3QOFA 5ALMA 1A5BB 2FWRA 1I7LA 4M86A 1P5JA 4UUNA 3ICQB 1RKBA 3VQTA 1QYVA 3A25A 1LZLA 2JGDB 4FEAA 4F5YA 2LKDA 3PEYA 2Z3VA 1EU1A 1NDQA 3C7KA 2VH5R 1YS4A 1L3BA 4WSOA 2HREA 1D1SA 1GU0A 4R2LA 4LOLA 1POXA 1C30A 1ZH2A 3FD8A 1XCJA 1NQOA 5AVSA 4A8JC 1SA0B 2M9MA 3KJIA 4KN8A 1F0KA 3I1JA 4KWCA 1NVWQ 2VJCA 1CRQA 2ZWIA 3PWTA 1PYDA 4DM7A 5BQXA 1Q16A 3EEFA 4JLJA 1FP7A 4Y7DA 5AVYA 2CUKA 3JQ8B 3T12A 2FEPA 2IDJA 2VDQB 2KE5A 4KJXA 3EGWA 1VLZA 4LYGA 2HJGA 1LLQA 4L2IA 5JHHB 4GG1A 1TCUA 3KE8A 1E58A 1KJYA 1GG2A 1WZCA 5C80A 4NBUA 1UT8A 4NYJQ 1AZLA 1Z82A 4ALMA 3EFEA 2Y1CA 1JECA 2VDWB 3GJ4A 4H16A 4OQLA 3ZXSA 2CFOA 2P5SA 2H1LA 3REGA 1LRJA 1QHXA 1DBRA 1S3FA 1Z07A 3G6KA 3I04A 4WLVA 3TGWA 4UPEA 2MSCB 2GCNA 4QDZA 5L3ZA 5BSKA 5GVSA 2QRMA 2HM7A 5LQJA 1PFUA 2WJJA 2BSAA 3AEZA 1KHTA 3P8ZA 2Q6TA 3OESA 1FJGB 3LBFA 3LW7A 1HZJA 1WG8A 5DW0A 3OQJA 2YWEA 4JLVA 2BTEA 1Z16A 3PDCA 4JMPA 4YA6A 5E2IA 2V54A 3OPQA 4WBXC 3UJNA 4OUDB 3OH8A 4HX9A 2FGKA 1C41A 2IGBA 5KS2A 3UN1A 2QQGA 1XPRA 3QXGA 4RIFA 1NZJA 4RENA 3IUQA 3VJKA 2V3WA 2Q5HA 3FZGA 3NBQA 3OC6A 3IP7A 3OX3A 4KMRA 4COKA 4YUYA 2OLJA 3N5KA 3V1TC 1Q0QA 5LP6B 2WF5A 4TOIA 4OREX 2Z08A 2B4QA 2I2BA 3IFSA 3ZWWA 4MWDA 3WLNA 1QGAA 1OGYA 4FINA 4HNAA 4DRXA 1E0DA 3DNPA 5TMEA 2GJAA 4LSWA 1QGOA 2JARA 5FTNA 3Q6NA 5HFNA 3MWYW 4C2AA 5AIBA 5HS4A 3U3KA 5GVRA 4ALIA 1FBNA 3M6AA 1IQRA 1SG9A 2FV8A 4XUDA 1C3XA 3TKAA 1PWYE 4CKWA 1IZZA 2QTAA 3FUTA 3FB1A 3QK7A 1EP2B 2C9OA 2MSEB 1DV2A 1V16B 2Y6UA 4MX8A 5LKRA 2XA9A 1CHNA 1I4EB 1A2BA 1W4ZA 3L0IB 4LPKA 4OGGA 4AJ4A 5B5SA 3R5SA 3CX6A 4OA8A 3IEKA 2WAYA 3OA0A 4FSDA 4MVYA 3ZE8A 2GHRA 5KOJA 3A1WA 2G36A 3ZLBA 1E60A 4KREA 5L3SB 4PGGA 1VP9A 3FPCA 3T3OA 4ESEA 3L4SO 4EG4A 2ZR0A 3TQSA 1ENYA 3G2IA 3PWSA 3ZE9A 5LYJF 5HGJA 1TYCA 2ECQA 3NS7A 2VYFA 2PL9A 4U3JB 3R24A 1P31A 2XVAA 2XYRA 2TMGA 4GNRA 4PIMA 5DMXA 3VAZA 1EUYA 3T0IA 2QZ9A 1PNQA 4JLNA 2Y1XA 4HVAA 1M75A 1QV9A 3IV6A 4Q15A 4QRDA 2DJIA 5F1YA 1TJYA 2PZ8A 2QV0A 2ZBPA 1RWPA 2FZ5A 2HJ9A 2II6A 1OXUA 2A5LA 3AJDA 4P54A 3L4JA 1FOEB 1JLLB 3DW3X 3AKEA 4TT3D 1H6AA 3F4LA 1KH3A 1SCNE 4DLYA 3ZHVA 3OO1A 2PZMA 4EB6A 3U62A 2RIPA 2BUBA 3DR5A 3KBBA 2R4TA 3R9KA 2WYWA 4UAUA 3QVJA 1M6VB 5AKGA 1LPMA 2HJWA 2IEBA 3N2KA 3R3WA 4G0UA 4RDCA 1BS1A 1NN3A 1SWWA 2COUA 1Z4JA 4AKEA 3OZ7A 4IDEA 3JAWA 1ORWA 3DQPA 5F33A 3FKSD 2FG6C 4HPJB 1DKPA 1BFDA 1OREA 1TO6A 3DOFA 3CLRD 4KI0A 4M7WA 3V1NA 4YXFA 1E9EA 1X7GA 3CYFA 1XJ5A 2COEA 2QDXA 1UCFA 3LWZA 1WV0A 2YWCA 2IHJA 2X3FA 1FFBA 1MIOA 3CF4G 4ZV4A 3SFZA 1VE9A 3HXLA 1XMXA 4RD3A 2O2YA 1EBUA 1G3QA 3K94A 3NNSA 3RVMA 3U81A 2WF9A 1TA0A 5FUVA 1QTRA 2PXAA 2Q5CA 3AR6A 4KRFA 3V4LA 1CDOA 4O4LB 3GP5A 4WNAB 1NG9A 2CXUA 4RORA 1GHTA 1T9KA 1ZGAA 4HH0A 5G02A 4MVJD 3EULA 4GC5A 1QU3A 2R62A 4ND4A 2EX0A 3DVQX 3IB3A 4ZODA 4O4IB 4RQUA 3MK31 2P77A 3ZHXA 2I7DA 1II0A 4EYSA 1QDUA 3ESCA 1JWAB 2J87A 2I4TA 2QLLA 1RLJA 1ZRMA 3F4BA 4TWZA 4F1KA 5HRCA 4I4CA 4NAVA 4JLMA 3EGDB 3K6SA 4NY1A 3QEMB 1DFHA 3RK1A 4OGWA 3CG0A 2O19A 2QE6A 2QD4A 5IC6A 5CA0B 3W7AA 3DV0B 4IF6A 4PQEA 4FWIB 3OX1A 2AK3A 4FZVA 4C6HA 4B4VA 3OJCA 2W0SA 5D5QA 4KITB 4HSEA 5AI6A 3GLVA 3CLTC 4QWMA 1UXJA 4QDJA 1G41A 3QX7A 1Z0SA 1KVTA 4Q9HA 5BWOA 1W36C 3D64A 1CZRA 4REMA 1KQ3A 4XKJA 1TFUA 5ILOA 2A14A 1Z39A 1YR6A 3BKWA 5AI8A 4DV2B 2XNHA 4D3ZA 3U4DA 1CS0B 1TK9A 1YQXA 4OSEA 1QLWA 3G49A 1U8YA 3PIDA 4H35A 1VMEA 2G6BA 4LE2A 1VE5A 4IP0A 4LHZA 1H6BA 1N5RA 3L05A 3F7OA 5JYEA 4H6WA 4QU8A 4R2IA 2XQFA 3UJ6A 4BO0A 1QUFA 2B94A 2J6BA 1IRXA 1PD0A 1UM8A 4C87A 1QYIA 4BFCA 2BTQA 2ZUBA 2VSFA 5KCMA 1GV0A 3IHKA 3P4UA 3P4XA 4ID9A 3K70D 2QTWB 4B5KA 1RFGE 1ODKA 4WUVA 5B1HA 1EZ1A 2AE1A 3HO8A 3HNOA 1O6GA 2FEXA 2FVXA 3F8TA 3NH6A 4NOMA 4CR6A 3RNOA 2WWYA 5NLLA 3ZHZA 3C14C 4UHFA 2IOYA 3FAZA 1GSAA 3SZLA 4EQ6A 4PRKA 4WASA 3PG5A 1Z6QA 2H08A 2WTUA 2HSEA 4DRZA 1U2GC 1TKAA 3I1IA 4AKSA 4J4TA 2QSJA 4BN5A 3V42A 4I08A 5CGQB 1WB4A 4QYTA 4ENWA 4ZN6A 4CKCB 5KSWB 4LRQA 3U5ZB 4AKGA 3JX9A 2FH5B 5JAIA 1ETHA 3GAZA 4E5NA 1D4FA 2P5TB 1P4GA 3Q7QA 5HILA 4C0XA 2F00A 4YRPA 1NF3A 2PAFA 2YY7A 2AG8A 3BL5A 3UUGA 1NU8A 2YFHA 1JVBA 3IP3A 1NJ8A 2NPOA 4RTRA 3G2JA 3MGBA 2OV3A 3OT1A 2G1PA 2CYBA 2Y4NA 2J0UB 1QANA 3CF6R 3QUQA 2ZSEA 2XB8A 2ZP1A 1YDFA 4TS3A 1P3JA 3KTAA 1H8ED 4QU5A 3USCS 2R11A 3FUVA 1RCFA 1WDMA 1OOEA 2OO5A 4BO4A 1V4BA 3TLKA 4CHTA 1NC3A 1V45E 3FVTA 4HDRB 1PU2A 3ESYA 3AR4A 4CKBA 2P6NA 4U1RA 4PZZA 1OJ7A 1N34B 1Z26A 5E9JA 1SHZA 2B92A 3UM9A 4BGUA 5DRTA 2HHCA 2F59A 3AW8A 3UHPA 1GUBA 4AZSA 5EJEA 1NATA 2CWDA 3LLCA 3RRFA 2X5OA 3E7XA 4E1AA 4CXMA 1EIZA 1KK3A 1JMYA 2AOUB 2X8LA 3MAAC 4RPHA 3GDHA 5TX7A 3LHKA 4QG7A 3G9XA 2LDBA 3EH1A 4OHXA 2AOXA 2ZM5A 1Q7TA 4JITA 1JDTA 1US8A 3D6VA 4PZEA 4K9NA 4D2IA 1XXLA 2YXEA 5FEUA 1TFRA 4K8OA 1B3RA 1VHTA 3DKRA 1EVEA 3GJZA 4RACA 4TTJA 4HRXA 2JJ1A 3KKZA 2NUTA 4OF4A 3RAGA 1LNSA 3JZIA 1WVMA 1U9CA 2V4UA 1TQ2A 3EVZA 5IDYA 3TMAA 3IKJA 5JY6A 2IYPA 3NYWA 3Q3EA 3LUCA 1AXEA 4R3WA 1IVNA 2YH2A 4HF7A 4OX9B 1TW2A 5DE3A 1O96A 3IA7A 4RGQA 3KSDO 2DQYA 5JQGB 4URUR 4K6CA 4YPFA 3REOA 3W34A 2Q3EA 4MHTA 4K46A 4C0QC 1JDPA 2ZRJA 5K7SA 3W5BA 1HNZB 4XM1A 2NM0A 3FCOA 3N8IA 1IMJA 1KEWA 1U3VA 4IG4A 3GO4A 1P75A 4TS9A 1AXGA 3PTAA 3ACCA 1KORA 3U7QB 1HQYE 2G9VA 4DMUB 3B2NA 1G9SA 2E82A 2HD4A 1T5IA 5JMPA 4CIWA 1D7OA 5JY1A 4MINA 5CH5A 3C15C 4RQBA 4MIOA 1QFSA 4EB0A 1PFVA 1J4AA 3G17A 4FMPA 5AJZA 3W3ZB 4DARA 5G4LA 2VAVA 3EFOA 2P4UA 3G2OA 4MW7A 1XSEA 3OOJA 4FCWA 2GA9A 1GNPA 2JHFA 1L5VA 5GJVC 5EMJA 2RE8A 3TG8A 4MQEB 2DAPA 2ZSKA 3ECAA 3WJ7A 4MA4A 5DTEA 2O2CA 2ZYTX 5JATA 2FEKA 4IZHA 3N2IA 3FKSA 4ZT4A 4AZVA 3KJXA 3WZ2A 1JDVA 5CVEA 1Z5VA 4MI1A 2VWQA 3D7RA 4XDZA 3FDJA 4A23A 3ISVA 3KZMA 3P4YA 4MJ7A 4WXRA 1J8YF 1PT9A 1QHIA 2X2OA 1XHEA 5I9NA 4ZQHA 4C4OA 4HN4B 2O0LA 4Z49A 2FG7C 2W2QA 2D0PB 1U99A 1ZD4A 3YASA 2ATCA 4G67A 4PC2A 4DTCA 1Z3IX 3I5XA 1WU8A 5HK9A 2RHHA 4KX3A 4QOHA 5ED0A 3L8FA 2C5FA 1DX9A 4I7EA 3IQZA 3TQCA 5TV2A 3BSYA 4IQ0A 1GGJA 1SCJA 1SJ9A 5C1OA 3DXYA 1R0LA 3DMHA 1NE7A 2XGOA 3EB9A 4FXOA 4OJTA 1GRCA 5EE5B 3ZQKA 3ONWA 1F4LA 4F8EA 1ZX1A 2VSNA 5BWCA 2IOHA 1FUEA 2JKZA 2JIZD 2H65A 1ZW1A 1Y3CE 2YVKA 4RHCA 1ORRA 4LRTB 1M6VA 3T4XA 1F14A 1QQAA 4OFZA 4R84A 3H84A 4RSHA 4YCLA 3GXBA 1X1SA 4PC3A 3E2PA 4IM7A 4G9BA 5A3JA 1SH7A 1YZHA 1YA8A 4GXQA 2J3LA 4BGDA 3TH5A 1CEQA 5LNK1 3KXLA 3RVBA 3AUUA 3PNOA 2JGDA 2WDPA 3OD5A 2ZXEA 4INAA 5D7NA 3GVIA 3LOPA 1ESEA 2MINA 4HB3A 2PT7A 5JDIA 1TKBA 4QODA 4PYOA 5IWCA 4M3NA 3B51X 4PO8A 2B2NA 5EJ2A 3NJRA 4CEJB 2WPDD 1DTSA 4CKZA 4BFVA 3JAWB 4N0DA 1UKZA 3ILVA 3PXDA 4Z51A 3B1YA 4PNEA 2JLXA 3DS8A 1Y82A 3H42B 4R1UA 1PFKA 1JTEA 3B89A 3LPAA 5AHRA 4JUIA 2MCFA 1ISMA 3RUIA 1NW5A 1JIIA 1KDRA 4L0DA 5FAXA 2QUHA 4W5TA 3PFFA 1YB6A 4LTDA 2P2LA 1EWTA 3F71A 1XZJA 3U37A 4AMUA 4GDFA 5D7BA 1SHUX 2Z8ZA 1L4UA 3T1OA 4JJ7A 5CITA 1FU8A 3QVOA 4DLUA 5A4IS 5TQ2A 1SRRA 3UWMA 2WJ6A 3B3AA 5B1EA 1UQTA 2FFBA 2VFAA 1UFQA 2VDWA 3HUDA 1XU7A 1UP7A 3F2VA 4LZNA 3P9KA 4PHGA 3ZY5A 5KHLB 2EJCA 5JZ9A 1DKOA 2R9VA 3BSFA 4CF4A 3UK1A 1IN7A 3KL2A 1ZHFA 4P83A 6GPBA 1E6MA 1C14A 2B5VA 3PEWA 3NNDA 4J4HA 1TZMA 2B9EA 3F6BX 3MWEA 4C0SA 2PKEA 3LZ6A 5EMKA 3AL0C 1L7MA 3MIIA 2XIQA 4ZOLA 5I9LA 2CYAA 1OKKD 4P5DA 5KNCH 3QE9Y 1V8BA 4EHJA 3NC4A 2EQ5A 2FG5A 2H31A 4JI7B 4DCJA 3SSAA 3QF4B 3LPDA 2BZ1A 2H4HA 2Z5LA 4PLGA 1PKXA 2AL7A 4V0OA 3BTSA 4TV8B 2I1VB 3T3HA 1KEPA 3KSUA 7GPBA 3HB5X 4F5WA 1MXFA 3N1UA 3JVDA 1RVDA 1RQRA 4HCJA 2XWBF 2IOFK 5FHQA 3W6OA 1TO1E 4EF5A 3B7PA 3N86A 3QX3A 2XCTB 3GBVA 1D5WA 3E5NA 2NZWA 2Z3WA 3NHSA 3PIRA 1GYPA 1IXRC 3C8HA 3PL1A 1BGXT 3V4PB 3ZK7A 4BE4A 2G63A 3BWVA 1YBFA 1Z34A 3KLBA 4HNAB 4UHDA 2DBVO 1L5ZA 4EFLA 3D6TB 3WYNA 2XUHA 1EP1B 4P36A 4HDAA 1IOWA 3RK4A 2F9LA 3OZAA 3CRQA 2BMVA 3D6AA 3CUEF 3EQ7A 1SK9A 3IT1A 2JATA 4Z99A 3WNZA 2UUCB 2XDAA 1JH8A 1KDOA 4JUBA 2ZBFA 1PHPA 4J0CA 3W4IA 1R7RA 3EXEA 4Q16A 2P30A 2VEOA 5JSZA 2WFLB 1R64A 2A4MA 3M4ZA 3R77A 1O2DA 1MA3A 13PKA 2OCBA 4K9LA 4MV9A 1NULA 5FORA 1GSOA 2EL7A 4EJ0A 4I66A 4Z54A 3KQLA 4B82A 1JR2A 6REQB 2HR1A 1F12A 1FS5A 1ODSA 1V95A 2FQQA 2I1LA 2DP4E 2NLOA 4U2DA 1I13A 2AQIA 3EIWA 3HL4A 4O5AA 2JGJA 4WACA 3STWA 3TJZA 3TRKA 4WAUA 2Q5QA 1ZP6A 1EGHA 3QEAZ 4KB5A 3ZDZB 1JL3A 3V33A 3CLUD 3F8WA 2OG1A 2ZROA 5DISB 4H08A 4RTPA 1JEJA 4WINA 1EE2A 1M66A 5CMLA 5H5JA 1QK5A 1UBUS 3T7EA 3AF1A 3TSCA 4F5EA 4OUKX 5KDDA 3U4GA 2Z6VA 1SBHA 3O31A 4BFTA 3OJLA 2XMPA 3RYFB 3WRWA 3CWZA 2I65A 5AW8A 2FW1A 3A11A 1QPBA 5HBRA 1PCXA 1QCYA 2BFDA 3WK6A 2HX1A 4PZDA 1E9BA 3AK4A 3OCZA 4RLHA 5A2QA 3OE7A 4Z2YA 3KYCA 4Z8XA 3CURA 3DAYA 1G1AA 1VXRA 3URMA 3AHIA 3W79A 1X1QA 2H8KA 2JIRA 3UWSA 5J9FA 3SVZA 3K70B 2P6RA 3W3AH 2AOUA 2H1VA 2V59A 1BFUA 3CM0A 2AE2A 1GQYA 2I33A 1V5WA 1NY5A 2A86A 2PBFA 3X1ZA 1YQGA 2CVPA 2MU1A 3CX4A 3LCMA 1DJOA 4C7KA 3HYCA 3E9QA 3GRZA 1YRLA 3DOCA 4WZBE 2QN6A 3RREA 4K28A 3LX5A 3MSXA 4CM8B 5ES3A 3FYHA 1P80A 4OHVA 3ZDYB 3M6MD 5FFMA 5KTOA 3ZZUA 3L2OB 4YGXB 4DLSA 3EIQA 3T3IA 1HNNA 1TUIA 4UC0A 5EHZA 4KUHA 3U3XA 3IKVA 3GLHB 3CIFA 4KXUA 1E8DA 4QJBA 4XFDA 3MUNA 2FKNA 5SV2A 1F51E 1VKNA 2D5BA 5FXMA 1A72A 2O8DA 2CVHA 3SJCA 2JCXA 1OLUB 4JKIA 5GTDA 3LOQA 4RMNA 3Q88A 5A6SB 3KV1A 2K2QB 4TLAA 4Y67A 5SYNA 2PL5A 2EU8A 4YMWA 4L0QA 4E22A 2Y1EA 4J0FA 1PG5A 4C20A 1FS6A 1VE6A 1LJUA 3L0YA 2NVWA 3FHOA 5ADHA 3G23A 3KKEA 4HG2A 3OIGA 5BYBA 3FSJX 4DLXA 3VO8A 2UVPA 4YUAA 4AJJA 5EZQA 4D3DA 3R4VA 1L4FA 4FX5A 4HFJA 2XCLA 3OOHA 1EXVA 1SB9A 1EB9A 4QXRA 5DEOA 1UMDA 4KSCA 3I42A 2MR6A 4UXHA 1ZRHA 1XZIA 3LRTA 3TOVA 2A7XA 2HIMA 1D04A 4L95C 4CKXA 4C2UA 4JBGA 3DE7X 2IZ0A 1RYNA 3WDSA 3I45A 2WR8A 3ZNQA 2MYPA 2PKQO 2ODQA 1PAUA 1ZNZA 2Q45A 1PK8A 3UKOA 1OVGA 2W8BB 1I3CA 1T10A 5CAEB 1E1RD 1BMQA 1H22A 1XF1A 1Z29A 2D2XA 2W2LA 2ZPUA 4Y9TA 3ZHCA 1W75A 4C0JA 3DZDA 1D03A 2VDNB 2GILA 2X2FA 2JL1A 3ODGA 1MRZA 2ZYHA 4BBAA 4RSGA 4DCCA 3UAXA 3D7KA 3L6UA 1NURA 3I8OA 4FOSA 4L8VA 4BMZA 4O1MA 3LYHA 3ZLJA 2AC7A 4IDFA 5HQJA 1L7DA 3I5YA 3PDIB 2LXNA 5JYCA 1GQRA 3FVQA 3MPOA 2YFKA 2Y76A 1I4WA 1RJEA 1KFBB 4MQEA 1GTVA 4UUPA 3IJ5A 4KYUA 2XH8A 3ENZA 3PFNA 3A9WA 1VIVA 3ZKWA 3QYFA 5K3BA 5EJ8A 5FX2A 3JQDA 2P3LA 3O2JA 1CUAA 4NABA 4Z7QB 3MC1A 3DBRB 3GN2A 1G5PA 2TMDA 4C7XA 3QA3E 2VLBA 3T99A 4PLYA 5HOEA 2JS7A 1WLYA 3FG9A 1FFXA 4J1NA 4ARCA 5F7OA 1XCPA 1CQJB 3NVMB 5A3QA 3A4TA 3GEDA 3PUYA 2NNLD 2HL6A 4R81A 4ZI7B 2R66A 1E3QA 4HNQA 3JAKA 5FUXA 4IFTA 4AG5A 5DHTA 4EHBA 3MAJA 3JD1A 1GDTA 2ZUUA 3GFGA 4QECA 2CHQA 1JPJA 1MC1A 1NI4B 2ID7A 2IBMA 1PJSA 4WNCA 3T9FA 2O2DA 1QAQA 3AVOA 4HQ0A 4WJZA 3PQ3A 1BKDR 1CEXA 4US0R 3TO5A 2PJDA 2ATIA 5IC5A 2VP6A 1EHCA 3PDIA 2H1SA 4WVFA 2ZVDA 2PL3A 3H1PA 5F2NA 4D80A 1CE8A 2QT1A 2LZ0A 3OLVA 1XZEA 4LBVA 2BDTA 4H2DA 1HQCA 2CMGA 3GP8A 1C81A 3FOWA 2D7JA 4I55B 5DGTA 1A4XA 1QHGA 1WAMA 4WKBA 1HZZA 5DP1A 5EC8A 5COQA 3UV6A 4LF5B 4XYMA 2XGGA 2FZWA 3DVLA 3ND7A 3X1JA 4QXPA 8OHMA 1E6WA 1I1HA 2V0GA 2CMHA 2YV5A 3A8TA 3DHYA 1X94A 2EW8A 2GS9A 2VP2A 2W8ZA 3LA8A 3ZGLA 4CMEA 1NKSA 2FPIA 3NBUA 3W4KA 1IQ0A 2V0CA 5BN4B 1VYVA 1RZRA 2G5PA 5DOZA 4E2XA 4LC0A 3UQYS 5J58A 4B4DA 2JFPA 4NC9A 1T3SA 4C3UA 4MPPA 2X86A 5DW3A 5D3MB 5T7BA 1XCMA 3F7TA 4M0UA 3VU8A 3T7RA 1ULSA 1Y7IA 5BWMA 2PZFA 1ABBA 2ZATA 1P5HA 3C5WP 2CHVA 3A3NA 2O9JA 4F8JA 1HT0A 2F1JA 1MAAA 3AEKA 3Q1KA 4RYLA 4B7CA 3OY2A 2XDYA 1II9A 1MGPA 3B1JA 4FB5A 5LJLA 3RUEA 4A9AA 3BORA 2J6HA 2BL4A 4HHEA 3MUOA 4ZYWA 4HYQA 3OJFA 4UBLA 5J2UF 1GPDG 3DW1X 4QOGA 1X7WB 4J0EA 1RHQA 2DWCA 3MJHA 4YT4A 4XGIA 5I51A 1XDUA 3B13B 5I7WA 1RI5A 2XNKA 2PHZA 2YWJA 5FHRA 4BQRA 5CA1B 3B3FA 4RVCA 5JS1A 1URPA 2Q9BA 3BAZA 5E6SA 2G4LA 1T9BA 1Y42X 2CE7A 4UMDA 1EDBA 4YI5A 1AGXA 1RLOA 2A1UB 1Y81A 1OZHA 5ALNA 4AUNA 5CNJA 2BMJA 4BQEA 2C7PA 5IJAA 4WLFA 4MP6A 1J24A 4CMJA 4DIKA 1LC3A 1PS9A 1Q6YA 1R00A 1R4AA 1RPNA 1N3IA 2V3VA 1VSBA 3NHRA 4JDPA 2I67A 4QPNA 1R66A 4D3FA 1AKRA 4D57A 1YR7A 4TTRA 3R5KA 3JPWA 4JYPA 3SLKA 3WIDA 2OSVA 3N8GA 4BKPA 1DWQA 2ZE6A 4CMCA 3RUPA 1Z2EA 2VQEB 4DBLC 2E4WA 4JNCA 3W2IA 3EPKA 3A9RA 2QY6A 3EXHA 1NW3A 3TDNA 1AMNA 3V1LA 1TXGA 3DKPA 2VIIA 1GTZA 1ADBA 3ZWMA 4KGZA 4BIIA 2DR2A 2CHUA 1KI8A 2W6CX 3UVEA 5SY9A 2WC1A 1MJHA 3LK7A 1QO0A 2Z5GA 3Q40A 4ZO9A 2BFDB 4IJQA 2PCLA 4F3KA 4Z7JA 2P9GA 4XOIA 1Q7GA 2QMZA 4ARZA 1ZA2A 1GGFA 2H92A 1LV7A 3RABA 3UHAA 2IS4A 1ONSA 4NNOA 4RHXA 2PMCA 4DC0A 1CZUA 3KVVA 1ZHHA 3H87A 2WV7A 4NG4A 3PGLA 2XQJA 3H9BA 4TZKA 3KKOA 4EKDA 2OCKA 4JI4B 1JMKC 3SX4A 4D3XA 4CM7A 4Q7KA 5B4VA 5JZVA 2VXCA 2LPMA 1UAAA 4E5YA 1FQOA 3HYLA 1ADJA 4EVSA 1EUCB 1IPHA 3V8QA 4X94A 4BLQA 4C0WA 4DPLA 5KWIA 1F9EA 1PZHA 3GCWA 1E2KA 5HG0A 3FYCA 1LZKA 1DADA 3BFXA 4NTZA 3DZIA 3KKKA 5EJ9A 3GFBA 2X77A 1H9CA 1F2UB 3ZDRA 3E84A 1I9GA 2BFAA 2QQEA 3PFBA 3U0BA 2I0FA 2OV6A 1QORA 2HMTA 3MLBA 1YRHA 1L5NA 3U7EB 1M5TA 1VL8A 1E6UA 1IRIA 3GEBA 4J0QA 3ROTA 3S7TA 3QZUA 2B4AA 2F3UA 2J9FA 4KQKA 4MV0A 2HPAA 3T5GA 3C98A 2HWXA 1LVHA 2YZKA 4IPTA 1AHNA 3STUA 1M34B 4M0MA 2ZIEA 4WWHA 2FRDC 2ZJ8A 2HXYA 3L92A 1DQRA 2M32A 5JQGA 3G0OA 3R3ZA 1G38A 3G8DA 3S2ZA 1BYUA 3SGLA 3RTGA 1KK1A 3CLVA 5HOQA 4EPXA 5AICA 2C1XA 4B71A 1YDGA 3IMCA 4G09A 4Y6QA 5BR8B 4BBJA 5F9HA 5J4HA 1UBKS 2QPAA 1K8YB 4MB2A 5F1PA 4RMIA 1AGYA 2FXVA 3GF4A 2NZ8A 2ORYA 1VG8A 2ET6A 2XUQA 3NAZA 3QE3A 4CLXA 2Z6AA 4MS4A 3IMGA 4D9FA 4ZOLB 4P82A 1X77A 2I22A 3AV0B 5FFNA 1CUDA 1VFNA 4D45A 4LRYA 1YZUA 2GM5A 3EOAI 1UKBA 4GKBA 2P90A 2FUG6 1F8FA 3GCGA 5CG1A 3DTVA 3EJWA 1G7SA 2BM1A 1WUKS 3KYJB 5CA0F 3DGEC 1GPKA 1NRWA 2D54A 1ML3A 1XJ0A 5EHXA 4M22A 1WZEA 4F60A 1QH8B 4HN9A 2PX5A 2E89A 4Z6KA 3KZOA 2L42A 3GVXA 4UEOA 1NNI1 3ECCA 4HB2A 4HH1A 4DG8A 1EH5A 4MYCA 2QAGC 4QGBA 2E5WA 2P91A 3CNLA 5DNEA 1K6JA 4BO7A 4BVFA 2QIOA 1PQ4A 2R1ZA 1T2DA 5A0TA 2OCAA 1YS7A 1TD9A 2P2GA 3WP1B 1LQTA 1MCZA 5KOYA 3EGXB 3TLGA 3WKCA 1GG8A 3DT8A 3RYIB 1VE7A 5FKJA 1IZ8A 2B7LA 2BD0A 4GOJA 3AR9A 3SIRA 5ALVA 4B85A 3FOAA 1XU4A 1X1BA 4IKEA 1OWOA 4NOLA 4KDFA 2PKXA 1ULAA 4XIGS 1PJRA 2FAXA 2ODPA 1OWLA 1TCVA 2RHJA 3LECA 1SC1A 1JHDA 3GUYA 1KYQA 1MLDA 2F6RA 2WLTA 3ABOB 3OEYA 1RMTA 4IS2A 4FNGA 5HR5A 2EKZA 4XYEA 5K4GA 2DC1A 3MELA 2ZRAA 2D0IA 4AWXA 4C2TA 5EVJA 3HXTA 2EFCB 4DEXA 1L7VC 5AK4A 4BZXA 3JWIA 3CB4A 3ZWDA 2NZVG 4O8CA 4OFWA 3EXFB 1IATA 3RD5A 2I8CA 2X6QA 4Y2YA 1S9HA 3DPIA 3KB8A 3WK4A 5AW3A 4ZEXA 1ORIA 3OUUA 1NMYA 4MK4A 3FNEA 3ICWA 2FZKA 4XWYA 3KEGA 3LKBA 1SU6A 4F71A 1WXFA 3KJNA 1PL0A 3KOZA 1SMKA 1V39A 5F5NA 3K0KA 3AR5A 5ECWA 3EX7C 1Y48E 2BFOA 4MV7A 3KFVA 1SFRA 3O4JA 3I8SA 3F46A 4JROA 4OP1A 1J8QA 3V7YA 9ATCA 1U4SA 2IU6A 4RQAA 4X7BA 4UD2A 2PD4A 3A70A 5IVPA 1B23P 5D2CA 4M9ZA 5LYJB 1KARA 2FPKA 2HEGA 2KQUA 4UZEA 4WV3A 5KYWA 1QPZA 3DM9B 4XGNA 4LF7B 3B8EA 4Q1BA 1N0HA 2IF2A 4OATA 4W1RA 2YHBA 3P9SA 3ZCVA 1ZH8A 4FFVA 1U2SA 2RC6A 1X86B 2XT0A 2HWYA 3TG2A 2DQZA 2E0IA 3CPHA 3HRKA 4BBPA 4A92A 3OEED 1K66A 3AVVA 2B9VA 4BPBA 5J40A 1BXGB 3VBCA 3ZG6A 2OZVA 1K68A 3JD4A 3TLBA 1J20A 4XLZA 4X7RA 1GZ3A 1P18A 1HEUA 3HUFA 1YFJA 1Z0UA 2F48A 3P2MA 4JP3A 2WF7A 5ALDA 2FRDA 4Q3DA 2WAOA 4P7FA 1RIIA 4LTMA 3RC3A 1SOVA 2ZYIA 4RKFA 3QNWA 1SBCA 3HYRA 3IT0A 1WHSA 3FWYA 4B9AA 2CKDA 3TAXA 1N2EA 3HA7A 1VA4A 1VSVA 2AW5A 4E4YA 4OX9Y 4TSFA 5GJBA 1XD2B 2JGMA 1DRJA 4P4TA 4BX0A 3SM9A 3C8UA 2C9BA 3OQ1A 1VCIA 3UEOA 3D3JA 1KY5A 4J2TA 2QRNA 3F78A 4UDNA 2SNIE 1Z68A 5DBFA 1GZHB 1BHSA 1XZHA 2ZBDA 3V3TA 3VZBA 5H4GA 2X0DA 4H7EA 2WSMA 4QLOA 4L15A 2JZOA 3I52A 1UBTS 4R1NA 2Z8XA 1FNCA 1NWHA 2QU8A 4WZAA 2QGFA 1ZIYA 2V7QD 3AM4A 1EE9A 1KO5A 3DHVA 3M1AA 3NC0C 4UBKA 3ST7A 1FJ2A 3BT7A 2UUPA 4ZYTA 5T5QA 6CHYA 1V6SA 2HTFA 5I01A 3TCXB 4FE3A 3I2YX 3BB3A 5IT9A 3ONFA 1XWIA 4LJAA 3B1FA 5HTOA 3GD5A 1EYZA 4HPWA 4Q1VA 1NBAA 4LXXA 1M2VA 3GRVA 1MG0A 3A1EA 2ZSDA 4ENUA 1D7AA 1NW4A 4XIJA 4ZVMA 1JRLA 3BXEA 3GAMA 1DC6A 1Y3AA 1EM8A 1JG7A 1Q0PA 2JI8A 4DVJA 3ETNA 4BTEA 5DNYB 1U0GA 4LBWA 2QVZX 4HFRA 2K7ZA 3IURA 2ZLBA 4HDOB 1H66A 3MMPA 3SDSA 2AGVA 3E9MA 1Z17A 3FYDA 4GX0A 2BWJA 4MMXB 2ZSHA 3DXFA 1UJNA 2SKCA 4YBZA 5KKAA 3FJ1A 1MENA 3ZC3A 3DBRA 2G4VA 2J48A 2O2ZA 1VRWA 1U6IA 2VHEA 3WGYA 4BFSA 4UMVA 3ZV5A 3U3ZA 5I5EA 2JZNA 3WGOA 3U3MA 5EKTA 1AHHA 2FPLA 5IG2A 3JU3A 2W83A 3GVCA 3SF0A 5DX8A 4PS1A 3TZQA 4BNFA 4C04A 3IEPA 3KYBA 4G65A 2AS0A 3W8DA 5DB4A 1ID8A 2G82A 4DQUA 4NNJA 5IJ0B 2Z2YA 2VZEA 2Q5LA 3EDCA 4RKEA 1N1GA 1E4YA 2XUFA 5DX0A 3B3GA 2GCOB 2RHGB 3TW8B 5HTKA 2CLDX 3OJ0A 2A92A 4UM7A 2ZJ6A 5IMBA 2AVNA 3WOHA 1YJCA 3DOJA 3K0AA 5EIFA 4IXWA 4CM9A 3T94A 4ZVLA 4ZI3A 5KI6A 3MERA 1PT6A 1ZCBA 1WCV1 5AUOB 1V43A 3E8XA 4OP2A 3RTCA 1W52X 1BDJA 3TFOA 1RQXA 1IZ0A 3UMVA 4DC1A 3C4JA 2W22A 3KSAC 1B0ZA 1MQ9A 1K27A 3I61A 5ECYA 1BRMA 3NHFA 4MV1A 4TRMA 1FNMA 1MDBA 3HA2A 1NHGA 3B1KA 4R2XA 1DBIA 3HGTA 1PL7A 2PO7A 3CVOA 1KEKA 1UJMA 2PQMA 1MJGA 3BF7A 1TYDE 1CVLA 1VGVA 3DO5A 5FPSA 3SG0A 1DO2A 5DCYA 2JCVA 2OXTA 1E77A 5H59A 5C7YA 5G1NA 1QX4A 1U31A 4FHCA 4OJMX 2V96A 2B3DA 4RLSA 5HCUA 2XOEA 1D8AA 5HWSA 4FX2A 1G8JA 3PXXA 4ZT3A 2YS7A 5CJPA 1VLVA 1P0IA 2WT8A 1LC0A 2JLRA 3N6XA 5I8ZA 4W5NA 3DEAA 1IEWA 3KQSA 1BH6A 3TZKA 5E7JA 1K92A 3UUEA 4A6EA 1IXSB 4TKZA 4A26A 1K7SN 5T3YA 3RI3A 2XVXA 4MAFA 3ZV4A 1I4LD 1FDWA 2ZRMA 5LBUA 3O6VA 4BNGA 4C29A 2QN2A 4JEIA 3D8SA 3IDFA 5TR9A 2AWOA 4ZU3A 2BKVA 2WV9A 2RKBA 3BA6A 1KFJB 4R16A 4W7SA 1U2EA 3KU4A 4HDKB 4YIHA 1SC4A 2QAGA 4WQMA 4H60A 1ST3A 1Z7GA 2X9QA 3E58A 1GO2A 4EZEA 2PRIA 3LY5A 2IPAB 3T38A 5G3YA 3SS7X 2OFWA 4G01B 4AUKA 4AY4A 5FWXA 5ADUS 5CYOA 1CC1S 4ZJZA 3CTPA 2RG7A 3OAAD 5BQ3A 1AD2A 2NADA 2YJ6A 4MH0R 5CVVA 1KOLA 3FUWA 1IYZA 3BCHA 3M2PA 3WG9A 5JRZA 4MWBA 4AP5A 3FHLA 4UTOA 4TYMA 1Q3TA 4XSGA 3N8KA 1NC1A 5HJ5A 2M2IA 3NGXA 4RF4A 1X7DA 4RZXA 1EFAA 3K2IA 5A4KA 1YGYA 3WLKX 4QEKA 1AURA 3JRWA 3NJ8A 1BHQ1 5AIAA 3CKLA 1JEEA 1LDMA 4XFJA 1P9WA 2VJYA 3EWIA 3H9UA 1C2YA 4OD0A 3JALA 4ONEA 3MUFA 2BRUA 1MBZA 4H6PA 1EFLA 4C76A 1XE3A 3DTYA 4ZVOA 1W88A 3KD2A 1CPYA 1BXRB 1DWPA 2C5BA 1P73A 5B1YA 3ZBTA 3DLTA 2B36A 5AVXA 1GUFA 3E7PA 3OFKA 3PC7A 4NJMB 1TTQB 1UBFA 2WZBA 4YT2A 3OZSA 3I3SR 2JIZA 4Q4HB 4UNRA 5PNTA 2PBRA 1NI3A 1HQKA 3Q8XB 5CVTA 3KWJA 3CEHA 2FSPA 1B41A 2R1UA 3WYBA 5K0GA 4H1UA 1RXCA 5JAOA 2GZHA 4OHPA 1FYFA 2HBYA 3BWXA 4DPMA 1L6RA 1UWLA 2DPXA 3BK7A 2AJ8A 1DRKA 1UJCA 1QH1A 2YASA 3B8HA 3JYNA 3KV3O 3MF4A 4JGBA 4UAJA 1HYQA 4YFYA 5TDHA 1QE3A 3G0GA 4ZXFA 5HSGA 4Y9UA 2G06A 2HSJA 3P9ZA 2QOEA 2RHTA 1TZ2A 4OQQA 3O8BA 2XHZA 2OCDA 2IZ7A 3K72B 1Y1RA 1VSUA 5A3RA 2O54A 4OLAA 4PYIA 4QU9A 5DDIP 3FNGA 3WBFA 4KSBA 4DIDA 4YX9A 2YXNA 4TMFA 3UBTA 1JYFA 2W2PA 3O3CA 5BYKA 2B6NA 2Z2JA 3DXXA 1BXRA 2CF6A 2QKYA 4CG3A 4OXQA 1XTBA 1HG1A 1BHJA 2QP9X 5DTQA 3R6GA 4LGMA 5INTA 1G21B 3DZJA 5DI9A 4G5HA 4HNRA 1XVUA 4V2UA 1ZIXA 1FMTA 4F6RB 3AWIA 2NU6B 4AU1A 1EVLA 2EZ4A 2PV0A 2HUNA 2BHRA 4G5YA 1NIJA 3BDVA 4ER0A 1HE3A 3O8OB 4HDNB 4Z3KA 2PX2A 3U4QA 2Q0SA 4Q1FA 1KMNA 3ZWXA 3MT7A 1KVUA 1LK7A 1II8B 3T52A 5GADl 2AR7A 4G1MB 2C97A 1MQ8B 2OO7A 2GBIA 2W8BA 2CXHA 4LVOA 3NIFB 4MQ6A 4JLPA 4EF6A 2CBGA 1QH1B 1MO5A 1WVGA 3PVCA 4ZT6A 3F1KA 1U80A 2KS6A 3VYSB 5HUQA 4MLCA 4NK4A 4HQ6A 1QGED 3OSUA 3RGGA 4C1BA 2GF2A 3VHXA 5C8VA 1KVRA 3NTRA 4IIXA 1I1NA 4GE0A 1RYDA 3IULA 3A2LA 5ERGB 3OZBA 2L18A 5AT1A 3T4UA 2XAUA 3BGIA 3MS7A 2VWGA 3SEQA 3TS1A 4OK3A 4P58A 5IP5A 1BROA 1JWBB 3I2JA 4UTPA 1NUUA 5A0VA 2VUIB 4F2GA 2O3TA 3R5HA 4JJIA 5FULA 1Y1QA 5E7IA 1G21A 1KAGA 2C8JA 3GK3A 3S2FA 3OZFA 2CCGA 4IWYA 3A4MA 1J2RA 5F51A 3R76A 1YUBA 4DJFC 4MZXA 1NBHA 4JYMA 5CT4A 4DQKA 3ICEA 2PT6A 1IY8A 3H99A 4G5XA 2HI0A 4NULA 4Q7JB 2X9LA 1MEJA 4PZLA 4ZZ0A 1A98A 2WUFA 4NBTA 1RXIA 2BW0A 4NFHA 5ICFA 3RVJA 3QSGA 2IP4A 3IPXA 4MDFA 2WTAA 3E7FA 4FNAA 2PD3A 3IPLA 2I2AA 2WVJA 3D3NA 3ICVA 3JAKB 3L7NA 4P38A 1VHDA 4DBVO 1AQNA 2P1DA 1E5XA 2AX4A 2VTVA 3GP3A 3L7AA 3NXSA 4NAHA 3UKDA 3ZHTA 4CDRA 1D2MA 1DL5A 1WZUA 2RAPA 2WHEA 4MA5A 1U7OA 1NVFA 2GBFA 3EGXA 4CQLA 1FIUA 2ZTMA 1W9MA 4D4LA 1KI4A 2PRZA 4X8HA 3VDRA 2ZJ0A 4KK4A 2IKQA 2XJ4A 1KIMA 3RVPA 5CIYA 3HJAA 1RDFA 3DMDA 2F8TA 2B7BA 1TECE 2HHJA 2M6RA 2IHUA 3IPCA 4MUBA 4JLDA 3SX2A 4C78A 3QXCA 4Q4LA 2BE7A 1J33A 5EOVA 3R7SA 4ME6A 4E2ZA 1L4BA 1Z6TA 3F90A 1WP4A 4IJUA 3W5SA 1UT6A 3C6ZA 1UIRA 3COZA 4XSHA 3R8XA 3TFQA 1KYVA 3WX0A 5JBNA 3GRCA 2ZKIA 2OP0A 1G60A 4N0MA 4N0QA 2FN4A 1A1SA 4HATA 1L4HA 4KNVA 3W8NA 4YR9A 3GEMA 3CRVA 4TKUA 3W1VA 3ZCTA 4WKPA 2PQ0A 2XB6A 1IBSA 2AIRA 3CZ4A 3MS4A 2WZCA 3KCNA 5C5EA 5LKAA 5C18A 3ROXA 2ZRCA 4RK1A 3FXAA 3ASYA 3CY6A 3F7NA 3FPAA 3OVMA 3I2HA 3OF5A 1NXPA 3B7WA 4ZD6A 4CMIB 2H5EA 1XX6A 4TKLA 1W9HA 2CW5A 2ZRFA 3KUDA 4K3UA 4F1JA 3HXPA 4Q1DA 1Q3HA 2IUEA 4MO2A 3TLXA 4E5MA 4H18A 4YJ3B 2I66A 2QJOA 5AJXA 3RU3A 2Q0XA 4B3HA 5KVCA 3ZJTA 4J07A 3D5QA 2YC2C 1A2QA 1V41E 2JHPA 5KQRA 4BV3A 3TL2A 4IHAA 1CY1A 1I7NA 1KJ8A 5CXUA 4KFSA 1O0BA 2PSSA 1FX1A 4O2BA 4LISA 3DDNA 4HKTA 2PR2A 2MDTA 1QHHB 4A0GA 1XPJA 2GB4A 2ZWOA 4FC6A 3UA3A 1KZGB 2JAQA 3J80A 1NL3A 2GZ1A 1KEEB 4NCAA 4AW9A 3I05A 3T0GA 3NBFA 2VHZA 4DMCA 4UMFA 4JVLA 2R3SA 3RYCA 1X7XA 1TK2A 5JAMA 1TQ4A 3NATA 4EG8A 3IEIA 2IPOA 4B3CA 1NBWB 4KBYA 3PA8A 2QW8A 4BGEA 2P2SA 4DNFA 1SOMA 4MR8B 2HHHB 2QX7A 4DG9A 2H1WA 2BR5A 4DYVA 2BM8A 1ISHA 4CR7A 4F5ZA 3VJLA 2JLCA 2DPHA 2PMBA 2PR7A 2NU9B 3EGOA 3K4PA 1XAGA 2DR3A 4CQMB 2RFLA 1G18A 2IELA 4GI2A 3ZIUA 3K9LA 1U5AA 3TWOA 5E4FA 2GBPA 3U9TA 1GZVA 4L3VA 4FOTA 3P19A 5KU7A 3TUJC 1T9GR 3T8YA 3EMDA 4WGFA 4OP3A 2F3QA 4IIGA 5AM1A 1U0NA 5TPZD 4BAUA 3F97A 3HUUA 5FYDA 1APBA 3KR9A 2VBIA 1EIWA 3VRHA 2EKQA 1QNLA 3FNHA 3MSCA 3MTBA 4IDPA 3PYXA 3W5UA 5A4AA 1XB2A 2CLOB 3KZNA 4CDGA 1A5SB 3ZWAA 4NFSA 3TLJA 4E94A 3MG9A 4CM6A 5CB4F 2A7QA 2PH1A 1ISJA 3UTCA 2V6MA 2IS1A 4YRMA 2GVZC 3D8TA 3IE0A 4EMSA 3B6EA 3VKGA 1GPYA 4WKOA 4ZVSA 4KQCA 2EDAA 4DLRA 2X40A 4YRGA 4KXYA 2VO1A 4UNPA 1RRCA 3I5MA 2H6EA 1FB5A 1SHJA 2MMCA 3T3EA 3F6EX 3MRXA 1GPAA 4MMYB 3WIUA 5HK8A 5AXDA 4R1PA 3OIUA 4AYTA 4TN5A 1K2VN 1D2HA 2GO7A 3IBSA 2PGLA 4NPCA 5EZYB 2XA1A 4U9UA 3L77A 4E5VA 4DXAA 2CB9A 2XOKD 4DHWA 1XGKA 3Q5EA 1DMSA 2R7AA 2FMFA 3JZDA 4G6ZA 3UTDA 1QG2A 3AI2A 1AMOA 5HRUA 3KM0A 4DDUA 1OT3A 1W2HA 3FRHA 1HEIA 1L5RA 1BD3A 3OLYA 4WK4B 3EISA 3H86A 1EFCA 2RHRA 3HO6A 2WHRA 3JWPA 3DMGA 3IAUA 4BQPA 5MFPA 5B2ZA 2B69A 1OYOA 1YH3A 5ALRA 4RPKA 1JEQB 1U98A 2ZYDA 2W6ZA 4N03A 1O9GA 2AFHA 4P08A 4YLGA 4B7UA 1CDDA 4AY6A 2ZBVA 3LVFO 3H7IA 5FBKA 3UB4A 5JEDA 2WJIA 3VU3A 1XL0A 4E09A 1JZSA 3OCUA 5I7EA 2JLSA 4JVOA 3A3KA 2V9CA 3MGCA 2JFOA 4YP5A 2C9CA 3C3JA 4G0ZA 4GQIA 2J9XB 2Z57A 3OTGA 4H17A 4HH3C 4W1PA 3R7AA 2I3BA 4P3XA 5HKBA 2CNLA 3OIYA 1MJ5A 3D9QX 1BE8A 4NCJA 3U1BA 3LA6A 1JAXA 4YRBA 4ZMRA 3PHGA 4LVUA 2FP4B 1E5DA 3MCUA 5D3KA 1ZCAA 1KI9A 5TVKA 2RGNC 1W59A 2G83A 1UDAA 3L4BA 2XCOA 4GL2A 1FF9A 2IXAA 1U1DA 4O4LF 5AJVB 2D4AA 3D4NA 3WI7A 3VR5A 2XYVA 1LV8A 4PZYA 5EE0A 3AUSA 2IV2X 1CUIA 2CXXA 2ZRPA 4LWZA 4Q3KA 2QYSA 2BUCA 3DD1A 5FV7A 1F3OA 1ULZA 1HM5A 1ZY2A 4GD3Q 3NWPA 4QGGA 4DNPA 4E30A 2C2XA 4HQLA 4LVCA 4HXEB 8ADHA 5IXYA 2PUHA 2QMOA 3LT1A 5BMVA 4O1IA 1TEVA 1GFWA 3MCWA 4JP2A 1E1YA 4DR5B 1ABEA 2YYAA 4JC8A 3DVRX 1NSFA 8AT1A 4WY8A 2OAP1 2UXDB 1A8IA 1RJGA 1RTKA 2P5YA 2ORWA 4RKWA 3RVSA 1XRLA 1R15A 1GA4A 4MUXA 4OOEA 1GL7A 1XZ8A 1CYEA 2DUWA 2EWVA 2GTPA 3QKSB 1NQAO 1OFTA 1NW6A 3Q9SA 1RWVA 2ZTHA 5FRDA 2WIBA 1YE3A 5T8KA 1PDOA 4YP9A 1XZQA 1ZM3A 3WYDA 3ZCRA 1QHFA 4WN9B 3IUSA 1E1NA 4OHRA 3ITKA 4MYSA 2JI7A 2PGXA 5GGXA 1SXJB 4MKGA 4FGUA 2ADMA 3IUYA 4TLCA 5J43A 2O0JA 1UMDB 1U7TA 5ITZB 1EE1A 1P1RA 2VJOA 3GI1A 2AC2A 3A10A 3QVTA 2QIPA 2SCUA 2JD0A 3U09A 1B6RA 4ENTA 2FPOA 3DVAA 1KI3A 3W04A 3OE4A 4YCBA 4B33A 4B6EA 4UOZA 3GRAA 2Q29A 3T1VA 2SECE 3QYJA 1YBMA 5IZCC 5E3JA 3LCRA 3M4JA 2VP5A 4DIBA 7MDHA 4N6NA 2H7XA 4JIGA 2P6MA 2C61A 5JDCC 4OGFA 3WLJA 4C4YA 4A15A 3EZYA 2OCLA 5FBRB 2QD1A 2DPMA 3AINA 5GIPE 3R0VA 1MV8A 2ROQA 3L6BA 4TXLA 1GM5A 1RWOA 2P68A 3BXPA 2A5GA 2GM3A 3KC2A 2NTYC 3THWB 2JAHA 2XY4A 4OHWA 1GZ4A 3PHCA 1EBFA 3CH7A 1KQOA 4E7OA 3F5MA 1E4EB 1IPFA 1WZIA 3G9TA 3ZHUA 3NV9A 1PZEA 4WESA 3H9CA 4YJ2F 3BRQA 1F8XA 3CLSD 3PE4A 4JCOA 4KRGA 1JG1A 2VQ3A 3TQRA 3SYMA 4Z1MD 1T6ZA 4F97A 2Z4TA 2WIJA 1EESA 4MKXA 1Z2PX 1OA1A 2ZI6A 4Q24A 1QKIA 3OQVA 4DLVA 2PLNA 1EXNA 1UUFA 4B47A 1BH2A 1UBJS 1Z88A 2QQ5A 5DNDA 5LZ2A 2AD1A 1AKYA 3STXA 6ABPA 3ANNA 2YZGA 3I04M 1GR0A 1Z2NX 1Z8FA 2IFTA 3UGTA 5FV4A 2JFXA 3WIEA 4DSZA 4MTCA 4CL2A 3GGSA 3MFQA 4Q21A 5LIPA 3IBGA 3RUFA 3VDMA 1I01A 2I3ZA 2OCGA 3DT9A 2HPVA 2J09A 5KJEA 4A91A 4N49A 4WRRA 5GMOA 1YB1A 2PBLA 1R0YA 4FYYA 4O6VA 4DMFA 5B6IA 4KGDA 1HR0B 5KQLA 1FYEA 4Z1MA 2Y99A 1RFLA 4NI5A 3AI7A 1H93A 5KB3A 1OTYA 1B7GO 2A84A 2GN9A 4D9CA 4OHFA 1JQDA 1DUSA 3M4XA 1L9XA 2BVNA 2PGJA 1HG0A 1TLLA 2Q1SA 2Q4TA 3KR1A 2HHLA 3A9CA 5T3UA 1CT9A 1IOZA 3JQPA 3M2TA 4QU0A 1KZ9A 1ZESA 2YR0A 4FJ0A 5I4BA 1JU3A 2I7VA 3COVA 3K20A 4FOPA 4EZIA 5IKXA 3K0SA 3E7DA 3JQ8A 3S2EA 4YMLA 2ZUEA 4NIMA 3MWDB 4DM3A 1G66A 3IHWA 4P93A 3P9YA 3TQFA 4ZHQF 2BFNA 3X2SA 4CV0A 1FFEA 4RABA 4DMHA 1P2DA 1EXWA 4QPCA 1K3FA 1KJNA 2GQ0A 3GLKA 2ZPAA 3N6RA 3PQ8A 2PMFA 4ZIRA 5K8JB 1N5MA 1G17A 1DAOA 1X8LA 2OBLA 3VKWA 3P0IA 3PX3A 5I9IA 4Z4IA 2VYCA 3STTA 4BOYA 4RA9B 4FEGA 3N0WA 1B93A 4CQMA 2UZ1B 2I4RA 3PVSA 3LE8A 2J85A 3DUFA 3O2QB 3VO2A 4LX8A 1QQBA 3E8SA 1ULTA 1TTTA 1GITA 3E9EA 3DTTA 3IAAA 2BOVA 2A1UA 1E2GA 2RGWA 2R6ZA 5JI2E 1B14A 4N76A 3HSYA 3RFXA 4FGKA 1VFPA 1I94B 5F7XA 5LOVF 3A6FA 3MCTA 5E2BA 4YP6A 5JTUA 4HTFB 3B7GA 3B3JA 3JQBA 1WDWB 2ZJZA 4W6ZA 4UVHA 4MIYA 1YFZA 5A71A 3EGCA 1A04A 4PIPA 3O7MA 3VPAA 8ABPA 1GAWA 1V8FA 3M3PA 2XEXA 1Z83A 1WE2A 4BS9A 2BGKA 5A62A 2O7QA 2W71A 3P52A 4NYIQ 3PBKA 3IV7A 4BUZA 1GZUA 3ZWNA 3O21A 3WQRA 2HA5A 3ELBA 3ZVRA 5KHAA 5IYZB 3ILYA 3ZEIA 4GYWA 1W1UA 1SKMA 2WD8A 2QP4A 2WVGA 4MJ3A 2X14A 4Q9KA 1BDHA 2IW1A 1O0SA 1JHXA 1SZJG 1WHSB 2YMMA 3RASA 1XI2A 4L8YA 5EZSA 1ADYA 3GLFB 3WNQA 5JCJD 3C8MA 3KP1A 1Z7EA 2CLSA 1B1AA 1JHYA 2HK6A 2J67A 4N7MA 3FTNA 1Q12A 5EINA 3B3QA 2WJ3A 4AF8A 5P21A 3LNTA 4EPTA 2C4VA 2G0NA 2QVGA 2ZYRA 1XRQA 2FKAA 1W0JD 4DJAA 2CFCA 3IAHA 5BMOA 1BTOA 2I9PA 3U48A 4N7JA 3PFHA 4PPFA 2O2GA 3WV4A 1L5MA 1FTQA 3OTHA 1UFVA 3P0HA 2F67A 4Y30A 2Q8PA 3S27A 1L6IA 1CUBA 4C05A 2I91A 4CLHA 2AJCA 3B1XA 2IY8A 3NZEA 5K4HA 1NMXA 3EZGA 3NP7A 3AG6A 3FX2A 4B0OA 1ORHA 1E1MA 2FZEA 4CZ2A 4TKVA 1W2GA 3ORQA 3TBKA 1FP4A 1S3SA 2ZREA 1H94A 2POQX 4IV8A 3K8ZA 4IXNA 4BIMA 2YRWA 2BTOA 4UE3S 2V7EA 4ALNA 4AK9A 4GE3A 4DXHA 2NMVA 1AGNA 2WUDA 1LNQA 1NQ5A 4G1VA 3U2QA 3BGOS 2JVKA 1KGSA 2QG4A 1GIAA 2J3IA 4R2HA 4RNCA 1JT2A 2QRVB 4ZALA 2JKYA 3R7NA 1F2DA 3MWEB 5B3KA 1U6JA 2EV9A 1QBKC 2Z5FA 4B79A 4O63O 2OM2A 4TYPA 1J00A 3LK6A 4UM9D 2C31A 4HK4A 4N3AA 4N0PA 2DHRA 4L5CA 4W82A 3INTA 3ZNPA 2PM8A 3O9MA 2Z6QA 2FQWA 1L0BA 2ZSJA 7AT1A 2ZRQA 1MVLA 1TAUA 1MFPA 3HCWA 4M37A 3ZZTA 2BF7A 1P61B 1AQYA 3KALA 3RLFA 2V9PA 3C1TA 2XX3A 2N1MA 3JXEA 4TUYB 1E2NA 2GARA 1DG3A 1E64A 1DPFA 3FOBA 4MVJE 2R1TB 3HVUA 5G1OA 1ZQ1A 1JH9A 3R6WA 4Z4FA 2ZFUA 4ZO6A 3SVLA 2GN6A 2GRUA 2YXDA 3ENKA 2UAGA 1WABA 5CURA 1O6BA 4ZKDA 1ST2A 2CL6X 2GWRA 3O73A 3VR4D 1CJVC 2P9HA 1W4AA 4OHMA 3IOBA 3WIBA 1CY2A 1FQJA 2EG5A 2Z83A 1NM5C 1H4SA 5KSOA 3T1HB 5C0OE 2FDCA 4FR0A 3DOIA 1BD4A 1R5BA 5JS6A 3IBCA 5BY2A 1E1QA 3GJRA 8GPBA 1WOYA 3NU1A 4NXNB 2G0TA 4EJ2A 4CR8A 2VPTA 3HP7A 1P2TA 4HPXB 3RHZA 1F5SA 3V3KA 4LF9B 2PUCA 5KYUA 1ENZA 1MABA 4Y1GA 3V97A 3ZE2B 3BRWA 3DWFA 3H0EA 4L73A 3ZDDA 4J0JA 4M1EA 4Y18A 1SN7A 2KMLA 3Q7IA 2O8CB 4TRJA 3GRPA 5DNAA 3OHMA 3FIUA 2MYUA 2R1VA 4Z0PA 1UBHS 4GPEA 1IB6A 1RLMA 4IL5A 2OZPA 3R7DA 1RAIA 3WB1A 2ZIGA 3RS4A 1P19A 4UBOA 5LDHA 3NTOA 1EAYA 1VHJA 5ELMA 3WLSA 2D1TA 4IDNA 1AK1A 1F6WA 3TCKA 1VLMA 1QOZA 2V7XA 4QUKA 1OZ0A 2O8FA 1CP2A 3EDOA 3RVDA 1M7BA 2FSFA 1UXKA 1TF5A 4NCKA 1I3LA 4WLOA 5EYPA 4TMTA 2C2GA 3AVYA 2X7HA 2HFKA 1V25A 1XNHA 4GMXA 5H4HA 4X6LA 1SD1A 4CIYA 1XVLA 4HVLA 5JCOA 1X1RA 2LV8A 2R00A 4X6YA 1A88A 1YCDA 4IKPA 3VNBA 1XQ1A 1IAQA 3QJYA 4Q1EA 3AJ9A 4E33A 1UJBA 5J2TB 1WEHA 2B25A 2PFGA 4L9SA 3LS2A 4AC9A 4D0GA 1OI7A 1BQ4A 1SUEA 2CVFA 1LU9A 1GPJA 1IN4A 1VPVA 4RVUA 4ENVA 1JB9A 2I71A 3ROQA 1IONA 3NVDA 2P4SA 3HLYA 4IO1A 2VHTA 3V4ZA 2XXJA 3X1MA 2RGEA 3PEFA 3OJEA 2IEAA 4YY3B 2R65A 5DTMA 3FSEA 4YDHB 4EG6A 3B60A 4IZOA 3NX4A 2BMWA 1UBCA 4EYKA 3KEMA 3WKDA 1CYDA 2NSLA 3G3EA 3UCFA 4BWYA 5IDWA 7YASA 4RWEA 4LAFA 1VPDA 3AVPA 2O5CA 3RJ5A 2BHTA 3I09A 4WLUA 4YRDA 2BCEA 2H59A 3IRVA 3D4BA 2YZMA 2Y77A 3E7WA 2O07A 1HA3A 3O47A 3CT6A 3BOSA 4IW3B 4PSAA 2V7TA 3FPHA 5J23A 4TZ0A 4EO7A 3HCCA 1P4SA 1RBQA 1X80B 3MD0A 3DC7A 4DQVA 10MHA 3H5AA 1JHMA 3LHFA 4XRGA 3BMOA 2XE7A 4LXUA 5AM5A 3OZIA 4V0SA 1RRKA 3PITA 1WB9A 1WO8A 1RXEA 4KNYA 4J16A 5HF6A 2WINI 4WA7A 5ITSA 2R6AA 3HMQA 3TZBA 4QFCA 2FW8A 1A71A 1F2TA 4LGCA 1UDCA 2W6ID 4DWWA 5EXPA 4OI1A 3UAWA 3K6JA 4B3SB 4LRSB 2MT9A 2NUAB 2UUBB 2XSZA 3G1WA 3S2YA 1A9QA 1BCRB 1NI4A 3IDSA 4I4TF 3EMBA 1IJFA 3MEQA 4UREA 4QM7A 3CX3A 4PICA 1C9DB 4MUKA 3NR2A 4L4UA 2DETA 4E4TA 5IBQA 3OBIA 1UK6A 1A2KC 2DQKA 4ZV7A 1QWOA 2IU4A 1RJWA 2IHYA 4D6XA 3ABRB 3BSSA 2Z9CA 4LJLA 4LKRA 5KSPA 4C4SA 1SC3A 3T35A 2QM3A 1JA0A 1QYWA 1Y9EA 5LA6A 4BRZA 4A2PA 4PRLA 2H3HA 1IQUA 1EWYA 3UJ8A 1B73A 2V6GA 3RFTA 3UOGA 1I7QB 3O5AA 5HP4A 5BW6B 2QNBA 3N87A 4PN3A 3JASA 5GGYA 3KHSA 3TGPA 3HHEA 3FPEA 4IDDA 5L95A 3QU2A 1ZYUA 2D8MA 1ILEA 1Q15A 3G82C 2I2FA 1XBTA 4NJEA 5B3JA 2DWUA 2QHXA 5G0VA 1U8AA 5FJIA 1FDSA 3R3XA 5TT1A 6LDHA 3K9HA 5JZSA 3SZOA 2ZRLA 1P44A 4ZJPA 4J1TA 4GVPA 1EM8B 3EC1A 4BKQA 1OIWA 4K9MA 4BYMA 3L4EA 3SLGA 5C52B 1R2QA 1N2HA 4POOA 3R7WA 1BX1A 4CHGA 4HO1X 3MMZA 4MW1A 1IBLB 1GZSA 1FTGA 3A3PA 2J4CA 4JJGA 2UVQA 4L5BA 4MW6A 4FT4A 3TM4A 3UG7A 1ZJYA 4DQXA 3HB0A 1OBCA 4PN7A 5KNDA 1ZSNA 4V0KA 3CONA 3GT0A 1GAJA 4Y6PA 2ZZKA 3VR6D 3ZV3A 1X9IA 3LYAA 4HAYA 3HU1A 4CETA 4YJHA 1WBJB 4IZ6A 4OBXA 2QLTA 3SYRA 4A2WA 2CV2A 3DAOA 5JC8A 1XAHA 3RHFA 3WZMA 1BU8A 3HVKA 1UINA 3L8GA 1SUWA 3NFRA 4JKYA 1EJ6A 1T35A 3E9YA 2BFBA 2CZQA 4XB6B 4ED9A 5ICCA 5C1DA 1K8QA 4M6WA 1JHUA 3MXTA 4G8DA 3EODA 4IKOA 3ZWVA 4D9GA 1L7NA 2QWXA 3WLOA 5FQOA 2WDZA 5D6NA 5DTRA 1R9JA 3QQ5A 5HX7A 2P0EA 4CTKA 2BFEA 3DONA 1Y7TA 1G7TA 3LC1O 1TMYA 4CTOA 2X7JA 3GDOA 4JKOA 5EIEA 4KVGA 5IHPA 4QL3A 3DCIA 2GFIA 3DG9A 5AKHA 4AX4A 2IYYA 3S2IA 5T4BA 3VZSA 2PY6A 4P22A 3ZJVA 3FHTA 4HWKA 4TYWA 1GL6A 2QMUA 2RHLA 3OTWA 1GNLA 3DKKA 2D2FA 1ODCA 2PS0A 2VZLA 3GX1A 3AY3A 3UXHA 1WSAA 3BFPA 2X23A 1PV2A 3HCNA 2CJXA 4BY9E 3S0JA 3UANA 4RVOA 1R0XA 3CXUA 4AD8A 2QL6A 1KERA 1WUYA 5K0CA 1C9KA 1JU9A 3DZGA 1DIBA 1P0PA 4H31A 4MV4A 4MIEA 2HWKA 1HFKA 4FYWA 1OA0A 2ZS9A 1VMIA 1D8TA 5EKSA 1N2CB 4DV5B 1P74A 1CZOA 1VZ2A 1FFDA 2M6KA 4Y7CA 4KO8A 1WUTA 3FGPA 1TIPA 3I4FA 3RC1A 1ZUNA 2OB2A 2V4ZA 3JRXA 1VMAA 3NHZA 3M83A 3DUWA 4Z7OB 3ZHQA 5KNBD 1DEXA 2G9RA 2FWIA 2ZDHA 2ORIA 3EFHA 3FJOA 4JUFA 2IJGX 3GIDA 1BOOA 1UKVY 3WKEA 1Q1QA 3PQEA 2EAUA 5MDHA 1WNTA 5IEJA 1IZ7A 1H0SA 1PZNA 1YB5A 1F6BA 2FW6A 3LUHA 5SYMA 5TMBA 2ZRGA 3MQFA 1R88A 2D4HA 4BNVA 4Z1OA 2P69A 4FOLA 3A0RB 3LXUX 4X95A 3E53A 3DZ8A 3O4IA 4EF4A 3B5JA 2NO9A 1L8LA 3G2MA 1ZONA 3TIFA 3HKBB 4WEOA 3UT5A 2BEUB 4IFBA 1N2CE 2ZS7A 3NT5A 4V38A 3K0FB 3B82A 4F7WA 4W5HA 2Y27A 2H9AA 3ONDA 3JQFA 2GLTA 2P9JA 3Q11A 4Q82A 4S1TA 2XUKA 3W4JA 5DEIA 3C70A 2ZIXA 3BE8A 1PLJA 4DCVA 1GGMA 5JU6A 1UMCB 2CV0A 3KAQA 1P7CA 3BB1A 1YO6A 1EFRD 1I8TA 3FYUA 1DOAA 1P1BA 2QQ0A 4X0EA 1QP8A 1UAGA 2A88A 2WSSA 1PZXA 4HAXA 4HQKA 4C43A 1FDTA 1KBOA 4JLKA 4B2PA 3E81A 5J4VA 1QRUA 1SK8A 4QULA 1W87A 2SBTA