4U7TB

Crystal structure of dnmt3a-dnmt3l in complex with histone h3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
187
Chain Sequence
FMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGVRVWSNIPAIRSALVSEEELSLLAQNKSSTKLVKNCFLPLREYFKYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (cytosine-5)-methyltransferase 3A
publication title Structural insight into autoinhibition and histone H3-induced activation of DNMT3A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase regulator
total genus 46
structure length 187
sequence length 203
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4u7tB00
2XYVA 1KPHA 5EMKA 3TQSA 4K6MA 4MWZA 3A27A 4KIGA 3P9NA 4CTJA 5F2NA 2ONYA 4EQZA 2AN5A 2GLUA 5DX8A 2CKDA 2OB1A 4AUKA 3SSMA 2P7IA 2PLWA 2QRVA 5GIOE 1QAMA 4BLUA 2CL5A 3ORHA 5D1HA 5DTRA 3BZBA 3REOA 2P1DA 4PCAA 1SQFA 3RIEA 2A14A 2CWWA 2XBMA 4E2YA 4M38A 1JG2A 3UA4A 2PXXA 5DT2A 2QRVB 4PIPA 2G1PA 2ZIFA 3SSNA 1RJEA 2VDWA 4CKEA 4YUZA 5CUQA 4QDJA 4AX8A 3EVAA 4QTTB 3MTEA 3THSA 3G88A 3U81A 1IXKA 2FK7A 1UFKA 1UWVA 2G72A 4PGHA 4C06A 2ZCJA 5P8WA 3LKDA 4KWCA 1HMYA 5EMMA 3M6VA 3UJ7A 3JWGA 4PINA 1G38A 5BP7A 5ICGA 4YV0A 1R6AA 2JG3A 2O57A 3GO4A 4QTUB 3EVZA 4C07A 5DPMA 3LSTA 2IBTA 2UYHA 3QV2A 3UA3A 3TLJA 3RW9A 5FQOA 3PVCA 2Z6AA 3KPJA 3NDIA 5E2AA 2AN3A 3HCDA 2EFJA 1SUIA 4PYKA 4RYLA 2UYQA 2QM3A 2OYRA 5K03A 1JQ3A 2K4MA 3SR4A 4RVHA 5GM1A 3SXJA 2N47A 3WSTA 5GM2A 3O7WA 1RI3A 1ZGAA 5CVEA 3P71T 1V39A 2WA2A 1NBHA 1X19A 5FA8A 2NXEA 2B2CA 1VP3A 1O9HA 3CKKA 3GXOA 3TMAA 5EZQA 1D2HA 4HTFA 4ISCA 4E2WA 3OZRA 5F2OA 3P9CA 3NVKI 3P2EA 4LECA 2ZZMA 3A25A 2ZWAA 5T6BA 5BXYA 5LQRA 2EJUA 3FRHA 4PNEA 4RVDA 3TM4A 2JHAA 5DX0A 2IBSA 3GCZA 4ER3A 1AQIA 1VQ1A 3ER8A 4PIMA 1L3IA 4OBWA 4QQNA 3X0DA 4XCXA 5EKUA 5CCXA 5H02A 3P9KA 5DM0A 1P1CA 4IV8A 1JSZA 4RX1A 3TPZA 2B78A 2H1RA 5DXAA 3NW9A 1X1DA 1D2GA 2PXCA 4KDRA 1JR4A 3KQYA 3LL7A 2GB4A 1NW6A 4O29A 4OA5A 5G02A 2HR1A 3DXZA 4E2XA 5C9ZA 3EEYA 5CVJA 1R8YA 1KHHA 2ZBQA 3KQQA 3FPFA 3DR5A 2QY6A 3KQSA 1SVUA 4V0RA 3FPHA 3UJ6A 5DSXA 2I6GA 1NBIA 2GS9A 2ZFUA 3B3FA 3EMDA 1NV8A 1ORHA 3VC2A 4AZWA 1RI4A 1AQJA 3THRA 3CJQA 3GRRA 2GAFA 1QANA 3OU6A 3ERCA 5DWQA 3KPVA 3I5UA 3F4KA 1EQAA 3HCEA 3R0QA 3TKYA 3LDGA 1SKMA 3HVHA 1N7IA 3OE4A 2QE6A 3G2MA 3DXYA 4BP3A 1O54A 3DMHA 3KQPA 3Q87B 3UJDA 3UJBA 1I1NA 4GOMD 2O0LA 3BUSA 5EPEA 3DLIA 2QYOA 1WXXA 4OA8A 2ZIEA 3EVCA 4RTKA 3ID6C 1FPQA 1VBFA 3CGGA 3DULA 3GNLA 3GWZA 1YB2A 2VDVE 1X1CA 5ICEA 3MGGA 2PSSA 4FSDA 1M6EX 3FTFA 3UWPA 2NNWB 4DQ0A 2G71A 4FS8A 5FADA 5CCBA 3P2IA 2BZGA 2PBFA 4R6WA 1YZ3A 3UZUA 2XVMA 3OFKA 4PCLA 5EC8A 5C1IA 4AZTA 2JHPA 4DZRA 5ICFA 3DH0A 3NWBA 4FP9A 3ANXA 3BGDA 1U2ZA 2BM8A 1WZNA 3SM3A 3H2BA 2AOUB 3OZTA 4M37A 1NW3A 1FP1D 3GRYA 2PKWA 4FGZA 4LWPA 2NP6A 3IYLW 4P7KA 2UYCA 2OBFA 5FTWA 2XYQA 3UFBA 5K8VA 5EHIA 2PXAA 3DLCA 5B1SA 2PJDA 4HRAA 2G8NA 4RWZA 3CCFA 1JQEA 3TOSA 3B89A 1XDZA 2YX1A 2PY6A 7MHTA 1QYRA 3T0IA 3TFWA 3PFGA 3PTAA 1G55A 2HTEA 1RJGA 1H1DA 3KHKA 2AOTB 1QAOA 4MIKA 3UJ8A 1Z3CA 4F86A 4PYQA 1Q0TA 1RJFA 4RTNA 4V0QA 3A7EA 3O4FA 4GOOD 5CVUA 1KR5A 3P2KA 2AZTA 2ZLBA 4NECA 4DA4A 3HP7A 2B3TA 4EMSA 1YF3A 3KPUA 5K01A 3LBYA 2ESRA 4M36A 3HM2A 3CC8A 1KXZA 1G60A 2P3LA 3G8BA 3EVDA 3KR1A 5DLYA 2YTZA 2IH5A 2H11A 1YUBA 3UJCA 1ZHFA 3T7TA 2AOXA 2Y1WA 4U7TB 3VYWA 4UOEA 3D2LA 4GEKA 2O07A 2OKCA 4QDKA 3V97A 1L3CA 1QZZA 1BC5A 5CIYA 2AR0A 2R3SA 3M6WA 1FJXA 3C6KA 3T7RA 2IH2A 1KP9A 5DRTA 3SX0A 1ZKDA 1BHJA 3FPEA 3DMGA 5M5BA 3JWIA 2I62A 1X1BA 3LHDA 3K6RA 3LX6A 4X61A 5HOQA 3BGIA 3KKZA 5MHTA 5IH3A 3BT7A 3HCCA 4R8SA 2ERCA 2OPBA 1XCLA 1ZQ9A 1EJ0A 3A26A 3HNRA 4GBED 5BW4A 5K0NA 1JTFA 3FUTA 4CXMA 3PFHA 3DP7A 4XUEA 1G6Q1 3LDUA 3KR0A 1XTPA 5KVAA 4YUXA 1MHTA 5K0LA 3FRIA 3G2OA 4GOND 5JUWA 2P3OA 3DXXA 2DULA 3CVOA 5C0OE 4ER5A 1TW2A 2R6ZA 5KS2A 1R18A 2AVDA 4FT2A 3LCVB 2E5WA 4QPNA 4BLWA 2ZZNA 2Z6QA 1NW7A 2HMYB 4RVFA 2I7CA 5DM2A 1XCJA 1EAMA 5ERGB 2I9KA 3KU1A 3G5LA 1WXWA 4IWNA 4C4AA 4R8RA 5EVJA 1JTEA 2ZZKA 3LPMA 3CJRA 2NXJA 5T67A 3R24A 2VZ9A 4E30A 4E31A 5EEGA 4DCMA 1XDSA 3FPGA 5K0CA 3C3YA 3DOUA 1M0EA 2PWPA 3UBTA 1NT2A 2NYUA 5LQAA 5GINE 4KDCA 3MCTA 5EIFA 3M33A 5HIKA 1N2XA 3OCJA 4PONA 3TM5A 4HGZA 5CVDA 2YQZA 3ELDA 3AXTA 3ELYA 5FHQA 3T7SA 3TRKA 1P91A 3A7DA 4YMGA 3C6MA 4KIFA 1YZHA 3C0KA 5EHGA 2ZBRA 3PT9A 4Z2YA 2WA1A 2ORED 2HWKA 2DPMA 2P41A 3E8SA 3KQTA 2AOVA 3KQVA 4PWYA 5LQCA 1QAQA 1VLMA 3HEMA 5HFJA 1NKVA 4RTOA 3OZSA 3DUWA 3NMUF 2BR5A 1YFJA 2FYTA 4P58A 3R6TA 3AXSA 3PB3A 4CWAA 4ER7A 2CMHA 3K0BA 5EQJB 5FWAA 3KPYA 4WXHA 2WK1A 5E8JA 3GRZA 1INLA 1DL5A 3UJAA 3EVGA 3GIWA 2GH1A 5HILA 1XJ5A 1B42A 5U4XA 4ATNA 3JWJA 3C3PA 5EGSA 2NP7A 3MAGA 1F38A 3MCZA 3OFJA 1AF7A 3VSEA 2G70A 1XDUA 3A4TA 3FUVA 3NVMB 3ELUA 3OU7A 1R00A 3BWBA 5E1OA 2UZ4A 1JG1A 3SVZA 9MHTA 1NW8A 2OXTA 3M4XA 3QOWA 1SG9A 3G89A 3R3HA 4IKPA 2AOUA 3BKWA 3PLAE 4HH4A 3RODA 1PRYA 3I58A 4RTJA 3NTVA 4HSGA 5HIMA 1XXLA 5EEHA 4H0NA 2C7QA 5FCDA 1UIRA 4ZTBA 1ORIA 5LQNA 2JJQA 1YFLA 4AZSA 5DSTA 2V74B 3MB5A 5E9QA 4RTSA 5EKXA 3NDJA 3HA5A 1L1EA 3ELWA 4YUYA 4F84A 1KYWA 3LBFA 1OR8A 2PVCA 4E70A 2BH2A 4EKIA 3FUUA 1ZG3A 2YXLA 2FK8A 3E23A 3QOXA 4X41A 2PX4A 2IP2A 2EJTA 2ZBPA 3CJTA 3FYCA 1O9GA 2AOTA 4HGYA 4QPPA 4WVLA 5E1MA 5E9JA 3FPJA 4C03A 2IIPA 5JR3A 2PT9A 5CD1A 5ICCA 4IV0A 2NXCA 3B7PA 5EIWA 2Q41A 4OBXA 10MHA 1HNNA 2ADMA 2EX4A 4P7GA 5K0GA 4PYJA 4EK9A 1JG4A 3E05A 4X60A 5K0FA 4PYOA 1Y8CA 3VC1A 4GUAA 2P40A 3S68A 5HZMA 5E1DA 2OO3A 3PX2A 1EIZA 3PX3A 2AOWA 3I9FA 3IHTA 3EGIA 3EPPA 4DM3A 1L9KA 3LGAA 4HC4A 4A6DA 3AJDA 4MTLA 3LECA 5LQJA 1F3LA 3DTNA 2ZW9A 5FA5A 3EVBA 4MHTA 1KPGA 3EGVA 1JSXA 5GWXA 3LKZA 2Y1XA 3G8AA 3CBGA 3O31A 4BP1A 5IKMA 1VL5A 2P8JA 4PYNA 4C08A 2YR0A 2B25A 3NJRA 1VIDA 3P97A 4OQDA 4CTKA 4C05A 3HTXA 1NW5A 2HV9A 5D1NA 1WS6A 1L3BA 3IV6A 2F8LA 3P8ZA 5FULA 3I64A 3KR2A 4M7RA 2H00A 3UJ9A 4E32A 5GIPE 2P7HA 1RJDA 1IM8A 3FZGA 5DTMA 4YMHA 3G2PA 1DCTA 1VPTA 3HVJA 2IDKA 3BGVA 3B3GA 2IGTA 3KQWA 4KVZA 5K0EA 3EGEA 4YUWA 4F85A 5KQRA 3I53A 4BLVA 2ZWVA 3KPWA 5E9WA 4RTQA 5DTQA 2UYOA 4LG1A 2B9EA 2LD4A 2VP3A 3BXOA 3V8VA 3EEOA 2JHCA 4RSRA 1EJ6A 3AWIA 4JXJA 5GOZA 1XVAA 3M6XA 4FR0A 4Y30A 5HIIA 1P39A 5EG5A 3FUWA 5E1BA 4EVIA 3HVIA 1R74A 2AVNA 4ER0A 2P3QA 5CVVA 3BWCA 5FQNA 1WG8A 5GP1A 4C04A 1VE3A 2PGXA 2XVAA 4A6EA 1T43A 2ONZA 3M70A 4X1OA 3LCUA 4YV1A 4DF3A 1JG3A 2GPYA 3FYDA 2PV0A 4KRGA 1TW3A 2V7EA 2YVLA 3EVFA 1NV9A 3BWYA 4BY9E 1RI2A 4DKJA 4E33A 4YV2A 5BW5A 4P7FA 4QQKA 2AS0A 1KYZA 3MERA 3DMFA 2IH4A 5LQKA 1TPYA 3GRVA 2ZIGA 2IFTA 4U7PB 5K0BA 2C7PA 1WY7A 5T64A 2VDUE 5DRYA 4L7VA 3HA7A 3HVKA 2IPXA 2JH8A 4LWOA 4RTPA 4RTLA 2FHPA 4P7JA 4GQBA 4MQ4A 2PT6A 5EMJA 2ZVJA 2ZSUA 5LSAA 4KW7A 3MQ2A 2PX5A 3HCBA 5LQUA 4HTFB 3GGDA 3HA3A 4RVGA 2PWYA 4FSXA 1MJFA 3FTCA 2Z6UA 4GC5A 2YXEA 1SUSA 3R9XB 4XUDA 1BOOA 5DM1A 1M6YA 1I9GA 4X63A 4B17A 3ER9A 2KW5A 3G7UA 4Y2HA 5F2KA 5DXJA 5K0JA 3HCFA 2YXDA 4GOLD 4PYMA 5DM4A 3AY0A 4QVKA 4DCGA 1R8XA 4RTRA 1VP9A 2YUIA 3HCAA 2OB2A 2ZULA 3BWMA 1RI5A 2PX2A 5LR6A 3Q7EA 1BKYA 4GC9A 1N7JA 2VS1A 3GRUA 3M6UA 3SSOA 2BR3A 2EG5A 3JWHA 2AN4A 5CM2Z 2XYRA 5FUBA 1IY9A 4QVGA 5K05A 4EKGA 2CMGA 2BM9A 3FTDA 1FBNA 3KQOA 3OE5A 3SGLA 4OX9Y 1KPIA 3G2QA 3TKAA 4PYIA 3EMBA 1I4WA 5EOVA 2OY0A 4YUVA 2HNKA 1D2CA 2O05A 3P9IA 3L8DA 4PGGA 3BKXA 3FUXA 5HEKA 3SMQA 3GDHA 4OQEA 2ZTHA 4ER6A 5EMLA 4DMGA 3FTEA 1Q0SA 2FPOA 2FCAA 4G56A 4GF5A 4R05A 3ME5A 1FP2A 2BR4A 1G8SA 2NXNA 3OPNA 3OU2A 4HG2A 4PYLA 4E2ZA 4RV9A 3IEIA 3KR9A 8MHTA 1JQDA 1RI1A 1EG2A 2GA9A 3G5TA 3MHTA 5FHRA 2JH9A 3B3JA 1KIAA 3EVEA 3TR6A 3MTIA 3B5IA 5K09A 2O06A 5E2BA 5EZSA 1AV6A 5KQSA 4RTMA 5HIJA 3NWEA 2C7OA 4XUCA 4POOA 1G8AA 2FRXA 4R6XA 3E7PA 1X1AA 4CKCA 5FWDA 3PS9A 2C7RA 3LCCA 3GJYA 5E8RA 5KYGA 1NE2A 2PX8A 4CKBA 3GU3A 1DUSA 2P35A 3KQMA 2IDJA 4FZVA 5DX1A 1PJZA 4AZVA 3LDFA 1ZGJA 1SQGA 1P1BA 4FT4A 2OZVA
chains in the Genus database with same CATH superfamily
1XGKA 5A5GA 3DUFB 3GW8A 3K0CC 4GQAA 3T1HB 3I73A 4JUFA 4KIGA 2YQ5A 3KWJA 5ERYA 1GZ5A 4JMLA 4M1YA 4BEVA 3B1VA 3M6AA 2IYQA 5IARA 4J8PA 4G24A 5ICSA 3UMSA 1QIEA 3ZJ5A 2JAPA 2ZR7A 3U4GA 5AVQA 2ZYVX 1IHUA 1QRAA 4D45A 5A0TA 3ISJA 2V97A 4HDAA 3X1JA 3J80A 4K9MA 2P1DA 3TLXA 4GDFA 4CEIB 3PLRA 4MYDA 2GR9A 2E7ZA 1IAQA 2HBZA 2WV9A 3BJEA 1LGYA 5FF9A 4PX5A 2VPXA 1S1CA 1CS0A 4YXWA 4QDJA 2CV0A 2IZ0A 3O82A 5EQFA 1UM8A 3LPLA 3L8ZA 2CVZA 2RHGB 5B58C 2QN9A 1CW2B 3E7DA 3D8RA 4BBPA 3WL7A 4IHJB 3WGZA 2ECQA 5JXHA 3O2JA 1JEYB 1G38A 1G3UA 2Q8PA 1N75A 2DP4E 4JFRA 4WNCA 1RIFA 4RENA 5DPMA 1MAWA 1ESCA 2WM3A 4OGKA 4O59O 4NE2A 4ZI3A 3WZLA 3IEVA 3OZIA 2QZ9A 2X3FA 1T4BA 4DM7A 2QZSA 2R1UA 1DELA 3S2YA 3S99A 1CIJA 3OIUA 3WS7A 1T5TA 5I01A 3T5TA 5JNSA 3RVLA 5H9VA 3O91A 2A0UA 1TQ4A 3BIJA 3H4TA 4OK3A 5IASA 1ZVKA 2Y4NA 4F6LA 4PE5B 5H82A 1VGQA 5BV1A 3P2OA 1P29A 4C4XA 1U80A 1OXUA 2VJLA 4ID3A 2E5LB 3C24A 3OHSX 4QECA 1A97A 4DDTA 4WT7A 3UN1A 1KZ6A 1PR6A 2BOVA 2ZJYA 1CYDA 4PLPA 4PSDA 2PRZA 4Q3EA 4YN3A 3TWOA 2ZWAA 4B4KA 4D5EA 2A1TR 3QXJA 4G1VA 1OV4A 1TVMA 3MT0A 3N2YA 2PPVA 4RY8A 4KOEC 1OWLA 4MP3A 4QOIA 1EZZA 1QFMA 3DKIA 3PITA 1GNPA 4LTDA 2PK3A 5EWLB 1FOEB 2HJSA 3ILYA 4CN9A 2GEVA 4JI2B 9LDBA 1EUCB 5F3DA 3TPZA 5M7EA 1UXIA 1FNSA 1BMFD 5LP6A 2C4KA 2GPNA 3R3YA 3NG1A 5CLHA 1WDTA 1DMSA 2O2XA 2GM5A 3HPQA 4MK4A 3T4UA 4Z7QB 1T6YA 4LRWA 4LNAA 4RU1A 3FNBA 4I66A 4DT1B 1T5BA 1XRNA 2GN8A 1XVLA 2QXYA 3AFNA 3IPCA 3PG5A 5DN9A 1O95D 3RDPA 4LE1A 5FOTA 1HE3A 1C3OA 1PTJC 1ZN8A 4AO7A 5J2UF 2H8KA 2A5JA 3V8QA 2JIRA 1JHYA 5I4IA 1E4EA 2E48A 4RPIA 2QRMA 1YDFA 2JGJA 2VZLA 1EEHA 6ADHA 2I6SA 4BFUA 3FN4A 1H0RA 3QEMA 3WGMA 1PQ4A 3W78A 3PKJA 2GZDA 2FJPA 1DG1G 1SG0A 2CE7A 4QOHA 5DSZA 3KUUA 4ZYVA 5DCYA 2WSSA 1VG1A 4W9MC 2IS4A 1FYFA 2FW6A 3CB2A 4JJFA 5KYUA 2EARA 2FF5A 2ZVQX 1W52X 1JKXA 4TXHA 3H2IA 3ANLA 2DT8A 3FMVA 2C03A 1HE4A 2FN3A 4K9NA 3SQDA 1O6CA 5HF6A 4DQ0A 1Y33E 3AINA 1E62A 4QU0A 4OBBA 3TPCA 3UT5B 3A37A 3C5VA 5C1IA 3C5CA 3GY0A 4CRWB 1P7WA 3H4VA 1MXFA 3EZNA 4X8LA 3H5WA 1CZRA 4TLMB 3WSVA 4D7AA 4DVGA 2JIDA 1XNRB 4HH0A 4M37A 1PVDA 1MAUA 1U28C 3JR3A 3HVUA 5TC4A 4DMUB 5L8VA 1GR0A 3I1JA 3KOUA 4ICIA 4RANA 3CPHA 5DI9A 1WUYA 4H3HB 1L5NA 5LXTA 1TADA 1ZX1A 1Z82A 1QQBA 8ABPA 2O52A 2V98A 2AZ4A 2PX6A 2PY6A 3LQRA 3R3VA 4G8BA 3TINA 2AUTA 1SU6A 1O0SA 3LUCA 5JSUA 1Y6GA 5F9HA 3SG0A 4MIKA 4CV0A 1I6WA 4U9UA 2ZAMA 3AONB 4UOQA 2X8JB 1PWYE 4G5FA 2UXDB 3CO5A 1EGMB 2I7XA 2ZLBA 3JU3A 4NECA 1UFRA 4EG0A 2VQ3A 1RAHA 1TTPB 3AIIA 3QE0A 2I87A 5JECA 4FKBA 4AQYB 4I50A 2IYWA 1E4VA 3JPWA 5LUAA 4M1SA 3T95A 1VCOA 1PZEA 2V7WA 3UJCA 3DBVO 4HF7A 4K9SA 2XJ4A 4D0LB 4HX9A 1QO9A 2C77A 3CW9A 1DO8A 2OKGA 2VTEA 2YN0A 2UVQA 4MDYA 3GRCA 1JLMA 1G3QA 4D8YA 1G17A 2W2LD 2WT9A 2YZKA 1VCMA 3NT2A 5DH9A 3SFZA 4GM1A 3T7RA 4BWFB 3W5CA 4KK4A 3GCDA 3A6EA 4KGZA 4W82A 2I62A 2WG0A 4K6OA 3K6RA 1RWVA 2WV7A 4KX5A 4LKRA 2RI0A 3V2GA 4AJEA 3KXIA 4YJFB 2QTVB 4LRXA 4WN9B 3BTOA 1NZDA 1P72A 1U9IC 2TMDA 2R0QC 1U2DA 4M8IA 3HCCA 4ESVA 3BA1A 2ATVA 1L5ZA 2EKPA 3EUFA 4N40A 4R8SA 2RDMA 4DY6A 4ITVA 3BF7A 3UEOA 1JTFA 4JVLA 4YH1A 1XZIA 1PZFA 3I42A 3RV3A 2JCYA 3RASA 3DO5A 4OL0A 1O97C 1WXIA 2DBVO 2VNSA 1RZUA 1VJ5A 3OLYA 1VMIA 4GW3A 1T36B 1SR8A 2HU5A 4D6XA 1P1IA 2WWIA 4M0CA 4EUHA 4BVKA 4ZA2A 5TMBA 3D8UA 4BNDB 2DTEA 1QKJA 5IBPA 1VKNA 2JGLA 1PBNA 2KB0A 2WJVA 3F3YA 3IT3A 1EA5A 4BDTA 4DYVA 5JZMA 3BCSA 3DBLB 4K1LA 3PGMA 2WRZA 4GR4A 2ZZNA 4WBSA 3SDZA 3NOOA 2I67A 3O0TA 4HZIA 4TT8A 4LHWA 4TRJA 4QHTA 2QROA 4IWNA 1BGVA 4DUZB 1ZR2A 1SCIA 3P4UA 4ZAXA 1HZJA 1QHNA 3WK4A 4BX2A 3OEEA 1L5HB 4IUYA 5TMDA 1J2EA 3A4NA 2F3RA 4EB6A 1TC1A 1OH6A 1MO4A 3M33A 1C5KA 3AO0B 2CNNA 3VDNB 2DG2A 5C3UA 3OJLA 4U3JA 5FAKA 1RBZA 4K3UA 1WY5A 4EP1A 1JHVA 1LCIA 4EL0A 1YZHA 1VMKA 4EKNB 1P2TA 1DT3A 2P77A 5DB4A 1GZDA 5K4GA 5T4FA 4BX9A 2VP2A 3DEZA 3OKCA 4ZV9A 2AXEA 5CA1A 2BR5A 3O0DA 2HJGA 1BCSB 5TIIA 1UXHA 4PZAA 2I29A 1TMGE 2CNOA 3CCCA 2PQMA 4MV3A 3T5GA 4CWAA 4ER7A 1G20B 4BMDA 4NSNA 4WXHA 4K46A 1VYHA 3UC9A 1HGXA 2GH1A 5AK6A 4QOEA 3RD5A 1W73A 4EJ0A 1K7EB 3OTGA 3JWJA 1JE0A 3CX3A 3DKPA 3LK7A 4Z99A 1AGXA 2PL5A 4BGEA 3D1LA 3GH3A 5I5GA 3KLMX 3T5BA 5LJLA 3OFJA 3VSEA 2Z09A 3E70C 4CMKA 1L9XA 2BBSA 3PF9A 1X7ZA 4FGKA 4YJ3F 4D26A 1TK9A 2DKOA 3EASA 4KV7A 3QPUA 2IIVA 1J21A 4QBTA 4Z9AA 3M4XA 4OMCA 4Q1FA 3IR6A 3QOWA 4TYQA 5CDFA 5IXSA 1FQJA 1QLJA 1M2JA 2UXCB 1PR9A 1DHRA 1OVMA 2P4UA 4QU8A 1I4OA 3WIUA 3H3JA 5F12A 2VSYA 1P9WA 4U2GA 1QGDA 1MORA 1CULC 2A67A 4RJLA 1N9GA 4HPJB 5FWNA 3SHOA 2DBRA 2R6CA 2XXAB 2BL4A 16PKA 3KX2A 1D0IA 1TNDA 4KN5A 4MEBA 3X2SA 4F96A 3H42B 3NIGB 3QNMA 4Q7QA 1K89A 4CKYA 2H52A 2J3QA 5CX4A 4CGYA 1Z63A 4KXWA 3M5WA 3OZDA 1TK2A 4M9RA 2XITA 1D2AA 3PRHA 3EDQA 2X7XA 3AF3A 3H5TA 121PA 1FSPA 3HBMA 4PSUA 1MENA 3M7IA 3KG2A 1W5AA 3JRXA 4PRYA 4P4NA 4X60A 2BJHA 4Q7MB 3GB9A 2D5CA 1RD4A 2IHKA 2XLBA 5E1DA 3LT5A 3TBFA 2J6HA 2NSJA 4JYPA 4QL3A 1I3MA 2J9RA 2W6JA 1J97A 1EVZA 1T9GR 2RGXA 3C6BA 4PICA 4YGXB 3QKTA 1RWXA 1Z18A 3NC1C 3KYCA 4ECEA 3OPQA 3UCFA 3SKYA 2YW2A 1X80A 5FA5A 5IT0A 1DJPA 2KE5A 2J45A 3REQA 1FFXB 2EGHA 2QQEA 3A2KA 1XZ8A 4FI3F 3O31A 4UUQA 3B85A 1LBEA 4N12A 2HPZA 5A7GA 4TLEA 4R9UC 3EOZA 5C52B 3P0FA 2IY9A 3IIJA 1SJ9A 4Z9YA 4NAVA 5I6DA 3RSHA 5U4QA 5AUOB 3NASA 4S05A 2VH1A 2JFXA 4YRSA 3WK6A 1GT91 3NIBA 1LPNA 3L04A 1T2NA 2OV4A 4UE3S 1LPBB 1IM8A 2C4VA 3RI3A 3H0KA 5A4MS 4KVZA 1LVHA 1XL0A 2Q3CA 4PPGA 1PWHA 3LJKA 4QYIA 4ZZ1A 2GA8A 1QP7A 1BA2A 1DAMA 3SLKA 1CJMA 3I53A 2DPLA 4OBEA 2ZU6A 1IDOA 1GU1A 5T4EA 3UXEA 3FM9A 3C3WA 3OTOB 2ABWA 2R44A 1Z4KA 3A36A 5ITVA 1MIHA 2C2WA 3IMCA 2C31A 2ETVA 1WEHA 4KZPA 4B8ZA 2SCUA 2XUFA 2HK9A 5EIBD 4P93A 3ITNA 5CT9A 5CVVA 3TLAA 1U1CA 2C82A 5GP1A 4CMHA 3RANA 5KDLA 4U5XA 1Q77A 3NHBA 2OWEA 3GLHA 1RAFA 3DZGA 1KO5A 2OMEA 1CZKA 3NEAA 4LA4A 5BR4A 1OAOC 3LWZA 3PRKE 1ACJA 3DT8A 3KDAA 4MWDA 1ZM4A 3RJMA 3ZLTA 1TW3A 3NOXA 2ZETA 1C9NA 1FZQA 1M72A 4TUYA 3ZE2B 5HZGA 3ETDA 3VGPA 5DLPA 2O7SA 4MWTA 3HSYA 1P4AA 5I7AA 521PA 2RMKA 3D2AA 1YNSA 1QIJA 1E9VA 5AICA 3OTHA 3D7MA 1QHHB 4BVLA 1JIUA 1JAXA 2X0IA 1QFZA 2C5LA 2AG6A 2CDNA 2HA7A 3LM8A 3PJEA 4HYTA 5E6SB 5A4FS 3HEAA 5CFNA 3SZUA 2I2WA 3OG9A 2HUNA 3OZ7A 3IJRA 4EI7A 2NO7A 4WA7A 1G8FA 1BCRB 1V7QA 2QU7A 3W06A 4ZHSA 4JI7B 1NN5A 2PEYA 1YT5A 3W3AA 2AB0A 2IYRA 3ECAA 4FM9A 4B17A 2FWIA 5AKZA 2EGUA 3WXMA 2Q9CA 5K0JA 1PTJA 1O8BA 1E3LA 4IDCA 3FBTA 4JVNA 2NGRA 1E3WB 2L2QA 2Q6VA 1PCXA 4WESA 4OXQA 3GLFE 1C4OA 3LZDA 5FPPA 1UMDB 1W25A 1BKYA 4IAOA 3BEOA 1QPBA 5CLQA 3VV3A 1GKIA 1EESA 4EYEA 1FXWA 5JI2E 4LW8A 1XN1A 4GYJA 1SY7A 2OECA 2JPDA 2PZFA 1IZ0A 2OVFA 3CX8A 1DBIA 2BM9A 1LDMA 3U17A 4CQMB 4IO1A 1QE0A 2RAPA 1HDIA 3M6FA 3OMXA 1S1MA 4UNSA 5JNVA 1L6IA 1XCMA 3B70A 1JHMA 4NU6A 1TC2A 4AN1A 1T3GA 2I9PA 5KQPA 3A1VA 5KYXB 5LOVF 2ST1A 2JLBA 2ZYHA 3GJQA 5A6SA 2B4AA 5FUXA 5FPYA 2HK7A 4PZ0A 1PL6A 2I54A 3IE1A 1GPNA 2NU8A 2VJMA 1ZW1A 2BJWA 1EXVA 4YRBA 1NVVR 3H6KA 3VZDA 2ONKA 5BYAA 1MQ8B 4JQCA 1KFEB 4M60A 2IS1A 1JQKA 2BR4A 1ENPA 3KSDO 3OU2A 1U28A 1XEXB 1Y3IA 4OHBA 4RV9A 2HQBA 1IMOA 3MTGA 4WDQA 3AM1A 2HFKA 3F9RA 3Q9SA 4IVPA 4YPFA 3MHTA 1PGOA 4PGFA 2HLNA 2IUSA 4MV4A 1W4CA 2FMIA 4KPGA 5K3BA 2PQ6A 2FR8A 2WYVA 5DGIA 3TTTA 4ZKDA 4TYMA 5BPFA 2YS6A 5E2BA 2Q4EA 3DOIA 4BJ5A 3M5CA 4MUEA 3EN0A 3UMJA 3ZDZB 4BU0A 4C6HA 3PFBA 3W6NA 1CEYA 4Y0VA 5K3CA 1FFWA 4S1PA 2XADA 1IN6A 4WFQA 4X1YA 3RCBA 5H1YA 1ZGZA 4KAXA 3EB9A 4UBIA 1WU8A 2XCSB 2DECA 2A59A 1VL8A 2H0QA 3LPNA 4BATA 2HNBA 3OZGA 2XWSA 1H1LB 2PKQP 2ZIAA 4XE5A 2CJFA 1D2NA 4FNMA 4XYBA 2MYTA 2DFNA 5CFRA 3AHEA 5B30A 1JH9A 3QXXA 1U2QA 1BKSB 2X4IA 4OL9A 5AI4A 1ND5A 1VHWA 1DRWA 3Q5EA 1VB3A 1P2SA 3A1DA 1WSBA 4CT4B 2AN5A 3AHFA 1MGPA 4LC1A 3AQ4A 4MMZB 3NRJA 1NTOA 5GAJA 1YE5A 1XVIA 1U2GA 1XQ9A 2GZHA 1AZTA 3SSMA 5GJCA 3VVMA 4F5WA 3KCNA 5JANA 1SOVA 5AVSA 1B6TA 3OZVA 4JEIA 1PUJA 4DIDA 3BORA 2ZAYA 4PCAA 4GZ5A 1AXGA 4MV8A 4JJZA 4YAFA 1EB9A 1QZUA 1U9IA 4CM6A 1D4AA 2A9KA 2XIQA 4HHEA 1MC4A 1QGYA 1P5JA 2VDWA 2OXEA 3AJAA 4XLLA 2XKBA 5KC9A 1JJAA 1LWOA 3FW1A 4LBYA 1VFPA 2QTWB 2ZB2A 2JIMA 3LUKA 4GRAA 1UFKA 1YRAA 4PGHA 4PN7A 1WW8A 3QLJA 3RJ5A 4KWCA 3TEFA 4EW2A 5JAPA 3PQFA 4V39A 3IALA 3DFIA 1N3IA 3CUEF 3PXXA 3TG8A 4TMVA 4Z7OB 3C7DB 3L46A 1PJ3A 3OD5A 1DMRA 3JWEA 5CYFA 4EGSA 1I1QB 3C6XA 4IQ0A 3PF8A 3QYAA 3A3YA 5IUJC 2E82A 3LWDA 3KHUA 4DV3B 2BP7B 5EQDA 1WTAA 4L3OA 3ZK7A 4JI8B 1CUYA 1T3SA 3K0FB 2NW6A 3ZCTA 3JQCA 5FPSA 5A7FA 1W30A 2C97A 4N5DA 1DKLA 4JWTA 3KV3O 2O2SA 1TOAA 4KVAA 2FP4A 1Z56C 1ISJA 1W5TA 1RCFA 3QV1A 3HXQA 1BQEA 3K7EA 5AOAA 4AJ1A 2C1ZA 3IUPA 4YTEA 2AC2A 2J9FB 3L4BC 1JR3A 4OLJA 1A5SB 1MFZA 3RIMA 2JFOA 3WLLA 1XZQA 2MINB 5F2OA 3BMOB 1SULA 5JZVA 2IXGA 1ZJ5A 1V4NA 2QM0A 4N6OA 5BSHA 1ECCA 4JROA 3U6KA 1X1TA 4WD3A 3AVQA 1T9HA 4KQ9A 1N32B 2BKEA 1M3SA 3KYBA 1KH2A 1HT3A 1FTQA 1MRZA 2EC5A 4NE7A 3VTKA 4ZYTA 3K70B 2Y1OA 1AUPA 2EW2A 4FNOA 1CFJA 4MINA 3ZDBA 2QMYA 4GD3Q 4OFXA 5D01A 5J2TF 4HQNA 4DZZA 1JR4A 1K66A 3KQYA 2GB4A 3OP4A 4L4UA 5D3KA 5ECDA 5EY5B 2RE8A 4ZYUA 4LFBB 1P2FA 5C9ZA 1O9BA 1H6CA 1Q7CA 2BCEA 3LQ2A 5KYNA 4N6GA 2E18A 2NTVA 1G2OA 3SC6A 1U1EA 3AESA 2YNMA 3TNFA 4PSCA 3U48A 1DDIA 1ORRA 2RHWA 4LBVA 3HP1A 1NJ5A 2IQ5A 1V3TA 4UNQA 2HADA 4RXUA 2J1LA 3RRJA 5AXDA 4FE4A 3URMA 2YWCA 4DLLA 4JU8A 4G0ZA 6CHYA 3DMHA 3Q87B 1H3FA 2OBNA 3ROXA 2F62A 3IB3A 3QUQA 5J5VA 2OZKA 3HMKA 5CA0A 5FLKA 5GZ1A 4ZVQA 1LTKA 2G0AA 1YZYA 4QXPA 3A6LA 1IPHA 2P6MA 2GESA 3PUZA 3KQNA 2RI1A 4W5HA 4LHEA 1N5DA 2C98A 3HR8A 3FPLA 5JNWA 1MX3A 3P2IA 4DLYA 4INPA 3WP0A 2WMDA 5BWNA 4Q1BA 1K5HA 1US8A 2D7CA 5ICFA 4R0VA 4BE4A 4CJXA 2PZ8A 5C51B 1H8HA 1LLFA 4IOMA 3OQPA 2RIPA 2J0VA 3BD6A 1LVGA 4DJ5X 1FSSA 1WCV1 1E2EA 1RKQA 3EMVA 4O3FA 3HO6A 3IYLW 2BBWA 5DNVA 2D2VA 2W7TA 2WIFA 1J22A 4R71A 2VJDA 2WNSA 3JQGA 1GFZA 2CBGA 1IN8A 5GJWC 2YXPX 3DWGA 4WRRA 1PJ2A 3IQGX 3KTFA 4IJMA 5C8XA 1ISSA 1KJ9A 2OG1A 5IT4A 3VKUA 4JX9A 1PEAA 1VSUA 3HLTA 1GTG1 4EVQA 3C6QA 4AKTA 3OEHA 5EZ5A 1I2AA 2OHGA 2IHBA 2VYND 1LV8A 4RDXA 2BYTA 4BO4A 3SIRA 5K0SA 4DBLC 5KNCD 5DLEA 4EHHA 3ZI4A 1VJTA 4MS1B 2ZANA 4MKFA 4ZGWA 1XQVA 1ZOIA 3HYRA 3KTDA 3D0QA 5AIBA 2P9ZA 1VB5A 1ZK1A 2QN6A 3DPIA 7ADHA 4MUXA 2IPOA 3DV2A 4A03A 3DTVB 4Q7KA 4BLSA 5LQDA 3TD6A 5KNBH 3E7WA 4UUNA 4V3CA 4HQFA 4NG5A 1Q5PA 1Y4DE 4R5HA 4CEHA 4OXRA 1ZBDA 3USES 3NP9A 1TUEA 3KOXA 5JQGF 3D2LA 3RRXA 4YYEA 2HJRA 2ORYA 2VYVD 2NUAB 3FNRA 5CIYA 2R3SA 1IN5A 1IUOA 2C2KA 3ELBA 1IN1A 2BRUC 3OA2A 3RWBA 1OZ0A 5C8YF 1DX9A 3DMGA 4J43A 5C5IA 4OEHA 1P0PA 1DFIA 3KKZA 2JI7A 4E1VA 3FHJA 3ORYA 1EE2A 3A1WA 4C20A 3KTAB 2PFSA 3ESRA 5BW4A 1PYOA 2ERCA 3L7LA 1N2CE 2QX4A 4LF6B 5HKKA 1J8YF 1MHPA 1CU1A 2Y1DA 3LDUA 1XTPA 4OHPA 4UNPA 4BO8A 1ENZA 2BDTA 5AHRA 4BFSA 3OWHA 2ZIXA 3N2GA 4P34A 3QFHA 1Z45A 4HQLA 4Q5IA 2BBOA 4GMDA 2DULA 3MAAC 5GGYA 3KJHA 4I55A 1Q0QA 3JQ9C 4MAMA 2C2HA 2CLFB 3DDCA 3LCVB 3GARA 5FB3A 3IAM1 1J25A 2VDRB 3JASB 3IT0A 3PQEA 4O4HB 1LXCA 2BMAA 3FWPA 1SCQA 3UJHA 3KZVA 5CXXA 1R8JA 2RH9B 3JY6A 4OGLA 3G5LA 2E55A 1GYPA 1I4DD 4NABA 4BGDA 4HR7A 3IC5A 4U7HA 3CJRA 3W8EA 2R1VA 3EPLA 2IYZA 3TIGA 4F3KA 2XYHA 1XZBA 4HQRA 4QWMA 5G53C 3QLUC 1W9HA 2VRBA 2WLSA 1R8QA 3F3KA 1PHRA 3WLKX 2H2IA 3ESAA 5DM70 4DR1B 3HACA 3QVGA 3TBKA 3TOXA 5AW6A 1GZHB 1JIQA 1YZKA 1VDZA 3CY6A 3AXTA 3ELYA 4FFPA 4UU8A 3TSZA 3KXDA 4N3GA 1TYAE 4N8SA 3U44B 3N0XA 3WADA 4YYZA 3I5YA 4Z1MA 3RK0A 1EBUA 5HRAA 2NU9A 3PT9A 2VLBA 3ROMA 2HWKA 5GTDA 1H3NA 4D02A 3IQZA 4A91A 4F71A 1VLMA 3KL2A 4M7OA 3VHRA 3EZ7A 2CCJA 1TZCA 3L8CA 4DMLA 1XYGA 5D5HA 3D6AA 4R9VA 2J0QA 1HPLA 2GK3A 3JAWB 3BX1A 4LJSA 1K8RA 3H1PA 1PR2A 3ZOKA 3EVGA 3GIWA 2CCKA 3VH4A 3V9AA 4ATNA 3SHVA 5ALTA 1XA3A 2EJBA 1OVGA 4B7CA 2QVXX 3BH0A 3DCYA 5JMTA 4RHFA 2OFOA 3EARA 1F3OA 1R8SA 3FKQA 5F5XA 1B8OA 2O8NA 5EJ2A 4KIWA 4YRLA 1WHTA 1RWNA 2W2KA 1RPTA 1DVRA 4TLAA 5E1OA 5ILGA 1GG5A 1D8TA 4MRAA 3L0DA 1QYDA 1P33A 1YRYE 3LX4A 1L4GA 1JTVA 2PCLA 4XGIA 1GGEA 3J81A 3CO0S 1SA0B 5HA5A 2CXNA 4HH4A 4XB2A 4QQ8A 2O48X 1XXLA 5EEHA 1OJ7A 4EAAA 1FQOA 3ICEA 3MTBA 1RPAA 1KBOA 1ZJJA 3V1NA 4CG0A 4XWTA 5EWJB 2PU5A 3X1KA 2G1JA 1NYQA 1PFWA 5KVQA 1GL3A 1ULZA 4E70A 4OXKA 4KJZA 1SB9A 1A9QA 2IP1A 4IIVA 5I4KA 2NZVG 9MHTA 3PNQA 1Y9AA 3L7IA 3CJTA 4ND8B 4QPPA 3S8YA 3ICWA 4DCOA 3VDQA 2VXCA 3TXAA 9ABPA 3JXEA 3T7DA 2YWRA 3PQCA 1P81A 1PZGA 1IOLA 2QP4A 4XLZA 4G9EA 1FVOA 2VHTA 1K08A 4UFNA 1NHGA 4BQRA 2I80A 3SZ3A 3CN7A 1JZSA 2V65A 3H83A 4XW2A 4LOIA 4TVOA 3SZOA 4X54A 1Y8CA 3I9JA 1QR2A 5LQSA 2JLYA 2LCIA 3OZXA 4FMCB 2G5GX 2YC2C 3Q41A 1USUA 4GLLA 2PH1A 4NKRA 1ISPA 4HEA1 3GGPA 1E8MA 4ON9A 1MB0A 1XHEA 2X58A 4PWZA 4M49A 1TO2E 2AOWA 2JA2A 1MEOA 3A8TA 3ZKAA 3EPPA 4YRGA 3PZBA 5KUTA 2BAGA 2Q2NA 2B20A 4WGGA 3EEFA 5LQJA 1NF8A 5CCDA 1FLNA 4FZRA 1KPGA 4LXGA 3BA6A 4F9TA 2FP3A 3VR3A 1U7ZA 1Q19A 2R6FA 3CUUA 3G68A 4L76A 4GPZA 4WN3A 4ZVSA 2EZ9A 4J0EA 4J0GA 2O8CB 4WCFC 5K1ZA 3X44A 3HTXA 4PV7A 1P7CA 2W6OA 3ZLBA 1MABB 4CQLA 3KJXA 4LC9A 4PVCA 3TW8B 4N41A 4CMEA 1C0IA 2GHRA 2QL6A 2X23A 3B9QA 3E4CA 1OTHA 3F6PA 4RMIA 3WZ2A 3G6KA 3PDCA 1TVKB 3EY4A 2AFHE 2O6LA 1DCTA 2XNHA 1YZUA 3SF8A 3UWOA 2JNWA 3U7IA 3QH4A 2RONA 3ETCA 3B2EA 1JAYA 2NU6B 3GPIA 3LY8A 1TM5E 5F2EA 1OLSB 3I9V1 3RFCA 1Y8RB 4IOLA 2PPLA 2R65A 4B2PA 2FCRA 1CY7A 2ZEJA 3ABOB 3QKUA 1PT6A 4BTLA 3O47A 3ZE6A 1P3JA 4FR0A 3ND7A 5EKSA 2O54A 1ZD3A 4YASA 1M0WA 5KNDA 4XIYA 2UZ1A 1FIUA 1RT9A 4D9NA 4AY2A 5EVCA 5FQNA 2HLPA 2DETA 3BRQA 4H7DA 5HF8A 4A2QA 3ASYA 1N57A 4KE8A 4HL6A 3TQQA 4CIXA 1VJRA 3K0HA 3C14C 3WGGA 5KYKA 1EFPB 1P0CA 4GBGA 4IHKA 4L4SA 4QOGA 5D7NA 3T99A 3TN7A 3NHJA 3UXMA 3L4BA 4OH1A 1GQ2A 1K6MA 4MW2A 2OCGA 2HA6A 3OEED 1PS8A 2VHEA 1U0EA 2GN4A 1OX4B 2OG2A 3RC7A 8AT1A 4YCNA 1RC0A 5EE9A 2AXQA 3LRPA 4JY7A 4GG1A 3DVLA 5GADl 3R77A 2Q49A 1GZSA 2W2MA 4ZOLF 3WOHA 3ZJYA 4ASUA 4P4SA 3QTLA 1GGFA 4JJ8A 1U4SA 2D2XA 1Q14A 2PGNA 2HSDA 2C04A 3SPXA 4HNUA 2CDRA 1G7TA 4ZZ2A 2W6NA 3PFFA 3ZHVA 5ICMA 4CM8B 3MS4A 2ZVJA 2YV1A 5DISB 2Y2UA 3RT7A 3AUJB 5TQJA 1RRPA 5I7OA 1Z17A 2WPNA 1MOSA 3FPSA 3RRZA 2JD2A 3AFGA 4KFTA 2OORC 3L41A 2RHTA 1MFPA 4DREA 1PSWA 3MXTA 2DPYA 3MIIA 2Q3FA 4JI6B 3PDUA 1D6NA 5JD5A 1JVBA 5AJTA 3HFSA 4RTRA 4GOLD 2F1HA 4KXVA 2WF7A 2WJGA 1CRPA 5CK5A 4BVBA 2ZITA 3D7KA 3AL2A 3GLIE 1EP2B 1CRWG 5H9WA 4CUKA 1N7JA 1F51E 1KRHA 3A9TA 3L6BA 4C01A 4E14A 2CSXA 2FQWA 3ZD8A 5FUBA 4A2CA 3F3SA 3ROPA 4EKGA 4OGWA 4PXSA 4BIMA 4I7EA 4AMYA 4B6JA 5JAHA 2O4CA 1P2DA 3R5TA 2YWDA 3P4YA 4A8HA 3MMXA 1S6YA 2R1TA 4R0NA 3UMMA 5HRCA 3VYSB 2G6BA 1R3DA 1CIPA 2Q21A 1UCFA 2YWHA 3WKBA 4MW0A 4HNAB 5BNFA 4RK0A 5IHXA 1UWCA 1N0UA 3ZWCA 3DEAA 1V47A 4M1KA 3PQ3A 4H7IA 3RC1A 1ZUNA 1TF2A 2LV8A 3LYLA 3CRW1 2IJGX 3WGQA 1XZFA 1ZIOA 2ZAOA 1EDBA 2J0SA 4LRTB 1DTWA 1KC1A 3QTTA 4I3GA 2LWIA 3VU0A 1QHEA 1U8CB 4O4LB 2G7MC 2WFLB 2XOKA 3RC2A 4WKGA 1E3SA 3B3JA 1KSFX 4WZBE 1ODJA 2OD2A 3PPYA 1T0PA 1TGVA 2ZDHA 3AB7A 1QH8B 4EVRA 3E9RA 3LLMA 3OESA 3GDFA 4CLRB 4F3YA 2I3GA 1M6VB 1Z68A 2B5OA 5JD6A 1T13A 4Z53A 2I3BA 2W6JD 3O1LA 4AF8A 1YVDA 4AULA 4F1WA 1AHNA 3DT6A 3L8GA 1KYIA 1Z74A 1Q1EA 3IBSA 1JIIA 3PENA 4NU5A 4QZVA 1E7MA 2HOQA 1COWD 1KMMA 5B64A 3WYFA 3HDGA 4JR2A 3ZIUA 4DMKA 5KOYA 3R6GA 2P35A 1E61A 2VSNA 4FZVA 4PLFA 1EKXA 4NZOA 5TMEA 1MPXA 3SIWA 1YCGA 3A4TA 3AVWA 3GGCA 2P5SA 2BISA 2DGDA 3I3SR 4RF3A 5ALZA 1X7YA 2O2EA 3TQSA 4CKBB 4QEKA 2JLZA 5K3FA 4A2WA 4Q01A 5JNTA 2MYPA 3L9WA 1LSOA 4J16C 5DX8A 4C0BA 2GEUA 1V37A 5TT1A 1KE2A 1VPLA 2ZRFA 2VT7A 5B7GA 1XK6A 4XJTA 1BHSA 2G06A 3ORHA 1C3LA 3BD7A 3REOA 1ZLXA 1YCDA 1B7GO 1QHGA 3D9QX 3IMKA 1GUYA 4NULA 3N8NA 5CIWA 1A2KC 2WWVD 3SWWA 1OBFO 3GNSA 4Q4LA 2AMFA 1X7GA 2NQTA 1NXPA 2Z43A 3TSWA 1CR6A 4IJ6A 1PLLA 2JAWA 4OHXA 3VKFA 3HUEA 4AL4A 1ZD2P 3CZPA 2QIPA 1GHTA 1KZ1A 4NYJQ 2H4HA 4WFKA 4FD2A 4ZAWA 5BMVF 1J09A 1LTHR 1A9ZA 1AGYA 1QRDA 3OWXA 4GZ6A 4V03A 5JSKA 5TR9A 3UTCA 4G2TA 5SZKB 2HJHA 4XIGS 4OJQA 2IBTA 2C92A 2XMSA 1P2BA 4H6WA 4L8WB 3RRBA 1PJ4A 3TE7A 1WSWA 3AFMA 4DLWA 1I7SB 3LC0A 3PQ4A 4EY6A 4HGQA 5B4UA 1C0KA 2ZJBA 3TUJC 1YB4A 4LHYA 4AK9A 2N47A 2TRSB 2WWRA 2NYVA 2YVAA 3P20A 1UPBA 4Q1AA 1R88A 2P65A 3AILA 4D46A 2PRYA 3IH5A 6AT1A 1SXJB 4HWRA 2HJVA 3MWYW 1YU9A 3MJTA 2FQ1A 4LPKA 1SQ5A 3HI6A 1O7JA 5K8CA 4IIJB 4WLUA 5ALPA 1YOVA 2X7HA 4LECA 2A7XA 5IYZA 3USCS 1JG7A 3KZNA 3V55A 1JLLB 3TAXA 1ZXBA 3DZKA 5MGBA 3FDZA 2OWDA 3MT7A 1VQ1A 4OBWA 4D0SA 4PAQA 2O5RA 3TD9A 3ZW7A 1SK8A 3OZEA 1XNGA 3F74A 2D1YA 2H1RA 3GRPA 1XOIA 1POWA 4MQBA 4O29A 4Q3CA 2A9QA 5B3AA 3SD7A 3V4LA 3FOFC 3I2HA 4Y6OA 3LQKA 3TB6A 4B2YA 1AG9A 2EFDB 2R86A 3DXZA 4ZU6X 3L77A 5H4GA 5JAQA 3AVVA 1WD7A 4ZO6A 2C3MA 2ZJ8A 3OF5A 4FC6A 5JVDF 2R8EA 5KU1A 3OJ0A 4OMFG 4KAAA 2YRXA 1DC6A 1V6AA 4NAUA 3R0IA 1EBBA 1KI3A 1YGPA 1ZM3A 4JNCA 1FJGB 4NEGA 2C2MA 3V1UA 3NNSA 4LE0A 4EENA 1Y98A 2EOAA 1UJ4A 2M32A 2YFQA 3GZTB 3PPVA 1MX1A 5DYTA 5G1NA 1L7BA 3R0QA 1COZA 4XJVA 3TQOA 1WBDA 2QX8A 1ODKA 3P9YA 5A71A 3ROZA 2GN2A 3QHQA 4Y9TA 4LV5B 1SPXA 3GD5A 3BWVA 3KQUA 4G26A 2GCOA 1SEPA 1K2WA 5CXSA 4J29A 2OYCA 4YRNA 1L7PA 2JAHA 1KZ4A 5IMBA 3WGYA 4ARZB 1PW5A 1AKYA 1S0UA 1XTIA 3HFJA 4L5CA 4NJMB 1ACLA 5F1OA 2SHKA 1QLHA 1XQ1A 3Q8WA 4US1R 1EM8A 3UGKA 5ICEA 4WHMA 1F14A 3E3LA 4EKDA 1P62B 1CF2O 2PBFA 4QA9A 1SU4A 2AXPA 2ZWIA 2LGJA 1GNSA 1II8A 2E2WA 4R4JA 2OXRA 4LXUA 5SZHB 4D98A 5EC8A 2AMVA 4JC4A 4JUCA 1VFNA 2CMDA 4TMZA 1UDXA 1NJFA 5F9MA 1XLTC 5LA6B 4D2IA 4YFVA 1CUJA 1E7WA 3PC3A 1U2ZA 2JANA 2V6IA 3P96A 2YFYA 3NEJA 3PIRA 2G1KA 5CPFA 1IY0A 1I3LA 4IDFA 2PR7A 5BQ3A 3F49S 4ZRDA 5BSFA 5BV0A 4LQ4A 2WDZA 3T9BA 2HRDA 3KKPA 2BGUA 1K8YB 2VPTA 3OZWA 3QE3A 4YI5A 1CF9A 5E95A 3CLTC 5HRUA 3EQ7A 1GIAA 5CLJA 3DF7A 4TTJA 3DZIA 3H13A 2NACA 2WG1A 3E9DA 3F8WA 2J7PD 4PLVA 4FBMA 1AKUA 4ZVRA 3O3OB 4X1IB 4ZO4A 1U9CA 3K8OE 3K5HA 3UJ8A 3E8XA 5L3VA 1RJFA 3MPOA 2JI4A 1KR5A 1QRRA 1J23A 1ZY2A 1ZO8A 1W0KA 3V7FA 1CP2A 4CG3A 3JYOA 3NXKA 4QGSA 4DIEA 2O3TA 4YRRA 2FPGA 1DLJA 4IY1A 1U04A 4FHZA 2YOFA 1XJWA 5BNWA 4G65A 2H4FA 1GCIA 1R2QA 2RGUA 3W2IA 5I8PA 5JTUA 1UDRA 5KBYA 1WSDA 3BIOA 4FYIA 4WCFA 5DHFA 3RTCA 1U2PA 2O1SA 1FTWA 4JSRA 5DGCA 3HI4A 3IOEA 4FR5A 5AOCA 1L7XA 3F46A 5EUMA 3WKEA 1TT5B 1WSAA 2AR0A 4TGLA 4Z0TA 2ZPUA 4UPEA 5JJIA 4HNSA 4PPQA 1BXGB 3OH8A 1ZKDA 4D41A 1EIWA 1EWRA 5KVVA 2RCYA 2WQZA 4X61A 1VLLA 1KGSA 2HMWA 5HOQA 3QYPA 2ZUDA 1A9OA 4F1KA 3BQNB 5F98A 3I2JA 3MJVA 1M9NA 3IMGA 4TKUA 4HXYA 4W1SA 1NQAO 3C39A 4ZGGA 3LF1A 4BEWA 2G5CA 4L0QA 1WR8A 2XQJA 5D3MB 4CXMA 2OBBA 3IPRA 5THQA 2V5VA 2NZYA 3E7XA 5JRDS 1G6Q1 1ZITA 2RIRA 2O2ZA 3G5UA 2AW5A 4N7JA 4B81A 4E0BA 4MKXA 2GHIA 2MSWA 1H2AS 3QVOA 4BO9A 4DPKA 2MU1A 4OIMA 4F3TA 2BHLA 4YJ2F 1NXXA 4P4TA 3G85A 1S01A 3RUEA 4EHAA 5KNBA 5KYWA 5ELXA 1TTHA 1THZA 3H2JA 3C8MA 5BRJA 2GO7A 5DLQC 2II6A 3R3JA 4LOAA 3DPSA 3DVQX 1JR3D 1N2EA 2JFHA 3H19A 1V7CA 5CK4A 1NBAA 4J9VA 5EXPA 4JC8A 3JZFA 1PGPA 4QOFA 5T67A 4II3A 1WETA 3E9ZA 4E31A 1DO0A 3PXCX 2VZ9A 1XDSA 4WXPA 5IBRA 1GZ4A 3I5AA 3HKDA 4OSEA 5ED0A 2QIOA 1VCIA 5I7UA 4JQYA 3WGOA 3W6UA 3AGPA 2WJZB 5F77A 4HUTA 3IGFA 2ZI3A 3LIIA 4G67A 4XB6B 4XM2A 2H9AA 2Z8YA 5CVDA 3AERA 4HQ0A 2R6HA 3GPDG 4ZI5A 4KG7A 3QVUA 4DRYA 3C74A 2AWOA 2VTVA 5HDQA 3B78A 2PRJA 3UKDA 3PFNA 4B4DA 4CF3A 4O8CA 1N34B 1IHPA 2HHHB 2YNMD 1E9RA 3KQVA 3RU7A 2BFDB 1NUSA 2B1JA 3I8XA 4UARA 1P5ZB 4DOMA 3GJTA 4Z5XA 3R6TA 2ZT6A 4AO6A 4LY3A 3C3DA 1INLA 1LNQA 2AKYA 2AR7A 2BBTA 2PANA 3U0VA 3U4QB 1MB9A 1BYIA 1KTVA 2DE0X 3O4IA 4AMVA 2OQIA 4UXIA 1MQAA 3KKNA 3K32A 2ZBUA 5EGSA 2SICE 4GE0A 2PKRA 3FF1A 1QHXA 3LXRA 3ROGA 4E94A 1XNQB 2I4MA 4OD0A 2ETXA 1D4OA 2QXTA 3N6VA 4QNRA 5JSZB 1SGWA 4DCNA 1P74A 1YJ8A 2H1SA 2ZU0C 1CQJA 3OQIB 1EI9A 2NTJA 2EBHX 3E22B 3Q72A 2I91A 1ZH4A 4HMPA 3DEYX 3TRIA 1JHQA 2P9JA 3VU3A 3TAHA 2KJQA 1LQUA 4U6QA 1OKKD 4Y9UA 3L7YA 4C0XA 2CUTA 4L1KA 4OREX 3LVFO 4N5MA 4AECA 5ITZA 1FDRA 3DL2A 3EGDA 3TRFA 3C5WP 3BRWA 4LWZA 4M7PA 1Z62A 3PUHA 1UC5B 5EJIA 4B3XA 4MWEA 3S28A 3BGSA 3G7SA 4UTZA 3QOXA 3AK4A 3PNVA 4E5SA 1U99A 1Z6ZA 4YP0A 2AOTA 3UB4A 2GRAA 3G79A 2ZGVA 3R7FA 1JBKA 2AZMA 3AIOA 2J0UA 1X8JA 2I8AA 4YP1A 4YMVA 3CU5A 5HKAA 3BMNB 5IVKA 1FU8A 3EXEB 3FLAA 2AXNA 4JKYA 4O33A 1HNNA 1OBCA 2G5TA 3PGVA 2I03A 3TNYA 1DARA 2YZNA 2WU4A 2NN3C 4EZIA 2NWQA 2P68A 4WL0A 1T25A 1DI0A 2V58A 3AOGA 1K0UA 5CB0A 3TR5A 2DUWA 3I04A 1RXEA 3WKCA 3PD1A 3AUTA 2CJYA 2HU2A 4UEOA 1ZGHA 2H1IA 2JZOA 1MU0A 2R25B 4ZEOA 3OTQA 3I9FA 3P26A 1OC4A 3BL6A 4DARA 1YHYA 1L4BA 4CTNA 2ZTSA 4Q4DA 3U0BA 3MCVA 4FQ5A 4OHUA 1PLJA 1ZCJA 2IODA 3KC2A 3KOOA 3EGVA 3RVQA 3SEAA 5CCEA 3F6SA 2Y1XA 3VR4A 4JVSB 1MJGM 5EMNA 5IM4F 2CXPA 1UBHS 3CRNA 5DHTA 1DV2A 3Q3IA 1D5WA 4OQDA 4BYMA 1CIVA 1R27A 1ZMTA 2ZSAA 2C61A 2F17A 2R00C 5D1NA 1QDLB 3C43A 3FLEA 5JROA 4AQ7A 1HT1E 4WMLA 1YQGA 5FULA 4H4DA 1W88B 4A5SA 4C6TA 5B5SA 2H00A 4UTVA 4QDOA 2VDJA 3FZGA 3ZV6A 3HVRA 1Y6ZA 2M1XA 3B3GA 3CFYA 3FCEA 1GQRA 3LT2A 4F4JA 1KIFA 4DLKA 1E99A 1FCJA 2R4QA 5HKKD 5LYJF 2ZB4A 3OOJA 1OLOA 1II9A 1NC1A 1EFCA 2JAUA 3GJ6A 1CY6A 4L8VA 2DLDA 2EQ5A 3MGKA 3Q6IA 1I7NA 1B8PA 3VTZA 3W5HA 3C3KA 1PQYA 4QBGB 2GCEA 2O7VA 3WISA 4QREA 4MWGA 4WUTA 1X9GA 1FUIA 3KL4A 1G98A 1M83A 2XGOA 4DEYA 5KC8A 1X6VA 3KXKA 2CY0A 1G16A 4HNRA 4M86A 2F4NA 3ZK9A 1SO8A 4OUDB 4TV9F 4BQOA 4DR5B 4X1OA 2PL9A 1TFUA 3ZPXA 4HZUB 1HXHA 4FMDF 1Q15A 3WLFA 3RGWS 3RIGA 4YMUA 1Y5IA 2FPPA 1RE0A 1O58A 2G67A 2JGEA 2X8AA 3LFHA 3QVLA 1K63A 1WL8A 3VPDA 4MS3A 3RYFA 1VL2A 5CDTA 4G1EB 1NZJA 1OWMA 2UZ0A 1HKUA 3D6MA 4XGKA 1FNDA 4LXXA 4DG5A 4H1WA 3O38A 1GYQA 4BY9E 1XLWA 1OFGA 2H2WA 3GVIA 3IR5A 2I4LA 3U9SA 4E33A 4DV6B 1VIVA 2QTMA 1L7AA 1R0ZA 1XAIA 4QJIA 4XGQA 3OAAD 4JA2A 3P9SA 4KUGA 3V4PB 1IIBA 4JBWA 1WY7A 1OOEA 1RXYA 2VDUE 2GPSA 4Z6KA 2EAUA 3TW4A 4QDUA 4XFDA 4YMSA 5I7FA 3WAJA 2V3VA 4Z1MD 2GFHA 4WBNA 3KB1A 5AKGA 3VV2A 1UWKA 4IHAA 3H9QA 4KW7A 4O1MA 3VBCA 3HCBA 1FLAA 4HTFB 1MO2A 1EK5A 1XHFA 2W0SA 1BXRA 2H92A 4IGKA 4ND6A 4CHGA 4G8CA 1YRWA 2X0JA 4G9GA 2X3YA 4JUAA 5BT8A 5BVHB 5EHZA 4BBJA 3U3ZA 5DM1A 4UBMA 1TKRA 2OCYC 3ANTA 3ER9A 3G7UA 4MX8A 1OI7A 3VNBA 5A2GA 1XXHE 2COEA 2OV3A 4DCGA 5KNLA 4QVKA 1LPAB 3QPCA 3BC1A 3ZY3A 1YZGA 1E4YA 4UHFA 2JIZA 1HH4A 1XT6A 1UJNA 1RIIA 2JFQA 2OB2A 1N8SA 3KOZA 3MFQA 4KVGA 4LDNA 4AJIA 1ECPA 4EEKA 7REQB 4KQJA 1OLUB 4NU0A 3IOCA 2BTOA 1HYBA 4LNUB 3KOWA 2V55B 3H11A 3PYLA 1S8NA 1P2GA 5BY2A 3Q3GE 4L07A 2HK6A 4HWPA 4ZOCA 4EBBA 4GWGA 1IY8A 3LQ4A 1KPIA 5LIPA 1PNOA 4OG2A 3A2NA 4BNZA 3IDSA 4ZVNA 4TTTS 1UPAA 2HNKA 2Q3LA 3VAYA 5K3OA 3WB1A 3VKWA 3VPSA 1A27A 2ON6A 3H7IA 3WIOA 1IK4A 1JZTA 3AI7A 3CTPA 2OD9A 2QTBA 1FDWA 1OAAA 2HSGA 3B36A 5IC4A 1QK3A 2JF0A 4N01A 3RRFA 1DKOA 4MGZR 4UNIA 4Z7JA 5IXJA 1GVNB 3A9CA 2B94A 2JLQA 2PLAA 2TMGA 2ZUWA 1B26A 3ME5A 3TX6A 2WABA 1DXOA 4BNYA 5AVWA 2IOFK 2ZDQA 3GXBA 5HKLA 3HB7A 4R3UC 3HU2A 1R64A 4OHYA 1SKYB 3PHGA 4KQ6A 4RFSB 2BKVA 4WKOA 3B53X 1KIAA 1JMKC 4Y1RB 1MT3A 2FZ4A 2B4KA 1IOVA 1S8FA 3JD4A 4L2IA 2O06A 3IQIX 3BE4A 2HDHA 4QBHA 2GBFA 4XEHA 1ODTC 1ZM2A 4AZ3A 3U1BA 2AFIB 4MWBA 2QNIA 2GZ1A 2AG5A 4HADA 3LCCA 2IYUA 3GJYA 5CEFA 4Q12A 4WLVA 2WHPB 1M6HA 1MPTA 1GG9A 2HDNB 2M9MA 2NTYC 3L07A 3TIXB 2F1JA 2V7QD 4AY3A 2BJVA 2DQYA 2EXXA 2Y1EA 3COVA 4FN4A 5BUQA 4B09A 1LA2A 3I4LA 4K6MA 2WYIA 4BV9A 5C5EA 3AHJA 4QVIA 4YHHB 4KPEC 2OBYA 1B43A 4G6ZA 1V8FA 2X2EA 1J00A 3IDQA 2GLUA 1VI6A 3A1UA 2GEKA 3GOQA 3VZCA 3PUKA 3EYWA 1A9PA 1FPMA 1IWPB 1YV9A 3KXLA 5EE3A 3WTCA 4DPMA 1Y9JA 3V9PA 5JO0A 1OZAA 2HM7A 1V8ZA 2F3SA 2JJ1A 3BHIA 3F0TA 3NTXA 4GO1A 1A98A 3ZK8A 1W87A 2R79A 3NYWA 3RTGA 4P31A 2O8FA 4RPGA 1WXFA 2R1ZA 2C07A 3MJCA 2ZSJA 3QF4B 4E2YA 1PYGA 3DOJA 1XD2B 4JB8A 4Z7NB 1RM0A 1W1WA 1NQXA 3IERA 1I6LA 1F2TB 1N9ZA 2JB9A 1GZVA 3OIFA 5ALHA 3U13A 1JEYA 1P45A 2M98A 2QLJA 5M3BA 1W1UA 3I09A 1ZXXA 1GL9B 2WPDA 3Q2OA 1Y37A 4W9NC 5EMMA 2VJBA 5KNDD 1NJ2A 4UQLA 2XKJE 3AU9A 4YV0A 5AKXA 2MCFA 2IVZA 2PUGA 3RHTA 4OQQA 2FRVA 3KZCA 5EYPB 1SCUA 1T3ZA 2XXJA 3KLPX 4X8HA 5JDCC 5ADWA 4TYWA 4M8NE 5ALWA 3AKEA 2H9YA 2VF5X 1KQ3A 1U94A 1DDGA 3COZA 5IN4A 4K9PA 2FG6C 4QFMA 4I9NA 2FSIA 1POXA 2OYRA 3SHFA 2WHYA 1T5HX 2XTJA 1BTOA 2ZYDA 4ZVPA 4MQFA 1V8BA 3OHMA 1KBZA 1GQQA 2WA2A 3AMVA 4Q03A 1JALA 1L5WA 3BYZA 2QMEA 4JJKA 2W00A 4KQKA 3FYHA 4L5AA 1ADYA 4ASUD 3CUWA 4X20A 3FDFA 3OCYA 5EZQA 4WZBA 5JAMA 3NFYA 4WLEA 1VPVA 3LO8A 2O50A 5EWLA 5TXGA 1U8YA 3FWYA 3JSAA 1I36A 4WUVA 1H85A 3BE5A 4M54A 1EUCA 3RPEA 4B3SB 2X9LA 3TTXA 4B9AA 1AIPA 1OXVA 4KXQA 1Z8NA 1XTVA 3GCZA 1AQIA 4DV2B 4NCNA 1HC7A 2FSVA 2BMJA 3IPAA 3IAEA 4RA6B 5H02A 4D0NA 2AI2A 2W8ZA 1E0KA 2B78A 3IP6A 4R40A 4CT0A 2YVQA 4TWAA 4X8OA 2A9PA 1KU0A 2XUGA 4GX0A 3FF4A 3W04A 4I9UA 5LQMA 3EY9A 3B9BA 1KHHA 3HABA 1SMKA 3OWOA 4MQLA 4OHMA 5I9TA 5B57C 4MI9A 3IQDB 3UHPA 4QC2A 1E18A 1WA5A 1WB9A 1MR3F 4CM5A 5IAGA 3SSAA 5FBHA 2NUPA 3KLNA 1E1NA 4FBGA 1V35A 2JJ8A 1RLOA 4U00A 4WECA 5AHKA 3RBVA 4DA7A 4DS3A 3ZKWA 1L5SA 3FOEC 2XMRA 1X1QA 5COBA 4IJKA 2G8LA 3L0OA 2QLMA 2C2XA 3G3EA 4R8VA 1U3GA 1DAFA 2LDXA 4MW4A 5IZ4A 2WNHA 4UCWA 3NOVA 1I3CA 1I1NA 4ETNA 3DLHA 2ZRCA 4P3PA 2ZRQA 1PGNA 1M2OB 3JARA 2POQX 4L4ZA 3AWDA 4GVPA 4JITA 5IKEA 3Q40A 2WWYA 4EG7A 2NVOA 3ZDAA 1RKBA 1MTOA 2P9QA 3NUZA 5KCZA 5LLTA 1U9YA 5ESRA 4O63O 1KRXA 4EUNA 3IQEA 3RQSA 5F3WB 1LUAA 4D9KA 4IIHA 2RG7A 2H0AA 3VVLA 4AMUA 2XCQA 3SAJA 1OROA 3Q6MA 1KJ8A 2ZUEA 5TS2A 2J3IA 4J2HA 1G4AE 3NHPA 3OJXA 4ABYA 4O4IB 1F17A 4M9XA 3E9NA 1PL8A 3TCNA 2A5FA 5KEIA 3H2BA 3AUAA 2AOUB 4RZQA 3W9BA 4J91A 4URHA 4XIJA 3WRXA 4X91A 1HZZA 1O96A 1SBCA 3NYRA 1GN9A 4RIEA 3K1YA 1BFKA 3DQPA 5JV5A 4EA9A 1LBHA 1YK1A 4WEQA 3D8HA 5AJHA 5EHIA 2PXAA 1KMNA 1CERA 2QNRA 4CR8A 1KO8A 4YAIA 1CQZA 3CCFA 3DFMA 3R23A 3ADDA 2D1TA 3PNLA 4IHQA 2CFRA 2QMHA 4MB0A 7GPBA 1TK3A 2ATCA 1LBSA 2AI1A 2CNLA 5A4AA 4AJJA 3BJMA 1ULUA 1WMSA 1QX4A 2XPCA 3QF7A 5LU9A 4HLCA 2CYAA 2WE8A 1UBGA 4PVDA 4FGLA 3T1QA 2HMSA 2XZPA 4BKQA 1OQAA 4Y6LA 1YQWA 3I34X 3V4SA 3LBNA 3W5JA 5HF9A 3IL2A 2JK1A 1Z0UA 3LBYA 3MILA 2O3QA 1M74A 2XCOA 3VOSA 1IJEA 1O6GA 5AYVA 4DUPA 5IDWA 4ZCPA 1SQSA 2NZ8A 1LSSA 4TSRA 2O7QA 2JCGA 5BT9A 3ZTYA 3VPFA 3L43A 1SUDA 3T7TA 3GCGA 4LQDA 5CR9A 2FOXA 2WUVA 3T54A 4UOEA 3O8OA 5IDVA 4C0QC 2B3DA 4B76A 3SEQA 2ECFA 1ZPDA 4HBGA 1O6BA 2OAGA 3SX0A 3K9LA 4DXDA 1I01A 4LE2A 3LHDA 1X1BA 4ZJYA 4QG7A 1TQHA 2CLKB 2Z5VA 3BGIA 2XWQA 4I4LA 2DMRA 4W1RA 3SFTA 3A11A 4JH0A 5IH3A 5MN5A 2XZOA 1KP3A 2ZKLA 1BS9A 1U8XX 2OPBA 4PS0A 3EW9A 3G9TA 3CT4A 2OGWA 1T36A 3Q9UA 3ZD7A 4CIWA 2I0FA 2WKQA 4DA8A 1V95A 3NBYC 2VOJA 3VYUB 2UUCB 2C4NA 1HE5A 2C4WA 4TKMA 2VJYA 4HB3A 1JFFA 3OJWA 3UJ3X 1YDHA 3DBLA 4W4TA 3RU3A 3VZQA 5DBFA 2J6IA 3V4RA 3I23A 4TYYA 3RUAA 1VLHA 1G291 3SIPA 4D4JA 4DBLE 1TW2A 4FT2A 5J4KA 1AB6A 4DIBA 3TLGB 1LBQA 2A8YA 2GAOA 1U02A 2JRLA 2OTCA 1IH8A 2W6ZA 5GV8A 4B3RB 3AEKA 1L5HA 3PHLA 2IY8A 2YRWA 4E3ZA 1RNLA 4OTZA 3UV7A 4FMPA 4WVFA 1Z6AA 4KXYA 2BONA 5F78A 4CTOA 3R24A 3I6QA 3ZD6A 2Q2VA 1XF1A 1YBMA 4UHCA 1DU4A 1WVGA 1WDLA 2CXQA 4MVJM 4D92A 3GVPA 2A84A 4G0XA 1GAEO 2GD6A 4BQFA 4TV8A 3K70C 4NFYA 4R9RA 4XWOA 3ESDA 2WIAA 4IUCS 3SZLA 4ERNA 2HO5A 2JEOA 1BWPA 5EPUA 3VPGA 3N05A 2OV1A 3BL8A 1T8TA 3AI3A 2AEJA 4DV7B 3RARA 1BCSA 2OCKA 1NX6A 1YFKA 2IUYA 1XYYA 2NAFA 4HPWA 4NZ9A 5EHGA 1XTBA 2DPMA 4J6FA 4UZEA 2AIRA 1Z0AA 3DAFA 3MOSA 1EQ2A 2PWBA 1EFKA 1VLQA 3DUWA 4OJNA 5DYYA 3OCUA 5I7SA 3VVCA 3FCUB 5EWMA 4D6PA 1H6DA 4L0DA 4EEZA 1IQUA 3GLKA 3GRZA 3R6WA 4RA9A 1TFRA 2DTDA 4NYIQ 2C3UA 4KPFC 3W9SA 2PE5A 3MF4A 4CMIB 3UYLA 1V71A 4B7XA 1KYVA 2H5EA 3FOBA 3RYHB 3L6UA 2PJUA 1CZNA 1NRXA 2DQ4A 4KQXA 3VYRB 1XDUA 1XRQA 3LPCA 1YZFA 2YFKA 1GTSA 5I7EA 3OU7A 1VXOA 1DUVG 4AYTA 5DWDA 3LCMA 5PGMA 1H2XA 2CLCX 2OXTA 2ZTUA 1NLUA 4UU7A 1WPRA 1CUBA 1P7PA 2WFAA 5FTLA 3THWB 4ENVA 1CVIA 1GARA 3D7RA 2XXAA 3Q3HA 5ALXA 4LBZA 1OTXA 1CSEE 2VUTA 1JNXX 3QOFA 4BCBA 2ET6A 5DDIP 1YZNA 3BEDA 1WXHA 4BMZA 1BVYF 3CVYA 3V2IA 1KI8A 2JJQA 4ALIA 1J70A 2MIIA 3QSGA 5JSQA 1K88A 3OFNA 4L8YA 3UHFA 1VLZA 2J4CA 2NTEA 5EKXA 2J9XB 1M8FA 1LEHA 1BIFA 2JKYA 2BW0A 3ELWA 4II2A 4TSKA 3ZCRA 2PVCA 3A6PC 1YS2X 3O8QA 4KFUA 1VYTA 2X6RA 4ZI7F 2VNKA 3BJRA 1I14A 4GP6A 5FI1B 4PTZA 5JRZA 5CD1A 3UPUA 1A9XB 1VSTA 4QXOA 5EZYF 4OAOA 4W5OA 5EJ5A 3V7YA 2AHOA 4YALA 2QS9A 4TN1A 4DAEA 2OBMA 2IXBA 1XYVA 2ODNA 4LF4B 3C3CA 3VR6H 3IHWA 5HJ2A 1K9VF 1GA4A 2QJOA 5M29A 2DSTA 1KVTA 1SUBA 4EY5A 2A86A 1ULHA 2E4VA 3S68A 3S29A 1MDBA 4LJ5A 5UKDA 3U4AA 4BTEA 4J0QA 2XDAA 3EDRA 4JNKA 1BEZA 4ZCSA 3FYTA 1OIWA 3HXTA 5DEOA 5DWVA 2ID7A 1S2DA 2GZRA 7YASA 1FFXA 4OQLA 5IMSA 5K2OA 3AVPA 3GELA 3KU4A 2P2NA 1JPUA 1RW4A 1KR2A 2VZEA 4BX8A 4Z8XA 2C9YA 4R1QA 5JI3E 1F2VA 1DHTA 3AG6A 4LRQA 1KSJA 5GWXA 3TEMA 1CDOA 3G2KA 4S35A 5E4FA 4UNNA 2UYGA 2IYSA 3CEJA 3T3OA 5HJ5A 5IZCC 3D2CA 4O2AB 1JB9A 3NJRA 3BSWA 3P97A 5GJBA 1ZD8A 1ZVJA 2BGTA 4RDIA 2HV9A 4KLNA 1CUEA 4MVJH 1EBFA 3F7MA 3W5SA 1SKBA 4Q9KA 5JEEA 2YJ3A 4X0EA 3UJ9A 5GIPE 3DQZA 2ZI6A 2NO9A 3LDAA 3WNBA 3HV0A 4W9NA 1DAIA 3C6ZA 4F85A 2R8OA 2DY0A 2L17A 3CBQA 4BFYA 5F1PA 1HRKA 2VRNA 4RLHA 1FFGA 4JLVA 3JRWA 1RLMA 2XB8A 1WZIA 3CWZA 4HP8A 2RKOA 3QXCA 3VSBA 3QM1A 2VQEB 1P44A 5JDCA 3MFYA 4JXJA 2BV3A 1UBSB 3ANNA 3QXGA 3TEJA 5L53A 3CR3C 5KOIA 2ZB8A 4M8LA 1A8IA 3T1YB 3HYLA 5CHEA 4WOPA 1R74A 1CS0B 2QT0A 2BGWA 1EWVA 4HFNA 3MRXA 5JCOC 4COKA 4JKIA 1IXSB 4X93A 1W19A 2VDOB 4DF3A 2PYIA 3BK1A 3BSFA 4AS2A 4IOJA 3HG7A 4Q3AA 4MZXA 4FOSA 2DJIA 1I4TD 2A5DA 4J7UA 4JD5A 4MI3A 4R2WA 5DYIA 3SYKA 3BXEA 1ZOPA 5E0OA 3FCSB 1NPTO 2M6RA 5B1DA 3JQDA 4K87A 2O14A 2V7XA 4MA4A 4MV9A 1P61B 2IXEA 4A16A 5AQ1A 1QNLA 1CUIA 1KO4A 1X3LA 2AS0A 2OQ2A 3MERA 1NNI1 2RK3A 4A8TA 3BBLA 1Y8ZA 1Z07A 3Q4GA 5DRYA 2NVUB 2PGIA 1ONBA 5BN1A 2IPXA 1LPPA 2JD1A 3B1JA 3W8FA 3EIFA 1IE3A 2GNPA 1PJRA 1UXGA 1TZKA 1H66A 2A2ZA 3AEYA 3GGDA 5LQUA 3BCRA 3ZGVA 5C46F 3JVDA 1GCGA 2JLSA 3NM5A 4OX9B 3EDYA 3GEHA 4MZDA 4NG4A 3U1VA 1OUMA 4OAPA 4X63A 1DKQA 1E3EA 4EI8A 5AM3A 5CDHA 4PLTA 1H5QA 4ZYZA 1YCHA 3IBCA 5EE1A 3CNNA 4JBGA 4NEQA 3UHJA 4N0MA 3HCAA 4JLWA 2QPLA 2GVNA 3UY4A 5LR6A 1FLVA 1XIVA 4CQMA 3EIEA 5LP6B 1S96A 1UBLS 3KVRA 1MKYA 1K06A 1TXGA 1PYDA 3JWHA 4TLCA 3BK7A 1RAEA 1U90A 3TLEA 3ZWVA 3KZXA 2GPBA 1Z35A 2YWEA 2FPKA 3R5SA 2A0FA 2IZ7A 2DR2A 2V7BA 1ULAA 2J41A 3JYLA 2GEDA 2XUOA 3UC5A 2OCAA 4OJYA 5FWXB 1Z2DA 4YJDA 2C83A 4C0JA 1PR5A 1C3OB 3FDJA 3UKJA 1CUVA 2K7ZA 3VR5D 4ANFA 1IXYA 4IDOA 4KU4A 4BMXA 3MMNA 2Q0HA 4YUVA 1T1JA 4FINA 5IFLA 2NZXA 1E4EB 1G6OA 3P7MA 3BRWD 2OGZA 4JBNA 4YCDA 3WB2A 4G3XA 4NDZA 5I48A 4D79A 2Z5FA 4YRKA 4P54A 4BFCA 1TTTA 3FTEA 3VC3A 3RWOA 3NAGA 3QEMB 4KYTA 1S2MA 1IATA 5LDHA 1KOFA 1PDWA 1GXSB 3LWNA 3SR3A 1FJHA 1GUBA 2FSHA 3WQRA 3ZS9A 2PRKA 1KDRA 3OTIA 1N2ZA 1UJMA 4F4IA 5B36A 2F1RA 3ICCA 1C41A 4H77A 1QTIA 2HJ9A 3N2LA 13PKA 5HFNA 2XWBF 3RS4A 1L5MA 3TR6A 4BQEA 2Q5OA 3N8GA 5CH8A 1TZMA 1PW7A 5M04A 3T3NA 4GPIB 1YJAA 4RTMA 2IY7A 1K4YA 2W6QA 3MWEB 1XZGA 1FFDA 4M76B 1EJ2A 3RFUA 1E0DA 1ZQ1A 3ESQA 5FLYA 3QIAA 1E2UA 5FWDA 5KPDA 3ETNA 3M49A 1EVKA 2DR3A 3H3XA 4MIEA 4US2R 4QJ4A 4G97A 2G08A 4NCAA 2VNJA 2MOKA 1DUSA 3LMKA 5LXTB 1IDN1 5FJIA 3VR4D 2JRCA 4YJKA 2O59A 3JW8A 2QK4A 5JSYA 1K7XB 4LGYA 2YMMA 1VYVA 1N0VC 4UHHA 4ZT2A 5AKEA 1BE0A 1T15A 1ZCAA 1R9MA 4N0PA 3BWDD 1JHAA 3OCCA 3PUYA 1UBOS 1P60A 1UPTA 1BVRA 4FIZA 5FJJA 2PUCA 5CPBA 1YXMA 3UAGA 4GICA 1CHDA 1XZJA 3BE6A 4KH1A 4MARA 2OC4A 4JCOA 3FFAA 3ICPA 1ZN9A 2F1KA 1R9NA 2GM3A 1AH2A 4K9KA 2IOHA 2OYSA 3ZTTA 2I4NA 4C7BA 4PPFA 4TL8A 3FHOA 4R9SA 4YX9A 4O3MA 2PT7A 2QTTA 1Z4IA 2C96A 3ZBUA 4Z2AA 1HF3A 1UWVA 4ZCMA 2YJNA 1DEXA 1LK0A 3UH1A 5P8WA 2ZCJA 3LKDA 1HMYA 2W4MA 3RS2A 5IRCD 1X42A 4BJ3A 3L0ZA 1L5KA 4PINA 1EEXB 4FDLA 5BP7A 2EX0A 3WLIA 1Y42X 1B2LA 4MV5A 3BPSA 4ZIRA 2C88A 4L73A 4A6PA 2YUTA 3QJ5A 4KSYA 2RH5A 2QPTA 4RNCA 1IJFA 4NXNB 2V0NA 2W4QA 5F7XA 5E2AA 3L8HA 3MC1A 3KT6A 3LQYA 4XI9A 3U5TA 1S4MA 3TNJA 1YC2A 1QH1B 1K8ZB 1P3DA 1DRKA 1Q0HA 1R5NA 2JCXA 1PQPA 4XCVA 4DPLA 3U7GA 3B9RA 2HU8A 3I30X 3P71T 3II6X 5CVEA 3BMOA 4YT5A 4MROA 4MICA 3IAS1 3BMXA 1YH3A 5F4BA 1OLXA 1DEHA 1H2YA 3DW3X 4JSTA 4RSGA 3GNQA 2ADFA 4N0DA 5AVRA 1QF9A 1KIMA 3NVKI 1PV2A 3A25A 4G8JA 5T6BA 3ZTWA 4W5QA 1F7VA 3ZZ0A 1KEPA 2EBUA 3RLIA 3TM4A 3KJQA 4L22A 3RF7A 1T5OA 3WFZA 4A4DA 4D74A 3GPLA 3WICA 5JWOA 2DYKA 4NBRA 1S8AA 2E4UA 2V7UA 4JJGA 4XWWA 1MA0A 4FZ3A 3UT6A 4JJ6A 3QUTA 3DEJA 4KDRA 4TWRA 4BVGA 2HR1A 1ZD5A 1M1XB 4H17A 4ZRMA 4BLOA 1M10A 3HUUA 4AYWA 3G49A 4X85A 4EB6B 4JDPA 2JIZD 5THXA 4AS3A 3VC7A 3FOCA 4ARVA 2P6PA 1NBIA 3A1EA 5DBEX 2IXAA 4U3JB 2FLKA 3W1EA 1C9YA 2QAGB 1KRWA 1FNNA 3N7UA 3QPWA 2Y0BA 3QYFA 3QY9A 5J4HA 1BX0A 4URWR 2FI1A 4XB1A 3WK8A 3DTTA 3LHKA 4QTZA 1LZLA 1EFDN 1QCCA 3E7FA 1E59A 4WLNA 5G1PA 2YINC 4WCVA 4OMUA 3OE4A 4OHCA 5CA1B 1CB7A 1OPRA 2G9QA 3JX9A 3Q2KA 4WADA 4TWIA 2Q5LA 4NBWA 1IVSA 1LY1A 3KK0A 2ZIEA 1HY3A 3LLUA 3KVNA 4YLGA 4YRDA 1EG7A 3GWZA 4V0SA 4UU0A 4BNWA 3IODA 3T1TA 4Z3OA 2VBFA 2W48A 3OCXA 2XRFA 1EX1A 1WP4A 5CLLA 5A05A 1J0AA 4R6WA 2YYYA 1KZGB 4C5AA 6YASA 4L3WA 2O6HA 4JIGA 1X7ZB 3ZXIA 2I6QA 4DANA 3QG5A 1HK7A 3SHWA 4YR9A 2FPRA 4RJTA 4YCCA 3F6RA 4KI0A 2C5HA 3PIIA 1N5JA 3ZHYA 1T6NA 4H2DA 3S1AB 5BQFA 5A4JA 2C9ZA 2PKWA 1EVIA 1QV7A 1W93A 1Z38A 3RG8A 3LC2O 4Y6QA 3WO0A 3Q12A 4GMXA 3SLRA 1FVXA 2VQ6A 3GMIA 4MOWA 5B1SA 1U8UA 1ZKMA 4C0WA 1C3XA 1NUPA 2WNIA 1NAHA 1WP9A 4NOKA 4EWLA 2KM1A 1S7CA 3RKUA 4MS1A 2VWPA 1KYXA 5AKKA 1PBTA 4CFSA 2O8EB 1KVSA 4PAWA 4BN0A 4NWIA 2B35A 3MOGA 1V6SA 2QG6A 2OSVA 2AFVA 4O25A 5LBIA 2X0KA 3DTVA 3N8DA 1C1XB 2B1QA 3HDJA 4S1WA 5LB4A 4BLRA 1UANA 2OGTA 2Q6LA 2ZTLA 4ND5A 4WZ6A 1QIKA 1JT9A 3HB0A 3IILA 3HNPA 4H15A 2HCRA 1PSZA 2ZIZA 1JLKA 4B6RA 2R96A 1ADJA 4I14A 5CAEB 1FFHA 4OKNA 3SY8A 3PGJA 2EDAA 1DX4A 4LK2A 2JVKA 4YO7A 5DW0A 5F9FA