4U7TB

Crystal structure of dnmt3a-dnmt3l in complex with histone h3
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
187
Chain Sequence
FMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGVRVWSNIPAIRSALVSEEELSLLAQNKSSTKLVKNCFLPLREYFKYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (cytosine-5)-methyltransferase 3A
publication title Structural insight into autoinhibition and histone H3-induced activation of DNMT3A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase regulator
total genus 46
structure length 187
sequence length 203
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4u7tB00
2A14A 2YXLA 3OZTA 4EQZA 2IFTA 4BP1A 4V0QA 1ZQ9A 5U4XA 4EKGA 3EVEA 4LECA 1D2HA 3NDIA 2Z6QA 5FCDA 1SKMA 1XDUA 2HMYB 3M70A 4FGZA 5K0BA 5GIPE 1QZZA 3FUTA 5EMJA 4ER3A 2GLUA 4OQEA 2PLWA 4RVFA 3TOSA 3NVKI 3MB5A 3HA7A 5P8WA 3DMGA 1Q0SA 2EX4A 3LCCA 3B3JA 3O7WA 3GRZA 5K0JA 3SM3A 5DM1A 1RJGA 1P1BA 3BWBA 3M6UA 1FP1D 4PYIA 1EIZA 4AZVA 3OZRA 2QY6A 2GPYA 3KQOA 2WK1A 2C7QA 3DLIA 3EVCA 1WXXA 3QOWA 4FS8A 3GWZA 1G8AA 3P71T 2NXJA 5K0GA 3PX2A 4KDRA 2ZZNA 4PIMA 5FQNA 1EAMA 4X41A 4EKIA 3ERCA 2OZVA 5E9QA 3NWBA 4PYQA 3HVHA 4KIGA 4DMGA 2FYTA 3E23A 2ZIFA 4C05A 1NW5A 1NW8A 2P7IA 3AXSA 1N2XA 4HGZA 3C3PA 3UJ9A 4CKBA 2OYRA 3B3GA 1YF3A 4GC9A 2P35A 4IV8A 3A27A 4O29A 1BHJA 2I7CA 5DX1A 4CXMA 3CJTA 2C7OA 3LKZA 2IH4A 3SR4A 2ZCJA 4MQ4A 2BM8A 3BKXA 5GIOE 1TW2A 2NXCA 2YVLA 3OCJA 4E30A 4FT2A 3G2OA 3P2KA 8MHTA 1O9HA 1NV8A 2CMGA 3DMHA 3ELWA 2O07A 3OU7A 5E1MA 2Z6UA 4IKPA 3MCZA 1SUIA 1V39A 5EOVA 4GQBA 2P3OA 5C1IA 1XXLA 3G5TA 3KQTA 3UA3A 2QE6A 2PWYA 5GP1A 3TR6A 4YV1A 5KS2A 3FTEA 3HCEA 5EMLA 4MWZA 2B2CA 1NE2A 4ER5A 3MHTA 3I58A 5CVDA 1KPIA 1XJ5A 3G2PA 4CTKA 2ZZKA 5HFJA 2AOTA 2JHCA 5IKMA 2N47A 4CKEA 2PGXA 3HCBA 3FPJA 1BKYA 5DTMA 4C4AA 2I6GA 4NECA 5DXJA 4C06A 3SSOA 5F2NA 4R8SA 1O54A 3MAGA 1SUSA 1JTFA 2VDWA 5BW5A 1P91A 4PWYA 3HNRA 4U7PB 2XYVA 3DUWA 3OU6A 3BWMA 2WA2A 2I9KA 4E31A 10MHA 5HIKA 1HMYA 2R6ZA 5FHRA 5FTWA 2PXAA 4ER0A 4PYJA 3B3FA 3LCVB 2PX5A 2AS0A 3UBTA 1EG2A 5E2AA 3QOXA 4FT4A 4OA5A 1JQDA 2FRXA 4Y30A 1JSZA 4QDJA 1I1NA 5DXAA 3IEIA 1SG9A 3KU1A 3B7PA 3BGVA 3NTVA 4PYNA 3DP7A 3SVZA 2AOTB 4RTLA 3CCFA 3C0KA 4HTFB 3S68A 4GOND 1ORHA 9MHTA 2PVCA 1R74A 3F4KA 2AN4A 4P7JA 1L3BA 2YUIA 1G6Q1 3KKZA 2IPXA 2FK7A 3EVGA 1TPYA 3GRUA 5DX8A 5K05A 3HTXA 3MQ2A 3EMDA 1MJFA 5DM4A 1KR5A 4C04A 3P9NA 3FPGA 1N7JA 3NWEA 4HC4A 2P3QA 4YMGA 4KWCA 3EGIA 5FUBA 2HTEA 1IM8A 1XCJA 1RJFA 1R6AA 4FSXA 3E05A 3JWGA 3NJRA 3ORHA 5FHQA 4AZTA 1XTPA 2CKDA 5HZMA 1AQJA 2AVNA 2O05A 2UYQA 3TPZA 1L9KA 4LWPA 1MHTA 1BC5A 2VDVE 1NW7A 3M33A 2P8JA 2EG5A 1KIAA 1B42A 2ZIEA 1WZNA 1X1BA 4C08A 2ERCA 2BR4A 1NW6A 1DCTA 3EVFA 4MIKA 2H11A 1QAQA 3WSTA 4KRGA 3D2LA 4IWNA 4OBXA 3HVKA 3PFGA 5FA5A 2PBFA 4A6DA 1QYRA 3DXYA 2YX1A 3V8VA 2FCAA 3Q7EA 4FSDA 4FZVA 3RW9A 3HCAA 3UJ8A 1DL5A 5M5BA 5LQAA 3FPEA 5EVJA 1L3IA 1KP9A 2PKWA 3ID6C 4CKCA 2NP7A 3OE5A 4BY9E 1VLMA 1RI5A 1NBIA 2HV9A 3SX0A 3G5LA 4X60A 5DWQA 5FA8A 3NMUF 3KQQA 4M7RA 3EGVA 2NP6A 4AZSA 3SSMA 5JUWA 2LD4A 3TKAA 3BWYA 4BP3A 2XBMA 3CGGA 5HEKA 2XYRA 3DLCA 3KHKA 3OFKA 4X1OA 4GC5A 4DQ0A 4DKJA 3AXTA 3LHDA 1AQIA 1YZHA 3KR9A 5EKXA 1R8YA 2ADMA 2XYQA 3GO4A 3LX6A 4XUCA 5DLYA 3SMQA 1ORIA 3LSTA 5EEHA 5GOZA 2Y1WA 3EVBA 1VBFA 2YXDA 5ERGB 3GIWA 4P58A 1X19A 1UIRA 2BR3A 2G8NA 2ZWVA 5EZSA 1VIDA 4P7KA 5FULA 1TW3A 1YFJA 3LCUA 3PTAA 3EGEA 2AR0A 3BKWA 2HWKA 3LDGA 2P3LA 2G70A 3PFHA 5E8RA 3EVZA 3DTNA 4HG2A 4YUVA 3A25A 3FTCA 3ER9A 2AZTA 2PWPA 5CVEA 1WS6A 4RTQA 3E7PA 1P39A 4DZRA 2DULA 3BUSA 2YQZA 1WG8A 2C7RA 1EQAA 3GGDA 3R6TA 5DT2A 4RTPA 2PJDA 3R24A 1M6YA 2JG3A 5K0FA 3AJDA 2AOUA 2B3TA 5EZQA 3LKDA 3K6RA 5D1NA 3EPPA 3VYWA 2ZZMA 2H00A 3UJ6A 1IXKA 2GA9A 1OR8A 1PRYA 1VE3A 3O31A 3THSA 3A26A 4K6MA 3BGDA 2EJTA 4RSRA 2PT9A 1JR4A 5C0OE 4ISCA 3FPFA 3FTDA 4HSGA 1P1CA 3FRIA 3G8AA 3P2EA 4OQDA 5DTRA 1JSXA 3HCDA 2V7EA 4RTJA 3VC1A 5DTQA 4LG1A 3LGAA 3LBFA 4BLVA 2PT6A 1FJXA 1IY9A 4DM3A 1R18A 4HTFA 4MTLA 4R6XA 1KYWA 5K01A 2IGTA 3TFWA 5H02A 2ZBRA 5K0EA 3GU3A 3IV6A 4OA8A 2UYCA 3BT7A 5CVUA 1VPTA 1SQFA 3BZBA 2ZVJA 5LQCA 1QAOA 3M6VA 3DXZA 4PCAA 3KPYA 1VL5A 2AOUB 3MGGA 3FZGA 5IH3A 3R9XB 3UWPA 4DCGA 5EQJB 3GDHA 3CJQA 2B9EA 1SVUA 2ESRA 3KPJA 3LBYA 4QTUB 4XUEA 5T6BA 3VSEA 4RTRA 4RTOA 4AZWA 3V97A 1NT2A 3ELYA 3HVIA 5LSAA 4RTSA 3K0BA 5KQRA 1VP3A 3EVAA 3ME5A 3TMAA 5BW4A 1D2CA 1YB2A 1L1EA 4UOEA 5LR6A 4PNEA 5EKUA 4E2YA 1G55A 2ONZA 2QYOA 3C6MA 5EIFA 2IP2A 3GRRA 5ICFA 2GS9A 5ICCA 3LPMA 4POOA 3KR0A 2AVDA 3PT9A 3FUUA 4CTJA 5EMKA 3UJAA 2P7HA 3DULA 4PYMA 5HILA 4Y2HA 5K8VA 1M0EA 3TKYA 3LDFA 5DRYA 2OO3A 4ER6A 2GH1A 4PYKA 3T7RA 1YFLA 3CC8A 4V0RA 4M38A 2QM3A 3HCCA 1JQ3A 1EJ6A 2UZ4A 5BXYA 4R05A 3IHTA 1X1AA 2HNKA 2P41A 3PX3A 5KVAA 3NDJA 3UJBA 2NXNA 1KHHA 1INLA 1UFKA 3C3YA 4RYLA 4RV9A 5CUQA 3TLJA 5ICEA 5E9WA 5KQSA 1KPGA 3SXJA 4IV0A 1EJ0A 3G2MA 3H2BA 3M6WA 2AN3A 2R3SA 5DRTA 1X1DA 1G38A 1H1DA 4GBED 4X63A 2ZBQA 3EMBA 4P7GA 1YZ3A 2JHAA 3NVMB 5DX0A 5EMMA 1RI2A 3BWCA 3RIEA 5CCXA 4OBWA 2NYUA 1F38A 2G71A 2P1DA 2UYOA 3I9FA 4GF5A 2H1RA 3A7DA 1ZGAA 4H0NA 4YV0A 2UYHA 2P40A 2OY0A 4QVGA 2ORED 2BZGA 2OPBA 3G7UA 3JWHA 4KW7A 3CBGA 1RI3A 1VP9A 5FQOA 1JG1A 5CD1A 5CM2Z 4QQNA 2ZLBA 2YTZA 3E8SA 3P9CA 4GOMD 4AUKA 5HOQA 3B89A 1FBNA 1FPQA 2E5WA 2PSSA 3HP7A 1O9GA 3SSNA 1NV9A 3OZSA 2ZW9A 3TM5A 5DSTA 3UZUA 2YXEA 3KPVA 2G72A 1F3LA 3SGLA 3UA4A 5CVJA 3C6KA 3UJCA 2FPOA 5GINE 3IYLW 5K03A 1RJEA 5LQKA 4PGGA 4KIFA 3GNLA 2Q41A 4XUDA 3FTFA 4E33A 1T43A 2EJUA 5EG5A 2GAFA 3TQSA 5EIWA 3QV2A 2PV0A 4ER7A 4QDKA 4PINA 5E1DA 4QPNA 2IIPA 2PY6A 4YMHA 3KQSA 2EFJA 3P97A 4E2XA 3G89A 3R3HA 2OB2A 4DA4A 1N7IA 3A7EA 4GEKA 2CL5A 4YUWA 3M6XA 3M4XA 1SQGA 2ZFUA 2JJQA 5G02A 4R8RA 3KQPA 1M6EX 4RX1A 4A6EA 5GWXA 5HIIA 4E2WA 4RVGA 2AOVA 5CVVA 3BGIA 2V74B 4G56A 4AX8A 2PXXA 5EEGA 1KYZA 4PCLA 4EK9A 1RI1A 5GM2A 2WA1A 5GM1A 2OBFA 3P8ZA 2BM9A 1QAMA 3HCFA 3T7SA 5F2OA 4ATNA 3X0DA 5JR3A 3UJ7A 5K0CA 1XVAA 5LQNA 5EHGA 3R0QA 2AOWA 2YR0A 4YUYA 3I53A 2O57A 4HGYA 5K0NA 4OX9Y 1ZHFA 1JG2A 1U2ZA 5MHTA 4U7TB 4E70A 1VQ1A 1UWVA 2IDJA 3BXOA 4CWAA 5DM2A 3GCZA 2B25A 1NW3A 4E32A 4DF3A 5HIJA 3CKKA 2PX8A 4RWZA 3RODA 5T67A 4BLUA 3HM2A 3KPWA 1R8XA 2IDKA 1AV6A 3ELUA 5K0LA 3FRHA 2VZ9A 1G8SA 3MCTA 3EVDA 4HH4A 1WXWA 3B5IA 4YV2A 1RI4A 4KVZA 3CJRA 4YUZA 3I5UA 2O06A 3KQWA 1JQEA 5EPEA 3KR1A 1Q0TA 4E2ZA 2VDUE 3OU2A 3AWIA 3T0IA 2Y1XA 4QTTB 2GB4A 3DXXA 2ZTHA 4DCMA 5C9ZA 2XVMA 3PB3A 1ZG3A 4C03A 3EEYA 1ZKDA 4M36A 2VP3A 3OPNA 2JH8A 3TM4A 1PJZA 3O4FA 4GUAA 4KDCA 3T7TA 2AN5A 1HNNA 3CVOA 1RJDA 3Q87B 2Z6AA 1G60A 3HEMA 1KPHA 4L7VA 5LQRA 2OB1A 3GXOA 2BH2A 4WVLA 3FPHA 1D2GA 4HRAA 2NXEA 5D1HA 5LQUA 1XDZA 1NKVA 3U81A 3DMFA 2ZSUA 3OE4A 7MHTA 2CWWA 1JG3A 2FHPA 2ZBPA 2ZIGA 4Z2YA 2OXTA 5ICGA 4XCXA 5CCBA 4B17A 2ZWAA 3HVJA 3GRVA 2G1PA 5FWDA 3FYDA 3JWJA 5DM0A 3G88A 4EMSA 1NBHA 1AF7A 3DOUA 1XDSA 1BOOA 3FUVA 2QRVA 3PVCA 4PGHA 5E8JA 2DPMA 3LDUA 5B1SA 3TRKA 5BP7A 3MERA 3NW9A 4GOLD 4QPPA 1FP2A 2OKCA 3MTEA 3DR5A 3P2IA 4YUXA 3ER8A 1L3CA 1WY7A 2PX4A 2PXCA 5E2BA 4R6WA 1QANA 1XCLA 4WXHA 5HIMA 5CIYA 4ZTBA 3MTIA 2O0LA 3I64A 4M37A 3FYCA 4RTMA 2ZULA 3FUWA 2KW5A 5EGSA 4LWOA 2PX2A 4C07A 5FADA 5KYGA 2IH5A 1Y8CA 4GOOD 3THRA 4MHTA 4RVDA 2IH2A 1JG4A 3GRYA 4F85A 3UFBA 3P9IA 3PLAE 1X1CA 3DH0A 4QVKA 3FUXA 3KPUA 3L8DA 4PIPA 5F2KA 3KQMA 1JTEA 2HR1A 2JH9A 3G8BA 4PONA 3P9KA 2XVAA 2B78A 4PYLA 1KXZA 1Z3CA 2QRVB 3JWIA 4P7FA 2CMHA 4X61A 4RTKA 4EVIA 4F86A 3ELDA 5K09A 2IBSA 2ONYA 3VC2A 3LECA 4F84A 2K4MA 5E1BA 4RTNA 3GJYA 2F8LA 4FR0A 2NNWB 3A4TA 5E9JA 1YUBA 5T64A 4QQKA 5LQJA 3KQVA 3PS9A 2BR5A 2C7PA 3HA5A 5EC8A 3AY0A 2I62A 2AOXA 5E1OA 3UJDA 3EEOA 3G2QA 3OFJA 4RVHA 1DUSA 4PYOA 1R00A 2FK8A 3KQYA 1ZGJA 5DSXA 4FP9A 2IBTA 3LL7A 3KR2A 4BLWA 2VS1A 4JXJA 3HA3A 1I4WA 1I9GA 5DPMA 2JHPA 5EHIA 5FWAA 3ANXA 3REOA
chains in the Genus database with same CATH superfamily
4CR8A 4WUVA 3O3MB 4PWZA 2Q8PA 3OX1A 3V48A 4FR5A 3D6VA 1U63A 1VDMA 4FYKA 3EVEA 2IUTA 5KKAA 3I04M 3MGAA 4IQ8A 5TE9A 3EFHA 4MCIA 5SY9A 1ZCJA 1U6KA 4QGHA 2IHNA 3FPKA 5JNRA 2EGUA 1CZHA 4EG0A 3N0XA 4D5GA 1UQUA 1N3IA 1FDWA 1DWUA 5LZ7A 2FEMA 3PC8A 1EX1A 1NVEA 2KM1A 1E61A 4U6SA 4NBWA 5JXJA 2WTMA 2IEBA 3UT0A 3U09A 1OJLA 3TZKA 1QIMA 3UWOA 2NUPA 3GW8A 2XF8A 2Z2IA 3AY6A 2D2VA 4UMFA 4XGQA 5B58T 5CB6A 5FQNA 3J81A 1JYSA 2HU8A 4IRMA 3L5OA 1KTIA 2W0MA 4Z9XA 2QV7A 1N57A 4LE0A 4EY3A 2OZVA 3GARA 3E9EA 2ZITA 3O5AA 3GLIE 4DV0B 4S04A 1GQQA 2P7IA 1PGNA 1V35A 4C0JA 3LUPA 2I7CA 5EXPA 2AEEA 4UVHA 3DWFA 1U2SA 2VNAA 3KXLA 4OQFA 3NS7A 4D4GA 5A4IS 3EDRA 3HDYA 4AWXA 1NI3A 1RNLA 1VKHA 2I4LA 4LRTB 4NQRA 2VHVA 4FC7A 4BWYA 2PWAA 4QYSA 3AJ9A 1TTQB 1IYZA 5FJIA 2J0SA 1NA5A 3G82C 2NUPB 4YRQA 3OZXA 1WZCA 4RV5A 5JT1A 1QIEA 2L0XA 4KYUA 1SCNE 2AFIE 3J7TA 4Z0HO 2MMCA 4OVKA 2OHFA 1PR9A 3CRZA 1YDMA 2F7SA 4KTTE 4ER5A 3FAZA 4RZIA 4B6GA 3HB7A 1HEUA 3CXUA 3WK8A 4BWGA 3GVXA 2DX7A 2H1IA 2JHCA 3C6BA 1YQQA 3PKIA 3M1LA 4PCVA 1U0OC 5A0TA 4UUPA 1HDYA 3BL6A 4OQYA 3GG9A 1R0KA 1PJLA 3K9QO 4PLZA 4MTCA 1JR3A 3COYA 2P4HX 4MQLA 4R8SA 2F59A 3R7NA 1S8FA 3L2OB 1I9CA 1EFRD 2NSHA 4B35A 1AH2A 2ANBA 4OUDA 1KE2A 2ZJ0A 3DUWA 3PQ7A 4UZFA 3I1IA 1I2BA 5GJCA 3RNLA 2D5CA 1VIVA 1BGVA 1BKSB 1FVFA 2HQRA 1S02A 4CMAA 4LOJA 4J7AA 2VPZA 4OJNA 1CEQA 1L5MA 1Y7PA 1ND5A 1Z4IA 2BUBA 5T6MA 2IITA 3IPXA 4GG1A 3RK0A 3QX8A 1HEYA 4B2PA 2ODPA 3IEIA 2EF0A 1WMEA 2WINI 4U5XA 4DGSA 2WP8J 1KOGA 2ZUCA 2ZYIA 1F5SA 2GZMA 3W5HA 1WDTA 3R20A 3SBOA 1VE1A 2HJ9A 3CH5A 4QUHA 3JYHA 2AYYA 1UPXA 4X1KB 2O8EB 3V34A 1R74A 4TT3A 1T9DA 2Y1GA 3FX2A 3K9LA 8ABPA 1EFPB 4WK6A 3PYLA 4HGPA 3E6AA 4IGEA 3V4LA 1KJQA 4OB6A 3N7TA 3OIWA 5DM4A 1L4KA 2X3UA 4JLBA 5IVPA 3ICQB 1NM5A 2JFHA 1U0JA 3AGQA 3B6EA 3GGPA 3H2GA 4OUDB 4PQGA 3A3OA 4RGVA 5FUBA 2ZBVA 4UTNA 2NO9A 1ZVMA 2FSSA 1R6AA 2Y2UA 3H6GA 3WNCA 4LFBB 3U17A 3DAOA 4IIDA 3AKCA 2FWRA 1KMIY 1LH0A 3WRWA 3M3HA 1A7KA 2QMEA 2ZYAA 3CG0A 5TVKA 3AW8A 1OFUX 3NJRA 4OTZA 3FIUA 2ZXEA 4IDGA 2GKSA 3SYMA 2C77A 2WNSA 4DG9A 4EY7A 1MZPA 1Z56C 2MYPA 5E6SA 5FHQA 4INOA 2B30A 2HSEA 1J9ZA 2WHYA 3EZ7A 4M1WA 3X2SA 4DTCA 4KO4S 2DR2A 2ACEA 2W2OA 2I03A 1ZEMA 3CTPA 1ORVA 3LY8A 4P84A 3VYTB 2F8SA 4I66A 5IXJA 2FKAA 3UGQA 4ARUA 1DCTA 1A98A 1HT1E 1N5MA 1Z6TA 2AMJA 2Y99A 1EWYA 3LZ6A 4TQ9A 1Z7WA 2UVDA 4KRGA 4WXPA 2D7DA 1DKUA 5FA5A 2J5KA 4DG8A 1L7XA 5DHFA 2CLEB 1CUZA 1MO2A 2HJRA 4QE3A 2J45A 3S1AA 3CU5A 3ER6A 1N6PA 4JGIA 4LRQA 1KI7A 4BASA 5JVDF 4WZBE 1IVNA 2BJHA 4ZVLA 4Q39A 4BBPA 5LNK6 4YAEA 1COWD 1WVGA 1KKMA 1NY5A 2GM9A 4M0DA 1IXZA 2FOXA 4XB1A 3JYLA 4J2OA 3SBDA 4AD8A 4EJ6A 5AWFC 5E6SB 3A04A 4BP3A 2M32A 4QGBA 1P44A 1RYMA 2P68A 2F3PA 3R3ZA 1GADO 5GTDA 1TYZA 5HG0A 3T1NA 3OTOB 5FTLA 4BUZA 3QJ5A 4OLAA 2GBLA 3RQSA 2QMZA 2Q2WA 3KCNA 5DLYA 5ABPA 2GBCA 2R8PA 5EEHA 2R00C 4CR7A 3I23A 5JATA 2V3CC 1NOIA 3H5RA 2ZT7A 2PKXA 5LWQA 4J1TA 3RRJA 2E7ZA 4HVCA 3S1AB 1KFJB 1EVJA 5ULLA 1O4VA 1STOA 2VBFA 3KXDA 1EK1A 1E7SA 4QRIA 4DKXA 4XVHA 3LCUA 2I6QA 3PFHA 1IK6A 2X7XA 4B3SB 4V3BA 3DB1A 3UAWA 3SOPA 3P5BA 2XBLA 3AI7A 2E82A 3B78A 1PT9A 3R3YA 2ZYTX 2AZTA 3QY9A 2R1UA 3WY9A 2CYBA 4FYPA 3ZCSA 4WZBA 4R2HA 4AK9A 1ZXXA 3SC2B 1D5CA 2JIRA 4ZAXA 1JE0A 5DT2A 1MC8A 4RTPA 4F12A 1NVVQ 2G1KA 1FP7A 3VAZA 3R6DA 4URYR 4EF6A 2ZPUA 4NEGA 5JISA 1MJNA 1A7AA 3A4VA 3ZI4A 1ZJYA 1HDOA 1HDCA 3ELBA 3CF4A 3RJ9A 3LX4A 4G1UC 4ZJUA 1E5QA 1E2DA 1C2YA 5I7UA 1ZONA 1X3LA 4LBWA 3LWBA 4ZODA 1JE1A 1SPBS 1OZAA 3L7NA 4YRAA 2GAJA 3DZCA 5K4AA 1M6HA 2FZKA 4LK2A 1X9GA 1N8NA 3NYWA 5A4MS 3KZMA 2EW2A 3D7NA 4D3XA 5B64A 5J2TB 2IGTA 1JTVA 3HB4X 4KFSA 3NKFA 4M21A 3UV7A 3BT7A 4TXLA 3VBEA 3DFMA 4N54A 2W6QA 2VKTA 4HYYA 5ITSA 1I6KA 3KKMA 1U98A 3FZGA 2E55A 4WBXC 4ZVVA 2ISSD 3MILA 4MRAA 4LHWA 3IS3A 2QG6A 3UK7A 4JN6B 5GQSA 4GZMA 4QJBA 4D92A 3SF0A 4N4AA 4RTSA 2OQ2A 5K4HA 1Z5GA 1D2CA 3OCZA 2IEDA 1ZYUA 2GZ2A 1G6HA 1R6UA 1O5IA 1L6RA 3DF7A 4G0PA 2Q4DA 1GPBA 3GRRA 3BSYA 3T3MB 1DIBA 1TD9A 4NPCA 2QR5A 3LPMA 4F4FA 1GZSA 4BLPA 4I4IA 2J5BA 1H22A 2OHVA 3IT1A 2QGNA 4H4DA 3M9WA 3KOWA 2EKPA 1LLUA 4ZANA 4CVNA 4JQYA 4TYMA 1DIGA 1M34A 3E2IA 5C4IA 4ZT4A 1KI8A 3WK7A 4CU5A 5F4BA 4FDLA 1YFLA 3IR7A 3NHWA 4V0RA 5M2QA 1K7SN 1SKYB 1A1SA 3OHSX 5BXYA 2JZNA 1WXHA 2ZJ3A 1PZMA 2BV3A 5H83A 4I0WB 1KNQA 4RV9A 3O1LA 2YWHA 1CZNA 1SZPA 3SXJA 3WLEA 4RK0A 3H2BA 4LV5B 3PHGA 2WAYA 4HVAA 1X15A 3O9MA 1YCFA 5BNFA 3P0IA 5EUCA 1E7RA 2KYRA 3PSHA 5EMMA 3WGZA 5CCXA 3RYTC 3NUGA 2BEWA 3DBRB 3R7DA 1YR8A 1XRNA 1XJCA 4HDKA 1DDIA 2G71A 3GT0A 3H5OA 5IABA 3UMMA 4XCQA 2G80A 4EG1A 2WE8A 2NVUA 1M34B 2IX3A 4HF7A 3IR6A 1BOFA 2HJVA 2HUPA 3KS9A 4DWJA 5A4FS 3M8KA 1CFZA 2W00A 2ONJA 3G0HA 2EYUA 2RGUA 5H70A 3A3KA 5HR5A 2ILTA 2E4UA 5JNLA 1SHUX 2FWIA 2O5EA 1J9EA 3HP7A 4A8PA 1KDPA 1ESCA 1D9ZA 1YH3A 2JH3A 2OHOA 3Q8LA 4M0PA 4J94A 1OH8A 2BSAA 2QLTA 4FFMA 5HQJA 3P4XA 3HBNA 3LX8A 4O2BF 1F6BA 1GUAA 4N6OA 4XW2A 4PY2A 3KYCA 5FTKA 3D6UA 3ITNA 4EAQA 3AVVA 3TQSA 4L3VA 1KJIA 2BEWB 3R7WA 4HDKB 1USKA 2IKQA 3LNCA 3S8MA 4CE6A 4QD3A 3O84A 2XSZA 2IDMA 1EM6A 3QQPA 4NYIQ 4ZPXA 1WAMA 4IOLA 3O4JA 3K1JA 4BE9A 2BDEA 4OI1A 1EYZA 2QX8A 1ZK2A 5LUAA 5F9HA 4LJ4A 3AU8A 1T3ZA 4AO7A 4A5SA 4C29A 4X84A 1FDTA 5EWLA 4EJFA 3M9LA 4LJRA 4NXNB 3NHZA 2EZ8A 3V7FA 1F8GA 1RYZA 3P2MA 4FCWA 2FAXA 1ECPA 4HNAB 3ZE7A 4CKYA 2XT9A 5GM2A 3Q5EA 4GWKA 2BM9A 5EJ8A 4TRMA 3KYCB 1CUBA 2B7BA 4BGVA 4DRYA 5ALDA 2IYFA 3K09C 2YR0A 2JJ2D 4HGYA 3JVDA 1ANKA 1ONBA 2I8AA 2JA2A 3HJBA 5K6RA 2NG1A 5KX5F 5MHTA 1OBCA 3NBQA 4E3ZA 1JHAA 1JV2B 1QKKA 3BXOA 4LN1A 4UU8A 2C31A 1TK3A 4QYWA 4KXYA 3CKKA 3LFHA 2FZ4A 1DJOA 3PEYA 3P32A 1I51A 1K8ZB 4PLGA 2C96A 1GQSA 4KQCA 4RHFA 3WK9A 5SZJA 5K0LA 3USES 5EWLB 4ZD6A 5K1ZA 1U7XA 3DG9A 1L7DA 1SIOA 1TM1E 5F7ZA 3ETEA 4XDHA 3PL5A 1WZIA 2Y1DA 1HORA 3DYIA 1SVSA 1C9YA 2H57A 1N3LA 5HTKA 4FW9A 4CF4A 2R0QC 2BDUA 1XN1A 2ZS8A 2AHRA 3KAJA 3Q12A 1SZJG 2LCIA 4G4SO 2QZ4A 2VDMB 1J90A 2FH5B 2V65A 1SWVA 2GERA 4GXRA 2J5XA 4BDTA 5FF9A 3VQTA 4L73A 3FD8A 1GTZA 3KIPA 5IAEA 3W5DA 3HEMA 4PG6A 1F8UA 3BHJA 3O2NA 2RKBA 4M49A 1A82A 1U0HC 4NARA 1DBWA 1PIWA 2JK0A 3C3CA 3A9RA 2ZSUA 4JIGA 1T24A 2HB6A 2QHXA 4H27A 3B1VA 3ETGA 3MAJA 1UBHS 1TADA 2EFEB 2YN2A 5IHPA 4R1OA 3BHMA 2G1PA 3DMPA 4HNTA 3Q3GE 1M8GA 1GXSA 5KQMA 1QCZA 5J4LA 1YZQA 3NONA 4CNBA 5TB5A 1DLIA 1BOOA 3GH3A 1E1YA 1FNBA 1ZVQA 1P1HA 2B99A 2CNWD 2H1VA 2PRSA 4Q82A 5J2UA 4RVOA 2P91A 4CG3A 3A4YA 2J0VA 1IU9A 2PXCA 1P18A 2YBEA 1TT5B 4PR0A 1DKRA 1M2KA 1XEXA 4R6WA 4Y2JA 5DYWA 4PZLA 1RW4A 4RTMA 1GO2A 3HFGA 3AVOA 5AVKA 3A6PC 5FI5A 5BQPA 3O47A 4GLFA 3VZPA 3ITEA 2JFBA 3AHCA 4FGJA 4A7PA 3OOEA 4HWKA 4AJJA 4R0VA 4B3FX 2P5YA 5C8ZA 3KJXA 1OPRA 2MYTA 4CL8A 3SS9X 4EPWA 2P75A 3CNLA 4M0LA 1QG4A 2JI4A 1H65A 1CTQA 1FYDA 5KOHB 2BTQA 2JARA 1E3WA 1Q3TA 1FU7A 4RHUA 1TIBA 2GF2A 3E9YA 1NYRA 4GL4A 4CIBA 3QU9A 4GT1A 3FNRA 2NU9B 4DCSA 3Q0EA 3DDCA 2WZBA 1N8KA 1NONA 5K0TA 2GK6A 4IUBS 4QPJC 1XEXB 1NVKA 1HLPA 2AEFA 3NHKA 3O38A 2WJVA 4Q3BA 2NNWB 3V9AA 5IVDA 5CFPA 4DW8A 1CUCA 1A2BA 1RPNA 4WKPA 4HGQA 4L4RA 3EWIA 4QBGB 3SLGA 2I62A 3G9QA 1M2NA 2V5VA 5ALKA 4RVHA 1G9SA 3EMVA 5ECGC 3UANA 4ANFA 4HH3C 3T1QA 1M2JA 2JI9A 3WGKA 1LPNA 4ILEA 4GMXA 1L5NA 3W6NA 2JBAA 2NTVA 3GT3A 4BE4A 2R4TA 3L04A 3P2YA 5JAUA 3VPBA 1I4WA 5IBCA 1R6XA 4NQZA 1E3DA 5TF0A 1E3WB 2ICAA 3LBNA 1C9MA 4PBTA 4JB3A 4QT4A 5FOQA 2Z2JA 2R00A 4RCZA 4BP1A 5D3KA 5CA0A 2IYTA 4NU5A 4IXNA 2TMGA 5U4XA 3Q3IA 3TQHA 4BNIA 2P6RA 1NQWA 3R8CA 2JLVA 2VUHB 1TF7A 3NDIA 3TBKA 3R0JA 2IVFA 4ZQIA 1EK0A 2W2PA 1I2DA 2J9GA 2ZBGA 3BSWA 5SY6A 4G0VA 3R9WA 4OUKX 4OQEA 3ZJUA 3HXPA 4E1AA 4P4TA 5CLIA 3EASA 3GK3A 3PIRA 4PSDA 4KBFA 4COOA 1LUAA 2A3NA 3RVLA 1AB5A 3M6UA 3GZNA 2AD1A 1A5BB 4KQGA 4ENSA 3D3KA 2VQSA 4HQRA 4UPEA 1VKOA 1I7LA 4J07A 3EZFA 2Z9DA 4EI9A 4GMHA 3FKSA 1A3CA 4KDRA 4W8HA 1Z2AA 2ACVA 5FTJA 5JASA 1NRWA 4L5JA 1NYTA 2X3YA 4IUCS 1BE8A 4KRYA 3RASA 4IDPA 3KD2A 4RD2A 3PQFA 4AKSA 5B58C 2LKCA 3QOFA 4AULA 3WGVA 1FYEA 3PV0A 3VI3B 5CA0B 3W6PA 2FJ0A 4OG2A 1XMJA 4TTRA 2AYXA 4H7JA 1E7MA 3PG5A 4EQ6A 3AUSA 1P7YA 4GP6A 2DFDA 2OILA 3T8YA 4B5KA 2V98A 3F3SA 3CJTA 3LG2A 4KFUA 3DE7X 1HH4A 3FFTA 3NTUA 4F4HA 3CN9A 1BHQ1 5KDLA 3OQVA 2OBLA 2NU6A 1O9HA 3UT5A 3ZZ1A 3IHWA 3AFGA 3RK1A 1XP5A 2Q3EA 2JCYA 1TYCA 1NVTA 2C42A 1D09A 2RONA 2EBHX 3H2JA 3GJSA 3G6WA 2C4HA 4JMLA 5CLHA 4D3YA 4DCTA 1KWKA 4TPKA 5EGNA 3GLGE 2BCEA 4CQJA 3RYCA 3GUYA 3UA3A 3C74A 1T25A 2WT8A 2A1TR 2C8LA 3Q5DA 3WWYA 4PZUA 2C9MA 4KP7A 2YXBA 3KZXA 1DCFA 3CR8A 3OTHA 5CVDA 1PYGA 3IMCA 5FORA 3VR0A 3LHIA 1W76A 2BEJA 3C1TA 3G7SA 2WYOA 1IONA 4GMFA 4JC8A 2H7YA 5HF8A 4CTKA 1ADGA 1FSPA 1TK2A 4AZ3A 2R7MA 4DR6B 4DLPA 2E89A 4HLUC 1T0HB 2AXPA 4I08A 4TKMA 4ZRMA 1QMPA 5JE8A 5B6JA 1AN9A 1ISRA 2GJ9A 1S96A 3C3WA 2E85A 4M0MA 1O54A 3K9WA 1BMTA 2XMPA 4JB2A 5EHNA 3JYQA 2NU6B 1Q0RA 3TBFA 1ZM4A 2RGDA 3I01M 4G2NA 3MF4A 1TF5A 4L8FA 4LDPA 3AUXA 1L5VA 4MS3A 4ND8A 3Q3CA 4NX2A 4QQFA 4UM7A 3UTDA 4N65A 4A91A 1HG1A 2GVDC 4D9HA 1JB9A 2C9BA 5LQMA 2NSLA 1EU1A 1P6UA 4KBYA 4BGDA 2Z5VA 5DYGA 2C2BA 3QF7A 3A05A 5EUMA 2HU5A 5F1OA 4GL2A 1PBNA 1PHPA 3ZZMA 1AK9A 1TLTA 2G0AA 1HYHA 4K8RB 1P19A 3ZN2A 5KPDA 3QXXA 2HYIC 1UFRA 1UXGA 1Q0UA 4ZCQA 3SZRA 4P92A 1ZMBA 3G9UA 4R1MA 5DIFA 5FNVB 4XYLA 3GLGA 4U6NA 2DB3A 4WNIA 4MUJA 4AZ3B 3ONWA 4DB4A 3QG5A 3ZBPA 2HMAA 3M2TA 2A7XA 2HYDA 3V2GA 1DQZA 1H66A 1K5HA 1QTNA 1VHTA 3B6KA 5HGXA 2DXIA 3CLKA 3N8HA 2O3TA 4MO2A 4DQDA 1XL1A 2LTAA 3HTXA 1JHOA 3MQ2A 4BNXA 1DT3A 1YR2A 3C45A 4MS3B 3WGTA 1NLUA 1W5AA 2O3RA 4ND8B 5TPZD 4DMHA 1CF4A 1PWZA 4NTZA 4OQNA 3ESQA 3MFYA 4DABA 2JGAA 2W2NA 5C8VA 3PE4A 2GF0A 4AT1A 5GZ1A 3BBLA 3IP9A 3Q6NA 5KZMB 5IF9A 1M2HA 2O7VA 1OILA 4I5IA 1NI5A 1Q5PA 4EGQA 1VHJA 1LKZA 4O4JF 1CG6A 3R09A 1GPLA 4R41A 2UYQA 1UEXC 3BMCA 1R64A 1NW7A 2EWWA 4ONEA 3O8NA 3GZJA 2C83A 3EUFA 5DN6D 2D2XA 5FOVA 3WP0A 2Y0PA 1KIMA 3ZE6A 3UUEA 4LVCA 2OUIA 2JIDA 2OBNA 4TQAA 5B55A 1ADBA 3D2LA 3VNAA 4ESEA 5KSWB 1N5RA 1UBTS 5IEBA 4A6DA 4FDVA 1M1YB 3VTAA 3U2QA 4Q7LA 2FCAA 4NCHA 4K6CA 2CVOA 3B1XA 3FPEA 2ECFA 3WGNA 4NR0A 1ZSNA 2BKVA 1ZSVA 1JMVA 2HV9A 2JJ1D 5CG1A 4UBLA 3AEKA 1OCEA 4Z6KA 2JRLA 3KQQA 3OY7A 1FC0A 3SZOA 4AZSA 4YRZA 3OTGA 2LD4A 1XDBA 4XWKA 3QTTA 4MMYB 1IZYA 2Z5GA 3ZGLA 3QVTA 5IT4A 1WEKA 2JLYA 1E9AA 3AXTA 2Q7DA 4DEVA 4FHGA 4ETWA 3IP3A 3WYGA 3DCYA 1QKIA 2VI5A 2EZTA 4OO3A 2AQKA 2WSSA 2AJCA 2BE7A 5CLLA 2WAAA 2XLCA 1LY1A 1M1NA 1OAKA 4P0TA 5HM8A 4Z4HA 4GKVA 3QSGA 3ICOA 4CMBA 4N8DA 1DU4A 1YFJA 3CB4A 3U4GA 3CVWA 1P1FA 3AEKB 4MULA 3LJKA 3HN2A 4Z4QA 1ZM7A 1T4BA 5AOBA 2VYQA 1SHJA 1OIWA 3QUQA 4R3WA 4DWOA 1I30A 3SIWA 2Q6KA 4BO1A 5AW2A 2Q5CA 4ZPJA 1RWWA 1TJNA 2RCYA 2X1VA 4NENA 2ECQA 5FXMA 5F4ZA 3BUSA 4YP5A 4R8KA 4F4CA 4KLAA 4TTVA 4MW9A 2BGGA 2YQZA 4ASUD 1GWNA 5TF4A 3ORFA 3AB7A 4N3BA 1YQGA 2CXTA 2V1XA 4G4GA 3TZCA 1UC8A 3TNFA 1GR0A 5CFOA 1N75A 4M1TA 3P9ZA 4X62B 4S2EA 3E9ZA 4QYTA 1CHNA 3D3QA 2REOA 3U40A 4L6CA 1UBNA 3OF2A 2QG9A 4DA6A 5LQNA 1H94A 1PRYA 3FMGA 3SYNA 1BQ3A 3A26A 4ZQGA 2G36A 1DAKA 3A1FA 5CMLA 1FSSA 1U2TA 3U7HB 2EERA 3RNOA 2BSXA 3FRIA 2C5SA 1Y4AE 1JSXA 3F6YA 3W1WA 2FP3A 4P33A 2W6MA 5MDHA 2OWEA 1OT3A 2O48X 1E0SA 2R48A 5AW9A 4BLVA 4CEJA 1SR8A 1KI2A 5FBHA 2R25B 4NENB 3KSUA 1J07A 1OWLA 1EVZA 3I6MA 3PPVA 5J9FA 4OA8A 5HJ7A 2VRNA 1RC8A 1E79D 1WXIA 5FTMA 2J9FA 2HSWA 3H8JA 4R7GA 3H0EA 3WB0A 4BJ1A 1CIVA 3NC1C 1LQTA 4PZPA 1YBFA 3CUTA 4IDNA 4CCAA 5L53A 3SZLA 5DW0A 4J0JA 1HE3A 3LBYA 3QVMA 4AZWA 1WOMA 4HYEA 3IO3A 2WIGA 3L6EA 4MCJA 3ME5A 4MHOA 3TEJA 1GPWB 1BAPA 5FKJA 1P2FA 2I1VB 4CEJB 1U65A 2FEKA 2QTRA 4TMTA 5B5SA 1FJGB 4ZI7A 2FF5A 1I01A 4BGIA 1YKSA 1GA4A 2QTAA 2IIBA 7REQB 4Q1EA 5EJ7A 4KVGA 3M5PA 4L02A 2J9FB 3C8ZA 3VR6H 2HLDD 3RS0A 4PPYA 1FUYB 4C3UA 4ETIA 5JSZB 1Y37A 1G6OA 1CY4A 2CVPA 4JJZA 4O4HA 1AXGA 3FMIA 1TEHA 3BRCA 4B82A 1EJ6A 1J7KA 4KPUA 1LEHA 1QQ7A 3TXXA 5FUWA 4HH1A 3RYIB 2ZRFA 1CB0A 3JWPA 4JA2A 1HR0B 1WMSA 1UKYA 1KBQA 4WADA 2C59A 2JVJA 5E9WA 4X8LA 2B8JA 3O73A 3RUEA 4NK5A 2EU8A 3AM5A 5CW1A 3TD2A 2R3SA 3DPUA 4OCZA 3IJEB 1V95A 5DYTA 4ZI7B 3AETB 3U1TA 4K3UA 4MB6A 3ZHXA 4R7ZA 2YKGA 5ITZB 3A10A 1NN3A 1TD1A 2KB0A 5ADWA 2J48A 4F9TA 1MX5A 1RD4A 3LA6A 3NNSA 4KXLA 1H8HA 2GZDA 2XOKA 4GSLA 4YV0A 2PL5A 2HT1A 5KJ1A 3RPEA 1FEZA 4POAA 4O4HB 3PYMA 3UUFA 4TLEA 4R2WA 1A71A 1KOLA 1F12A 4WKNA 3SX4A 1CY7A 2AKYA 2DYKA 4D74A 4EP1A 5K8LA 2XMBA 2QTBA 1GM5A 4KPUB 1TKBA 2XD4A 2ZDQA 4P35A 2M6LA 3TX2A 3CVVA 4DUYB 3EPHA 1MP0A 2FDXA 3TWOA 5IT5A 4HVLA 1XTIA 1CEXA 2WJ3A 1MJ5A 3O8QA 3ORSA 1WSWA 2O2IA 3I6IA 5DSTA 5DFAA 2FPGA 2H54A 1GTVA 3HN6A 5FBQB 721PA 4HRYA 3GNLA 4RACA 5LDGA 3WTBA 4E33A 4MZDA 3K5WA 4H59A 3IOBA 4G37A 3AWDA 3RHZA 2P6UA 1ZSYA 2BE9A 1J39A 1ONSA 1FNDA 3FDXA 4OREX 4ZQBA 4BL5A 1YC2A 2VHXA 3OQJA 4GM1A 4ZK2A 1OWMA 1PV4A 3KQSA 4L6AA 4YT4A 3A2MA 3SJBA 1IHUA 1MV8A 1WJGA 1D0SA 4F7WA 5C1OA 2GD1O 1VB5A 2CL5A 5I9TA 5F3RA 4L85A 3FLBA 2JZCA 3Q0TA 3U7RA 4BQOA 4QJIA 4JBLA 3O8QB 1YS2X 3A0UA 5EZ6B 1HDGO 1IXSB 1Y8RA 3UMFA 1X7DA 1JIJA 5TNXA 6LDHA 1CUHA 3WNVA 2PZEA 3G59A 1E8MA 4ITUA 4IHJA 1BWPA 4WNYA 5T4FA 3BRWD 3T7SA 4D80A 1G21E 3ASYA 5F2OA 3NHPA 1AGXA 4MYTA 5E0OA 3N76A 5L4LA 3I53A 2MSDB 4X6YA 2W2XA 3MLEA 4TMXA 4M0KA 4E70A 1EX6A 1VQ1A 4RM3A 5ALRA 1ZMTA 2ASEA 1GZDA 3DZBA 1CUGA 2CL6X 1QVWA 4G0QA 1QVAA 2XMCA 5EJIA 2GA8A 3T4PA 2G63A 1M83A 3FYUA 3DKIA 2PMEA 4MVYA 2WM2A 1KRHA 2Z1DA 4OHCA 3ELUA 3KOOA 4IO1A 3INGA 3ZOKA 1Y8RB 2JCBA 3F9CA 3O74A 3P2OA 5IARA 4DSNA 4E5KA 1ND6A 3U5ZB 1U4NA 4F6CA 1U9CA 4JLSA 1I94B 1L7AA 4G1MB 3RJMA 4HLUA 7YASA 3AQIA 4FWIB 1Q84A 4JJ4A 3HJFA 1RE1A 4GR9A 1C9EA 2VPWA 2JCVA 3CVUA 2KE5A 4RJTA 2YJTD 1QX3A 2MSKA 1CS0A 3FCXA 4N7JA 5LBIA 1O8CA 2JH8A 3UG6A 4GUAA 4UBNA 1XNHA 4FWBA 5ALMA 2YZKA 3GA0A 4HLCA 5EP4A 1OH6A 3U48A 2WM8A 3FY4A 4FZ5A 3ZDRA 3ZKWA 2G1UA 2BYTA 3T5GA 1J22A 1TM7E 4C4XA 1OA1A 3TPCA 1UK9A 1FMLA 3FIJA 1PJBA 2QLNA 3FPHA 3FYUB 4WLNA 4WNAB 4HFNA 3FF4A 5LQUA 1KSFX 2A78A 2YZMA 1M66A 4QNNA 1DRKA 3FH0A 2YW2A 1DZ3A 1YE3A 5DYYA 3T3PB 1PR0A 3UFXB 3MELA 2A9PA 2C9OA 3RTEA 3UHAA 3ML1A 3IJRA 1C4XA 4UNPA 5CCEA 2V6BA 1PZEA 1ZMRA 2NWQA 4BKMA 5ES3A 1E1CB 1U02A 1JSCA 1OHHD 2JI7A 2P9HA 4LVNA 4GR5A 2QRVA 2QRLA 3HPRA 4IJ5A 1OY1A 1P6QA 2LCFA 4CFYA 1CS0B 1FP2A 4JSYA 1KO7A 3U1BA 1A8SA 1E1KA 2PEYA 2W83A 3FJOA 5G53C 4YT8A 4RF2A 3WQQA 3ZKWB 3OURA 4KODA 3GBVA 3GPIA 4PSUA 5DEOA 4AMUA 2HA2A 1BEZA 5LXTA 1NMXA 5G0SA 3F7OA 4DQVA 3NHBA 3GJRA 5A6SA 2JKZA 5KYGA 1RCUA 1F1BA 4UBIA 4DY6A 1ZU4A 2LIPA 3K5IA 3TR0A 1X1CA 3L4EA 1KARA 4CM8A 4DRXA 3EAGA 4EYKA 1ZGGA 1I3KA 5C7YA 2B7CA 3PFFA 1JWBB 1URPA 4Q4DA 2HR1A 1QTQA 5FBRB 3BJIC 3GMSA 3DVQX 5C8YF 2FFJA 3S40A 2CGEA 4WPGA 2QRVB 5CRIA 4EVIA 4O2AA 2X0KA 2IL1A 1QGAA 1YIOA 3IP7A 4D8YA 4Z8YA 1VZ3A 3VC2A 3LFUA 4F9FA 2K4MA 1P62B 1MLDA 3N28A 4WTOA 3TVTA 1MRSA 1JDNA 1HE1C 3EPRA 4R3UC 5LXTB 3EA5A 5DISB 2BR5A 2EEZA 3N70A 4I2NA 3RVPA 3WWZA 5A6SB 5JCZA 4AO8A 1FQJA 4ND7A 1HDZA 1ORTA 1ZIDA 4RLHA 1Y1RA 4DIEA 3CBQA 4FHDA 5M7EA 4CM8B 4D44A 1AU9A 4DRXB 1F7UA 4BNTA 2GJKA 3GH1A 5AVJA 2VHCA 3Q8WA 3RDPA 1LSJA 1BTOA 1SD1A 1ESNA 3GCWA 3L0DA 3WIEA 4Q6WA 3DDWA 1IOLA 3D8HA 3U3JA 4UZEA 5CDUA 2NUTA 1N92A 1U0TA 3TGPA 3QFSA 4JCCA 3WP1B 2IFTA 1KEVA 1Z0UA 5TIIA 2OAGA 5JQGA 1T5SA 3ENNA 1O03A 1CXZA 4BZZA 1B3BA 4AKHA 3M6IA 1ISHA 4F0JA 5GIPE 1E9RA 3GJQA 3CEHA 2RHTA 1T2EA 3KOXA 2WVAA 1KO8A 1EEXB 4IRXA 4RKQA 1JIQA 5LMZA 2PGDA 4Q34A 5EN4A 2OC9A 1EFCA 1I1HA 1S2LA 3AEQA 3BWBA 1PDOA 3D8RA 3DNMA 4HAYA 5CVCA 3SQOA 3V4SA 2XB2A 3AVXA 5CDGA 1QWSA 4E0BA 4HQLA 4PQEA 3AM4A 4P3OA 1X2BA 1ZGBA 2G06A 2PANA 3FZEA 3JQDA 4E5YA 2RSLA 3QBEA 4QGGA 4MITA 5A6VA 2LGJA 2HNAA 2XSZD 3G0DA 2NUTB 3T1TA 1PJSA 4L75A 2Q45A 4GXQA 1DWPA 4WMLA 3SIPA 2WFAA 5L4NA 2RMKA 3T15A 4OHXA 2ZIFA 4OOEA 5JQGB 2E0IA 3E4CA 3SXUB 4CKBA 2WHPA 3BERA 3T41A 4OKSA 4JGGA 4JJ8A 5CHEA 2Q7OE 2G4CA 3EH1A 2Q5IA 1EWRA 1H2BA 4ZMSA 1HZZC 2A5LA 1G3QA 3AP2A 3DMRA 3PHIA 2WIJA 4J4BA 5TV2A 4H6XA 3FCCA 2QLMA 2QRMA 3AEQB 3CW9A 2XJ9A 3J81k 5MGNA 3DP9A 2Q6TA 1WW8A 3OLCX 3QX7A 4V02A 1WHTB 1G16A 4CEIB 4J2HA 4BRZA 1HRKA 2BKEA 1RHMA 3DEIA 4HLDA 2GEUA 3MCZA 3CUWA 2HHAA 1G4AE 3BCSA 2Z8ZA 2PWYA 3BS4A 3UATA 1A0OA 1AKNA 1ZCZA 4CIAA 2XJ4A 1N9GA 1G9TA 1T2NA 5IZCC 1KS9A 3NT2A 2ZYDA 1VXOA 4JSTA 3P26A 4QARA 4CKBB 4F5ZA 2XDQA 2R85A 3PC3A 4M99A 2ODAA 5FBWB 2JLAA 2A0UA 4G1EB 4X6LA 2EFDB 4GZ3A 4KWTA 1UK6A 5I7FA 2Y8EA 2C7BA 1B0UA 5BVHA 2HI0A 4BNZA 2GZ3A 1U8TA 1YWGO 2PJZA 1Y6FA 1T4DA 4D25A 2NT3A 3M4JA 1KMHB 1NFFA 1PZGA 3D3JA 3GP5A 3AJAA 2X76A 3IT0A 3SLKA 1E66A 1SBTA 3EZNA 3WKEA 1L5ZA 1XEAA 1WW3A 1X86B 4YFYA 2JLUA 5AJTA 1R3DA 4I4TA 5B3LA 2CLSA 5IPFA 4W5JA 1TA0A 3HY4A 1E2EA 3QLUC 3I05A 4RJLA 2DCMA 2EKQA 1BEUB 1P45A 1GPDG 3W78A 2C9DA 5B2EA 3TAUA 3AF1A 2E5LB 4F3YA 1N9GB 1KDVA 2XAAA 1XOIA 5JZVA 3FMOB 1FFXA 1GNTA 2Q1SA 3NWJA 3H75A 4RS3A 3CCFA 3E15A 3GAAA 1G8YA 3KETA 1ORHA 5BOVA 1C7EA 2R8YA 4XJXA 3RVKA 5BVHB 1SCKA 1M1ZA 4RPLA 4P7JA 4EG6A 2GFQA 2MMGA 4I3GA 3F71A 4X7PA 4D9IA 1KVQA 1Z7YA 2CFCA 2IHZA 1DHTA 5CD9A 1TZMA 3H18A 3AL0C 4G0MA 1H6DA 3HB0A 4OH7A 1VJTA 2CDBA 3GDFA 1LPOA 3FPBA 2IIVA 4ZA2A 3M5DA 4C0LA 1J25A 5EVCA 5ES4B 5CDYA 3AO0B 2H5IA 4RZ2A 5AOCA 2XNDD 4K46A 1SXJC 1HL3A 4EELA 2QJRA 1M8PA 4RWEA 1C0KA 2Z56A 3TSYA 3O9ZA 4PX5A 3ZIAA 1FFXB 5I7AA 1RU3A 4PEVA 4PN3A 1QCCA 1R0CA 2Q6OA 1XD2B 4LWPA 2IV3A 5K7SA 1E2NA 2PWBA 3FVTA 3JQ6A 4CTMA 1JIKA 4K9RA 3DFUA 4GNRA 1WZNA 2M2IA 1FY2A 5BUZA 3OE7D 2BR4A 4M83A 4YWJA 2BZ0A 1VRWA 3N6XA 3TJMA 4AYTA 3TFOA 5IVKA 3KV1A 1Q1QA 4MVJM 3R41A 3VR3A 1JQLB 2HKIA 3TFQA 1RAIA 2R84A 4ID3A 4R1UA 1Z07A 2H2GA 4ZJPA 3C3DA 3E3AA 1OJ7A 3EFEA 4FZVA 3TQFA 4RQBA 5JNUA 4K87A 5A9RA 1C3JA 2Y6UA 2RIPA 4PCUA 1GHTA 3MTDA 4YK7A 1LK7A 3N7UA 4D9NA 5JY6A 1GU1A 3LT2A 3SX0A 1D2AA 1M74A 3ANMA 1PKXA 2W5UA 4JP3A 3M4ZA 3PRKE 2PBLA 4KUHA 2H0QA 2PD3A 4O4LF 3GAZA 2IUFA 4OK3A 2IHKA 4LA4A 4Q47A 3R8XA 1RSZA 4CM4A 3DLCA 2ZRGA 4UEJA 2Y3IA 1X1SA 1ETHA 1ZQ1A 3KR9A 2UAGA 1OROA 3PF8A 4J0HA 1SG0A 3WGOA 4W99A 4C5BA 4OXQA 3W3AD 2PS0A 3AR9A 1ML3A 1VBFA 1LTKA 3L92A 1XF9A 4B0PA 2ZGVA 2FQYA 1NBMA 2O7RA 2XUJA 3EG9A 3OM0A 1B6RA 1S2DA 2FR1A 1DAIA 4Z8XA 1C7FA 4BZQA 3K70C 4MA5A 2QL5A 3FHJA 1EGAA 5E8RA 4J3FA 3SVLA 1X7WA 3ZD7A 4MV1A 3B85A 1XRPA 3INTA 2VTVA 3QXHA 3EZGA 2NSDA 5J2TF 1T3HA 4LXIA 4PNPA 4TV9F 4CM4B 2A5FA 2VF8A 3F6EX 3K0KA 1KH2A 2OENG 3JAWA 1YDWA 2LPMA 3PGLA 4EM6A 3ZGYA 1JMKC 3AB8A 2JG3A 2AG8A 4BNHA 3ZE2B 3CZ5A 4GSKA 3WA6A 4ZI2A 4ZHSA 1P73A 1C0EA 3ZU6A 4BFUA 2A0XA 1GTRA 2H00A 4PR3A 3IB3A 2O2XA 3PI6A 4YACA 1IQUA 2FRDA 5A5DA 2PT9A 2DHEA 3ZBUA 2FW7A 5IXYA 2W2LD 1NBAA 2G04A 1T4CB 1E1QD 3KHSA 4X54A 5DTRA 5K3BA 1DG1G 4BO6A 1X7WB 1CBUA 1X1RA 5DTQA 5HPYB 2Z95A 2X23A 3BB3A 1JW9B 1Y9AA 1PR1A 2D1YA 3IPRA 3DEKA 5K0EA 1FJXA 4ZQCB 2ZBRA 2VJCA 2C3MA 3JAWB 4XOUA 2C5EA 4FS3A 2XXJA 2E4XA 1ULSA 2VPYA 2ZR0A 3EGDB 1BMFA 1JAXA 3GLHE 4LIPD 3UKDA 5AM0A 1N32B 5CTAA 1T34A 2XYHA 2Y4OA 1FYVA 1U1DA 3ABRB 3LTEA 3ZHBA 4XUEA 3BE5A 4F2PA 3RUPA 4NV0A 3AM3A 4KIUA 3F6BX 4TZKA 4B46A 5DHRA 2X4DA 5KWVA 1KP3A 2QI9F 1TZBA 3WYEA 3MJVA 2V9PA 5LR6A 4GI3A 2E5FA 3EYWA 1U1EA 3E9DA 5JEEA 3SS7X 2GRAA 3RSZA 1H1LB 4NMWA 2F3TA 5ICCA 3PE6A 2QZ9A 1W93A 2XGJA 4CI9A 1YMUA 1CLUA 2XKAA 2J3QA 1C0LA 1HQYE 1Z25A 4GLLA 2BFDA 1PFYA 1CRLA 5CT9A 3NBXX 4F2HA 3SFVA 5IASA 4O2LA 2QAJA 2VK1A 5K8VA 1UBRS 1T2VA 4D9JA 4K05A 4GYWA 4DIBA 3HFRA 3HCCA 1TJPB 1KAGA 4UHEA 3A2LA 2FSVC 2GZSA 2CDNA 3A4MA 3FLMA 1ATIA 4J9UE 3IHTA 4WK0B 5F52A 1PQPA 4OF4A 3KEFA 4YPVA 5LQCA 5FLXA 4XFJA 3D4NA 3VPDA 3R77A 2F67A 1J97A 1R88A 1S3GA 4UHKA 2GEFA 2GN8A 3W8RA 3JTEA 3DKVA 4MYSA 2O1SA 2ADFA 4GMKA 2GLXA 5DRTA 3CKLA 3ZK7A 4B71A 2YYAA 3ZJ5A 5C80A 1GQ2A 2VTBA 1OI4A 1VG1A 1JAHA 3LYHA 4P7GA 2OXRA 4ZZIA 3A4IA 3EGOA 3GFQA 2XUPA 2G6BA 2GD6A 2HBYA 2C2MA 3A1NA 4HEA1 4KGDA 4QDXA 4AO6A 1KOJA 2NV6A 5DI3A 4B6RA 2VF4X 4CYMA 1SHTX 4EJMA 2GHIA 5LMNB 2BFEB 1G0NA 1XA4A 4H7PA 1SUFA 1KYXA 1T9AA 1U7ZA 2C03A 4K40A 1ZH2A 3ZX5A 4AJ9A 1QOPB 2WB4A 4IL5A 2GXAA 4H2DA 4AUKA 3C97A 4KRFA 2J67A 1RDFA 3CM0A 3UB4A 5HKKA 4BMOB 1C50A 3SJUA 2M6RA 3OZDA 3SSNA 4DL9A 3CVJA 1FOEB 1RXUA 2VRWA 3TNDA 4FYVA 1UOOA 5LP6C 5EJ2A 3CRMA 1DEOA 2PU5A 3FNQA 1KGDA 2XEDA 3HYNA 4UVIA 4NESA 5JRDS 1LBIA 2PGLA 1EGMB 1SAYA 3FCSB 2V8BA 3EG5A 4JXXA 4HZGA 5EG5A 2X1HA 5AXDA 2XLBA 2SCUA 1E59A 2BM0A 2RCNA 3EHDA 4LHSA 2ZUFA 2WU3A 5DI3B 3PC4A 5KCZA 2QVCA 1YDGA 2D7CA 2AMVA 4DQXA 1LV7A 3VNUA 1EVKA 1MHPA 4KX3A 4MW6A 1JFFA 3D6HA 1Z75A 4NV1A 4M0EA 1E6MA 4E6PA 4XVUA 1KWGA 2FN7A 1E3MA 1TUBA 1UBLS 3BIJA 2JFUA 4MI3A 2BGWA 1NVGA 1LF0A 5G02A 3RLFA 1K7YA 1M6EX 1XDWA 2HFKA 2MTBA 2MINA 4F5EA 3IAUA 2WVHA 2B4TO 1D0VA 1O96B 2QDXA 1TAHA 4JQCA 2X1LA 3P8ZA 1FPMA 2O7NA 3R3UA 1DTEA 3UJ7A 3NDBB 1HZZA 2QUIA 3NHRA 5EHGA 4BFSA 4BQFA 4CKWA 5L8VA 5ALOA 3CO5A 3WMFA 6ABPA 3PQCA 1ZHFA 4H7IA 3OX4A 4LTDA 5BO5A 2M9MA 5CM9C 3RF6A 5JNTA 2IXTA 3MT8A 2IDJA 1JWLA 3F9RA 2Q3CA 3C1OA 5SYMA 4W1SA 1SRRA 1JFFB 2O3SA 4YRNA 1WKCA 1V5FA 3SQWA 1TUBB 3S3TA 3DO8A 1L7EA 3I9KA 1R5NA 1Y8QA 3LY5A 5KNLA 1CVIA 2FE1A 4DR1B 5CR9A 2VZ9A 1H5NA 1LVUA 4EHIA 2OBMA 5IZCA 2B98A 4YV2A 2HHCA 2MINB 2VR1A 4KVZA 5KOYA 1N6RA 2V7WA 1J99A 3SS8A 5LLTA 1T3TA 3E2MA 1NIPA 1ISMA 2C29D 4R2KA 1NVDA 2RGEA 3QMVA 2Y1XA 2YV5A 3E3OA 1EFUA 1S3SA 5TARA 3WLMA 3QKUA 3UJNA 2PMCA 2QTHA 3QPUA 3WO1A 3HYTA 3REQA 1R1DA 1LWOA 1SXJE 1ZW6A 4XYEA 3UV3A 4HUQA 4KDCA 4X6XA 1UBUS 3T7TA 1DKQA 2EDCA 2VBCA 4Y98A 1WDWB 4Q1FA 4NBLA 3OCWA 1BNCA 3QLUA 1EDZA 5H4HA 5LA6B 1KSGA 4WVLA 4BU0A 3K0CC 4M1QA 4NZYA 1KK3A 1RFGE 2OFWA 3ABZA 1DQRA 2A9RA 3IBSA 3LWDA 1GZVA 4D56A 3LA8A 4G5XA 3QPVA 3OE4A 1H0HA 2IBMA 3A6GA 4BB9A 2G1AA 4JHXA 2FZCA 2WUVA 3N6RA 1SVIA 4HR7A 2Z83A 3GJTA 4NAVA 2OL4A 2HRBA 3L0YA 4JQSA 1QGDA 5F5NA 3U7JA 1CDEA 4EMSA 4PZZA 4F2DA 1ELOA 1NQXA 4WCFC 4PZAA 3VR5A 1BH2A 4PGHA 3V7WA 1X8JA 3PXAA 4ENRA 1KYQA 1OQAA 4YGYA 2NO6A 2PBRA 1YJBA 3PHLA 3QEMA 3REQB 4LOIA 3VSBA 3LE8A 5AW3A 2QRGA 3EHEA 2Y92A 4HUQB 2H17A 3EBPA 4OAQA 1OX5A 1W46A 2PS9A 1PVOA 1ZL0A 4AIIA 2AEMA 1OZGA 2VOEA 4BVKA 3FUWA 3RG8A 5TEWA 5DK4A 2N1MA 4LFCB 1UJ6A 2DM6A 4P36A 1SXJA 3OKFA 3EXFA 2WAOA 4UOQA 2JJ8A 3I39X 3PE3A 4N5HX 5L3SB 1RZVA 4FW8A 1FX0A 3CLSD 1GKYA 2C4WA 4WFKA 2YIDA 3GF4A 1IMOA 4RY2A 4OPMA 3X1WA 3ZZ0A 2PGOA 2P5UA 4RTKA 3ZCPA 5LMUB 3BC1A 1RQXA 4BPBA 4WW0A 2R65A 2AYZA 1V41E 1D1SA 2G25A 3AINA 1F48A 1EP2B 3N2GA 4FQ5A 5TJHA 1YZUA 5E1BA 2P6PA 3U37A 1SGWA 1SKQA 4PW0A 3ZBTA 1H0RA 3T52A 3BZWA 3DZIA 2EL9A 1FFBA 3KQVA 1J0DA 1NQOA 5AM4A 4EF4A 1FK8A 2OMEA 3O92A 4EVRA 2CV1A 1SQ0A 2FG5A 4RHEA 4EEXA 3EEOA 5A05A 3UJDA 3MK31 3ZDFA 1QIGA 4AICA 3JQ9A 2BI7A 4L74A 1RLJA 1FX0B 3BXEA 3U19A 1YJ5A 1EBFA 2I8CA 2XR1A 3LL7A 1P2BA 4YASA 2CLDX 2I2BA 2W7TA 2ECOA 3G2LA 4BIIA 4BLWA 4BMYA 4QJ4A 4EL0A 1HSZA 1Y1PA 1B14A 4TUYA 5DPMA 2JHPA 2WICA 1ZRHA 3QKIA 3VR4A 4C9BA 2XOKD 3CISA 5LUBA 1F2TA 1DRJA 2GSWA 3LPAA 4BNJA 1Y7LA 2EWMA 3N2GB 1FFDA 2P6OA 1ZQ9A 3OAAD 2GCEA 1FUEA 2GHRA 2ZTUA 3I09A 3NM4A 3SP1A 3UN1A 4QXAA 1MC1A 4L6IA 3LH5A 2HMYB 3O8OA 3QPCA 1Y4DE 4BZXA 1ZK3A 2PLWA 4Q1AA 4L8VA 4RFLA 1S4QA 3FOBA 3M6FA 5D3ZA 1LSOA 3FCUB 2WVGA 2GEJA 4C1BA 3AC0A 1VGRA 3D4PA 2OCKA 4NG5A 3QTBA 1FS5A 2K6GA 3EOZA 4LDRA 3K96A 3R74A 3REFA 2CXXA 2FWAA 3JVIA 3VAYA 4DCMA 4RVCA 1J8DA 5EIBD 2QQEA 1BCRA 1G8AA 1UPAA 2J46A 1L5GB 1P0IA 1M2FA 4Q9DA 1XPJA 4TUYB 3ANYB 2W2QA 4G24A 3HK2A 1JRLA 3EISA 3ERCA 1XQ1A 3EFBA 1F2TB 4DDWA 4NYJR 3QVSA 1I5RA 1TE2A 1W47A 3ICCA 4ZU6X 1P33A 1ZS9A 5CT5A 2D5LA 5IHXA 5KKNB 4NS4A 4YCMA 3FI9A 3IP5A 4GC9A 2IOFK 4C20A 2PUHA 2EV9A 5DX1A 4H4EA 3WGUA 1V26A 2IH4A 4TROA 1HQKA 2BM8A 3M4YA 3ZV7A 4LF4B 3F6SA 1Q7RA 2NXCA 2JGLA 3CN7A 2WZCA 3T3IA 3T7KA 3OX3A 4TWBA 5J43A 3LW7A 1BX3A 2QROA 3PNLA 3TLKA 4DADA 3X44A 1IBMB 2ZSKA 4IDAA 5FWXA 4HAOA 2BEVB 1Q0PA 4GP9A 1DX6A 4RF5A 2YASA 5B12A 1GY8A 1UBMS 2P3OA 2KBFA 2YMLA 2WBLC 3KQTA 3QWHA 3VKGA 4PTLA 4C4TA 4EARA 2VA9A 2VF7A 3B8HA 4IVPA 2IPNA 5CK5A 1Y81A 5EMLA 3RSHA 1GLGA 1NE2A 1V4VA 5F21A 3HDQA 2H7VA 1F8XA 3GA7A 3KK0A 4ZU1X 2FETA 1CHDA 5G4KB 4GPZA 2PSHA 3D1LA 5FNVF 4BQQA 1MCZA 1XGKA 2N47A 3PHJA 1VECA 1G7SA 2OCGA 3VBCA 1JBEA 3DDOA 1FBTA 1RAHA 1P61B 4PLCA 3Q8KA 4KO8A 5L7WA 4G3XA 1UT6A 2PUDA 3TLBA 3DB2A 1MR3F 2VNKA 1OYVA 3L0IB 1UZAA 2RGWA 3HNRA 5EZ5A 1FNNA 3IELA 3TRDA 4YCLA 4Z4CA 3BWMA 5FWXB 2I9KA 2R6ZA 4YRIA 1X94A 4FEEA 5BWOA 3RUIA 4EVQA 1NYQA 1YHNA 4DA7A 4OA5A 4DSTA 2Q5HA 1PF7E 3SKYA 1GN8A 3EZ6A 2H5EA 3R5FA 1PR4A 4HAUA 3NVAA 1E4VA 2GDJA 2ATXA 3MTQA 5CEJA 1JS1X 3JQGA 1AS0A 3PC2A 3DZDA 3VOSA 2FSVA 4CUKA 2ZRHA 4CF5A 2O19A 2A67A 2DCUA 3ZH2A 2PVCA 3V6LA 4ZT7A 4WACA 1HNZB 3UHFA 5C18A 2QRNA 3NV9A 2FK7A 2CXQA 4RA9A 3NNDA 4NZ9A 3EVTA 2D8MA 3PLRA 3WBBA 4RDXA 1PAUA 1MRZA 4OH1A 1Z0KA 2WSYB 1QRSA 1U8XX 3HB5X 2VAMA 2BFBA 1P72A 1U8UA 1JDJA 2POCA 4QM7A 4OX9B 2VPTA 2YL2A 3SK0A 2IODA 4D6PA 4JB0A 4OIMA 1NU6A 3UXHA 5AVSA 5M34A 4AQYB 1ZGHA 5CLGA 1Y89A 3CRVA 3OCYA 2V0GA 1ZK1A 1B3RA 1H9CA 3JQGB 4XYGA 4GM0A 4MCAA 1XZNA 1J49A 2LBPA 3F7MA 4JITA 4GU5A 3IV7A 3ETJA 1T8YA 1ZITA 2Z8XA 3OOYA 4K3VA 1VI6A 4BWVA 3C8DA 5KAPA 1GEEA 4RA9B 2EXXA 1QAQA 5ISMA 3QXGA 5LP6A 1CKEA 4L16A 1ZK0A 4Y2PA 3K4HA 1ENOA 3MD9A 5DHAA 4DMRA 4P4SA 2YX1A 4DNQA 3EUAA 5DNCA 4OSPA 1DL5A 5ALYA 3W9YA 1NMZA 2A5YB 2JGEA 4PN7A 5JEDA 1KP9A 3RQIA 2BFBB 3U56A 1DIAA 3Q5GA 3MT7A 3ZLUA 3BM5A 1G20A 1XJQA 3PIDA 4Y2YA 2VT7A 3UWMA 5DH9A 1QMGA 1A8UA 1JLKA 2BHNA 1LBSA 3H42B 3I2JA 4QICA 3WYAA 4ZZ3A 5CP8A 2Q3HA 1HFKA 3FFBA 4IR7A 5PGMA 4ZDKA 4RAOA 1JLHA 1M2EA 3ZWCA 3KHKA 4MEJA 2DZDA 2EX0A 4F04A 1QK5A 2F17A 1JPVA 1GARA 4ZYXA 1XL0A 2PO5A 2VYND 3LHDA 2ODEA 2ROQA 1TQ8A 2YS7A 4KC0A 1XK6A 3TVYA 3UMJA 1QG2A 3FHCB 4HDCA 3E9QA 3PQ3A 5GOZA 1GCIA 3EVBA 2WMOB 1GA6A 4P4SB 3H16A 5AW8A 5I7WA 1P60A 2XV1A 4FMCF 2BR3A 2I4RA 2I99A 1NXXA 3LI2A 4KGVA 3KT3A 1UXOA 1F17A 2RKOA 3T9DA 1G20B 3BKWA 2RG1A 1KEUA 3BIXA 4DMFA 5KVSA 1Q1NA 5K6AC 1MOZA 2PKQO 2R5WA 2W6IA 3R0XA 5HFAA 4JKOA 1KR2A 4ZOBA 4NU0A 4ZICA 2AG5A 1P39A 3DW3X 4B2IA 3Q2OA 3OD1A 3ESBA 1NI4A 2DGDA 4LYDA 5DYIA 4ZWNA 3LQRA 1W1UA 4AIRA 2QXUA 5DIZA 1YQ9A 1HPLA 4L4XA 3GDOA 2GK3A 4E5NA 1RXYA 3PRHA 5GZ3A 1OOEA 3ZGXA 2IRWA 3AJDA 2ZDGA 3OG9A 4R1NA 3S2ZA 5CBPB 3EPPA 4QASA 2Q0QA 3AHIA 4LCEA 4ZAGA 3UMGA 3WBKA 4F6LA 3O31A 1GQFA 1GGNA 4ZN6A 5JFTA 1ZZGA 2NV0A 1DV2A 3D4IA 3DYBA 5KQPA 2XUZA 4ISCA 5BWNA 1I0IA 3G9ZA 2V7EA 1W34A 1RHJA 2B37A 4NIMA 1QHNA 1FQWA 2KHZA 4DM3A 5AUQA 1B26A 5K01A 4ESVA 4DA0A 1U8CB 4X66B 1NI4B 2COEA 3K0CA 4MKGA 1Q95A 2DFKB 1UXIA 1CQJA 1YR7A 4I8DA 4Y9SA 4IIJF 3C3EA 1XMSA 2DTDA 3DXZA 4Q4JA 5FPPA 1DQPA 1O94D 3I8XA 3OPQA 3ZE1B 2YNMC 3MGGA 3M9XA 2XTNA 5TGTA 5BN5A 4XYMA 2R6GA 2X5NA 2PJUA 3V4OA 5T6BA 2QENA 4LSMA 3W4KA 2PRKA 4IIGA 3HJRA 4IDEA 4W1RA 2JFNA 2OQRA 4WCFA 4BKQA 1GAJA 4IKEA 2RH5A 3FMFA 4QOGA 4H1WA 1J2UA 3PHHA 1JI0A 1TIKA 1TQDA 2IP2A 4ENTA 3IQZA 4NATA 3KEMA 2FRVA 4KAAA 5IDVA 4DY4A 4FN5A 2D1QA 4EZEA 1Q7BA 3RHTA 1CQJB 5ED0A 2DT8A 3PT9A 2F55A 2OG1A 3DC2A 1XWWA 4R51A 4ZEMA 4Q4JB 4KDEA 2IYAA 3LQ4A 4BC1A 2J31A 3FPAA 2GH1A 2KQUA 3NFRA 1D4ZA 3P7MA 5D5HA 5BN5B 3W4IA 2CWDA 4YAKA 5FNZA 2HNBA 1R8SA 3S2UA 1M5RA 3I5AA 1F60A 3CF6R 4JLKA 4AB1A 1PWYE 4TS3A 5I4CA 2WTEA 3QPBA 1R2QA 3AUJB 3BXZA 2FPXA 2BFPA 1GU7A 1W35A 2IQ5A 3AFIA 1E7WA 2IS6A 4X8HA 2HZBA 2NXNA 5ER9A 1NR1A 1BG6A 5ICEA 5YASA 2PSDA 1UBJS 1K2VN 1HDXA 2H2FA 1Z2OX 4I1IA 1B8UA 4A0GA 3O1JC 2PZKA 5KU7A 2B20A 1XHLA 5HCIA 3RTAA 4LBZA 5KYVA 2I65A 3OQ1A 4R71A 2WUEA 3AB3A 4KAJA 4URUR 3HUTA 1KJ8A 5AJXA 3K9CA 3TECE 2P2SA 3O03A 4QFBA 1ZGAA 2CLFB 4X7MA 1GAWA 4AMYA 1ZBDA 2FFQA 3R4VA 4ODIA 1JGTA 2R6DA 3TI7A 3OIYA 3GLFE 1J1ZA 1L8QA 4FHCA 1VBKA 1N1GA 2IZ5A 5F3DA 4Q12A 2X9LA 2YXPX 3RF7A 3TLGA 1YJ8A 3X1YA 1LI7A 4IQFA 4NYMR 2GM3A 4FYWA 2JD0A 5JDCC 1EUZA 3C8UA 1OVGA 3DV0A 4MZXA 4WJZA 4PQFA 1P4RA 3EQ7A 1PR5A 3TLXA 1BA3A 2XTZA 3MZ0A 4XVCA 5AVTA 5F7XA 3D2CA 3L7BA 2VIIA 2F3RA 2VKQA 3IDSA 4MLZA 3E7XA 4R69A 2NXWA 1MU0A 3PSAA 3DVLA 1Y33E 1ZI8A 3CUSA 1E1MA 2NSJA 2OD7A 4RLSA 3BCRA 3D5EA 1CV2A 2GXQA 1N3YA 2PM8A 4J7CA 4CHGA 5J47A 5HRUA 1ADFA 2A1UB 4PIVA 2RHGB 2HK7A 2VRCA 3BMXA 5JSHA 2Z04A 4TLAA 2IIPA 2PY6A 1IQPA 3ZV6A 1ZZEA 4BAUA 4L3WA 5TRTA 1O95C 5BWMA 3G89A 2OAQ1 3QUTA 4LJ5A 3WKBA 4MWBA 1IBRA 3ABQB 4EPYA 3K0FA 4MS1B 4B3CA 4KO2S 1XZEA 3RHFA 4WBNB 4BVAA 3Q7TA 2HBQA 4E2WA 2CC2A 3DSRA 4JVOA 1QC5B 4M53A 5ESRA 1K9SA 4JBGA 3WXMA 1AIPA 1JHZA 1PP4A 2PXXA 2W6ZA 2PZFA 2YC2C 2Z4SA 3G2JA 4HEQA 4OIFA 3UQZA 1HKUA 1BU5A 4M1OA 1UMCA 1W85A 3CINA 4MA0A 3ABIA 4O4IB 3BJMA 3W5IA 1M7BA 1BN7A 2GNOA 4TL7A 5E6RB 4R8LA 1A04A 1U2ZA 3EXG2 3TSAA 4PC3A 1U2RA 3ROKA 3G8YA 3KLNA 3ND9A 2DLDA 4M9CA 4M98A 4EPTA 1SM4A 1X38A 1BD3A 1W0JD 4N39A 4RWZA 3QITA 1A8PA 1ESEA 3AERA 3DXFA 1FFCA 3GUVA 4UHFA 3D7LA 4UVGA 4R1TA 5CTJA 3VHXB 3HU3A 3S27A 1R8XA 4NFYA 3LBAA 3P20A 1DX9A 3K0FB 3P9SA 4JC0A 5H81A 1AV6A 1WSBA 3I52A 4UHJA 3VR2A 4ZT6A 1AKEA 3TLEA 1M7HA 4E1BA 4EJ0A 4AMGA 1JQEA 1UDWA 1NLMA 4WESA 3FOAA 4UHCA 1ESDA 2EHJA 1NU8A 3KU4A 4QELA 5BSRA 3SHWA 3WYDA 4R2MA 2OCIA 1I32A 3DTYA 3VH1A 3EEYA 5LIRA 1Q2UA 1EGQA 2X2FA 4GUDA 4CIYA 1X70A 1YBMA 3NP7A 2GCOA 1CX9B 3B82A 5IEJA 2E21A 3E35A 5FFFA 3WGMA 3WLOA 1HNNA 3DDHA 4YXWD 5JMTA 3DQZA 3DHWC 5EJ6A 2J5RA 2X58A 4ZYLA 3ZJTA 1UKAA 5A3SA 4FKMA 1LV8A 3UYLA 2CMKA 1JVBA 2Q99A 4IVRA 5DNYB 2WPNA 1C4WA 2ZRIA 5KQSA 3PXDA 7MHTA 4KJZA 1MQ8B 3HNOA 3JYPA 3SC4A 4UFOA 3SN6A 5KWIA 1K98A 3LUFA 1S1MA 1PDVA 2A9FA 2Z57A 2ZIWB 4GNKA 5HS4A 4KWIA 4F9GA 3ODPA 5DM0A 4MV4A 4G8BA 3UK2A 4QOEA 3IAFA 4KR0A 1XDSA 4K9OA 1E58A 3FUVA 4FCVA 4KN8A 4AF7A 5A4KA 5BP7A 1U94A 1WB9A 3ZY5A 1PQYA 3MTEA 4P6VF 5EY5B 3V33A 1TRHA 1NDUA 3FLEA 2FZGA 1BE6A 2NVOA 4X94A 1NX6A 2PQ0A 3I64A 3L7CA 5CJ2A 3MWGA 5LXTF 3WJ2A 4B3HA 1SB9A 4R0MA 1E1RA 2A58A 3GZ4A 1L5LA 1YR6A 3D0KA 2AK2A 1X8XA 1E0JA 3N2NA 2DERA 2VCEA 2CK3D 1E9EA 4LXUA 5EUQB 5AHOA 1CYEA 1V16B 4TV8B 2JAOA 2FUG1 1CR6A 3F1LA 3LLVA 3RABA 5K6TA 1U2QA 4YLEA 3RS7A 2MSNA 1VSQA 3L8DA 5F2KA 4NPHA 1YVUA 2Q0SA 1JEYB 4D4MA 4NMHA 1RYFA 3LDHA 4CIDA 2ONYA 1P5FA 2PZLA 4P2GA 5LQSA 1RCFA 1SCAA 3JZAA 3M3DA 3N58A 4REOA 4LTMA 1ZINA 1Q14A 3C3AA 5KMGA 2GR9A 2PT7A 4EYOA 3LF1A 5E9JA 5LKRA 4HDRA 2AXEA 2HMTA 2I4NA 2PLAA 3EEBA 5KIAA 2VHJA 4CNQA 1SJ9A 1H3FA 3AL3A 2HCFA 4TQUS 3NIGB 1Z06A 1L7MA 2XWJI 1D2EA 4PYOA 3MSXA 1X0VA 1YB6A 1S4MA 1SC1A 3FGZA 4MRPA 4XUGB 1AKUA 3JD4A 3C70A 2FSIA 3H1TA 2CJYA 4TM7A 1I5OA 1YASA 3TCXB 2RAVA 2QE7D 1G17A 1DEHA 3HR4A 5E4FA 2EFGA 5SZKB 4U39A 2UUOA 2J9RA 2O2CA 3VX4A 3AVWA 3SVTA 4X65B 4P3KA 4ZJZA 3LQ2A 3A3YA 1Q15A 1Y9EA 3HU2A 2P79A 4XWOA 4KQKA 2IWRA 3FOEC 2UUAB 2WI8A 1RADA 3IE2A 3IUJA 5CXQA 1MPTA 3R9IA 1QZZA 4HDRB 4OYLA 3VSCA 4RVFA 3IO5A 3FMPB 2XY4A 3ZVKA 1Q0SA 5K0JA 3B3JA 1PZXA 3OZGA 1E18A 4LMAA 1V1JA 5K6AA 3JRWA 5ILQA 5B6IA 1RJGA 3OWHA 5ALPA 1WDMA 1FP1D 2XWBF 4DSOA 1V9LA 5M29A 5D51S 4C14A 3IQGX 1PN3A 4KSBA 3ADPA 3VHLB 4P0QB 5ECYA 1YQDA 4P9NA 1QDUA 1MT0A 1TCCA 4WOBA 4LJ8A 4MQ6A 3GFPA 5LM3A 1BKDR 2XB6A 2PX6A 1N6NA 3JV7A 3LC2O 1CZKA 2ZCVA 2CD7A 3VR6D 1NMQA 3NGLA 3NHJA 3ZU4A 4FU0A 1QFZA 3AXSA 3N2EA 4KH0A 5AK4A 5EXXA 4GSYA 4OGGA 3TIGA 3FTNA 2ZROA 1SKAA 1W6UA 2ALJA 4O29A 4RMGA 2RIRA 5KNBA 1EEHA 1NUAA 3VU1A 4Y0NA 4KPYA 1G8MA 1P4GA 4LY0A 2ZJOA 4V1CI 4IGAA 4REMA 1AHPA 1SEPA 1C7RA 4FT2A 5EHXA 1KMMA 3LIPA 2P65A 3LO8A 1SVLA 3WADA 1U7UA 2EAUA 4LMRA 1EZ1A 3FCAA 1JJIA 1E4OA 1NUTA 1XRLA 3ZU2A 2G07A 3TZ6A 4DR2B 4C6SA 1E7YA 2O2EA 4ZVKA 2QP3A 3EVNA 5AXCA 4EA8A 1XXLA 3G5TA 3WL6A 3ZTTA 1QM5A 1U9IC 4GX1A 3MWFA 4JMPA 4CTOA 3U7GA 2MJLA 1YDHA 2YNMA 5KWEA 3HLKA 3O4GA 1QVVA 1KZHA 1T10A 2Z3ZA 3BPSA 4ZVSA 2C82A 2UUPA 3WYBA 5IKMA 1NBEA 4YDSA 4C7BA 3HCBA 3WYFA 1C4OA 3OE1A 4AL4A 4BN4A 1DO8A 3B1JA 1K97A 3O93A 4F3CA 2O23A 3UCXA 3WNQA 3F2IA 3F3YA 1SBQA 3G2HA 4U7PB 3OU6A 4V39A 1DBSA 1VLVA 1Y7IA 4IXTA 4JA0A 3TF5A 1HMYA 3FB1A 2ZYRA 1P74A 2YQ5A 4L5YA 1SOVA 5ER6A 3UBTA 1HMPA 5E2AA 3H9EO 2EIXA 4OHZA 1L7RA 3A1UA 3CLTC 1UJNA 3FG9A 4HMOA 4Y2RA 3JYOA 5HBRA 4BEBA 1C14A 5C4MA 2BFWA 3W6OA 4OEHA 4B44A 1CPYA 1IHOA 1LSSA 1WDKA 2BGTA 2B7LA 2J85A 3ZWAA 3KKPA 4RTLA 5JAPA 1AQ6A 3V4RA 2PL1A 2XVYA 3O7MA 1Z4OA 4MDFA 1TCBA 1L3BA 2R8BA 2DHCA 3F3MA 2YV4A 4DT1A 2HCRA 3EVGA 3OQ6A 1C8VB 4QLOA 2OV3A 3KHUA 1PO7A 1N7JA 2PNFA 3IKMB 3SYRA 3GVHA 4E4YA 2UZIR 3F5QA 4K6GA 2WUGA 2P2YA 2IY8A 2BKAA 3D6MA 3DT8A 4WRRA 3TS1A 1NG1A 4H7HA 3TLGB 1UOPA 2AQIA 4CMIB 5LCXA 1KTVA 1Q44A 1JEOA 3T3GA 2AR9A 1ZESA 2CKDA 2EP8A 1ONPA 1W2GA 1E2MA 2FN9A 1FSZA 2IYOA 5DGHA 5A3JA 2WSIA 1SD2A 4FI3F 1KMQA 2PFSA 3VSAA 2QU8A 3S44A 3SKVA 2ACKA 2YFHA 4YVFA 2C9YA 5H82A 1DFGA 4CEHB 4D0NA 5JDCA 1G2IA 1RKUA 4DT1B 1CK4A 2J6IA 3D0OA 4HRVA 1J8YF 2IOHA 4NS1A 1GGVA 2PBFA 3O0DA 3ZDQA 1WV1A 4NFLA 2X7JA 1WUHS 3C7KA 3V8VA 5KI6A 3WLNA 3V1MA 3WYCA 2B8TA 2ADOA 4G84A 3UJ8A 3DOEA 3MJ4A 5HVNA 5FIUA 1L3IA 2V7QD 3BH0A 4CKCA 5FPHA 5H3LA 4DDHA 4BEWA 2VPXA 3MCVA 4FX5A 4V0KA 3VGJA 1L8AA 2D5BA 2UXDB 4GRDA 5DV9A 1NUHA 4OHMA 1SU4A 3LQKA 3A0RB 3UJ3X 4DEXA 5JCJD 3O2SB 3A6HA 5EESA 5DBFA 5EE9A 1KI6A 3QVGA 2ZYSA 2CVQA 4OMUA 1PGJA 4Y1FA 5LZ8A 1O95A 1MFPA 4FDUA 1T8WA 6REQA 4S0ZA 1W5EA 2HN9A 4MQBA 1GSIA 2WF6A 3O4VA 5D5QA 4IINA 4C21A 1E2JA 2V6MA 1OFVA 4R7TA 1DEKA 1WO8A 4OATA 4BKPA 4AJIA 3D9QX 3SMQA 2JAPA 4OLFA 2P0EA 1UIMA 2GYWA 3RVBA 4XOIA 2IDZA 4DCVA 5IK2A 3M49A 3E7WA 3V8NA 4CMJA 4US2R 2GHTA 4A16A 4F8JA 4P58A 2BMWA 1K1EA 1P7PA 2HSDA 1TMGE 4YRCA 2E4VA 1X2EA 4HB0A 3ZWKA 5BV2P 5F76A 2ZQYA 1UODA 3Q9UA 1P4JA 4XR4A 5WRFA 2QNRA 5LFAA 2NAPA 4NU6A 3WRYC 1KEKA 1N9KA 1PJ4A 3I45A 1UKEA 3FETA 4UASA 3ZV5A 4BV9A 5JU6A 3JPWA 3JARB 2GAAA 4MVJE