4U7UD

Crystal structure of rna-guided immune cascade complex from e.coli
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
201
structure length
191
Chain Sequence
AWMYLSKVIIARAWSRDLYQLHQGLWHLFPDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasA
publication title Crystal structure of the RNA-guided immune surveillance Cascade complex in Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Rna binding protein/rna
total genus 30
structure length 191
sequence length 201
chains with identical sequence P
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 4u7uD01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 4u7uD02
4DZDA 4U7UD 5CD4A 5H9FK 2Y9HA 4QYZK 2Y8WA 5H9EK 3QRRA 1WJ9A 2Y8YA 3QRPA 3QRQA
chains in the Genus database with same CATH superfamily
4ALZA 2OUGA 3CCWA 1CJTB 1SC3B 5BR8F 3K59A 1XC9A 2BJDA 1TKXA 3BSAA 1WI8A 2RQMA 2VG5B 3V6DA 4ZDNA 2HNYB 2R9LA 5BR8J 4PXBA 3MZIA 4LVOP 3ICLA 1FTCA 1VFJA 1LNQA 1XMBA 2FY1A 3HD1A 1F5AA 1SKWA 1YRUA 1EP4A 4Q8EA 4ZPAA 5DQHA 5IFMA 2DGQA 4M5KA 2F5GA 3PV8A 2IY5B 1P9QC 5EWEA 4M8LA 1QLNA 2LEPA 4L3KA 3B6BA 3OUYB 4RW7B 3HZEA 5FD1A 1GAOA 2UXDJ 3TQ1A 1N33J 1VJQA 1BLUA 2ZOGA 5L46A 2LMIA 2DXDA 5GMKa 1M90T 3CTRA 2OLWA 1JJ4A 2M8DB 4MJKA 5B08A 2FVQA 2HFVA 2N3OA 1VQNS 1U1PA 4KJIA 2NXEA 2N4CA 3I31A 3L7OA 3BREA 3P49B 3H7HB 4GVBA 2V69A 2IC3A 5A0YB 1TTHB 1MW7A 3L9ZA 2CJ9A 5ETMA 4E2FB 2F9DA 4HR2A 2DVIA 3EDRB 4DQSA 1UWAA 1R0AB 3SZ2A 1B0VA 4HDGA 1AW0A 2OPRA 2BJ1A 3ZZ0A 5AXKA 1NM2A 3QPIA 2R7XA 3Q8SB 1X4EA 1G1XA 4EBCA 4LRBA 4ES2A 2VFRA 3EMTA 1RAIB 4DL2A 3PRVA 1VQ9S 4IG0B 2VH7A 2YX7A 4QIVA 3PKMA 2C3MA 2MJNA 3PYDA 2FJWA 3POTA 3TVZA 2DIUA 2OPSB 3OLBA 1RTZA 2ZOFA 1B7YB 3OTOJ 4JOUA 2VD3A 2CPFA 4J9MA 1S6UA 3JQMA 1JKHA 1Q7YT 2BM0A 1VQYA 4Y2KA 4Q7AA 4CO0A 4RW6B 2XSFA 5C25B 4RNHA 2GCFA 3HHLA 1HMVA 2HLTA 4I2QB 4OJ1A 4ZIWA 4WKYA 2ZJRQ 3DOKA 2QEXS 2DPJA 2FVRA 1NAQA 4QIFA 5HI7A 2LXUA 1KHVA 2W7OA 1U1RA 3BGFA 1O51A 4ED7A 3TRGA 1D9FA 3IWLA 3HKWA 3OSPA 2BYCA 5KFEA 1JLAA 4O3QA 4B9MA 1Y0HA 1MU2B 3KDNA 1TL3B 1AA1B 2ZH9A 2HRYA 3CPWR 2O67A 3BH7B 3J80U 4CH7A 4I6WA 2LEAA 4PXEA 3T1AA 4NLRA 5L1IA 2X1AA 4LF5F 3OFHA 2ZNZA 3GYNA 1TL7A 1FEHA 4LF5J 3VR1A 1HBOA 2MB0B 1WC5A 2GNKA 4YB6A 4PR6A 3DDKA 4I69A 4B9SA 1G2EA 3IGVA 5IM0A 1KTVA 3MFIA 3SCIE 2FJXA 1U6FA 5KG2A 1BQXA 4K0KJ 3CE8A 2HGMA 4KH0B 3KKFA 2AP6A 4UW2A 4ECWA 2MDAA 3SXLA 3T41A 2GMLA 4IFVA 1WKJA 1RDRA 3T1YJ 4ELUA 3C15A 2LQ8A 5KFFA 3D67A 5AE3A 4A8QA 4QQBA 3GJTB 4NLYA 4PYDA 3ADAC 4NPOA 3E2EA 4H4OB 3DFEA 4ILRA 4KRWA 5J2NA 2E9RX 2XGQA 2UP1A 2CJKA 2GHPA 1H38A 1YK9A 3VAIA 2BANB 4PG8A 2VA3A 4IYQA 1Q4RA 2DGVA 2RH3A 2QA4G 2A2CA 1IUJA 4DN9A 3PFEA 3AB4B 4QJVA 4IQMA 4F0KA 3DKDA 4PG7A 4WPAA 2LYVA 4C3KA 4OHVA 2PI4A 4GKKJ 3P45B 4ZVRB 2AF6A 4P2MA 2DEIA 2UUBJ 2JLFA 5ETNA 2QX0A 5KFXA 3HM9A 2DNLA 2B9EA 4FXDA 4OZJA 4FYWB 4P6QA 1MN7A 4X62J 3B78A 1KFDA 1RAGB 4A48A 5LM7E 1F5BA 4M5DA 2YNFB 3HSZA 4QPTA 2J76E 5DQIA 1AUDA 1T3OA 5C42B 1CVJA 1K47A 2I0XA 2J8SA 4ENOA 5F3ZA 3LO3A 1MROA 3DHWC 4YN3B 1Y10A 1H98A 2FVSA 3VHQA 1BD6A 2C2EA 5DO2A 1EETB 3KHHA 1FE0A 1TUGB 1GQEA 4MIWA 1AROP 2ASDA 2ZEJA 1YHQS 4QWDA 4ZLLA 4CH0S 4URQU 3QJJA 3TI0A 5KTQA 1N32F 1GTHA 2Y8YA 2CAJA 3T6JA 1WOPA 1FXRA 4LSLB 2CPHA 3IRXA 4Q8FA 4FF2A 4QCLA 5LSLA 3Q22A 1FDDA 2RKIA 1E6YB 3QMQA 1C0TB 4MFBB 5D6GA 2QO3A 1HNIB 4DEZA 2OPPB 2CQDA 3PJWA 2Z2LA 3L95X 4DV6J 4NYPA 3Q8UA 4ITSA 4URGA 4N77A 4PUOA 2RF2A 4YHHJ 2C2NA 4ED2A 3GG0A 3K5LA 1IKYB 4DR5J 1HQ2A 3VAMA 3EXCX 1LOUA 4JBCA 4K4TA 3M2RB 2BRLA 2B0GA 3CCLS 3PHTA 3WX4A 5HQLA 2M3DA 2XTJP 3ZNUA 3AJDA 2YNIB 1LWFA 3CJKB 4LIRA 3FFIA 1TKTB 3H5UA 2JEFA 2YY3A 5A2QY 4DPUA 1SJ1A 2VFSA 1BXNA 4DR7J 2WOMB 3OXLA 2PT0A 1X4BA 3A4TA 4ZP7A 1WC4A 4G1IA 1RT4A 3VTIA 4TYBA 4X4OA 5JUMA 2FDNA 4RWXA 1SL1A 1U4BA 3H25A 2PDAA 2DR7A 2DY1A 3PHEA 4FBTA 4WFBQ 3JSRA 4OYAA 4ED1A 2A3JA 4C9DA 1SQFA 4RBUA 2KKHA 3DLEA 2YKOA 2MQ8A 5KT4A 3IXQA 1OQ3A 2HWHA 3IM9A 4YB7A 1KRPA 1NZAA 3BPDA 4KR0B 3GIMA 5M2RA 3A8JA 3RGIA 2IAJB 1K9MT 2Y1LB 3R2DJ 3T9ZA 2ADBA 2CQ1A 1F3FA 1NHUA 3W5XA 4BC7A 5LMUJ 1I6JA 2LEBA 4PRFA 4WZMA 3R5CA 3N79A 2IFXA 2GVZB 2W9BB 3CD6S 4JI2F 2HS0A 1LWCA 2CQCA 5I42A 1ZAWA 4Z2XA 4TNOA 3R5GA 4RUAA 2HHPA 2Q1LA 3H42A 4YR0A 4IUFA 4CYUA 3QIDA 3GB0A 3OR2A 2GHVC 2XWXA 3Q8QB 3R6GB 2E1RA 3DRXA 4JI5F 2ACYA 4C8LA 2Q6CA 2LCWA 4CI0B 4DX8H 2KL8A 2HK3A 4WIQA 3H2UB 1TZ0A 5JVHQ 4A46A 1S1XB 1IJFB 1K44A 4RKUC 3FCVA 2CJQA 1OSDA 4LF1A 1NK6A 5F3TA 9RUBA 1NEEA 1PIEA 2FJAB 2BZ2A 1XTZA 3KMQA 2GZOA 2VFVA 5HK4A 1HNXF 2H4YB 3W9IA 3LUYA 3N28A 2IVFB 3FQLA 2MEWA 3AA8A 3AD9C 1FRIA 4ZVPB 3H2LA 1SUQB 3MECA 1LW2A 2W9CA 2MQNA 1FDBA 3NAIA 2Y3YA 3CGIA 1T05B 2GIRA 1TL4A 1KFSA 1KNZA 1VIOA 2MLYA 5RUBA 1TMJA 4CM0A 1FNOA 3L3CA 2KZZA 4QW9A 4ED8A 2ROEA 2L48A 4N47A 6FD1A 2AIRB 3OTEA 1E6VB 1FRKA 2VONA 4A47A 1U6BA 2JLGA 3CJRA 3GG1A 1KVKA 2D3UA 5FDLB 3DLGB 4F4YA 2FZCB 1TL3A 1KVJA 1CLFA 4KHPJ 2RDIA 3NS6A 2APOA 1S9EB 5GADI 3Q8RB 4WFNQ 4WU2A 2YWWA 3SDEB 4USJC 3ILOA 2V8VA 5AT1B 1I94F 2JLEA 5F0WA 4DG1B 2FUG9 2OPQB 3Q8VA 4RNFA 2VICA 1N88A 4LIWA 3R5AA 3LA0A 1YDLA 4YS2A 2BE9B 1VHIA 2KM8B 2VKZG 4K59A 1WF2A 4UZCA 3BM7A 5D78A 3N6NA 3MMCA 4U8VA 1DLOB 4ETXA 1R8PA 5GAGI 4DV4F 1FA0A 3NNAA 4BCAA 1FX4A 3MOZA 2KVIA 1N5YB 1QAIA 1FDNA 3IO1A 1FVQA 3CF5Q 1Q78A 4RR5A 5J2MA 3PKYA 3MR2A 1D0EA 4F3QA 1JLCB 2C2RA 4M5NA 4I64A 2V8DA 1IQTA 3M8ZA 2CADA 1OIAA 2RILA 4IG3A 1MMNA 4B3TJ 3BSOA 3NP5A 3BEGB 4NWBA 4EGLA 1XEZA 2VL1A 1HNVA 1ZOTA 4Q44A 3HO1A 3AD8C 2HURA 4NOHA 5KFVA 3DRSB 4DL3A 5M2PA 4NMXA 5JVGQ 3KK3A 4FNIA 1SJFA 1P27B 3PRBA 2PIIA 2NXCA 2E1MC 3GP9A 1WHWA 2L41A 4J37A 1ZM2A 3P8BB 2GGPB 2UVWA 5KG4A 1RXOB 3PYGA 1RAOA 3BQ2A 2B9YA 4K4XA 1X9WA 2BW2A 2QRRA 5C42A 1BWEA 3K2YA 1NPKA 1DZ5A 3EVOA 2HWIA 1SL2A 4CH1A 2B9XA 5B0BA 2YKMA 1TVRA 3KLIB 2B7BB 2ZC4A 2MQMA 2KHCA 1XNRJ 4DR6J 3GFZA 4RWWA 2UXBJ 4N56A 2YKNB 3PZPA 4S0MA 1D8ZA 2P2CB 5J1NA 3VAKA 1SPBP 2BE2A 2OD4A 3D1QA 3JQKA 3PNIA 2FB0A 2M70A 4G1QB 3UNGC 2AJFE 2CJXB 3MTJA 4OI2A 3M2VA 4LF4F 4DL0C 2ZJQQ 4DR2J 2J6SA 2CQHA 4AYBD 3FJ2A 1C0TA 3R1HA 4DMZA 4F4ZA 2LVWA 1DQAA 1KS2A 1PCAA 3BYRA 2J0WA 4O23A 1HBMB 1JJ2R 5HQMA 4X4SA 2BV3A 5DM6Q 4KGVB 3DXSX 1Z2ZA 1PAEX 2E5HA 2Z56B 1JLQB 1UJ5A 2HK2A 4CQ1A 4F36A 1S4EA 3ELHA 2C22A 2IHR1 2XG8A 5U47A 4OX6A 3GYGA 2GFFA 3C46A 2XWYA 5CYMB 1ZS6A 1VIXA 3KK1B 2B4UA 2CQ3A 5HO4A 2DGWA 1FJGJ 4LFCJ 4H4MB 2J6TA 1HI0P 4DU8A 2AW0A 3NBPB 4OL8A 3S7RA 3G87A 2VBXA 4DR3F 2UU9J 1SBRA 3GCWP 4QPXA 4WCEQ 1HNWJ 1AB8A 2RAQA 4MAKA 3WZ0A 2CKWA 2C2DA 1HBUA 4BWJA 1SKSA 2KXFA 2AEFA 4UUWA 4WJBA 1HWKA 4B3RJ 1Q8BA 5K14B 1J5EF 4FPRA 3DM2A 1YI2S 5B0EA 3MAQA 1D9DA 3I9V9 2KYZA 3OFGA 4TYAA 3DLJA 3FVYA 3RB3A 4C98A 1H7WA 4DV5J 2MKYA 4CCHA 3EYZA 2CJYB 4USIA 2IJNA 4X4UA 1SJQA 4P7VA 5C5JA 3Q8YA 1U8SA 1VBYA 2WAQD 4RW9B 1R8AA 2A0FB 1FF2A 4ANDA 1XWLA 3LP0B 2J9DE 3C14B 2G4BA 1RT3B 1AYEA 2XY7A 1ITPA 4MYTA 4ZVEA 3KLGB 2R2SA 4LF7J 1N48A 3SBMA 1AZSA 1K0TA 3D6MB 2GVZA 2W9BA 2C42A 3MOJB 2AMCB 1FTRA 1YLXA 4ZPTR 2XSJA 1HNZF 3VAJA 4DV1F 1UEKA 1UVIA 2DNOA 2DXEA 4ZVUB 1RTIA 3BO2A 1Z1ZA 1XR7A 4OI4A 2IVYA 2WONB 4J9QA 4EO6A 3BH6B 2CXEA 1T9VA 3MEDB 2JWNA 3OW2R 2C3OA 5KG5A 4ECQA 1NNDA 3UVJA 1RAHB 3K8VA 2NQPA 2J0XA 3A8KA 4QWEA 2IRXA 3HFVA 3RRKA 4Z7YA 4C7QA 2VHGA 4OX8A 4QU7A 2I2YA 1XK8A 2XS2A 2R7WA 1RU1A 3FBFA 2O1PA 2QT7A 4B3OB 4B3MJ 3OD2A 1WELA 1KC8T 1TAQA 1HI1A 3M6XA 4ZLJA 1NRKA 1XBWA 2PMHA 4HKQA 4ERDA 2CQGA 3UN3A 4DV3F 2G2OA 3MR5A 2V4JB 4KYZA 3OXGA 1LWXA 1RZMA 5D4NA 1KLNA 2ZNYA 4DV2F 1NB7A 5T7LA 1Y00A 3JSYA 4F4KA 1JJHA 1T05A 3DYAB 1G7CB 1VK3A 2GMJA 3UD3P 3OSNA 3PCOB 5AE1A 3WC0A 2EK1A 1EZZB 2XMVA 4FS2A 1S0VA 3Q2TC 4J9OA 3C3LA 4QYRA 3D54A 2GO8A 3CCMS 4TY8A 2N4DA 1SB6A 5KFGA 2OP5A 5HROB 2EKNA 3G71S 4ZPDA 5L1JA 3T5HA 3L7PA 2ZH1A 2DGTA 5CCLA 1HYSB 2G1HA 1S57A 1JLEB 3GQCA 2DNZA 1PAUB 1S5ZA 3D1OA 3F0NA 3BBBA 3DRPA 2HNDB 3HVTB 4K5RA 2MY8A 1JXVA 2RQKA 4N41A 1QUVA 2HQ3A 3CXCR 1H2VZ 1RTHB 1VBXA 5BYSA 5ETKA 2XYHB 1XMOJ 5EN1A 5DGAA 2ADCA 3TVYA 4K5SA 2C3PA 2W7AA 3R8YA 2BQRA 2LDIA 4AXIA 1WEZA 1ZAVA 4Y34A 1YJRA 2B5JB 1X4FA 4GO7X 2QSWA 1S1UB 4U67Q 2L9NA 4CT9A 3DOMB 3I56S 3KHLA 4DL4A 1PKUA 1WTBA 1NJXA 4C8YA 2ATCB 2DEJA 3NRBA 3NWGA 4H4KA 4JI0F 2FLNA 4J90A 3MF5A 4OYXA 3PG9A 2D3O1 1VC5A 3EUNA 4JI0J 2CZ9A 1RAEB 2F7VA 2AU0A 2W4DA 3RBEA 3GMGA 3CEDA 5DLGA 3G82A 3T1HJ 1YRTA 4QWCA 4XIUA 4JV2A 4MK9A 3J7YI 5LOQA 5HLFA 3M8WA 4QW8A 1TV6B 1CJKB 1UZDA 4LSNB 2XCAA 1Y3KA 3KK2A 2EFVA 3M8PA 1IKVA 3EICA 4M5LA 4LF8F 4LF9F 3M9MB 4O4GB 4LSZB 3ITHA 3I0SB 3SEOA 4PQUA 4DL5A 1BQNB 2FGCA 3BBFA 3EPIA 2BKOA 2RRBA 1NSKL 3AH6A 1C1BA 3D0GE 1PYTA 3MEGA 3NGDA 1OJ4A 4ZPVR 1K0VA 4LF2A 1F3VA 2IYGA 4MYUA 2GHWA 1RLCL 1T95A 4JI6F 4F4XA 1MN9A 1PG5B 3KOAA 4K8RA 3N4WA 3O1LA 4C0OC 1Y5NB 2BKPA 1NKEA 1P1LA 3ETMA 4PKDB 3KXDA 5EHHA 1OY8A 1S77D 2AGQA 3CUNA 1UEUA 3PO4A 3Q2SC 3HVWA 1SXLA 4X4RA 3UQSA 3KLFB 2HS3A 4ED5A 4I0WA 2JEGA 2PFFB 1NPPA 2V67A 4DHVA 3MCMA 4KHMA 2ZBCA 3KLIA 4CLFA 5CABA 1DTQA 4NA3A 3W2WB 2RUGA 4X64J 1WWHA 2J0SD 1TL1B 2WK4A 2Z2ZA 3I87A 2QC3A 4LVNP 3HKZD 2RJZA 1PYOB 4B9VA 5C24A 3WC2A 4IDKB 1QSSA 2V63A 3OVBA 2ZD1B 2KFZA 3DXBA 1YWXA 4DQPA 4KQZA 4A8SA 1TK0A 3FEYB 2F8EX 2YNGB 2OMLA 2E1AA 4USKA 2DNKA 4DSLA 3DRRA 3GR0A 3DC2A 3MUTP 3CIMA 2R2UA 2XM3A 2XB2D 2ACMA 1HI8A 1WACA 3IG1B 3HJVA 4YR2A 4KV8B 1VLOA 8RUCA 1F60B 2HVHA 3D4JA 2ZE2B 3H40A 1N6QA 3M7VA 5KOWA 4JI1J 2GVDA 4JI7J 4CP5A 2H1YA 1SKUB 2D9OA 5MAOA 1IKXA 1JQGA 4DX5A 3BJYA 2YWEA 1TKZA 3RBZA 2KI2A 4HVZA 4U7UD 1UCNA 2XHCA 2HQGA 2OFHX 2AKWB 2GMHA 4DU7A 1I5OB 3O3LA 3G2XA 2RRAA 4R5PB 4AQYF 2ZHBA 1FKPB 2MGZB 1UPMB 3EGVA 2FHKA 3RG6A 4A8KA 4OYBA 3J7AN 3QRQA 2DYAA 2GJ2A 5CAAA 3PEJA 1RWUA 1RSCA 3W2VA 4B02A 2CWXA 4O0NA 2BQ3A 4XK8C 3OJUA 2FHJA 3HSJA 4DV0F 1HLWA 1PYSB 3M8YA 5HATA 3M32A 1KEKA 1X8DA 2K3KA 1REVA 4BC9A 1TUWA 2UXCF 5AJ3F 2QLXA 3CJSA 1M5HA 2DHAA 3CO0P 3RBDA 5GAGU 1DJ0A 3OQ2A 3C6TB 4WTOB 2R7SA 1YKWA 3VGSA 1WKLA 1GMWA 4R25A 3CCTA 1YBAA 3RW7A 2E44A 3ZO7A 2QFJA 1JLFB 2KU7A 1S7HA 4IFYB 2DH8A 1S1VA 2QIFA 3US5A 2XS5A 4L75A 4P75A 1R31A 1NK7A 3M30A 3W65A 3ENAA 1RT3A 2YNHA 1B70B 1T7PA 2FLPA 2OSRA 4ELVA 3QT7A 5IT0A 4W98A 3N01A 2QL9B 2M2BA 2IPOB 1GNKA 5IOLA 4ZVHA 1Q5YA 4Q0BB 4XDCA 2AT1B 3I5BA 2PO4A 3VGVA 4ID5A 2COLA 1NDLA 4KHRA 3NNCA 4F0HA 2B6AA 2J9DA 4DFKA 3TUPA 2ALYB 1NSAA 5KFWA 2CPZA 2CA9A 5A8RB 4F2RA 3TAQA 1RBLA 3HCXA 3AOBA 5F9NA 2KN4A 4DV7F 2BXJA 5K20B 3MTKA 5HBMB 2YQ3A 2DY9A 1UWBA 2G0IA 2XLJA 1T03A 3UD5A 1VHFA 4QYZK 3FSIA 2OTJS 1RT5B 1HQEA 1RWWB 1U1LA 5KFTA 2AZ1A 1A0OB 3M1VB 5EDWA 1RI7A 1GH8A 2XMWA 1HFEL 4EYIB 1XIQA 2CDQA 3HULA 1HW8A 2BUNA 4RLEA 5E33A 1RT7A 1U1QA 3H8YA 4HDHA 5J2QB 1LQ9A 3CD5A 1RQ0A 1QY7A 3QSYB 4ZPBA 4CO1A 3MPYA 3PIPQ 3JYTA 1TKDA 1RYRA 4EUVA 3ZTSA 1PC5A 3MM7B 1QM9A 5EUHA 4J9RA 2VBWA 1HYSA 4BWMA 3RB4A 3CJ3A 1M0SA 1JWWA 3DN9A 3KJNB 5IT9Y 2ZH3A 4C11B 1T9TA 1MLAA 1TMMA 2PA8D 4YUDA 2YX4A 4WK3A 2OJ3A 4DPOA 2H51B 3BGRA 3ZZOA 2HHQA 2ABYA 2WW8A 2QMUB 2XMUA 4CNZA 4DUYF 4DPTA 1TKXB 1EAYC 3WX8A 3V6DB 1RUSA 1M5SA 2BOAA 3MM5A 4RBVA 2DITA 3CJ2A 3I4PA 1NZ8A 3J7Z5 1S1UA 4Y6IA 3ZZPA 1NLKL 2HMIA 4Q43A 5F8IA 4OMFG 3MM6A 3TW0A 1EP4B 5DM7Q 1U24A 2AZ3A 1CG2A 4NMLA 1ELOA 4B3SF 4P71A 2WCXA 4XTTA 3BGLA 4B3SJ 4TVAB 2MZSA 3G6XA 1ROFA 1D9AA 1FK9A 2YTCA 1RA6A 3QO9A 4NLDA 4DUZJ 3FSXA 2QYGA 4PG5A 3C16A 3CJTA 2JOQA 5K5MA 3AQOA 2GS8A 4AD6A 3KG0A 3SIPB 3J7A1 2R7UA 1UEVA 1S9GA 5IS2A 3KWMA 3N5FA 1H2UX 2XMTA 3UPFA 3KNGA 4W4MA 1FESA 4DSKA 4P2SA 1WI6A 4N8NA 2QYCA 4ECUA 5E3PA 3ENVA 4R8UB 3QLHA 4AL6A 4GVBB 2IC3B 1N5TA 3B4MA 3TUIC 4ZHRA 3KJVA 2B8QA 3ONQA 3R3TA 4A8MP 3NGSA 3IM8A 2DRAA 4QU6A 2VC1A 4GVLA 2JL9A 1C1CA 3G8QA 4HHJA 3EGNA 1B0TA 5E7OB 1PSDA 3UR0A 3ISNC 2UV8A 1EJ7L 1JLBA 5KFRA 2RVJA 1IQZA 3H20A 4UOCA 4DCJB 2V5HG 4EK2A 4O3PA 1TU0B 1UVLA 4JV5F 4M5JA 4E98A 2HQIA 4DS5A 2W8LA 4FBUA 1O5JA 3BO3A 2Q43A 2W01A 5LT5A 3QGPA 3POTB 4P2FA 1RT2A 2QZ8A 2WB1D 2KM8C 2CUYA 3ISND 3V81A 3BR9A 1D3WA 2XLKA 3ISZA 4Y3CA 1YQHA 1M1KT 4H4KC 3VCDA 3CCES 2NYHA 4K4VA 1JKHB 3FEXB 2P9EA 2BRKA 5D8HB 2IBKA 3UDVA 1YJVA 2V2KA 4IDKA 4USHA 2V4QA 1ZH5A 4WYWA 3TA0A 2G2YA 3HHLB 3GWCA 1HMVB 5KFUA 2GIQA 2OMOA 4OHWA 3TX8A 3OBIA 2LA6A 2PSZA 3DOKB 2DNYA 3C19A 2VV5A 1VRUA 4Q2MA 4TLRA 2HVIA 4EYHB 3TUZC 3RR8A 3VVTA 3IBWA 1G3OA 2AGOA 2CPJA 3PRDA 4OI3A 1CC8A 2B3TB 1FXLA 2YWHA 3B82A 3EVMA 3D2WA 3OPKA 4PZVA 3BGUA 4HYKA 2A2DA 2ZHAA 2QSFA 1FKOA 1JLAB 1U8WA 1FRXA 1U1MA 4XDDA 5LMNJ 1S1WA 4QZVB 5D4LA 3CC2S 3D3CJ 3CCRS 4P74A 3FMWA 1VQSA 4UY8T 2M8HA 4KGMA 4PWUA 5G4DA 1NK0A 2A6MA 2XMKA 3EM1A 3E8OA 3LAKA 2FJVA 3NL0A 3SCJE 1TL7B 1IBKJ 3OR1A 4OLPA 3N6MA 1M5OC 1HBOB 4ECTA 1U47A 3HHNB 4ETZA 1SL0A 4OZNA 3DDNA 2J7WA 2YVSA 1IN0A 2YKQA 2IM2A 5ETVA 4P10A 5IM0B 4LBPA 1OWXA 1L3SA 4CRJA 3THPA 1K1QA 1NSQA 3GSIA 3KJFB 3S01A 1S4FA 2NXNA 5HMXA 2CQBA 1A9NB 1KTQA 4KO0A 1UZHA 3WIVA 3Q0AA 4IFVB 4KT0C 2R42A 1R3NA 4USUA 3NCRA 4DL7A 2V68A 1KBRA 1XMQJ 3C15B 1LK5A 2P6SA 2RU3A 3VALA 3TAPA 4KSEB 5EX3A 5KFOA 1K73T 4WXWA 1S0NA 4Y28C 3TA2A 3CJ0A 2ZH6A 4IO9Q 1S0MA 3BBCA 4U96A 5J2NB 1W2BR 3R27A 5KT5A 2LU2A 1QTNB 5DS7A 3UCZP 1LFWA 3Q86A 1VS3A 5I3PA 3SSQA 2HHUA 3RZAA 2XC9A 2BKNA 2ILYA 4I1TA 1JNRB 3NMRA 4DZ6A 3BZQA 4C0HA 2ZBQA 2AWZA 5DG9A 4NASA 3AODA 2W24A 4Q45A 3IN5A 2QLFB 1O0PA 5B0CA 2QLJB 4NA2A 4M95A 2GV1A 2E1CA 2QMXA 3UW1A 3MI7X 1SC4B 5GAEU 3QT5A 3PIOQ 5BXIA 7AT1B 2VJVA 1J27A 6FDRA 3NNHA 3I9ZA 4Z37A 1HWJA 3KLHA 4KIAA 2FC8A 1LXNA 2I8EA 1JMTA 2CVEA 4IH6A 4ZPCA 2XNQA 3GJSB 4M5DB 3CT9A 4TQRA 3A3OB 5KFJA 3CDBA 1N0VC 5DDQC 3H4BA 1YJ9S 4KFBA 3QSIA 4KAIA 3ZFVA 3MAHA 1MROB 3V4IA 4ZJLA 2JHEA 1EARA 4L76A 1H73A 4PQAA 4LF6J 2DJWA 1UW4A 1R7IA 4W90B 3O5TB 2PE8A 4X4NA 2UUAF 1Q95G 1LW0A 3ZTRA 3IAS9 5HVGA 2GQCA 5AE2A 1UMJA 4M63A 3W62A 4MT1A 2VFTA 1QTMA 4NEYA 5KFYA 4P9SA 4DLGA 4X65J 5HJXA 1IBLF 1QJHA 5LL6d 1N34F 2IDEA 4LFAJ 2DR9A 4YFUA 4NXMF 2DTJA 1T0TV 1RT6A 4HI2A 5B0FA 5J2PA 1IBMF 3CCSS 2F4VF 3IRXB 1RTJA 1EQMA 1GMVA 5E2QA 4E8UA 2H5EA 1IBMJ 3TEHB 3FSYA 3GPAA 3QT6A 4GRSA 1KOHA 2L9WA 3NY0A 1IR0A 1H2TZ 1ZA1B 1Q86T 1S97A 1WDDA 2NSBA 3QBCA 1VQPS 1R8HA 1QSLA 3NEKA 2XYPB 3BKFA 3BB5A 5F8MA 3R5DA 4F4AA 3N0VA 4RO0A 2DPIA 2N3LA 4IRCA 3I82A 3I5AA 4TKTA 2DGOA 2A6OA 4HI1A 4PUOB 2RF2B 2KXHA 2E7VA 3MAAA 2K7JA 3IAM9 5DDRC 4RW4A 1WJ9A 1REGX 1N36F 1AT1B 2VIHA 5GMEA 4ILMA 2FIUA 4NYZA 1RAAB 2E1PA 3AB2B 5HMZA 2OTLS 1LWFB 1WF0A 1DHMA 1NCLA 2ZUAA 3FFIB 3R1LA 3R5JB 4IOCQ 5IWAF 4ZVQB 4ZN3A 1VMBA 2E9TA 3I32A 4ER8A 1VQOS 1RJJA 4Y2CA 4KGZB 4OYMA 3SI8A 3EDQB 1RT4B 4RW8A 1QSYA 4YDXA 3TJAA 2G2ZA 2HHSA 2OKQA 3EZOA 4FYVB 5CD4H 5DRKA 4LFBF 2IIHA 3I4HX 2VF3A 4F3MA 1Q8IA 2MQPA 1X4CA 3DLEB 1S6PA 4NYOA 3PX4A 1S7IA 5CQGA 5K8PA 2GQ2A 3MMBA 2W2PP 3QRRA 1AUSL 4LRAA 2HGNA 4X66F 3DLKB 3TZZA 4GKJF 1WHVA 3GJRB 1Z4UA 2PC6A 2M5YA 2WTFA 2JFDA 2OELA 2ZBPA 3M2UA 4ZN1A 5HL7Q 3MM9A 3TANA 2QLWA 4I2PA 4EBEA 1LWCB 4R8UA 3AT1B 2CQ4A 5I42B 4NXNF 4IQXA 1F0XA 2PA3A 3OLAA 4HHUA 4CYUB 4NXNJ 3C6UA 2AJ4A 3OR2B 3SCLE 3T9NA 2DNNA 2NREA 4OHZA 1WC0A 4RZRA 2OSQA 2UZAA 2ZC3A 2DGXA 1QE1A 3EGWB 5LXRA 3QFHA 4NRUA 2FQQB 3W5ZA 3MPVA 2WVBA 2HHHF 2QFIA 1F9FA 1OY6A 1JLGA 4ICLA 3R97A 2NLWA 4TLQA 1J5OA 1IVZA 2QL7B 5E0OA 1KWMA 3SMZA 1KQFB 5A8KA 4LRFA 3OTCA 3ZZTA 1S76D 4BS2A 4PABA 3VQSA 4M5MA 3IR5B 1YSJA 5KFCA 3MECB 1LW2B 2W9CB 2XGPA 3HXMA 3F56A 1PGZA 2XZTB 1NK5A 4JI3F 3CDWA 5IC4B 2AD9A 4HT7A 1FJ7A 1PO6A 2ZITA 1NH8A 2XMMA 1DTTA 5CZVA 2QGFB 2V8PA 2PD1A 1L3UA 2HEKA 4IKAA 3N5BA 3W7BA 3BN7A 2OI2A 4TXSA 1Q0NA 3TUJC 2PEBA 2NZ4A 2R8IA 1NDPA 4ZCKA 2X1GA 1CQMA 1XERA 3NKYA 2BEFA 4GC6A 1X5OA 2HRTA 1CS4A 3UI3A 2NXUA 4C8ZA 1FRHA 2CNNB 1VJWA 3UN2A 3M4XA 2VPWB 2AJ2A 4DR1F 1KQKA 3MM8A 4XO0A 3G4SS 3H98A 1UAWA 2HYIB 1FI4A 4D3HA 1RAFB 4WYLA 2GO9A 4ES1A 4UOGA 1IBCB 2KZMA 2NUHA 2VBZA 3RAQA 1Q7LB 5HN0A 2E5LF 3K58A 2BOPA 5FLXU 2JFKA 3MPDA 3M6UA 5GAHI 3T5JA 5BYQA 4U6PA 1FJCA 2RU9A 1QAYA 1RGVA 2DR6A 5CZXA 3J80Y 4RUCA 3I0RA 4HT5A 4LRDA 5FLXY 4DFMA 4CLLA 4K7QA 3BDEA 1MWZA 1LWEA 1EKRA 3ZZUA 4IR9A 5IXUA 3IP0A 2VG7A 2W2MP 2D9PA 1H0HB 2ZZTA 3MMCB 3HSGA 3I55S 5F8JA 4X2BA 3C2PA 2V9WA 2PI5A 1DURA 3KMSA 4WFXA 3MWBA 2GIFA 4O3OA 5I3UA 4CLTA 2HQCA 1F5CA 1V3SA 5J2MB 1NJYA 1EIYB 1UFKA 3CW2C 3M8RA 1T9YA 2KXNB 2I5JA 3FRYA 3TARA 3HDSA 1U6ZA 2HRUA 2KVQE 1WHXA 2LECA 2CPDA 4IG3B 4JI4F 1V3ZA 2WVCA 3NLCA 4NI2A 5J1EB 1SH3A 4NLSA 1HNVB 4FXWA 1DQ9A 4OJ3A 4WXOA 1ICEB 3G96A 3KK3B 3PXGa 1WEXA 2HKEA 1FE4A 2XZWA 4OZ0A 2ZM6F 1R6VA 4F67A 4OI6A 1HBNA 1VRTA 2MKIA 4K4SA 2ASLA 1ZBTA 2ZM6J 4NZ7A 2P9GA 2ZDPA 3H0PA 2YWFA 9ATCB 3NAHA 3E01A 2IMOA 4U9RA 1X0FA 3R2CJ 3LGMA 1IJEB 1R0CB 4V19J 4HL9A 1GXUA 1DARA 4J9SA 2YKMB 4DJBA 1QVFR 1NK8A 1FNXH 3CIZA 4AUKA 1TVRB 4WF9Q 1Q79A 3CB4A 3V6JA 5C2CA 2POKA 1SJ3P 1RCXB 3K5OA 3FBBA 1PC4A 3OFEA 5JXSA 2BE2B 5E5NA 4BDPA 2QTWA 4DUTA 1IXKA 4MKAA 1RWPB 4K50A 3M2VB 5ETSA 2KYXA 4DS4A 1N32J 3KTQA 2B4VA 1WG5A 3DDIA 1GTEA 3B8HA 4KGXB 2JVRA 2KTQA 1SIZA 1TP7A 3VF0B 1KDNA 1DFDA 2RDDA 2GQQA 1KP6A 4TU7A 1HQUA 4F7VA 4FN5A 2RDJA 2Y1RI 2M7SA 3E51A 2F4FA 2Y9HA 4YY3F 4J9UE 3G6ES 2AHOB 3D6FB 2XBPA 5LSOA 3SQGA 2E5JA 4ECXA 2U1AA 2AEMA 1X5SA 1NKBA 7FD1A 4UUXA 4UZBA 3QATA 3FQKA 4NCGA 4KE5A 3T19A 1IR2A 4AXJA 3RAMA 4NLUA 3RUBL 5KFMA 4FF4A 2X3DA 5IQQA 3QGIA 1X9MA 1HBUB 3NGUA 1M5VC 4AT1B 2H5JB 4ELTA 5SZTA 1SKRA 2LQJA 1GMUA 3M05A 4XPEA 1HHSA 3N6LA 1NJWA 3DM2B 3A1YG 1Q1KA 3HF5A 5D3GA 3VVUA 4C0BA 2FGOA 4DL6A 1R27B 2HIYA 3GV5B 3KUHA 4OX9F 2MKCA 2YBVA 1YZ7A 3H90A 1UW9A 2MMYA 4CZCA 3KG4A 3IR6B 2V9KA 1TK5A 4GMKA 1KQSR 4A8YA 5IV4A 4ZVGA 2GAGC 3KG1A 2KG0A 3OXFA 3PYEA 2JH3A 3DLKA 4OHXA 2N7CA 2LLZA 3I96A 5HP1A 1ZM3A 1WG1A 3OL6A 1UJ6A 2F9JA 2YQ1A 1AZSB 2ROGA 3FRZA 1H6KX 3HX9A 1RA7A 2XSJB 2AGPA 2VKRA 4JI2J 3T3FA 3D3BJ 1BWVA 1UA1A 3HK2A 2EBEA 1RTIB 3BSNA 4NZ6A 4O3NA 5E3AA 5JJBA 2DGUA 1D8YA 1UVJA 4EMDA 2BX6A 2U2FA 1Y3JA 4QOTA 5CCMA 4JI5J 4NLOA 1OYEA 4JV0A 3UVJB 4N8OA 3KHGA 2AX0A 1SV5A 4LBHA 4M1KA 4CWBA 1NU4A 1S72S 1T9WA 3BDPA 4WKRA 4ED3A 2HFNA 2N82B 3CVKA 4M5GA 1Q5VA 2HNZA 1BC6A 1EB0A 2ZOMA 4LQ9A 4DR4F 3V4MA 5K9FA 2OAUA 3K8WA 2G13A 1HNXJ 4XAKA 1S6QA 3CC4S 2ROPA 4DCPB 5H9FK 2RMLA 4GO5X 2VQEF 2MZ1A 1TR0A 5T7LB 3QJPA 3BQ1A 5LJ5Y 4X84A 1VC6A 1IWGA 4N7TA 2JDJA 2R3VA 3TAMA 2UVVA 3VAFA 3V2UC 1RHMB 4ZS6A 3JTPA 2DR5A 3SV3A 3QAEA 3LW5C 2E7WA 2R7VA 1WC6A 4ZPWR 3M6VA 2GW8A 4O3RA 4O44B 4TY8B 4C4WA 2L3MA 2BW7A 3GIKA 3IWNC 4JB8B 1XNQF 1YJUA 2FY8A 2WHOA 4QR2A 3KUEA 1FVSA 4Z7CA 4EWTA 2JC0A 3DRPB 2W8KA 2QL5B 4P73A 2VQFF 2P9CA 4DFPA 3JAMU 2K1RA 3BKUA 1X7VA 3TO8A 2X3GA 4UOFA 3HSDA 4I67A 3I5CA 2AYGA 2LQ5A 2AYMA 4USVA 4MKVA 4HEA9 2W2OP 1I94J 4C6AA 2C2KB 2WBMA 1LEOA 3FDSA 3DOLA 3LPYA 2FHOB 2CRLA 2HBRB 2MLZA 2EC0A 3IBCB 3HP6A 2XS7A 3PVXA 4Y2MA 2BJEA 1ZTTA 5KT6A 1HR0F 3PFOA 4DV4J 3K5NA 2EVZA 4F02A 1X60A 1GX5A 2C2ZB 4USWA 1HR0J 2X51A 4LJMA 3G82B 3FMBA 4QWBA 2Y1JA 1EX8A 4HACA 1VBZA 3AXKA 2AYEA 4DPWA 2OD6A 2BM1A 3HHLC 1WTFA 5HLFB 5D77A 4KKOA 3VV2B 3UWTA 1LFPA 3KK2B 2RQ4A 1RKIA 3R6LB 2D74B 3M8PB 4G6VB 1IKVB 2FLOA 5ETTA 2QA1A 4JYAF 2JEIA 1KLMA 2WVEA 1CBKA 1RISA 2WRMA 3ITHB 3M9NB 3UCGA 1UA0A 1VRQC 3DI6A 3EPGA 4PQUB 5KFQA 4JP8A 1V3RA 3IC1A 1P8GA 1HW9A 5J1EA 3HHLD 3PEHA 1C1BB 4RU9A 5HJYA 3MEGB 2KJWA 3DMJA 4CTAA 4EZ6A 1LKZA 1VK8A 4NE9C 4J9KA 1F6TA 2V2ZA 2JZ5A 1CSJA 3RBXA 3HHEA 3IGNA 2GJIA 3EWGA 2M88A 1U1OA 3FCWA 4KGKA 2J7KA 4DPXA 1RT1A 4OI1A 1U1NA 1S6OA 1U0HA 2LDYA 1CJVA 2LXFA 2AJ0A 1R43A 2YPZA 4F3OA 2WBRA 5DETA 4FZVA 4DSIA 2NPIA 3UCUP 2DNHA 3UFCX 5KFSA 3HPOA 3GR1A 1DTQB 4I7FB 2CQPA 3BPSP 3S1TA 1S1TA 2IMWP 1U1KA 1MWQA 2HG4A 3Q83A 1NJIT 2AYBA 4CLSA 2L08A 3LF0A 5C24B 2HBYB 1WSRA 3MMAA 2DBBA 4ES3A 2KT2A 4FF3A 4OLOA 5HMYA 1YITS 3PW2A 2ZH4A 3ZZZA 2VB6A 3LGNA 1P6TA 3MR6A 2XO7A 2UXDF 1N33F 4LF4J 2Q79A 3IS9A 4KB7A 5J1PA 3DRRB 2NSCA 3IBFB 3PW7A 1CULB 2JVOA 1Y9OA 2LU1A 4OYPA 1U0SA 2F40A 2FHMA 2BACA 4YDDB 3SFGA 3TOQA 2QA4S 1N6QB 4DOZA 4C8NA 2GVDB 3TVKA 4WE1A 2PFDA 1YRXA 1FT8A 8AT1B 2DISA 4WP8A 2OIHA 3UR3C 1IKXB 5F8NA 3QWUA 4KBIA 5KOXA 3OJSA 4C8OA 1TKZB 2N7YA 3HFKA 2D3OR 3U02A 2NYIA 3T5LA 1S10A 1IM4A 1DAXA 5ITHA 1PJ7A 4RPFA 3D1HA 2HFZA 2OGUA 2BMBA 1QD1A 5F8LA 1FWLA 3BKTA 4JV1A 2M0GB 1G4CA 2CWKA 1WG4A 2HFUA 5H9FJ 1FEEA 4DR3J 1F2GA 3W2VB 5GAHU 3Q89A 4HH1A 3D68A 1S49A 3RW6A 4NLVA 4PWDA 2R7QA 2DH9A 5KAKA 2CIMA 4ID8A 5CHCB 4OV6A 2LFVA 3OTOF 1HHQA 2IDLA 3M32B 1RBOB 1J5EJ 3L09A 2AJ1A 1IKWA 3JB9k 1REVB 1LXJA 2FPHX 3AJ1A 4NLPA 1YJNS 4AL5A 2JJ4D 3BV8A 1VQLS 4NCBA 1FRJA 2XMJA 2VG6A 5KFDA 5L9XA 1U45A 3LWLA 2MSSA 1TQLA 2M52A 5HANA 3V6KA 1VQ5S 3R5BA 1KSPA 1S1VB 2FZKB 3CMAS 3M30B 4OV1A 4MKBA 2YNHB 5HSPA 2BR0A 5EWFA 2D1CA 3W64A 1CPZA 4X4TA 3H5XA 4G1PA 1ZAXA 2EPIA 4F04B 1HARA 3DLHA 2FLLA 2A1BA 1HNZJ 4DV1J 1BE4A 4ID5B 3W8GA 1UP1A 2DRDA 4RBTA 4DCOB 2W1BA 2OHDA 3HT0A 1YBTA 5K8OA 2B6AB 4RU2A 1X5PA 3OL7A 4WWSA 3OFFA 1HPZA 3DGPA 3OL9A 1B4SA 2ZKUA 1SC1B 7FDRA 3MD1A 3LAMA 3O8WA 3KFWX 3PM9A 4DDFA 1V9OA 5GMDA 4K0KF 4U95A 2DRBA 4B08A 1VC0A 2XLIA 5B0AA 1UWBB 4J9NA 3AY0A 4EU0A 2G0CA 1T3NA 2F65A 4FVCA 1EKSA 1T03B 3M8SA 3T1YF 3TJ8A 1FD8A 5DDOC 1HQEB 3TP2A 4DXLA 4DV3J 3ET6A 2YXLA 1YTYA 3MUMP 4DV2J 3HI9A 4LR9A 3GIIA 1HA1A 1FNMA 3JSBA 1QAXA 4ZVFA 1S79A 1TELA 4UQTA 4A8OA 4L74A 1VI7A 4PYAA 3BGOP 3KUGA 4X4PA 4B9NA 3LP1A 1RT7B 4W92B 2P5VA 3P4UB 1V5VA 2KRBA 5HQ8A 2DNMA 3JYTB 2IYIA 3FBCA 4O44A 4PXCA 2LQ9A 4OJGA 3D66A 2R2TA 3FUYA 4GKKF 4FDFA 3G9CA 3ZXWA 2UUBF 5KFAA 3OVAA 1BGXT 2E66A 4WP3A 4X62F 3GIRA 1OYDA 1HL6A 2BJ7A 3BGRB 1CQNA 4FNHA 2CNOB 4C48A 1WSVA 4ZMMA 2AV5A 3FCHA 3U1MA 3GIJA 1N56A 3P6YC 3I6PA 1N0UA 2B4PA 1R6YA 4B17A 4LR7A 2YWKA 5ETOA 3UD4P 3JSMB 3NG8A 2V2VA 5ETRA 4K4WA 3Q24A 2HZCA 2B8PA 4LT6A 5I3QA 3HJFA 3MM5B 5ADZA 4YEAA 3A3PB 4O4RA 2HMIB 3QT8A 3MM6B 1U09A 1UL3A 3TQEA 2W9AA 3V5RA 5DG8A 2HVDA 5G0RB 2DHSA 4ZCLA 1WORA 4YP3A 2JRSA 2EWHA 4V1Ak 1FK9B 1VR6A 2E29A 1KQGB 2Z58B 3QO9B 4C3MA 4I56A 2P8IA 1QAJA 1SIWB 3C16B 3MHYA 4K2JA 2XY5A 1R8CA 1ZM4A 3OV7A 3EVWA 4K4ZA 3B54A 1S9GB 5I4MA 5GAEI 3MEEA 3AHPA 2Q6BA 2D3ZA 1U2CA 4FKYA 1EQ0A 4LF8J 4LF9J 2KO1A 2XY6A 4CLZA 1ZPWX 3EZ5A 2XZDB 2BE7D 3AXMA 5HVFA 2HIQA 4DV6F 4ANEA 3LALA 3QLHB 3A12A 2PGCA 1RHUB 2R8GA 4X4QA 4H54A 4ZHRB 3KJVB 4DQRA 3TA1A 3V6HA 3KLEB 1RWKB 1MMDA 4JI6J 4YHHF 2CG4A 1YJWS 1C1CB 3VZIA 4DR5F 5ETQA 4ED4A 3AA9A 4NCAA 2OEJA 2GA7A 2BBEA 1JLBB 1R0BG 3RRHA 5A2QU 2VJUA 2F8HA 1RWOB 3ZNJ1 1BQMA 2K06A 1Y5LB 2XEXA 4WZQA 3QZ8A 1F9EB 1CJTA 1RTDB 5EGYA 1YJ7A 4OI0A 2DK2A 1O8BA 2VG5A 2HNYA 1RT2B 4DR7F 3T6BA 4I7FA 3V81B 3ZTOA 1ZZNA 4UOHA 2HHTA 3VAHA 2PMWA 2RT3A 3W3SA 1Q53A 2LQBA 5IC6B 3K5MA 3HD2A 4QR1A 3CO9A 2AJQA 3HVRA 2V8GA 1PBUA 4MIBA 4UTGA 3GTYX 5BYRA 1NO8A 4FYXB 2CQ0A 2ERRA 1PJ5A 1VQ7S 2V8HA 2FZGB 1VRUB 1T11A 3OUYA 1RE1B 4RW7A 1CULA 3K7RA 2C1EB 1T8EA 1MNEA 4YB5A 5LJ3Y 2J5AA 2DHXA 5LMUF 2CQIA 2D7SA 2IM0A 1PILA 2WW4A 1L3VA 1FKOB 4ECSA 2CZ4A 3GV8B 4FKXA 4Q5VA 4ATNA 5IT4A 1S1WB 5E3RA 4L72B 3FGVA 1B7FA 5L9NA 1V5IB 2Z57B 3LANA 5A0YA 2W4PA 4ZLNA 1F2HA 5IZHA 3OR1B 1KR4A 2MZRA 1NSPA 2H5IB 3P5BP 1BUXA 1RHKB 1CC7A 1R0AA 1U7LA 3WIUA 4IR1A 4F50A 4U8YA 1RCOB 2HFOA 4AQYJ 1Y11A 5HMWA 1RBAA 1UTAA 1N8RT 3GLJA 3D28A 4KO0B 3J81U 1V6HA 4DLEA 4WIIA 4KPCA 4IG0A 2D41A 2FJDB 4PG4A 4MTPA 2C2MB 2OPSA 2MHNA 3MGJA 4WBFA 4DV0J 1TK8A 3J81Y 5MLCV 3GFXA 2ATLA 2Y8WA 2CZVC 2RSQA 5KG6A 2UXCJ 4RW6A 5AJ3J 2VU5A 5C25A 4L73A 2UUWA 2F3JA 2RD5C 2CPYA 4I2QA 2MY7A 5DZ6A 1WOSA 4OZLA 4C8KA 1GXLA 3PDNA 5F0UA 2W2QP 4O3SA 2ZZMA 4OYOA 2EC2A 3VGTA 2DB1A 5AXNA 3RB6A 4OZ5A 3TZYA 5KFNA 2I6WA 4WP9A 3KLHB 2Z2MA 4KHPF 1GEHA 2YPYA 1MU2A 2XMAA 2HW3A 1O6XA 4MH8A 5A8WB 2ZVIA 4KFBB 1Q8LA 5KG7A 4C97A 3V4IB 4HHHA 5L39A 2CJAA 4J91A 2FJEB 1WKKA 3D5MA 4QWAA 1LW0B 1NXIA 1JX4A 3F73A 3ILIA 4DV7J 3G6YA 4IRKA 3O2IA 3R7SB 1S59A 4USMA 1RKJA 5B0GA 1W7WA 3AOAA 4EI2A 5F9LA 4MK7A 2Z30B 1NK9A 3PX6A 1Z2LA 2EKYA 3ZTPA 4V19X 1RT6B 2KHDA 5J2PB 3AJ2A 3QGHA 2HBZB 1BHNA 2FJBB 1RTJB 4H4OA 4LREA 1RHQB 2BA9A 2KT5A 1RHRB 1UJ4A 2BANA 4B9UA 1FDAA 4LQ3A 1FO1A 3P3DA 3D0IE 4B3TF 3MCOA 1RB0A 1YX2A 1X4HA 3HMJG 4NL5A 1NHKL 1W2IA 1VGYA 2RIJA 4DZDA 2VZ9A 3DGVA 4OYZA 4LUBA 2K8GA 4NRTA 2H65B 5KG3A 3X1LB 1U2FA 3MAAB 4YQWA 3PTWA 4B9LA 2EK6A 4C3LA 4RW4B 2R8HA 3KLVA 4IH7A 2O66A 4C8MA 2R7OA 3KDOA 1U25A 1U2RA 4DUYJ 1WDTA 2YNFA 4Y2AA 4ZP9A 1HWIA 3JSMA 5K8NA 2ZWOA 3OHAA 1EHWA 2CNLB 2MJUA 1Q8KA 1TUVA 3TX0A 1W26A 1M1HA 5D0GA 2KFNA 2FD2A 5IV3A 4RW8B 2MKHA 1VQ4S 4CO2A 1XNRF 4DR6F 5G0RA 2V4RA 1EETA 2UXBF 3JTOA 4UY85 3QIPB 2O5DA 4PXDA 3CDAA 1RU2A 4ZVTB 1M1GA 4ZJOA 3CNQP 4ZJQA 1S6PB 4P72A 2F8MA 5GVQA 3SSRA 3MMBB 3L4BC 3K0JA 1Q81T 2AQ4A 4DR2F 4LSLA 4EBDA 3G86A 3R7NB 4DI6A 1WOOA 2QV6A 4D3GA 1RABB 1X0PA 4UT4A 1JK9B 4CO4A 4MMOA 2EFGA 3M2UB 1E6YA 3MR7A 3MM9B 3GCXP 5D15A 2ZVSA 4MFBA 3KNAA 1A6LA 4I2PB 3A8IA 3CD0A 1HNIA 2OPPA 3JS9A 2G1DA 4X4VA 4PAAA 2DCLA 1VQ6S 5H1SV 1SJ4P 3C6UB 1KKHA 3KLEA 2KRRA 2Z8QA 5D4OA 2KDOA 3K17A 2BJ3A 2DHGA 3HFZB 2RQCA 3DNCA 1FJGF 4LFCF 3GILA 2PMZD 2QMWA 1NB2A 2MKJA 1IKYA 2MQLA 2VDHA 2B56A 3GFYA 1QE1B 3A8EA 1M5KC 2NR0A 2B43A 3QJLA 2NPFA 3M2RA 1VOMA 4DSFA 4BLGA 2HVEA 2KT3A 2IA6A 1TFWA 3F41A 2UU9F 4WU3A 1JLGB 4ICLB 3MR3A 1H72C 4Y65A 1RTDA 4JV5J 1HNWF 1J5OB 2YNIA 3ILLA 3CJKA 3MMJA 5A8KB 4A8WA 1TKTA 1VISA 4ED0A 4B3RF 3CDEA 4ZOSA 2WOMA 3EZUA 2EFNA 1B0PA 1Y7PA 1CEZA 1DBDA 2DXFA 3D6HB 2H4WB 2RS2A 3MCSA 1DTTB 3R9LA 2DNPA 4OYIA 1FKAF 4KPYA 4DV5F 1QUPA 2MPUA 3AFGA 3PR5B 3CCQS 5CXTA 1X5TA 2BABA 3MPUB 1HKAA 1NBEB 3PR4A 1S0OA 2EFPA 4P2XA 1C0UB 1CS4B 3IR7B 1GXTA 1T9XA 3IRWP 5B0DA 2IAJA 1H3DA 4NLXA 1YBUA 3ULHA 5ETPA 4HH0A 4LF7F 2NUUG 3MM8B 3GSDA 4B9TA 2IM1A 4FPIA 2Z0GA 2ZUGA 4DF4A 2H54B 1OO0B 3RU0A 3CJ4A 3PY8A 3H4DA 2HZAA 2A18A 2DNGA 2CYYA 3I0RB 2G9OA 4NLQA 1S1XA 2VOOA 3MD3A 4CO5A 1LWEB 1U02A 3MUVP 5KT3A 4L6V3 2VG7B 2ALZA 4I6YA 4QYZJ 3BS9A 4B3MF 1UFWA 1HHTP 2QN6B 3HZGA 4J9LA 3GE9A 5I3UB 1NPRA 3C66A 3FK4A 2DD8S 4M5HA 3G8TA 5KT7A 4FXVA 1SUQA 2UVUA 5A6PA 1WNEA 2E9ZA 3LH2S 4M5IA 5IQ6A 5CA5A 2I5JB 4TU8A 2B51A 2I38A 4WFZA 5L8RC 1QDUB 3QRPA 4DQQA 3RAXA 1VBKA 3LOUA 3LP2B 2BJ9A 1FRMA 4NI2B 3TR5A 3FC9A 1NUEA 2HHWA 1E6VA 1APSA 2NCKL 2WB4A 3NS5A 1ZA2B 2ASJA 5ETLA 1FD2A 3A3NB 2AEJA 1B64A 2YH0A 3LPEA 3THTA 4AFFA 2CDRB 3C8YA 2O3DA 5F41A 5FDLA 3FNNA 2JC1A 3CC7S 3DLGA 2LP4A 1HBNB 1VRTB 3QWPA 2R7TA 2ZKTA 5DQGA 1XMOF 1S9EA 3E01B 5A8WA 2V94A 6AT1B 3UNYA 2R8KA 4IOBA 3W5YA 5D0EA 3SDEA 4ZK7M 1FFWB 1I51B 1RYSA 2XYGB 4RNOA 3U27A 3CWJA 5KG0A 4HTIA 2VASA 2VODA 3BO4A 1N5QA 4DG1A 5EX0A 2F63A 2WVDA 2EG1A 2OPQA 3NXZA 2XI3A 3RB0A 2OH2A 2UUAJ 4YR3A 1HWUA 3ENWA 4OFZA 3PJ9A 1N54B 1Y5IB 4PPDA 4RJVA 5F8HA 1DLOA 3MXHP 3D9BA 3RJMB 1ZZFA 1NJZA 3E3XA 3RYLA 1G6BA 1IBLJ 3T1HF 2DO4A 4FS1A 3VGUA 1N34J 1N5YA 4PCQA 1ACMB 3BR8A 4NXMJ 1YVFA 2FHJD 1Y4ZB 3S6EA 3BN4A 2F4VJ 3NCQA 1JLCA 4NEZA 2SXLA 3MDFA 3QFWA 1FJEB 3S8SA 3AOCA 3NCPA 1YIJS 2PN6A 2HHVA 1OS5A 2NXJA 2QJ3A 1B99A 1HQUB 1RWXB 2M4MA 2RHQB 3DRYA 2VUGA 5M2UA 3IMQJ 3GFHA 2DGSA 1WHYA 2IBOA 1GMWD 2IRYA 2K7KA 2DNQA 2DIVA 1CJUB 3PYFA 3DRSA 3G6VA 4CT8A 3SQGB 1SI9A 4C2MA 3JTNA 2V0NA 4CLPA 3CCVS 1VQKS 1FCAA 2E7XA 2EW9A 1LK7A 4K2XA 1N36J 2ZH8A 4NCGB 3K89A 2X7IA 2GGPA 1X9SA 4RNMA 2KJVA 2YH1A 1YJTA 4I68A 1LV5A 1R8BA 1WC3A 5B7WA 3T5KA 5D0RA 1FWPA 2FVCA 2LKZA 3BYPA 3IA0A 2VBYA 3W66A 4FF1A 1SCJB 5IWAJ 4A4JA 1NK4A 2E5IA 4JI8F 5D3GB 5L1KA 4X64F 4HLBA 1AXQA 2J7UA 3LTOA 4JI8J 2FVPA 4WTYA 2XULA 3QIPA 2DR8A 2X1FA 4J9PA 2YKNA 3HHDA 4LFBJ 2WSFC 2WZ1A 2UUTA 2CJBA 3VQTA 1OPIA 4YB1P 2R2RA 3X3UA 4YMEA 1N5VA 3NGTA 4DSEA 1XJWB 3MFHA 5L1LA 1ZTWA 3DU5A 3SFUA 4G1QA 3SQOP 2HPUA 2B4OA 3WBZA 3AD7C 1FFGB 4Y2IA 2HFSA 2MKKA 1GX6A 2XI2A 5HP1B 3SCKE 4CLUA 2M9KA 4X66J 5KFHA 1D09B 3DU6A 4GKJJ 1ZM9A 5T14A 1Q16B 1S99A 4ILLA 3QNWB 2ILZA 2MYFA 1U26A 4WFYA 3NGKA 3ETOA 4Y00A 2EBGA 4JI1F 3MPWA 1XR5A 4AL7A 4JI7F 2XCPA 4IO1A 1HBMA 3OVSA 3A13A 3CCUS 3PO5A 2D69A 1JXEA 2UV8G 1GT8A 1C4AA 1JLQA 2GAHC 2AX1A 1MG7A 3CDUA 1IWAA 4CNYA 2H9ZA 4QIEA 5CYMA 3KK1A 1SV5B 2EXUA 4FYYB 5HAOA 1U49A 2BQUA 4CO3A 4H4MA 5H9EK 5A76A 3NBPA 3W1YC 5A6WA 2IJRA 3OT9A 5DGBA 2HNZB 4M94A 1S9FA 4FYDA 5CYQB 2CPIA 2HHHJ 4EO8A 1GK8A 5GADU 3VAGA 2RNEA 1RK8A 1S6QB 5DLFA 2L9DA 2IJFA 2C3UA 1B3TA 3TWZA 3GV7B 2MZJA 1ZYQA 2J9EA 2CPXA 4CLYA 5KFKA 3UDCA 2EI5A 2RB7A 3NWRA 1OPZA 4NZ0A 4N5SA 1N52B 5K14A 4CLWA 1TFYA 2FC9A 2O01C 4JI3J 3TAMB 2CNKB 2IM3A 3SYZA 4J7CA 3UDLA 2FYXA 4A8FA 2DCUB 8ATCB 1HWLA 1ULRA 4PWWA 1Q82T 3EE3A 4R0JA 4MKYA 2NZCA 4DSJA 2HVZA 2HHXA 2X1BA 4A8XA 1P1TA 3OTBA 3ILJA 1C0UA 2YX1A 3AQPA 4ZKAA 1J2VA 1RLDA 5BJRA 4RW9A 3R7BB 2C28A 3CCZA 1IM6A 2V6AA 1FRLA 5L38A 1SC6A 4URSA 3LP0A 3C14A 1MWYA 1H7XA 2EEYA 3KLGA 2GC8A 4DR1J 2EFQA 3H59A 1RADB 3ENQA 4ZVSB 3CJ5A 5THWA 1T94A 3M6WA 2K1RB 1XQIA 2YWGA 1JXLA 3JXOA 4F2SA 3W9HA 1HD1A 1RHJB 2HWTA 2W25A 2R7RA 2E5LJ 1RWMB 4CLKA 2C3YA 2ZHOA 2CFXA 3FZBA 1FWKA 1OQ6A 5DZ7A 4DX7A 1KVIA 4CM2A 2WONA 3K57A 4DF8A 2HZVA 3NOGA 4J5OA 5CH7B 3QQCD 1C2PA 3M9OB 3MEDA 1ZPVA 4OX7A 1XR6A 1YG0A 3DOLB 4BBYA 3UN5A 1N5SA 3WDOA 3M8QB 2ZH2A 1YGYA 2MSTA 3D0HE 1D1UA 5CYJA 4JUZA 1OY9A 3GYXB 4ZITA 4B3OA 5KFIA 3U1LA 4DFJA 1NDKA 2OEMA 1TL5A 1BMQB 1S12A 4HACB 4Y0FA 2G0JA 2V4JA 3HVAA 4F8RA 4KKOB 4F0MA 3EGZA 1YZ6A 3DYAA 4ZP6A 3Q8PB 1X4GA 3QAUA 1KLMB 3P5TL 2ZH5A 3DI6B 2DH7A 2VFUA 3LP2A 3MURP 3KJQB 4KH1B 2MQOA 3U7JA 4JI4J 2HQDA 3H5SA 3HHKA 1SVDA 3ZZRA 5IT9U 3DMJB 4UQGA 4CTAB 3CMES 1WUUA 2CVIA 4ED6A 5HROA 4TY9A 4RL1A 4OHYA 4DBQA 4OZ1A 1F1BB 1JLEA 1FFSB 3CSKA 1RT1B 2HNDA 3BSCA 3HVTA 4ECVA 1VDHA 1T02A 1U0HB 2J8AA 2IRUA 3W9JA 3SSSA 4TQSA 2ZDOA 2QE5A 3OHBA 1CJVB 2ZJPQ 1RTHA 5F8GA 5T41A 3QGGA 4I4BA 2HAFA 1HIYA 5AXMA 1VLYA 4N76A 1F9HA 2DNRA 2QLBB 3BF4A 5DJBA 1JB0C 4IH5A 2B5JA 1UFLA 5LXYA 1S1TB 1OMSA 4RX6A 4IOAQ 3LGHA 1SH0A 1KONA 3DOMA 2Y0BB 4LBIA 2NS1B 3MMAB 2IA0A 1NDCA 2C2OB 4DN0A 1L3KA 4DWIA 2ZBIA 4IRDA 1S48A 2DT9A 2F1FA 4G3IA 3HLUA 5SUHA 2DHHA 1XN9A 2GJFA 1L5UA 4WK1A 2YKAA 4DUZF 3PW0A 2WSCC 3W60A 1K1SA 1NH7A 1FHTA 2ZH7A 3IS9B 2LXIA 2VPXB 1X4AA 1VQ8S 4DQIA 4U7CA 3P96A 4CDIA 1TV6A 1CJKA 5C7PA 4LSNA 3LQVA 3PW5A 1NHVA 3FKBA 4QR0A 2KB2A 2OFGX 1BY9A 3U1NA 4BHQA 1IR1A 4QBUA 5HVHA 2V34A 2A10A 4O4GA 3NS7B 1R89A 4MK8A 2K3IA 2QG9B 3I0SA 1KHWA 4GC7A 1FX2A 1BQNA 4WE1B 1KOOA 4LMZA 1C4CA 1AFIA 1WD6A 2WSEC 2K2PA 2E5GA 1CJUA 2HBQB 2EG2A 4YY3J 3PW4A 2XHWA 4RNNA 4LR8A 3QZ7A 2HGLA 5H9EJ 2HQFA 3H2VE 1HD0A 3TNVA 2OEKA 1URNA 1VYAA 4J9VA 4OYWA 2OPRB 3N9UC 2HSEB 4K4YA 2B7CB 3DCAA 5C2GA 1SQGA 3ZC4A 3NMAA 4PEOA 4ECRA 1OSCA 3KLFA 2YQ0A 3MEKA 2ZZNA 3WHIA 3IWXA 4PWDB 1X31C 1K8AT 1SH2A 2Y1IA 4NLTA 5KFPA 3HT3A 1T9UA 4ECZA 1DY3A 3DHXA 3GJQB 3W2WA 1UVKA 3FZ2A 3UO0A 1IKWB 2P6TA 1WC1A 4EFAC 2HLUA 1TL1A 2JNJA 2LA4A 4FP9A 3RR7A 4LRCA 3IFEA 1JJCB 3W8PA 4OX9J 2BDPA 2VG6B 2JSXA 1L3TA 1MMLA 3UE2A 2HS4A 5FJ4A 2ZD1A 1DQ8A 3LWMA 5E41A 4U7UK 4CIOA 1UKUA 2GX8A 2FTRA 2CQ2A 2Q3PA 1M5PC 2YNGA 1WF1A 3GONA 5AXLA 4ZIVA 3TZXA 2XO6A 4DPYA 2MKSA 5DDPC 3TYTA 3IG1A 2XNRA 3W61A 1NKCA 1TAUA 1RAJA 3FBEA 4KV8A 2Y0SD 3TJ9A 4OZ3A 3J7ZT 1URRA 3EXYA 2CPEA 5B09A 3EX7B 5LMNF 2ZE2A 1NMEB 1H74A 3B4DA 3KYLA 2CG8A 3H5YA 1JIHA 1P9YA 2QA2A 1RP5A 3EJMA 4F25A 3CD7A 1IBKF 4QIWD 4MIAA 2JEJA 2KG1A 4NX9A 2J0QD 3CULA 1HPZB 3DGPB 4KY3A 2W4CA 3O44A 3L7UA 4R5PA 2V50A 2MZQA 2RUSA 1FKPA 2MGZA 2PEHA 4ANCA 5CYQA 3VWSA 1VCTA 2JX2A 3UDEA 1I3OB 2VDIA 3TZWA 3NGRA 4YOEA 4DR4J 3GU0A 2UVRA 4E0DA 2BVZA 1XMQF 4L3NA 2Q66A 3GZ7A 2KH9A 3ET6B 5DG7A 2VQEJ 3OTDA 1AFJA 2KFYA 5EWGA 1UVNA 1MSWD 4USTA 4TU9A 3LP1B 4UF4A 4ZCIA 4KTQA 4RUBA 4RUHA 2WVFA 1JNZB 3C6TA 5LSRA 3J81j 1GFWB 2R4FA 1UPPA 3W63A 4EEYA 1SQEA 4ZVOB 1JLFA 1UVMA 4WFAQ 4IFYA 1N4LA 3J7YU 5KFZA 2V2QA 4ZLPA 1ZETA 3DLLQ 2VOPA 2BJ8A 2YKPA 2VPZB 1XNQJ 3F44A 4PPZA 3PACA 3OL8A 3RRGA 2W2NP 2EFOA 2MZTA 2B9WA 4OZ2A 2RRNA 3NOCA 5KG1A 3ZZYA 1UETA 3PX0A 2ZWPA 2VQFJ 3WQPA 3CJQA 4Q0BA 3DLBA 2MLXA 4P7TA 2VPYB 3JAMY 2IVMA 3QYYA 5KFLA 2RS8A 1I1GA 5D4PA 4LF6F 1RACB 4ZA1A 4F4WA 1WEYA 4O0IA 4FVMA 2ZBRA 4TN2A 3M8QA 1SJRA 5A8RA 1U48A 4EZ9A 2RE1A 1W25A 3AAWB 3D6TB 5HBMA 2MHEA 1QVGR 2UUCF 2J9CA 2XQCA 4X65F 1FXDA 2Z4PA 3TEGA 2OO4A 3CMQA 2UUCJ 4AE5A 2W7PA 3KHRA 1RWVB 3Q23A 1RT5A 4HTJA 2H3EB 4LFAF 4P52A 3FEZA 3SV4A 3CCJS 3M1VA 4R0EA 3RTVA 5K8MA 3MCNA 2MTLA 3MEEB 3JQJA 2MQQA 2VA2A 2DO0A 5KT2A 2I9SA 4OQJA 1VQMS 4NA1A 4KC5A 4JYAJ 2I1RA 1KN6A 2ASYA 3ZTQA 2RKIB 5J2QA 4G65A 2Z2YB 4OJHA 3CJ8A 4DX6A 3VZHA 2MXYA 3K5PA 1X4DA 5D0HA 5FIIA 4ZP8A 2ZFHA 5CD4A 4F26A 5KFBA 5JMNA 3MM7A 2HAIA 4PG6A 2RHSB 3PJXA 5E3QA 2J6UA 4K4UA 2H48B 3BQ0A 1RWNB 1PBAA 4C11A 4NLWA 4ECYA 1A7GE 3O6QA 1PJ6A 2R8JA 4XPCA 1FERA 3D7SB 1DRZA 3G8SA 4I6AA 4OIXA 1KD1T 2DKOB 4NLGA 1BQMB 5E3CA 4ZCMA 2VC0A 3THVA 4QIGA 4Q2LA
chains in the Genus database with same CATH topology
4DZDA 4U7UD 5CD4A 5H9FK 2Y9HA 4QYZK 2Y8WA 5H9EK 3QRRA 1WJ9A 2Y8YA 3QRPA 3QRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZD A;  4U7U D;  5CD4 A;  5H9F K;  2Y9H A;  4QYZ K;  2Y8W A;  5H9E K;  3QRR A;  1WJ9 A;  2Y8Y A;  3QRP A;  3QRQ A; 
#chains in the Genus database with same CATH topology
 4ALZ A;  2OUG A;  3CCW A;  1CJT B;  1SC3 B;  5BR8 F;  3K59 A;  1XC9 A;  2BJD A;  1TKX A;  3BSA A;  1WI8 A;  2RQM A;  2VG5 B;  3V6D A;  4ZDN A;  2HNY B;  2R9L A;  5BR8 J;  4PXB A;  3MZI A;  4LVO P;  3ICL A;  1FTC A;  1VFJ A;  1LNQ A;  1XMB A;  2FY1 A;  3HD1 A;  1F5A A;  1SKW A;  1YRU A;  1EP4 A;  4Q8E A;  4ZPA A;  5DQH A;  5IFM A;  2DGQ A;  4M5K A;  2F5G A;  3PV8 A;  2IY5 B;  1P9Q C;  5EWE A;  4M8L A;  1QLN A;  2LEP A;  4L3K A;  3B6B A;  3OUY B;  4RW7 B;  3HZE A;  5FD1 A;  1GAO A;  2UXD J;  3TQ1 A;  1N33 J;  1VJQ A;  1BLU A;  2ZOG A;  5L46 A;  2LMI A;  2DXD A;  5GMK a;  1M90 T;  3CTR A;  2OLW A;  1JJ4 A;  2M8D B;  4MJK A;  5B08 A;  2FVQ A;  2HFV A;  2N3O A;  1VQN S;  1U1P A;  4KJI A;  2NXE A;  2N4C A;  3I31 A;  3L7O A;  3BRE A;  3P49 B;  3H7H B;  4GVB A;  2V69 A;  2IC3 A;  5A0Y B;  1TTH B;  1MW7 A;  3L9Z A;  2CJ9 A;  5ETM A;  4E2F B;  2F9D A;  4HR2 A;  2DVI A;  3EDR B;  4DQS A;  1UWA A;  1R0A B;  3SZ2 A;  1B0V A;  4HDG A;  1AW0 A;  2OPR A;  2BJ1 A;  3ZZ0 A;  5AXK A;  1NM2 A;  3QPI A;  2R7X A;  3Q8S B;  1X4E A;  1G1X A;  4EBC A;  4LRB A;  4ES2 A;  2VFR A;  3EMT A;  1RAI B;  4DL2 A;  3PRV A;  1VQ9 S;  4IG0 B;  2VH7 A;  2YX7 A;  4QIV A;  3PKM A;  2C3M A;  2MJN A;  3PYD A;  2FJW A;  3POT A;  3TVZ A;  2DIU A;  2OPS B;  3OLB A;  1RTZ A;  2ZOF A;  1B7Y B;  3OTO J;  4JOU A;  2VD3 A;  2CPF A;  4J9M A;  1S6U A;  3JQM A;  1JKH A;  1Q7Y T;  2BM0 A;  1VQY A;  4Y2K A;  4Q7A A;  4CO0 A;  4RW6 B;  2XSF A;  5C25 B;  4RNH A;  2GCF A;  3HHL A;  1HMV A;  2HLT A;  4I2Q B;  4OJ1 A;  4ZIW A;  4WKY A;  2ZJR Q;  3DOK A;  2QEX S;  2DPJ A;  2FVR A;  1NAQ A;  4QIF A;  5HI7 A;  2LXU A;  1KHV A;  2W7O A;  1U1R A;  3BGF A;  1O51 A;  4ED7 A;  3TRG A;  1D9F A;  3IWL A;  3HKW A;  3OSP A;  2BYC A;  5KFE A;  1JLA A;  4O3Q A;  4B9M A;  1Y0H A;  1MU2 B;  3KDN A;  1TL3 B;  1AA1 B;  2ZH9 A;  2HRY A;  3CPW R;  2O67 A;  3BH7 B;  3J80 U;  4CH7 A;  4I6W A;  2LEA A;  4PXE A;  3T1A A;  4NLR A;  5L1I A;  2X1A A;  4LF5 F;  3OFH A;  2ZNZ A;  3GYN A;  1TL7 A;  1FEH A;  4LF5 J;  3VR1 A;  1HBO A;  2MB0 B;  1WC5 A;  2GNK A;  4YB6 A;  4PR6 A;  3DDK A;  4I69 A;  4B9S A;  1G2E A;  3IGV A;  5IM0 A;  1KTV A;  3MFI A;  3SCI E;  2FJX A;  1U6F A;  5KG2 A;  1BQX A;  4K0K J;  3CE8 A;  2HGM A;  4KH0 B;  3KKF A;  2AP6 A;  4UW2 A;  4ECW A;  2MDA A;  3SXL A;  3T41 A;  2GML A;  4IFV A;  1WKJ A;  1RDR A;  3T1Y J;  4ELU A;  3C15 A;  2LQ8 A;  5KFF A;  3D67 A;  5AE3 A;  4A8Q A;  4QQB A;  3GJT B;  4NLY A;  4PYD A;  3ADA C;  4NPO A;  3E2E A;  4H4O B;  3DFE A;  4ILR A;  4KRW A;  5J2N A;  2E9R X;  2XGQ A;  2UP1 A;  2CJK A;  2GHP A;  1H38 A;  1YK9 A;  3VAI A;  2BAN B;  4PG8 A;  2VA3 A;  4IYQ A;  1Q4R A;  2DGV A;  2RH3 A;  2QA4 G;  2A2C A;  1IUJ A;  4DN9 A;  3PFE A;  3AB4 B;  4QJV A;  4IQM A;  4F0K A;  3DKD A;  4PG7 A;  4WPA A;  2LYV A;  4C3K A;  4OHV A;  2PI4 A;  4GKK J;  3P45 B;  4ZVR B;  2AF6 A;  4P2M A;  2DEI A;  2UUB J;  2JLF A;  5ETN A;  2QX0 A;  5KFX A;  3HM9 A;  2DNL A;  2B9E A;  4FXD A;  4OZJ A;  4FYW B;  4P6Q A;  1MN7 A;  4X62 J;  3B78 A;  1KFD A;  1RAG B;  4A48 A;  5LM7 E;  1F5B A;  4M5D A;  2YNF B;  3HSZ A;  4QPT A;  2J76 E;  5DQI A;  1AUD A;  1T3O A;  5C42 B;  1CVJ A;  1K47 A;  2I0X A;  2J8S A;  4ENO A;  5F3Z A;  3LO3 A;  1MRO A;  3DHW C;  4YN3 B;  1Y10 A;  1H98 A;  2FVS A;  3VHQ A;  1BD6 A;  2C2E A;  5DO2 A;  1EET B;  3KHH A;  1FE0 A;  1TUG B;  1GQE A;  4MIW A;  1ARO P;  2ASD A;  2ZEJ A;  1YHQ S;  4QWD A;  4ZLL A;  4CH0 S;  4URQ U;  3QJJ A;  3TI0 A;  5KTQ A;  1N32 F;  1GTH A;  2Y8Y A;  2CAJ A;  3T6J A;  1WOP A;  1FXR A;  4LSL B;  2CPH A;  3IRX A;  4Q8F A;  4FF2 A;  4QCL A;  5LSL A;  3Q22 A;  1FDD A;  2RKI A;  1E6Y B;  3QMQ A;  1C0T B;  4MFB B;  5D6G A;  2QO3 A;  1HNI B;  4DEZ A;  2OPP B;  2CQD A;  3PJW A;  2Z2L A;  3L95 X;  4DV6 J;  4NYP A;  3Q8U A;  4ITS A;  4URG A;  4N77 A;  4PUO A;  2RF2 A;  4YHH J;  2C2N A;  4ED2 A;  3GG0 A;  3K5L A;  1IKY B;  4DR5 J;  1HQ2 A;  3VAM A;  3EXC X;  1LOU A;  4JBC A;  4K4T A;  3M2R B;  2BRL A;  2B0G A;  3CCL S;  3PHT A;  3WX4 A;  5HQL A;  2M3D A;  2XTJ P;  3ZNU A;  3AJD A;  2YNI B;  1LWF A;  3CJK B;  4LIR A;  3FFI A;  1TKT B;  3H5U A;  2JEF A;  2YY3 A;  5A2Q Y;  4DPU A;  1SJ1 A;  2VFS A;  1BXN A;  4DR7 J;  2WOM B;  3OXL A;  2PT0 A;  1X4B A;  3A4T A;  4ZP7 A;  1WC4 A;  4G1I A;  1RT4 A;  3VTI A;  4TYB A;  4X4O A;  5JUM A;  2FDN A;  4RWX A;  1SL1 A;  1U4B A;  3H25 A;  2PDA A;  2DR7 A;  2DY1 A;  3PHE A;  4FBT A;  4WFB Q;  3JSR A;  4OYA A;  4ED1 A;  2A3J A;  4C9D A;  1SQF A;  4RBU A;  2KKH A;  3DLE A;  2YKO A;  2MQ8 A;  5KT4 A;  3IXQ A;  1OQ3 A;  2HWH A;  3IM9 A;  4YB7 A;  1KRP A;  1NZA A;  3BPD A;  4KR0 B;  3GIM A;  5M2R A;  3A8J A;  3RGI A;  2IAJ B;  1K9M T;  2Y1L B;  3R2D J;  3T9Z A;  2ADB A;  2CQ1 A;  1F3F A;  1NHU A;  3W5X A;  4BC7 A;  5LMU J;  1I6J A;  2LEB A;  4PRF A;  4WZM A;  3R5C A;  3N79 A;  2IFX A;  2GVZ B;  2W9B B;  3CD6 S;  4JI2 F;  2HS0 A;  1LWC A;  2CQC A;  5I42 A;  1ZAW A;  4Z2X A;  4TNO A;  3R5G A;  4RUA A;  2HHP A;  2Q1L A;  3H42 A;  4YR0 A;  4IUF A;  4CYU A;  3QID A;  3GB0 A;  3OR2 A;  2GHV C;  2XWX A;  3Q8Q B;  3R6G B;  2E1R A;  3DRX A;  4JI5 F;  2ACY A;  4C8L A;  2Q6C A;  2LCW A;  4CI0 B;  4DX8 H;  2KL8 A;  2HK3 A;  4WIQ A;  3H2U B;  1TZ0 A;  5JVH Q;  4A46 A;  1S1X B;  1IJF B;  1K44 A;  4RKU C;  3FCV A;  2CJQ A;  1OSD A;  4LF1 A;  1NK6 A;  5F3T A;  9RUB A;  1NEE A;  1PIE A;  2FJA B;  2BZ2 A;  1XTZ A;  3KMQ A;  2GZO A;  2VFV A;  5HK4 A;  1HNX F;  2H4Y B;  3W9I A;  3LUY A;  3N28 A;  2IVF B;  3FQL A;  2MEW A;  3AA8 A;  3AD9 C;  1FRI A;  4ZVP B;  3H2L A;  1SUQ B;  3MEC A;  1LW2 A;  2W9C A;  2MQN A;  1FDB A;  3NAI A;  2Y3Y A;  3CGI A;  1T05 B;  2GIR A;  1TL4 A;  1KFS A;  1KNZ A;  1VIO A;  2MLY A;  5RUB A;  1TMJ A;  4CM0 A;  1FNO A;  3L3C A;  2KZZ A;  4QW9 A;  4ED8 A;  2ROE A;  2L48 A;  4N47 A;  6FD1 A;  2AIR B;  3OTE A;  1E6V B;  1FRK A;  2VON A;  4A47 A;  1U6B A;  2JLG A;  3CJR A;  3GG1 A;  1KVK A;  2D3U A;  5FDL B;  3DLG B;  4F4Y A;  2FZC B;  1TL3 A;  1KVJ A;  1CLF A;  4KHP J;  2RDI A;  3NS6 A;  2APO A;  1S9E B;  5GAD I;  3Q8R B;  4WFN Q;  4WU2 A;  2YWW A;  3SDE B;  4USJ C;  3ILO A;  2V8V A;  5AT1 B;  1I94 F;  2JLE A;  5F0W A;  4DG1 B;  2FUG 9;  2OPQ B;  3Q8V A;  4RNF A;  2VIC A;  1N88 A;  4LIW A;  3R5A A;  3LA0 A;  1YDL A;  4YS2 A;  2BE9 B;  1VHI A;  2KM8 B;  2VKZ G;  4K59 A;  1WF2 A;  4UZC A;  3BM7 A;  5D78 A;  3N6N A;  3MMC A;  4U8V A;  1DLO B;  4ETX A;  1R8P A;  5GAG I;  4DV4 F;  1FA0 A;  3NNA A;  4BCA A;  1FX4 A;  3MOZ A;  2KVI A;  1N5Y B;  1QAI A;  1FDN A;  3IO1 A;  1FVQ A;  3CF5 Q;  1Q78 A;  4RR5 A;  5J2M A;  3PKY A;  3MR2 A;  1D0E A;  4F3Q A;  1JLC B;  2C2R A;  4M5N A;  4I64 A;  2V8D A;  1IQT A;  3M8Z A;  2CAD A;  1OIA A;  2RIL A;  4IG3 A;  1MMN A;  4B3T J;  3BSO A;  3NP5 A;  3BEG B;  4NWB A;  4EGL A;  1XEZ A;  2VL1 A;  1HNV A;  1ZOT A;  4Q44 A;  3HO1 A;  3AD8 C;  2HUR A;  4NOH A;  5KFV A;  3DRS B;  4DL3 A;  5M2P A;  4NMX A;  5JVG Q;  3KK3 A;  4FNI A;  1SJF A;  1P27 B;  3PRB A;  2PII A;  2NXC A;  2E1M C;  3GP9 A;  1WHW A;  2L41 A;  4J37 A;  1ZM2 A;  3P8B B;  2GGP B;  2UVW A;  5KG4 A;  1RXO B;  3PYG A;  1RAO A;  3BQ2 A;  2B9Y A;  4K4X A;  1X9W A;  2BW2 A;  2QRR A;  5C42 A;  1BWE A;  3K2Y A;  1NPK A;  1DZ5 A;  3EVO A;  2HWI A;  1SL2 A;  4CH1 A;  2B9X A;  5B0B A;  2YKM A;  1TVR A;  3KLI B;  2B7B B;  2ZC4 A;  2MQM A;  2KHC A;  1XNR J;  4DR6 J;  3GFZ A;  4RWW A;  2UXB J;  4N56 A;  2YKN B;  3PZP A;  4S0M A;  1D8Z A;  2P2C B;  5J1N A;  3VAK A;  1SPB P;  2BE2 A;  2OD4 A;  3D1Q A;  3JQK A;  3PNI A;  2FB0 A;  2M70 A;  4G1Q B;  3UNG C;  2AJF E;  2CJX B;  3MTJ A;  4OI2 A;  3M2V A;  4LF4 F;  4DL0 C;  2ZJQ Q;  4DR2 J;  2J6S A;  2CQH A;  4AYB D;  3FJ2 A;  1C0T A;  3R1H A;  4DMZ A;  4F4Z A;  2LVW A;  1DQA A;  1KS2 A;  1PCA A;  3BYR A;  2J0W A;  4O23 A;  1HBM B;  1JJ2 R;  5HQM A;  4X4S A;  2BV3 A;  5DM6 Q;  4KGV B;  3DXS X;  1Z2Z A;  1PAE X;  2E5H A;  2Z56 B;  1JLQ B;  1UJ5 A;  2HK2 A;  4CQ1 A;  4F36 A;  1S4E A;  3ELH A;  2C22 A;  2IHR 1;  2XG8 A;  5U47 A;  4OX6 A;  3GYG A;  2GFF A;  3C46 A;  2XWY A;  5CYM B;  1ZS6 A;  1VIX A;  3KK1 B;  2B4U A;  2CQ3 A;  5HO4 A;  2DGW A;  1FJG J;  4LFC J;  4H4M B;  2J6T A;  1HI0 P;  4DU8 A;  2AW0 A;  3NBP B;  4OL8 A;  3S7R A;  3G87 A;  2VBX A;  4DR3 F;  2UU9 J;  1SBR A;  3GCW P;  4QPX A;  4WCE Q;  1HNW J;  1AB8 A;  2RAQ A;  4MAK A;  3WZ0 A;  2CKW A;  2C2D A;  1HBU A;  4BWJ A;  1SKS A;  2KXF A;  2AEF A;  4UUW A;  4WJB A;  1HWK A;  4B3R J;  1Q8B A;  5K14 B;  1J5E F;  4FPR A;  3DM2 A;  1YI2 S;  5B0E A;  3MAQ A;  1D9D A;  3I9V 9;  2KYZ A;  3OFG A;  4TYA A;  3DLJ A;  3FVY A;  3RB3 A;  4C98 A;  1H7W A;  4DV5 J;  2MKY A;  4CCH A;  3EYZ A;  2CJY B;  4USI A;  2IJN A;  4X4U A;  1SJQ A;  4P7V A;  5C5J A;  3Q8Y A;  1U8S A;  1VBY A;  2WAQ D;  4RW9 B;  1R8A A;  2A0F B;  1FF2 A;  4AND A;  1XWL A;  3LP0 B;  2J9D E;  3C14 B;  2G4B A;  1RT3 B;  1AYE A;  2XY7 A;  1ITP A;  4MYT A;  4ZVE A;  3KLG B;  2R2S A;  4LF7 J;  1N48 A;  3SBM A;  1AZS A;  1K0T A;  3D6M B;  2GVZ A;  2W9B A;  2C42 A;  3MOJ B;  2AMC B;  1FTR A;  1YLX A;  4ZPT R;  2XSJ A;  1HNZ F;  3VAJ A;  4DV1 F;  1UEK A;  1UVI A;  2DNO A;  2DXE A;  4ZVU B;  1RTI A;  3BO2 A;  1Z1Z A;  1XR7 A;  4OI4 A;  2IVY A;  2WON B;  4J9Q A;  4EO6 A;  3BH6 B;  2CXE A;  1T9V A;  3MED B;  2JWN A;  3OW2 R;  2C3O A;  5KG5 A;  4ECQ A;  1NND A;  3UVJ A;  1RAH B;  3K8V A;  2NQP A;  2J0X A;  3A8K A;  4QWE A;  2IRX A;  3HFV A;  3RRK A;  4Z7Y A;  4C7Q A;  2VHG A;  4OX8 A;  4QU7 A;  2I2Y A;  1XK8 A;  2XS2 A;  2R7W A;  1RU1 A;  3FBF A;  2O1P A;  2QT7 A;  4B3O B;  4B3M J;  3OD2 A;  1WEL A;  1KC8 T;  1TAQ A;  1HI1 A;  3M6X A;  4ZLJ A;  1NRK A;  1XBW A;  2PMH A;  4HKQ A;  4ERD A;  2CQG A;  3UN3 A;  4DV3 F;  2G2O A;  3MR5 A;  2V4J B;  4KYZ A;  3OXG A;  1LWX A;  1RZM A;  5D4N A;  1KLN A;  2ZNY A;  4DV2 F;  1NB7 A;  5T7L A;  1Y00 A;  3JSY A;  4F4K A;  1JJH A;  1T05 A;  3DYA B;  1G7C B;  1VK3 A;  2GMJ A;  3UD3 P;  3OSN A;  3PCO B;  5AE1 A;  3WC0 A;  2EK1 A;  1EZZ B;  2XMV A;  4FS2 A;  1S0V A;  3Q2T C;  4J9O A;  3C3L A;  4QYR A;  3D54 A;  2GO8 A;  3CCM S;  4TY8 A;  2N4D A;  1SB6 A;  5KFG A;  2OP5 A;  5HRO B;  2EKN A;  3G71 S;  4ZPD A;  5L1J A;  3T5H A;  3L7P A;  2ZH1 A;  2DGT A;  5CCL A;  1HYS B;  2G1H A;  1S57 A;  1JLE B;  3GQC A;  2DNZ A;  1PAU B;  1S5Z A;  3D1O A;  3F0N A;  3BBB A;  3DRP A;  2HND B;  3HVT B;  4K5R A;  2MY8 A;  1JXV A;  2RQK A;  4N41 A;  1QUV A;  2HQ3 A;  3CXC R;  1H2V Z;  1RTH B;  1VBX A;  5BYS A;  5ETK A;  2XYH B;  1XMO J;  5EN1 A;  5DGA A;  2ADC A;  3TVY A;  4K5S A;  2C3P A;  2W7A A;  3R8Y A;  2BQR A;  2LDI A;  4AXI A;  1WEZ A;  1ZAV A;  4Y34 A;  1YJR A;  2B5J B;  1X4F A;  4GO7 X;  2QSW A;  1S1U B;  4U67 Q;  2L9N A;  4CT9 A;  3DOM B;  3I56 S;  3KHL A;  4DL4 A;  1PKU A;  1WTB A;  1NJX A;  4C8Y A;  2ATC B;  2DEJ A;  3NRB A;  3NWG A;  4H4K A;  4JI0 F;  2FLN A;  4J90 A;  3MF5 A;  4OYX A;  3PG9 A;  2D3O 1;  1VC5 A;  3EUN A;  4JI0 J;  2CZ9 A;  1RAE B;  2F7V A;  2AU0 A;  2W4D A;  3RBE A;  3GMG A;  3CED A;  5DLG A;  3G82 A;  3T1H J;  1YRT A;  4QWC A;  4XIU A;  4JV2 A;  4MK9 A;  3J7Y I;  5LOQ A;  5HLF A;  3M8W A;  4QW8 A;  1TV6 B;  1CJK B;  1UZD A;  4LSN B;  2XCA A;  1Y3K A;  3KK2 A;  2EFV A;  3M8P A;  1IKV A;  3EIC A;  4M5L A;  4LF8 F;  4LF9 F;  3M9M B;  4O4G B;  4LSZ B;  3ITH A;  3I0S B;  3SEO A;  4PQU A;  4DL5 A;  1BQN B;  2FGC A;  3BBF A;  3EPI A;  2BKO A;  2RRB A;  1NSK L;  3AH6 A;  1C1B A;  3D0G E;  1PYT A;  3MEG A;  3NGD A;  1OJ4 A;  4ZPV R;  1K0V A;  4LF2 A;  1F3V A;  2IYG A;  4MYU A;  2GHW A;  1RLC L;  1T95 A;  4JI6 F;  4F4X A;  1MN9 A;  1PG5 B;  3KOA A;  4K8R A;  3N4W A;  3O1L A;  4C0O C;  1Y5N B;  2BKP A;  1NKE A;  1P1L A;  3ETM A;  4PKD B;  3KXD A;  5EHH A;  1OY8 A;  1S77 D;  2AGQ A;  3CUN A;  1UEU A;  3PO4 A;  3Q2S C;  3HVW A;  1SXL A;  4X4R A;  3UQS A;  3KLF B;  2HS3 A;  4ED5 A;  4I0W A;  2JEG A;  2PFF B;  1NPP A;  2V67 A;  4DHV A;  3MCM A;  4KHM A;  2ZBC A;  3KLI A;  4CLF A;  5CAB A;  1DTQ A;  4NA3 A;  3W2W B;  2RUG A;  4X64 J;  1WWH A;  2J0S D;  1TL1 B;  2WK4 A;  2Z2Z A;  3I87 A;  2QC3 A;  4LVN P;  3HKZ D;  2RJZ A;  1PYO B;  4B9V A;  5C24 A;  3WC2 A;  4IDK B;  1QSS A;  2V63 A;  3OVB A;  2ZD1 B;  2KFZ A;  3DXB A;  1YWX A;  4DQP A;  4KQZ A;  4A8S A;  1TK0 A;  3FEY B;  2F8E X;  2YNG B;  2OML A;  2E1A A;  4USK A;  2DNK A;  4DSL A;  3DRR A;  3GR0 A;  3DC2 A;  3MUT P;  3CIM A;  2R2U A;  2XM3 A;  2XB2 D;  2ACM A;  1HI8 A;  1WAC A;  3IG1 B;  3HJV A;  4YR2 A;  4KV8 B;  1VLO A;  8RUC A;  1F60 B;  2HVH A;  3D4J A;  2ZE2 B;  3H40 A;  1N6Q A;  3M7V A;  5KOW A;  4JI1 J;  2GVD A;  4JI7 J;  4CP5 A;  2H1Y A;  1SKU B;  2D9O A;  5MAO A;  1IKX A;  1JQG A;  4DX5 A;  3BJY A;  2YWE A;  1TKZ A;  3RBZ A;  2KI2 A;  4HVZ A;  4U7U D;  1UCN A;  2XHC A;  2HQG A;  2OFH X;  2AKW B;  2GMH A;  4DU7 A;  1I5O B;  3O3L A;  3G2X A;  2RRA A;  4R5P B;  4AQY F;  2ZHB A;  1FKP B;  2MGZ B;  1UPM B;  3EGV A;  2FHK A;  3RG6 A;  4A8K A;  4OYB A;  3J7A N;  3QRQ A;  2DYA A;  2GJ2 A;  5CAA A;  3PEJ A;  1RWU A;  1RSC A;  3W2V A;  4B02 A;  2CWX A;  4O0N A;  2BQ3 A;  4XK8 C;  3OJU A;  2FHJ A;  3HSJ A;  4DV0 F;  1HLW A;  1PYS B;  3M8Y A;  5HAT A;  3M32 A;  1KEK A;  1X8D A;  2K3K A;  1REV A;  4BC9 A;  1TUW A;  2UXC F;  5AJ3 F;  2QLX A;  3CJS A;  1M5H A;  2DHA A;  3CO0 P;  3RBD A;  5GAG U;  1DJ0 A;  3OQ2 A;  3C6T B;  4WTO B;  2R7S A;  1YKW A;  3VGS A;  1WKL A;  1GMW A;  4R25 A;  3CCT A;  1YBA A;  3RW7 A;  2E44 A;  3ZO7 A;  2QFJ A;  1JLF B;  2KU7 A;  1S7H A;  4IFY B;  2DH8 A;  1S1V A;  2QIF A;  3US5 A;  2XS5 A;  4L75 A;  4P75 A;  1R31 A;  1NK7 A;  3M30 A;  3W65 A;  3ENA A;  1RT3 A;  2YNH A;  1B70 B;  1T7P A;  2FLP A;  2OSR A;  4ELV A;  3QT7 A;  5IT0 A;  4W98 A;  3N01 A;  2QL9 B;  2M2B A;  2IPO B;  1GNK A;  5IOL A;  4ZVH A;  1Q5Y A;  4Q0B B;  4XDC A;  2AT1 B;  3I5B A;  2PO4 A;  3VGV A;  4ID5 A;  2COL A;  1NDL A;  4KHR A;  3NNC A;  4F0H A;  2B6A A;  2J9D A;  4DFK A;  3TUP A;  2ALY B;  1NSA A;  5KFW A;  2CPZ A;  2CA9 A;  5A8R B;  4F2R A;  3TAQ A;  1RBL A;  3HCX A;  3AOB A;  5F9N A;  2KN4 A;  4DV7 F;  2BXJ A;  5K20 B;  3MTK A;  5HBM B;  2YQ3 A;  2DY9 A;  1UWB A;  2G0I A;  2XLJ A;  1T03 A;  3UD5 A;  1VHF A;  4QYZ K;  3FSI A;  2OTJ S;  1RT5 B;  1HQE A;  1RWW B;  1U1L A;  5KFT A;  2AZ1 A;  1A0O B;  3M1V B;  5EDW A;  1RI7 A;  1GH8 A;  2XMW A;  1HFE L;  4EYI B;  1XIQ A;  2CDQ A;  3HUL A;  1HW8 A;  2BUN A;  4RLE A;  5E33 A;  1RT7 A;  1U1Q A;  3H8Y A;  4HDH A;  5J2Q B;  1LQ9 A;  3CD5 A;  1RQ0 A;  1QY7 A;  3QSY B;  4ZPB A;  4CO1 A;  3MPY A;  3PIP Q;  3JYT A;  1TKD A;  1RYR A;  4EUV A;  3ZTS A;  1PC5 A;  3MM7 B;  1QM9 A;  5EUH A;  4J9R A;  2VBW A;  1HYS A;  4BWM A;  3RB4 A;  3CJ3 A;  1M0S A;  1JWW A;  3DN9 A;  3KJN B;  5IT9 Y;  2ZH3 A;  4C11 B;  1T9T A;  1MLA A;  1TMM A;  2PA8 D;  4YUD A;  2YX4 A;  4WK3 A;  2OJ3 A;  4DPO A;  2H51 B;  3BGR A;  3ZZO A;  2HHQ A;  2ABY A;  2WW8 A;  2QMU B;  2XMU A;  4CNZ A;  4DUY F;  4DPT A;  1TKX B;  1EAY C;  3WX8 A;  3V6D B;  1RUS A;  1M5S A;  2BOA A;  3MM5 A;  4RBV A;  2DIT A;  3CJ2 A;  3I4P A;  1NZ8 A;  3J7Z 5;  1S1U A;  4Y6I A;  3ZZP A;  1NLK L;  2HMI A;  4Q43 A;  5F8I A;  4OMF G;  3MM6 A;  3TW0 A;  1EP4 B;  5DM7 Q;  1U24 A;  2AZ3 A;  1CG2 A;  4NML A;  1ELO A;  4B3S F;  4P71 A;  2WCX A;  4XTT A;  3BGL A;  4B3S J;  4TVA B;  2MZS A;  3G6X A;  1ROF A;  1D9A A;  1FK9 A;  2YTC A;  1RA6 A;  3QO9 A;  4NLD A;  4DUZ J;  3FSX A;  2QYG A;  4PG5 A;  3C16 A;  3CJT A;  2JOQ A;  5K5M A;  3AQO A;  2GS8 A;  4AD6 A;  3KG0 A;  3SIP B;  3J7A 1;  2R7U A;  1UEV A;  1S9G A;  5IS2 A;  3KWM A;  3N5F A;  1H2U X;  2XMT A;  3UPF A;  3KNG A;  4W4M A;  1FES A;  4DSK A;  4P2S A;  1WI6 A;  4N8N A;  2QYC A;  4ECU A;  5E3P A;  3ENV A;  4R8U B;  3QLH A;  4AL6 A;  4GVB B;  2IC3 B;  1N5T A;  3B4M A;  3TUI C;  4ZHR A;  3KJV A;  2B8Q A;  3ONQ A;  3R3T A;  4A8M P;  3NGS A;  3IM8 A;  2DRA A;  4QU6 A;  2VC1 A;  4GVL A;  2JL9 A;  1C1C A;  3G8Q A;  4HHJ A;  3EGN A;  1B0T A;  5E7O B;  1PSD A;  3UR0 A;  3ISN C;  2UV8 A;  1EJ7 L;  1JLB A;  5KFR A;  2RVJ A;  1IQZ A;  3H20 A;  4UOC A;  4DCJ B;  2V5H G;  4EK2 A;  4O3P A;  1TU0 B;  1UVL A;  4JV5 F;  4M5J A;  4E98 A;  2HQI A;  4DS5 A;  2W8L A;  4FBU A;  1O5J A;  3BO3 A;  2Q43 A;  2W01 A;  5LT5 A;  3QGP A;  3POT B;  4P2F A;  1RT2 A;  2QZ8 A;  2WB1 D;  2KM8 C;  2CUY A;  3ISN D;  3V81 A;  3BR9 A;  1D3W A;  2XLK A;  3ISZ A;  4Y3C A;  1YQH A;  1M1K T;  4H4K C;  3VCD A;  3CCE S;  2NYH A;  4K4V A;  1JKH B;  3FEX B;  2P9E A;  2BRK A;  5D8H B;  2IBK A;  3UDV A;  1YJV A;  2V2K A;  4IDK A;  4USH A;  2V4Q A;  1ZH5 A;  4WYW A;  3TA0 A;  2G2Y A;  3HHL B;  3GWC A;  1HMV B;  5KFU A;  2GIQ A;  2OMO A;  4OHW A;  3TX8 A;  3OBI A;  2LA6 A;  2PSZ A;  3DOK B;  2DNY A;  3C19 A;  2VV5 A;  1VRU A;  4Q2M A;  4TLR A;  2HVI A;  4EYH B;  3TUZ C;  3RR8 A;  3VVT A;  3IBW A;  1G3O A;  2AGO A;  2CPJ A;  3PRD A;  4OI3 A;  1CC8 A;  2B3T B;  1FXL A;  2YWH A;  3B82 A;  3EVM A;  3D2W A;  3OPK A;  4PZV A;  3BGU A;  4HYK A;  2A2D A;  2ZHA A;  2QSF A;  1FKO A;  1JLA B;  1U8W A;  1FRX A;  1U1M A;  4XDD A;  5LMN J;  1S1W A;  4QZV B;  5D4L A;  3CC2 S;  3D3C J;  3CCR S;  4P74 A;  3FMW A;  1VQS A;  4UY8 T;  2M8H A;  4KGM A;  4PWU A;  5G4D A;  1NK0 A;  2A6M A;  2XMK A;  3EM1 A;  3E8O A;  3LAK A;  2FJV A;  3NL0 A;  3SCJ E;  1TL7 B;  1IBK J;  3OR1 A;  4OLP A;  3N6M A;  1M5O C;  1HBO B;  4ECT A;  1U47 A;  3HHN B;  4ETZ A;  1SL0 A;  4OZN A;  3DDN A;  2J7W A;  2YVS A;  1IN0 A;  2YKQ A;  2IM2 A;  5ETV A;  4P10 A;  5IM0 B;  4LBP A;  1OWX A;  1L3S A;  4CRJ A;  3THP A;  1K1Q A;  1NSQ A;  3GSI A;  3KJF B;  3S01 A;  1S4F A;  2NXN A;  5HMX A;  2CQB A;  1A9N B;  1KTQ A;  4KO0 A;  1UZH A;  3WIV A;  3Q0A A;  4IFV B;  4KT0 C;  2R42 A;  1R3N A;  4USU A;  3NCR A;  4DL7 A;  2V68 A;  1KBR A;  1XMQ J;  3C15 B;  1LK5 A;  2P6S A;  2RU3 A;  3VAL A;  3TAP A;  4KSE B;  5EX3 A;  5KFO A;  1K73 T;  4WXW A;  1S0N A;  4Y28 C;  3TA2 A;  3CJ0 A;  2ZH6 A;  4IO9 Q;  1S0M A;  3BBC A;  4U96 A;  5J2N B;  1W2B R;  3R27 A;  5KT5 A;  2LU2 A;  1QTN B;  5DS7 A;  3UCZ P;  1LFW A;  3Q86 A;  1VS3 A;  5I3P A;  3SSQ A;  2HHU A;  3RZA A;  2XC9 A;  2BKN A;  2ILY A;  4I1T A;  1JNR B;  3NMR A;  4DZ6 A;  3BZQ A;  4C0H A;  2ZBQ A;  2AWZ A;  5DG9 A;  4NAS A;  3AOD A;  2W24 A;  4Q45 A;  3IN5 A;  2QLF B;  1O0P A;  5B0C A;  2QLJ B;  4NA2 A;  4M95 A;  2GV1 A;  2E1C A;  2QMX A;  3UW1 A;  3MI7 X;  1SC4 B;  5GAE U;  3QT5 A;  3PIO Q;  5BXI A;  7AT1 B;  2VJV A;  1J27 A;  6FDR A;  3NNH A;  3I9Z A;  4Z37 A;  1HWJ A;  3KLH A;  4KIA A;  2FC8 A;  1LXN A;  2I8E A;  1JMT A;  2CVE A;  4IH6 A;  4ZPC A;  2XNQ A;  3GJS B;  4M5D B;  3CT9 A;  4TQR A;  3A3O B;  5KFJ A;  3CDB A;  1N0V C;  5DDQ C;  3H4B A;  1YJ9 S;  4KFB A;  3QSI A;  4KAI A;  3ZFV A;  3MAH A;  1MRO B;  3V4I A;  4ZJL A;  2JHE A;  1EAR A;  4L76 A;  1H73 A;  4PQA A;  4LF6 J;  2DJW A;  1UW4 A;  1R7I A;  4W90 B;  3O5T B;  2PE8 A;  4X4N A;  2UUA F;  1Q95 G;  1LW0 A;  3ZTR A;  3IAS 9;  5HVG A;  2GQC A;  5AE2 A;  1UMJ A;  4M63 A;  3W62 A;  4MT1 A;  2VFT A;  1QTM A;  4NEY A;  5KFY A;  4P9S A;  4DLG A;  4X65 J;  5HJX A;  1IBL F;  1QJH A;  5LL6 d;  1N34 F;  2IDE A;  4LFA J;  2DR9 A;  4YFU A;  4NXM F;  2DTJ A;  1T0T V;  1RT6 A;  4HI2 A;  5B0F A;  5J2P A;  1IBM F;  3CCS S;  2F4V F;  3IRX B;  1RTJ A;  1EQM A;  1GMV A;  5E2Q A;  4E8U A;  2H5E A;  1IBM J;  3TEH B;  3FSY A;  3GPA A;  3QT6 A;  4GRS A;  1KOH A;  2L9W A;  3NY0 A;  1IR0 A;  1H2T Z;  1ZA1 B;  1Q86 T;  1S97 A;  1WDD A;  2NSB A;  3QBC A;  1VQP S;  1R8H A;  1QSL A;  3NEK A;  2XYP B;  3BKF A;  3BB5 A;  5F8M A;  3R5D A;  4F4A A;  3N0V A;  4RO0 A;  2DPI A;  2N3L A;  4IRC A;  3I82 A;  3I5A A;  4TKT A;  2DGO A;  2A6O A;  4HI1 A;  4PUO B;  2RF2 B;  2KXH A;  2E7V A;  3MAA A;  2K7J A;  3IAM 9;  5DDR C;  4RW4 A;  1WJ9 A;  1REG X;  1N36 F;  1AT1 B;  2VIH A;  5GME A;  4ILM A;  2FIU A;  4NYZ A;  1RAA B;  2E1P A;  3AB2 B;  5HMZ A;  2OTL S;  1LWF B;  1WF0 A;  1DHM A;  1NCL A;  2ZUA A;  3FFI B;  3R1L A;  3R5J B;  4IOC Q;  5IWA F;  4ZVQ B;  4ZN3 A;  1VMB A;  2E9T A;  3I32 A;  4ER8 A;  1VQO S;  1RJJ A;  4Y2C A;  4KGZ B;  4OYM A;  3SI8 A;  3EDQ B;  1RT4 B;  4RW8 A;  1QSY A;  4YDX A;  3TJA A;  2G2Z A;  2HHS A;  2OKQ A;  3EZO A;  4FYV B;  5CD4 H;  5DRK A;  4LFB F;  2IIH A;  3I4H X;  2VF3 A;  4F3M A;  1Q8I A;  2MQP A;  1X4C A;  3DLE B;  1S6P A;  4NYO A;  3PX4 A;  1S7I A;  5CQG A;  5K8P A;  2GQ2 A;  3MMB A;  2W2P P;  3QRR A;  1AUS L;  4LRA A;  2HGN A;  4X66 F;  3DLK B;  3TZZ A;  4GKJ F;  1WHV A;  3GJR B;  1Z4U A;  2PC6 A;  2M5Y A;  2WTF A;  2JFD A;  2OEL A;  2ZBP A;  3M2U A;  4ZN1 A;  5HL7 Q;  3MM9 A;  3TAN A;  2QLW A;  4I2P A;  4EBE A;  1LWC B;  4R8U A;  3AT1 B;  2CQ4 A;  5I42 B;  4NXN F;  4IQX A;  1F0X A;  2PA3 A;  3OLA A;  4HHU A;  4CYU B;  4NXN J;  3C6U A;  2AJ4 A;  3OR2 B;  3SCL E;  3T9N A;  2DNN A;  2NRE A;  4OHZ A;  1WC0 A;  4RZR A;  2OSQ A;  2UZA A;  2ZC3 A;  2DGX A;  1QE1 A;  3EGW B;  5LXR A;  3QFH A;  4NRU A;  2FQQ B;  3W5Z A;  3MPV A;  2WVB A;  2HHH F;  2QFI A;  1F9F A;  1OY6 A;  1JLG A;  4ICL A;  3R97 A;  2NLW A;  4TLQ A;  1J5O A;  1IVZ A;  2QL7 B;  5E0O A;  1KWM A;  3SMZ A;  1KQF B;  5A8K A;  4LRF A;  3OTC A;  3ZZT A;  1S76 D;  4BS2 A;  4PAB A;  3VQS A;  4M5M A;  3IR5 B;  1YSJ A;  5KFC A;  3MEC B;  1LW2 B;  2W9C B;  2XGP A;  3HXM A;  3F56 A;  1PGZ A;  2XZT B;  1NK5 A;  4JI3 F;  3CDW A;  5IC4 B;  2AD9 A;  4HT7 A;  1FJ7 A;  1PO6 A;  2ZIT A;  1NH8 A;  2XMM A;  1DTT A;  5CZV A;  2QGF B;  2V8P A;  2PD1 A;  1L3U A;  2HEK A;  4IKA A;  3N5B A;  3W7B A;  3BN7 A;  2OI2 A;  4TXS A;  1Q0N A;  3TUJ C;  2PEB A;  2NZ4 A;  2R8I A;  1NDP A;  4ZCK A;  2X1G A;  1CQM A;  1XER A;  3NKY A;  2BEF A;  4GC6 A;  1X5O A;  2HRT A;  1CS4 A;  3UI3 A;  2NXU A;  4C8Z A;  1FRH A;  2CNN B;  1VJW A;  3UN2 A;  3M4X A;  2VPW B;  2AJ2 A;  4DR1 F;  1KQK A;  3MM8 A;  4XO0 A;  3G4S S;  3H98 A;  1UAW A;  2HYI B;  1FI4 A;  4D3H A;  1RAF B;  4WYL A;  2GO9 A;  4ES1 A;  4UOG A;  1IBC B;  2KZM A;  2NUH A;  2VBZ A;  3RAQ A;  1Q7L B;  5HN0 A;  2E5L F;  3K58 A;  2BOP A;  5FLX U;  2JFK A;  3MPD A;  3M6U A;  5GAH I;  3T5J A;  5BYQ A;  4U6P A;  1FJC A;  2RU9 A;  1QAY A;  1RGV A;  2DR6 A;  5CZX A;  3J80 Y;  4RUC A;  3I0R A;  4HT5 A;  4LRD A;  5FLX Y;  4DFM A;  4CLL A;  4K7Q A;  3BDE A;  1MWZ A;  1LWE A;  1EKR A;  3ZZU A;  4IR9 A;  5IXU A;  3IP0 A;  2VG7 A;  2W2M P;  2D9P A;  1H0H B;  2ZZT A;  3MMC B;  3HSG A;  3I55 S;  5F8J A;  4X2B A;  3C2P A;  2V9W A;  2PI5 A;  1DUR A;  3KMS A;  4WFX A;  3MWB A;  2GIF A;  4O3O A;  5I3U A;  4CLT A;  2HQC A;  1F5C A;  1V3S A;  5J2M B;  1NJY A;  1EIY B;  1UFK A;  3CW2 C;  3M8R A;  1T9Y A;  2KXN B;  2I5J A;  3FRY A;  3TAR A;  3HDS A;  1U6Z A;  2HRU A;  2KVQ E;  1WHX A;  2LEC A;  2CPD A;  4IG3 B;  4JI4 F;  1V3Z A;  2WVC A;  3NLC A;  4NI2 A;  5J1E B;  1SH3 A;  4NLS A;  1HNV B;  4FXW A;  1DQ9 A;  4OJ3 A;  4WXO A;  1ICE B;  3G96 A;  3KK3 B;  3PXG a;  1WEX A;  2HKE A;  1FE4 A;  2XZW A;  4OZ0 A;  2ZM6 F;  1R6V A;  4F67 A;  4OI6 A;  1HBN A;  1VRT A;  2MKI A;  4K4S A;  2ASL A;  1ZBT A;  2ZM6 J;  4NZ7 A;  2P9G A;  2ZDP A;  3H0P A;  2YWF A;  9ATC B;  3NAH A;  3E01 A;  2IMO A;  4U9R A;  1X0F A;  3R2C J;  3LGM A;  1IJE B;  1R0C B;  4V19 J;  4HL9 A;  1GXU A;  1DAR A;  4J9S A;  2YKM B;  4DJB A;  1QVF R;  1NK8 A;  1FNX H;  3CIZ A;  4AUK A;  1TVR B;  4WF9 Q;  1Q79 A;  3CB4 A;  3V6J A;  5C2C A;  2POK A;  1SJ3 P;  1RCX B;  3K5O A;  3FBB A;  1PC4 A;  3OFE A;  5JXS A;  2BE2 B;  5E5N A;  4BDP A;  2QTW A;  4DUT A;  1IXK A;  4MKA A;  1RWP B;  4K50 A;  3M2V B;  5ETS A;  2KYX A;  4DS4 A;  1N32 J;  3KTQ A;  2B4V A;  1WG5 A;  3DDI A;  1GTE A;  3B8H A;  4KGX B;  2JVR A;  2KTQ A;  1SIZ A;  1TP7 A;  3VF0 B;  1KDN A;  1DFD A;  2RDD A;  2GQQ A;  1KP6 A;  4TU7 A;  1HQU A;  4F7V A;  4FN5 A;  2RDJ A;  2Y1R I;  2M7S A;  3E51 A;  2F4F A;  2Y9H A;  4YY3 F;  4J9U E;  3G6E S;  2AHO B;  3D6F B;  2XBP A;  5LSO A;  3SQG A;  2E5J A;  4ECX A;  2U1A A;  2AEM A;  1X5S A;  1NKB A;  7FD1 A;  4UUX A;  4UZB A;  3QAT A;  3FQK A;  4NCG A;  4KE5 A;  3T19 A;  1IR2 A;  4AXJ A;  3RAM A;  4NLU A;  3RUB L;  5KFM A;  4FF4 A;  2X3D A;  5IQQ A;  3QGI A;  1X9M A;  1HBU B;  3NGU A;  1M5V C;  4AT1 B;  2H5J B;  4ELT A;  5SZT A;  1SKR A;  2LQJ A;  1GMU A;  3M05 A;  4XPE A;  1HHS A;  3N6L A;  1NJW A;  3DM2 B;  3A1Y G;  1Q1K A;  3HF5 A;  5D3G A;  3VVU A;  4C0B A;  2FGO A;  4DL6 A;  1R27 B;  2HIY A;  3GV5 B;  3KUH A;  4OX9 F;  2MKC A;  2YBV A;  1YZ7 A;  3H90 A;  1UW9 A;  2MMY A;  4CZC A;  3KG4 A;  3IR6 B;  2V9K A;  1TK5 A;  4GMK A;  1KQS R;  4A8Y A;  5IV4 A;  4ZVG A;  2GAG C;  3KG1 A;  2KG0 A;  3OXF A;  3PYE A;  2JH3 A;  3DLK A;  4OHX A;  2N7C A;  2LLZ A;  3I96 A;  5HP1 A;  1ZM3 A;  1WG1 A;  3OL6 A;  1UJ6 A;  2F9J A;  2YQ1 A;  1AZS B;  2ROG A;  3FRZ A;  1H6K X;  3HX9 A;  1RA7 A;  2XSJ B;  2AGP A;  2VKR A;  4JI2 J;  3T3F A;  3D3B J;  1BWV A;  1UA1 A;  3HK2 A;  2EBE A;  1RTI B;  3BSN A;  4NZ6 A;  4O3N A;  5E3A A;  5JJB A;  2DGU A;  1D8Y A;  1UVJ A;  4EMD A;  2BX6 A;  2U2F A;  1Y3J A;  4QOT A;  5CCM A;  4JI5 J;  4NLO A;  1OYE A;  4JV0 A;  3UVJ B;  4N8O A;  3KHG A;  2AX0 A;  1SV5 A;  4LBH A;  4M1K A;  4CWB A;  1NU4 A;  1S72 S;  1T9W A;  3BDP A;  4WKR A;  4ED3 A;  2HFN A;  2N82 B;  3CVK A;  4M5G A;  1Q5V A;  2HNZ A;  1BC6 A;  1EB0 A;  2ZOM A;  4LQ9 A;  4DR4 F;  3V4M A;  5K9F A;  2OAU A;  3K8W A;  2G13 A;  1HNX J;  4XAK A;  1S6Q A;  3CC4 S;  2ROP A;  4DCP B;  5H9F K;  2RML A;  4GO5 X;  2VQE F;  2MZ1 A;  1TR0 A;  5T7L B;  3QJP A;  3BQ1 A;  5LJ5 Y;  4X84 A;  1VC6 A;  1IWG A;  4N7T A;  2JDJ A;  2R3V A;  3TAM A;  2UVV A;  3VAF A;  3V2U C;  1RHM B;  4ZS6 A;  3JTP A;  2DR5 A;  3SV3 A;  3QAE A;  3LW5 C;  2E7W A;  2R7V A;  1WC6 A;  4ZPW R;  3M6V A;  2GW8 A;  4O3R A;  4O44 B;  4TY8 B;  4C4W A;  2L3M A;  2BW7 A;  3GIK A;  3IWN C;  4JB8 B;  1XNQ F;  1YJU A;  2FY8 A;  2WHO A;  4QR2 A;  3KUE A;  1FVS A;  4Z7C A;  4EWT A;  2JC0 A;  3DRP B;  2W8K A;  2QL5 B;  4P73 A;  2VQF F;  2P9C A;  4DFP A;  3JAM U;  2K1R A;  3BKU A;  1X7V A;  3TO8 A;  2X3G A;  4UOF A;  3HSD A;  4I67 A;  3I5C A;  2AYG A;  2LQ5 A;  2AYM A;  4USV A;  4MKV A;  4HEA 9;  2W2O P;  1I94 J;  4C6A A;  2C2K B;  2WBM A;  1LEO A;  3FDS A;  3DOL A;  3LPY A;  2FHO B;  2CRL A;  2HBR B;  2MLZ A;  2EC0 A;  3IBC B;  3HP6 A;  2XS7 A;  3PVX A;  4Y2M A;  2BJE A;  1ZTT A;  5KT6 A;  1HR0 F;  3PFO A;  4DV4 J;  3K5N A;  2EVZ A;  4F02 A;  1X60 A;  1GX5 A;  2C2Z B;  4USW A;  1HR0 J;  2X51 A;  4LJM A;  3G82 B;  3FMB A;  4QWB A;  2Y1J A;  1EX8 A;  4HAC A;  1VBZ A;  3AXK A;  2AYE A;  4DPW A;  2OD6 A;  2BM1 A;  3HHL C;  1WTF A;  5HLF B;  5D77 A;  4KKO A;  3VV2 B;  3UWT A;  1LFP A;  3KK2 B;  2RQ4 A;  1RKI A;  3R6L B;  2D74 B;  3M8P B;  4G6V B;  1IKV B;  2FLO A;  5ETT A;  2QA1 A;  4JYA F;  2JEI A;  1KLM A;  2WVE A;  1CBK A;  1RIS A;  2WRM A;  3ITH B;  3M9N B;  3UCG A;  1UA0 A;  1VRQ C;  3DI6 A;  3EPG A;  4PQU B;  5KFQ A;  4JP8 A;  1V3R A;  3IC1 A;  1P8G A;  1HW9 A;  5J1E A;  3HHL D;  3PEH A;  1C1B B;  4RU9 A;  5HJY A;  3MEG B;  2KJW A;  3DMJ A;  4CTA A;  4EZ6 A;  1LKZ A;  1VK8 A;  4NE9 C;  4J9K A;  1F6T A;  2V2Z A;  2JZ5 A;  1CSJ A;  3RBX A;  3HHE A;  3IGN A;  2GJI A;  3EWG A;  2M88 A;  1U1O A;  3FCW A;  4KGK A;  2J7K A;  4DPX A;  1RT1 A;  4OI1 A;  1U1N A;  1S6O A;  1U0H A;  2LDY A;  1CJV A;  2LXF A;  2AJ0 A;  1R43 A;  2YPZ A;  4F3O A;  2WBR A;  5DET A;  4FZV A;  4DSI A;  2NPI A;  3UCU P;  2DNH A;  3UFC X;  5KFS A;  3HPO A;  3GR1 A;  1DTQ B;  4I7F B;  2CQP A;  3BPS P;  3S1T A;  1S1T A;  2IMW P;  1U1K A;  1MWQ A;  2HG4 A;  3Q83 A;  1NJI T;  2AYB A;  4CLS A;  2L08 A;  3LF0 A;  5C24 B;  2HBY B;  1WSR A;  3MMA A;  2DBB A;  4ES3 A;  2KT2 A;  4FF3 A;  4OLO A;  5HMY A;  1YIT S;  3PW2 A;  2ZH4 A;  3ZZZ A;  2VB6 A;  3LGN A;  1P6T A;  3MR6 A;  2XO7 A;  2UXD F;  1N33 F;  4LF4 J;  2Q79 A;  3IS9 A;  4KB7 A;  5J1P A;  3DRR B;  2NSC A;  3IBF B;  3PW7 A;  1CUL B;  2JVO A;  1Y9O A;  2LU1 A;  4OYP A;  1U0S A;  2F40 A;  2FHM A;  2BAC A;  4YDD B;  3SFG A;  3TOQ A;  2QA4 S;  1N6Q B;  4DOZ A;  4C8N A;  2GVD B;  3TVK A;  4WE1 A;  2PFD A;  1YRX A;  1FT8 A;  8AT1 B;  2DIS A;  4WP8 A;  2OIH A;  3UR3 C;  1IKX B;  5F8N A;  3QWU A;  4KBI A;  5KOX A;  3OJS A;  4C8O A;  1TKZ B;  2N7Y A;  3HFK A;  2D3O R;  3U02 A;  2NYI A;  3T5L A;  1S10 A;  1IM4 A;  1DAX A;  5ITH A;  1PJ7 A;  4RPF A;  3D1H A;  2HFZ A;  2OGU A;  2BMB A;  1QD1 A;  5F8L A;  1FWL A;  3BKT A;  4JV1 A;  2M0G B;  1G4C A;  2CWK A;  1WG4 A;  2HFU A;  5H9F J;  1FEE A;  4DR3 J;  1F2G A;  3W2V B;  5GAH U;  3Q89 A;  4HH1 A;  3D68 A;  1S49 A;  3RW6 A;  4NLV A;  4PWD A;  2R7Q A;  2DH9 A;  5KAK A;  2CIM A;  4ID8 A;  5CHC B;  4OV6 A;  2LFV A;  3OTO F;  1HHQ A;  2IDL A;  3M32 B;  1RBO B;  1J5E J;  3L09 A;  2AJ1 A;  1IKW A;  3JB9 k;  1REV B;  1LXJ A;  2FPH X;  3AJ1 A;  4NLP A;  1YJN S;  4AL5 A;  2JJ4 D;  3BV8 A;  1VQL S;  4NCB A;  1FRJ A;  2XMJ A;  2VG6 A;  5KFD A;  5L9X A;  1U45 A;  3LWL A;  2MSS A;  1TQL A;  2M52 A;  5HAN A;  3V6K A;  1VQ5 S;  3R5B A;  1KSP A;  1S1V B;  2FZK B;  3CMA S;  3M30 B;  4OV1 A;  4MKB A;  2YNH B;  5HSP A;  2BR0 A;  5EWF A;  2D1C A;  3W64 A;  1CPZ A;  4X4T A;  3H5X A;  4G1P A;  1ZAX A;  2EPI A;  4F04 B;  1HAR A;  3DLH A;  2FLL A;  2A1B A;  1HNZ J;  4DV1 J;  1BE4 A;  4ID5 B;  3W8G A;  1UP1 A;  2DRD A;  4RBT A;  4DCO B;  2W1B A;  2OHD A;  3HT0 A;  1YBT A;  5K8O A;  2B6A B;  4RU2 A;  1X5P A;  3OL7 A;  4WWS A;  3OFF A;  1HPZ A;  3DGP A;  3OL9 A;  1B4S A;  2ZKU A;  1SC1 B;  7FDR A;  3MD1 A;  3LAM A;  3O8W A;  3KFW X;  3PM9 A;  4DDF A;  1V9O A;  5GMD A;  4K0K F;  4U95 A;  2DRB A;  4B08 A;  1VC0 A;  2XLI A;  5B0A A;  1UWB B;  4J9N A;  3AY0 A;  4EU0 A;  2G0C A;  1T3N A;  2F65 A;  4FVC A;  1EKS A;  1T03 B;  3M8S A;  3T1Y F;  3TJ8 A;  1FD8 A;  5DDO C;  1HQE B;  3TP2 A;  4DXL A;  4DV3 J;  3ET6 A;  2YXL A;  1YTY A;  3MUM P;  4DV2 J;  3HI9 A;  4LR9 A;  3GII A;  1HA1 A;  1FNM A;  3JSB A;  1QAX A;  4ZVF A;  1S79 A;  1TEL A;  4UQT A;  4A8O A;  4L74 A;  1VI7 A;  4PYA A;  3BGO P;  3KUG A;  4X4P A;  4B9N A;  3LP1 A;  1RT7 B;  4W92 B;  2P5V A;  3P4U B;  1V5V A;  2KRB A;  5HQ8 A;  2DNM A;  3JYT B;  2IYI A;  3FBC A;  4O44 A;  4PXC A;  2LQ9 A;  4OJG A;  3D66 A;  2R2T A;  3FUY A;  4GKK F;  4FDF A;  3G9C A;  3ZXW A;  2UUB F;  5KFA A;  3OVA A;  1BGX T;  2E66 A;  4WP3 A;  4X62 F;  3GIR A;  1OYD A;  1HL6 A;  2BJ7 A;  3BGR B;  1CQN A;  4FNH A;  2CNO B;  4C48 A;  1WSV A;  4ZMM A;  2AV5 A;  3FCH A;  3U1M A;  3GIJ A;  1N56 A;  3P6Y C;  3I6P A;  1N0U A;  2B4P A;  1R6Y A;  4B17 A;  4LR7 A;  2YWK A;  5ETO A;  3UD4 P;  3JSM B;  3NG8 A;  2V2V A;  5ETR A;  4K4W A;  3Q24 A;  2HZC A;  2B8P A;  4LT6 A;  5I3Q A;  3HJF A;  3MM5 B;  5ADZ A;  4YEA A;  3A3P B;  4O4R A;  2HMI B;  3QT8 A;  3MM6 B;  1U09 A;  1UL3 A;  3TQE A;  2W9A A;  3V5R A;  5DG8 A;  2HVD A;  5G0R B;  2DHS A;  4ZCL A;  1WOR A;  4YP3 A;  2JRS A;  2EWH A;  4V1A k;  1FK9 B;  1VR6 A;  2E29 A;  1KQG B;  2Z58 B;  3QO9 B;  4C3M A;  4I56 A;  2P8I A;  1QAJ A;  1SIW B;  3C16 B;  3MHY A;  4K2J A;  2XY5 A;  1R8C A;  1ZM4 A;  3OV7 A;  3EVW A;  4K4Z A;  3B54 A;  1S9G B;  5I4M A;  5GAE I;  3MEE A;  3AHP A;  2Q6B A;  2D3Z A;  1U2C A;  4FKY A;  1EQ0 A;  4LF8 J;  4LF9 J;  2KO1 A;  2XY6 A;  4CLZ A;  1ZPW X;  3EZ5 A;  2XZD B;  2BE7 D;  3AXM A;  5HVF A;  2HIQ A;  4DV6 F;  4ANE A;  3LAL A;  3QLH B;  3A12 A;  2PGC A;  1RHU B;  2R8G A;  4X4Q A;  4H54 A;  4ZHR B;  3KJV B;  4DQR A;  3TA1 A;  3V6H A;  3KLE B;  1RWK B;  1MMD A;  4JI6 J;  4YHH F;  2CG4 A;  1YJW S;  1C1C B;  3VZI A;  4DR5 F;  5ETQ A;  4ED4 A;  3AA9 A;  4NCA A;  2OEJ A;  2GA7 A;  2BBE A;  1JLB B;  1R0B G;  3RRH A;  5A2Q U;  2VJU A;  2F8H A;  1RWO B;  3ZNJ 1;  1BQM A;  2K06 A;  1Y5L B;  2XEX A;  4WZQ A;  3QZ8 A;  1F9E B;  1CJT A;  1RTD B;  5EGY A;  1YJ7 A;  4OI0 A;  2DK2 A;  1O8B A;  2VG5 A;  2HNY A;  1RT2 B;  4DR7 F;  3T6B A;  4I7F A;  3V81 B;  3ZTO A;  1ZZN A;  4UOH A;  2HHT A;  3VAH A;  2PMW A;  2RT3 A;  3W3S A;  1Q53 A;  2LQB A;  5IC6 B;  3K5M A;  3HD2 A;  4QR1 A;  3CO9 A;  2AJQ A;  3HVR A;  2V8G A;  1PBU A;  4MIB A;  4UTG A;  3GTY X;  5BYR A;  1NO8 A;  4FYX B;  2CQ0 A;  2ERR A;  1PJ5 A;  1VQ7 S;  2V8H A;  2FZG B;  1VRU B;  1T11 A;  3OUY A;  1RE1 B;  4RW7 A;  1CUL A;  3K7R A;  2C1E B;  1T8E A;  1MNE A;  4YB5 A;  5LJ3 Y;  2J5A A;  2DHX A;  5LMU F;  2CQI A;  2D7S A;  2IM0 A;  1PIL A;  2WW4 A;  1L3V A;  1FKO B;  4ECS A;  2CZ4 A;  3GV8 B;  4FKX A;  4Q5V A;  4ATN A;  5IT4 A;  1S1W B;  5E3R A;  4L72 B;  3FGV A;  1B7F A;  5L9N A;  1V5I B;  2Z57 B;  3LAN A;  5A0Y A;  2W4P A;  4ZLN A;  1F2H A;  5IZH A;  3OR1 B;  1KR4 A;  2MZR A;  1NSP A;  2H5I B;  3P5B P;  1BUX A;  1RHK B;  1CC7 A;  1R0A A;  1U7L A;  3WIU A;  4IR1 A;  4F50 A;  4U8Y A;  1RCO B;  2HFO A;  4AQY J;  1Y11 A;  5HMW A;  1RBA A;  1UTA A;  1N8R T;  3GLJ A;  3D28 A;  4KO0 B;  3J81 U;  1V6H A;  4DLE A;  4WII A;  4KPC A;  4IG0 A;  2D41 A;  2FJD B;  4PG4 A;  4MTP A;  2C2M B;  2OPS A;  2MHN A;  3MGJ A;  4WBF A;  4DV0 J;  1TK8 A;  3J81 Y;  5MLC V;  3GFX A;  2ATL A;  2Y8W A;  2CZV C;  2RSQ A;  5KG6 A;  2UXC J;  4RW6 A;  5AJ3 J;  2VU5 A;  5C25 A;  4L73 A;  2UUW A;  2F3J A;  2RD5 C;  2CPY A;  4I2Q A;  2MY7 A;  5DZ6 A;  1WOS A;  4OZL A;  4C8K A;  1GXL A;  3PDN A;  5F0U A;  2W2Q P;  4O3S A;  2ZZM A;  4OYO A;  2EC2 A;  3VGT A;  2DB1 A;  5AXN A;  3RB6 A;  4OZ5 A;  3TZY A;  5KFN A;  2I6W A;  4WP9 A;  3KLH B;  2Z2M A;  4KHP F;  1GEH A;  2YPY A;  1MU2 A;  2XMA A;  2HW3 A;  1O6X A;  4MH8 A;  5A8W B;  2ZVI A;  4KFB B;  1Q8L A;  5KG7 A;  4C97 A;  3V4I B;  4HHH A;  5L39 A;  2CJA A;  4J91 A;  2FJE B;  1WKK A;  3D5M A;  4QWA A;  1LW0 B;  1NXI A;  1JX4 A;  3F73 A;  3ILI A;  4DV7 J;  3G6Y A;  4IRK A;  3O2I A;  3R7S B;  1S59 A;  4USM A;  1RKJ A;  5B0G A;  1W7W A;  3AOA A;  4EI2 A;  5F9L A;  4MK7 A;  2Z30 B;  1NK9 A;  3PX6 A;  1Z2L A;  2EKY A;  3ZTP A;  4V19 X;  1RT6 B;  2KHD A;  5J2P B;  3AJ2 A;  3QGH A;  2HBZ B;  1BHN A;  2FJB B;  1RTJ B;  4H4O A;  4LRE A;  1RHQ B;  2BA9 A;  2KT5 A;  1RHR B;  1UJ4 A;  2BAN A;  4B9U A;  1FDA A;  4LQ3 A;  1FO1 A;  3P3D A;  3D0I E;  4B3T F;  3MCO A;  1RB0 A;  1YX2 A;  1X4H A;  3HMJ G;  4NL5 A;  1NHK L;  1W2I A;  1VGY A;  2RIJ A;  4DZD A;  2VZ9 A;  3DGV A;  4OYZ A;  4LUB A;  2K8G A;  4NRT A;  2H65 B;  5KG3 A;  3X1L B;  1U2F A;  3MAA B;  4YQW A;  3PTW A;  4B9L A;  2EK6 A;  4C3L A;  4RW4 B;  2R8H A;  3KLV A;  4IH7 A;  2O66 A;  4C8M A;  2R7O A;  3KDO A;  1U25 A;  1U2R A;  4DUY J;  1WDT A;  2YNF A;  4Y2A A;  4ZP9 A;  1HWI A;  3JSM A;  5K8N A;  2ZWO A;  3OHA A;  1EHW A;  2CNL B;  2MJU A;  1Q8K A;  1TUV A;  3TX0 A;  1W26 A;  1M1H A;  5D0G A;  2KFN A;  2FD2 A;  5IV3 A;  4RW8 B;  2MKH A;  1VQ4 S;  4CO2 A;  1XNR F;  4DR6 F;  5G0R A;  2V4R A;  1EET A;  2UXB F;  3JTO A;  4UY8 5;  3QIP B;  2O5D A;  4PXD A;  3CDA A;  1RU2 A;  4ZVT B;  1M1G A;  4ZJO A;  3CNQ P;  4ZJQ A;  1S6P B;  4P72 A;  2F8M A;  5GVQ A;  3SSR A;  3MMB B;  3L4B C;  3K0J A;  1Q81 T;  2AQ4 A;  4DR2 F;  4LSL A;  4EBD A;  3G86 A;  3R7N B;  4DI6 A;  1WOO A;  2QV6 A;  4D3G A;  1RAB B;  1X0P A;  4UT4 A;  1JK9 B;  4CO4 A;  4MMO A;  2EFG A;  3M2U B;  1E6Y A;  3MR7 A;  3MM9 B;  3GCX P;  5D15 A;  2ZVS A;  4MFB A;  3KNA A;  1A6L A;  4I2P B;  3A8I A;  3CD0 A;  1HNI A;  2OPP A;  3JS9 A;  2G1D A;  4X4V A;  4PAA A;  2DCL A;  1VQ6 S;  5H1S V;  1SJ4 P;  3C6U B;  1KKH A;  3KLE A;  2KRR A;  2Z8Q A;  5D4O A;  2KDO A;  3K17 A;  2BJ3 A;  2DHG A;  3HFZ B;  2RQC A;  3DNC A;  1FJG F;  4LFC F;  3GIL A;  2PMZ D;  2QMW A;  1NB2 A;  2MKJ A;  1IKY A;  2MQL A;  2VDH A;  2B56 A;  3GFY A;  1QE1 B;  3A8E A;  1M5K C;  2NR0 A;  2B43 A;  3QJL A;  2NPF A;  3M2R A;  1VOM A;  4DSF A;  4BLG A;  2HVE A;  2KT3 A;  2IA6 A;  1TFW A;  3F41 A;  2UU9 F;  4WU3 A;  1JLG B;  4ICL B;  3MR3 A;  1H72 C;  4Y65 A;  1RTD A;  4JV5 J;  1HNW F;  1J5O B;  2YNI A;  3ILL A;  3CJK A;  3MMJ A;  5A8K B;  4A8W A;  1TKT A;  1VIS A;  4ED0 A;  4B3R F;  3CDE A;  4ZOS A;  2WOM A;  3EZU A;  2EFN A;  1B0P A;  1Y7P A;  1CEZ A;  1DBD A;  2DXF A;  3D6H B;  2H4W B;  2RS2 A;  3MCS A;  1DTT B;  3R9L A;  2DNP A;  4OYI A;  1FKA F;  4KPY A;  4DV5 F;  1QUP A;  2MPU A;  3AFG A;  3PR5 B;  3CCQ S;  5CXT A;  1X5T A;  2BAB A;  3MPU B;  1HKA A;  1NBE B;  3PR4 A;  1S0O A;  2EFP A;  4P2X A;  1C0U B;  1CS4 B;  3IR7 B;  1GXT A;  1T9X A;  3IRW P;  5B0D A;  2IAJ A;  1H3D A;  4NLX A;  1YBU A;  3ULH A;  5ETP A;  4HH0 A;  4LF7 F;  2NUU G;  3MM8 B;  3GSD A;  4B9T A;  2IM1 A;  4FPI A;  2Z0G A;  2ZUG A;  4DF4 A;  2H54 B;  1OO0 B;  3RU0 A;  3CJ4 A;  3PY8 A;  3H4D A;  2HZA A;  2A18 A;  2DNG A;  2CYY A;  3I0R B;  2G9O A;  4NLQ A;  1S1X A;  2VOO A;  3MD3 A;  4CO5 A;  1LWE B;  1U02 A;  3MUV P;  5KT3 A;  4L6V 3;  2VG7 B;  2ALZ A;  4I6Y A;  4QYZ J;  3BS9 A;  4B3M F;  1UFW A;  1HHT P;  2QN6 B;  3HZG A;  4J9L A;  3GE9 A;  5I3U B;  1NPR A;  3C66 A;  3FK4 A;  2DD8 S;  4M5H A;  3G8T A;  5KT7 A;  4FXV A;  1SUQ A;  2UVU A;  5A6P A;  1WNE A;  2E9Z A;  3LH2 S;  4M5I A;  5IQ6 A;  5CA5 A;  2I5J B;  4TU8 A;  2B51 A;  2I38 A;  4WFZ A;  5L8R C;  1QDU B;  3QRP A;  4DQQ A;  3RAX A;  1VBK A;  3LOU A;  3LP2 B;  2BJ9 A;  1FRM A;  4NI2 B;  3TR5 A;  3FC9 A;  1NUE A;  2HHW A;  1E6V A;  1APS A;  2NCK L;  2WB4 A;  3NS5 A;  1ZA2 B;  2ASJ A;  5ETL A;  1FD2 A;  3A3N B;  2AEJ A;  1B64 A;  2YH0 A;  3LPE A;  3THT A;  4AFF A;  2CDR B;  3C8Y A;  2O3D A;  5F41 A;  5FDL A;  3FNN A;  2JC1 A;  3CC7 S;  3DLG A;  2LP4 A;  1HBN B;  1VRT B;  3QWP A;  2R7T A;  2ZKT A;  5DQG A;  1XMO F;  1S9E A;  3E01 B;  5A8W A;  2V94 A;  6AT1 B;  3UNY A;  2R8K A;  4IOB A;  3W5Y A;  5D0E A;  3SDE A;  4ZK7 M;  1FFW B;  1I51 B;  1RYS A;  2XYG B;  4RNO A;  3U27 A;  3CWJ A;  5KG0 A;  4HTI A;  2VAS A;  2VOD A;  3BO4 A;  1N5Q A;  4DG1 A;  5EX0 A;  2F63 A;  2WVD A;  2EG1 A;  2OPQ A;  3NXZ A;  2XI3 A;  3RB0 A;  2OH2 A;  2UUA J;  4YR3 A;  1HWU A;  3ENW A;  4OFZ A;  3PJ9 A;  1N54 B;  1Y5I B;  4PPD A;  4RJV A;  5F8H A;  1DLO A;  3MXH P;  3D9B A;  3RJM B;  1ZZF A;  1NJZ A;  3E3X A;  3RYL A;  1G6B A;  1IBL J;  3T1H F;  2DO4 A;  4FS1 A;  3VGU A;  1N34 J;  1N5Y A;  4PCQ A;  1ACM B;  3BR8 A;  4NXM J;  1YVF A;  2FHJ D;  1Y4Z B;  3S6E A;  3BN4 A;  2F4V J;  3NCQ A;  1JLC A;  4NEZ A;  2SXL A;  3MDF A;  3QFW A;  1FJE B;  3S8S A;  3AOC A;  3NCP A;  1YIJ S;  2PN6 A;  2HHV A;  1OS5 A;  2NXJ A;  2QJ3 A;  1B99 A;  1HQU B;  1RWX B;  2M4M A;  2RHQ B;  3DRY A;  2VUG A;  5M2U A;  3IMQ J;  3GFH A;  2DGS A;  1WHY A;  2IBO A;  1GMW D;  2IRY A;  2K7K A;  2DNQ A;  2DIV A;  1CJU B;  3PYF A;  3DRS A;  3G6V A;  4CT8 A;  3SQG B;  1SI9 A;  4C2M A;  3JTN A;  2V0N A;  4CLP A;  3CCV S;  1VQK S;  1FCA A;  2E7X A;  2EW9 A;  1LK7 A;  4K2X A;  1N36 J;  2ZH8 A;  4NCG B;  3K89 A;  2X7I A;  2GGP A;  1X9S A;  4RNM A;  2KJV A;  2YH1 A;  1YJT A;  4I68 A;  1LV5 A;  1R8B A;  1WC3 A;  5B7W A;  3T5K A;  5D0R A;  1FWP A;  2FVC A;  2LKZ A;  3BYP A;  3IA0 A;  2VBY A;  3W66 A;  4FF1 A;  1SCJ B;  5IWA J;  4A4J A;  1NK4 A;  2E5I A;  4JI8 F;  5D3G B;  5L1K A;  4X64 F;  4HLB A;  1AXQ A;  2J7U A;  3LTO A;  4JI8 J;  2FVP A;  4WTY A;  2XUL A;  3QIP A;  2DR8 A;  2X1F A;  4J9P A;  2YKN A;  3HHD A;  4LFB J;  2WSF C;  2WZ1 A;  2UUT A;  2CJB A;  3VQT A;  1OPI A;  4YB1 P;  2R2R A;  3X3U A;  4YME A;  1N5V A;  3NGT A;  4DSE A;  1XJW B;  3MFH A;  5L1L A;  1ZTW A;  3DU5 A;  3SFU A;  4G1Q A;  3SQO P;  2HPU A;  2B4O A;  3WBZ A;  3AD7 C;  1FFG B;  4Y2I A;  2HFS A;  2MKK A;  1GX6 A;  2XI2 A;  5HP1 B;  3SCK E;  4CLU A;  2M9K A;  4X66 J;  5KFH A;  1D09 B;  3DU6 A;  4GKJ J;  1ZM9 A;  5T14 A;  1Q16 B;  1S99 A;  4ILL A;  3QNW B;  2ILZ A;  2MYF A;  1U26 A;  4WFY A;  3NGK A;  3ETO A;  4Y00 A;  2EBG A;  4JI1 F;  3MPW A;  1XR5 A;  4AL7 A;  4JI7 F;  2XCP A;  4IO1 A;  1HBM A;  3OVS A;  3A13 A;  3CCU S;  3PO5 A;  2D69 A;  1JXE A;  2UV8 G;  1GT8 A;  1C4A A;  1JLQ A;  2GAH C;  2AX1 A;  1MG7 A;  3CDU A;  1IWA A;  4CNY A;  2H9Z A;  4QIE A;  5CYM A;  3KK1 A;  1SV5 B;  2EXU A;  4FYY B;  5HAO A;  1U49 A;  2BQU A;  4CO3 A;  4H4M A;  5H9E K;  5A76 A;  3NBP A;  3W1Y C;  5A6W A;  2IJR A;  3OT9 A;  5DGB A;  2HNZ B;  4M94 A;  1S9F A;  4FYD A;  5CYQ B;  2CPI A;  2HHH J;  4EO8 A;  1GK8 A;  5GAD U;  3VAG A;  2RNE A;  1RK8 A;  1S6Q B;  5DLF A;  2L9D A;  2IJF A;  2C3U A;  1B3T A;  3TWZ A;  3GV7 B;  2MZJ A;  1ZYQ A;  2J9E A;  2CPX A;  4CLY A;  5KFK A;  3UDC A;  2EI5 A;  2RB7 A;  3NWR A;  1OPZ A;  4NZ0 A;  4N5S A;  1N52 B;  5K14 A;  4CLW A;  1TFY A;  2FC9 A;  2O01 C;  4JI3 J;  3TAM B;  2CNK B;  2IM3 A;  3SYZ A;  4J7C A;  3UDL A;  2FYX A;  4A8F A;  2DCU B;  8ATC B;  1HWL A;  1ULR A;  4PWW A;  1Q82 T;  3EE3 A;  4R0J A;  4MKY A;  2NZC A;  4DSJ A;  2HVZ A;  2HHX A;  2X1B A;  4A8X A;  1P1T A;  3OTB A;  3ILJ A;  1C0U A;  2YX1 A;  3AQP A;  4ZKA A;  1J2V A;  1RLD A;  5BJR A;  4RW9 A;  3R7B B;  2C28 A;  3CCZ A;  1IM6 A;  2V6A A;  1FRL A;  5L38 A;  1SC6 A;  4URS A;  3LP0 A;  3C14 A;  1MWY A;  1H7X A;  2EEY A;  3KLG A;  2GC8 A;  4DR1 J;  2EFQ A;  3H59 A;  1RAD B;  3ENQ A;  4ZVS B;  3CJ5 A;  5THW A;  1T94 A;  3M6W A;  2K1R B;  1XQI A;  2YWG A;  1JXL A;  3JXO A;  4F2S A;  3W9H A;  1HD1 A;  1RHJ B;  2HWT A;  2W25 A;  2R7R A;  2E5L J;  1RWM B;  4CLK A;  2C3Y A;  2ZHO A;  2CFX A;  3FZB A;  1FWK A;  1OQ6 A;  5DZ7 A;  4DX7 A;  1KVI A;  4CM2 A;  2WON A;  3K57 A;  4DF8 A;  2HZV A;  3NOG A;  4J5O A;  5CH7 B;  3QQC D;  1C2P A;  3M9O B;  3MED A;  1ZPV A;  4OX7 A;  1XR6 A;  1YG0 A;  3DOL B;  4BBY A;  3UN5 A;  1N5S A;  3WDO A;  3M8Q B;  2ZH2 A;  1YGY A;  2MST A;  3D0H E;  1D1U A;  5CYJ A;  4JUZ A;  1OY9 A;  3GYX B;  4ZIT A;  4B3O A;  5KFI A;  3U1L A;  4DFJ A;  1NDK A;  2OEM A;  1TL5 A;  1BMQ B;  1S12 A;  4HAC B;  4Y0F A;  2G0J A;  2V4J A;  3HVA A;  4F8R A;  4KKO B;  4F0M A;  3EGZ A;  1YZ6 A;  3DYA A;  4ZP6 A;  3Q8P B;  1X4G A;  3QAU A;  1KLM B;  3P5T L;  2ZH5 A;  3DI6 B;  2DH7 A;  2VFU A;  3LP2 A;  3MUR P;  3KJQ B;  4KH1 B;  2MQO A;  3U7J A;  4JI4 J;  2HQD A;  3H5S A;  3HHK A;  1SVD A;  3ZZR A;  5IT9 U;  3DMJ B;  4UQG A;  4CTA B;  3CME S;  1WUU A;  2CVI A;  4ED6 A;  5HRO A;  4TY9 A;  4RL1 A;  4OHY A;  4DBQ A;  4OZ1 A;  1F1B B;  1JLE A;  1FFS B;  3CSK A;  1RT1 B;  2HND A;  3BSC A;  3HVT A;  4ECV A;  1VDH A;  1T02 A;  1U0H B;  2J8A A;  2IRU A;  3W9J A;  3SSS A;  4TQS A;  2ZDO A;  2QE5 A;  3OHB A;  1CJV B;  2ZJP Q;  1RTH A;  5F8G A;  5T41 A;  3QGG A;  4I4B A;  2HAF A;  1HIY A;  5AXM A;  1VLY A;  4N76 A;  1F9H A;  2DNR A;  2QLB B;  3BF4 A;  5DJB A;  1JB0 C;  4IH5 A;  2B5J A;  1UFL A;  5LXY A;  1S1T B;  1OMS A;  4RX6 A;  4IOA Q;  3LGH A;  1SH0 A;  1KON A;  3DOM A;  2Y0B B;  4LBI A;  2NS1 B;  3MMA B;  2IA0 A;  1NDC A;  2C2O B;  4DN0 A;  1L3K A;  4DWI A;  2ZBI A;  4IRD A;  1S48 A;  2DT9 A;  2F1F A;  4G3I A;  3HLU A;  5SUH A;  2DHH A;  1XN9 A;  2GJF A;  1L5U A;  4WK1 A;  2YKA A;  4DUZ F;  3PW0 A;  2WSC C;  3W60 A;  1K1S A;  1NH7 A;  1FHT A;  2ZH7 A;  3IS9 B;  2LXI A;  2VPX B;  1X4A A;  1VQ8 S;  4DQI A;  4U7C A;  3P96 A;  4CDI A;  1TV6 A;  1CJK A;  5C7P A;  4LSN A;  3LQV A;  3PW5 A;  1NHV A;  3FKB A;  4QR0 A;  2KB2 A;  2OFG X;  1BY9 A;  3U1N A;  4BHQ A;  1IR1 A;  4QBU A;  5HVH A;  2V34 A;  2A10 A;  4O4G A;  3NS7 B;  1R89 A;  4MK8 A;  2K3I A;  2QG9 B;  3I0S A;  1KHW A;  4GC7 A;  1FX2 A;  1BQN A;  4WE1 B;  1KOO A;  4LMZ A;  1C4C A;  1AFI A;  1WD6 A;  2WSE C;  2K2P A;  2E5G A;  1CJU A;  2HBQ B;  2EG2 A;  4YY3 J;  3PW4 A;  2XHW A;  4RNN A;  4LR8 A;  3QZ7 A;  2HGL A;  5H9E J;  2HQF A;  3H2V E;  1HD0 A;  3TNV A;  2OEK A;  1URN A;  1VYA A;  4J9V A;  4OYW A;  2OPR B;  3N9U C;  2HSE B;  4K4Y A;  2B7C B;  3DCA A;  5C2G A;  1SQG A;  3ZC4 A;  3NMA A;  4PEO A;  4ECR A;  1OSC A;  3KLF A;  2YQ0 A;  3MEK A;  2ZZN A;  3WHI A;  3IWX A;  4PWD B;  1X31 C;  1K8A T;  1SH2 A;  2Y1I A;  4NLT A;  5KFP A;  3HT3 A;  1T9U A;  4ECZ A;  1DY3 A;  3DHX A;  3GJQ B;  3W2W A;  1UVK A;  3FZ2 A;  3UO0 A;  1IKW B;  2P6T A;  1WC1 A;  4EFA C;  2HLU A;  1TL1 A;  2JNJ A;  2LA4 A;  4FP9 A;  3RR7 A;  4LRC A;  3IFE A;  1JJC B;  3W8P A;  4OX9 J;  2BDP A;  2VG6 B;  2JSX A;  1L3T A;  1MML A;  3UE2 A;  2HS4 A;  5FJ4 A;  2ZD1 A;  1DQ8 A;  3LWM A;  5E41 A;  4U7U K;  4CIO A;  1UKU A;  2GX8 A;  2FTR A;  2CQ2 A;  2Q3P A;  1M5P C;  2YNG A;  1WF1 A;  3GON A;  5AXL A;  4ZIV A;  3TZX A;  2XO6 A;  4DPY A;  2MKS A;  5DDP C;  3TYT A;  3IG1 A;  2XNR A;  3W61 A;  1NKC A;  1TAU A;  1RAJ A;  3FBE A;  4KV8 A;  2Y0S D;  3TJ9 A;  4OZ3 A;  3J7Z T;  1URR A;  3EXY A;  2CPE A;  5B09 A;  3EX7 B;  5LMN F;  2ZE2 A;  1NME B;  1H74 A;  3B4D A;  3KYL A;  2CG8 A;  3H5Y A;  1JIH A;  1P9Y A;  2QA2 A;  1RP5 A;  3EJM A;  4F25 A;  3CD7 A;  1IBK F;  4QIW D;  4MIA A;  2JEJ A;  2KG1 A;  4NX9 A;  2J0Q D;  3CUL A;  1HPZ B;  3DGP B;  4KY3 A;  2W4C A;  3O44 A;  3L7U A;  4R5P A;  2V50 A;  2MZQ A;  2RUS A;  1FKP A;  2MGZ A;  2PEH A;  4ANC A;  5CYQ A;  3VWS A;  1VCT A;  2JX2 A;  3UDE A;  1I3O B;  2VDI A;  3TZW A;  3NGR A;  4YOE A;  4DR4 J;  3GU0 A;  2UVR A;  4E0D A;  2BVZ A;  1XMQ F;  4L3N A;  2Q66 A;  3GZ7 A;  2KH9 A;  3ET6 B;  5DG7 A;  2VQE J;  3OTD A;  1AFJ A;  2KFY A;  5EWG A;  1UVN A;  1MSW D;  4UST A;  4TU9 A;  3LP1 B;  4UF4 A;  4ZCI A;  4KTQ A;  4RUB A;  4RUH A;  2WVF A;  1JNZ B;  3C6T A;  5LSR A;  3J81 j;  1GFW B;  2R4F A;  1UPP A;  3W63 A;  4EEY A;  1SQE A;  4ZVO B;  1JLF A;  1UVM A;  4WFA Q;  4IFY A;  1N4L A;  3J7Y U;  5KFZ A;  2V2Q A;  4ZLP A;  1ZET A;  3DLL Q;  2VOP A;  2BJ8 A;  2YKP A;  2VPZ B;  1XNQ J;  3F44 A;  4PPZ A;  3PAC A;  3OL8 A;  3RRG A;  2W2N P;  2EFO A;  2MZT A;  2B9W A;  4OZ2 A;  2RRN A;  3NOC A;  5KG1 A;  3ZZY A;  1UET A;  3PX0 A;  2ZWP A;  2VQF J;  3WQP A;  3CJQ A;  4Q0B A;  3DLB A;  2MLX A;  4P7T A;  2VPY B;  3JAM Y;  2IVM A;  3QYY A;  5KFL A;  2RS8 A;  1I1G A;  5D4P A;  4LF6 F;  1RAC B;  4ZA1 A;  4F4W A;  1WEY A;  4O0I A;  4FVM A;  2ZBR A;  4TN2 A;  3M8Q A;  1SJR A;  5A8R A;  1U48 A;  4EZ9 A;  2RE1 A;  1W25 A;  3AAW B;  3D6T B;  5HBM A;  2MHE A;  1QVG R;  2UUC F;  2J9C A;  2XQC A;  4X65 F;  1FXD A;  2Z4P A;  3TEG A;  2OO4 A;  3CMQ A;  2UUC J;  4AE5 A;  2W7P A;  3KHR A;  1RWV B;  3Q23 A;  1RT5 A;  4HTJ A;  2H3E B;  4LFA F;  4P52 A;  3FEZ A;  3SV4 A;  3CCJ S;  3M1V A;  4R0E A;  3RTV A;  5K8M A;  3MCN A;  2MTL A;  3MEE B;  3JQJ A;  2MQQ A;  2VA2 A;  2DO0 A;  5KT2 A;  2I9S A;  4OQJ A;  1VQM S;  4NA1 A;  4KC5 A;  4JYA J;  2I1R A;  1KN6 A;  2ASY A;  3ZTQ A;  2RKI B;  5J2Q A;  4G65 A;  2Z2Y B;  4OJH A;  3CJ8 A;  4DX6 A;  3VZH A;  2MXY A;  3K5P A;  1X4D A;  5D0H A;  5FII A;  4ZP8 A;  2ZFH A;  5CD4 A;  4F26 A;  5KFB A;  5JMN A;  3MM7 A;  2HAI A;  4PG6 A;  2RHS B;  3PJX A;  5E3Q A;  2J6U A;  4K4U A;  2H48 B;  3BQ0 A;  1RWN B;  1PBA A;  4C11 A;  4NLW A;  4ECY A;  1A7G E;  3O6Q A;  1PJ6 A;  2R8J A;  4XPC A;  1FER A;  3D7S B;  1DRZ A;  3G8S A;  4I6A A;  4OIX A;  1KD1 T;  2DKO B;  4NLG A;  1BQM B;  5E3C A;  4ZCM A;  2VC0 A;  3THV A;  4QIG A;  4Q2L A; 
#chains in the Genus database with same CATH homology
 4DZD A;  4U7U D;  5CD4 A;  5H9F K;  2Y9H A;  4QYZ K;  2Y8W A;  5H9E K;  3QRR A;  1WJ9 A;  2Y8Y A;  3QRP A;  3QRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...