4U8UM

The crystallographic structure of the giant hemoglobin from glossoscolex paulistus at 3.2 a resolution.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
222
structure length
222
Chain Sequence
b'TYKDRRFQYILTNQHLFIDKLERDLHEIDDEFKKLGSDVKDQTVRHLKARISNLEGDDCKEHEAPCGGDVPQCISDLFFCDGHKDCKNGRDEDKEVCSEVPADIGSSFAGVVSWQACEEATPHHAVVTITANERKEFFKPRIWVRAILAFEEEEHEHHIKTFQLRGYYSFGDRTLALGPERGTKPVYGVRCHFDRGDDDHADCQIVNPASLFVCGNFAAERH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Globin a chain
publication title The structure of the giant haemoglobin from Glossoscolex paulistus.
pubmed doi rcsb
molecule tags Oxygen storage/transport
total genus 56
structure length 222
sequence length 222
chains with identical sequence b, q
ec nomenclature
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF16915 Eryth_link_C Annelid erythrocruorin linker subunit C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.620 Mainly Beta Beta Barrel Lipocalin Lipocalin 4u8uM02
4U8UO 2GTLO 4U8UN 2GTLN 4U8UM 2GTLM
chains in the Genus database with same CATH superfamily
4I95A 4WHIA 2OVDA 2RQ0A 1GXAA 1SWUA 4GU8A 4TLJA 3RBYA 3F6ZB 5BVQA 3FW4A 4AZRA 4Z6JA 2GTLN 5LJEA 3GE2A 1PM1X 4YCHA 5H9AA 1RXJA 3HWGA 2AT5X 1ICMA 3WZNA 1A2DA 1EPBA 3I17A 2OL8O 4BJ8A 3NX1A 4GZVA 4ZGFA 4FQBB 2Q9SA 4LZUA 3FA7A 3FELA 1EUOA 2Y3FA 4YVBA 1AB0A 5FFHA 2GTLO 4AZPA 3NQ9A 3CKFA 1N0SA 1N4JA 1NQNA 1KZXA 5BVSA 1FDQA 3B2LA 4ZR2A 1KQXA 5L8NA 1HXLA 5B11O 1IW2A 3ZUOA 3DTQA 5D45A 1P6PA 2KW1A 4QYNA 4YKOA 1BRPA 4KC8A 3B2HA 4U8UM 1LIEA 5JD2A 3BX8A 5B3MO 5LKFA 1SWHA 1CBSA 1DZPA 4BOEA 3RE5A 5IRWA 5CYBA 4GJSA 2IZKA 2BHVA 1QFVA 5EEEA 4ZHHA 3VPJE 2KT4B 1LCWA 4INNA 1BLRA 1GT5A 1I4UA 1SWCA 1SWEA 3K3LA 1CBIA 4KH8A 4AW8A 5HZ8A 1SWNA 1Y9TA 3C77X 4DQ4A 4ZHDA 2FGSA 2RTGB 4GDZA 2AT8X 1DFVA 1OPAA 1MX7A 3T2XA 3UEXA 3WBGA 3LV4A 2FS7A 4BGFA 4EXZA 2CZUA 4ZH6A 3G7XA 1LNMA 2HYSA 4HPDA 4I3CA 1FJ1E 4WBKA 5F1EA 1SRIA 1YP7A 2MWHA 4ID2A 4NP1A 5CSEA 4BX6B 3JSQA 3TGCA 4ML7B 4LKPA 2OVEA 3F9DA 1ZNGA 1I05A 4CDFA 3EW2A 4NNTA 4GJVA 4GUZA 4AZQA 3VG3A 3FENA 4I6SA 3UAQA 2IZJA 1LIDA 4YGGA 1VWKB 1W4TA 4QGWA 5IO5A 4TKBA 2O62A 4GETA 1EXSA 1VWIB 2OY7A 2E4JA 4TKJA 3T1DA 3UEVA 3B2JA 3FYFA 4YH0A 3ZW0A 1NC9A 5EPQA 4O3WA 5B5GA 1E00A 3RDXA 3PH5A 3DSZA 3VU1A 5KICA 3P6CA 4MEEA 4QQ1A 2G79A 2JW1A 4ZHGA 2K23A 3RDOA 1QQSA 2KTDA 4K19A 1K3BA 1LDOA 1KFFA 2AVIA 3O2YA 3FEPA 4NYQA 4ORRA 4Z2VA 1ZNLA 2C4IA 3EBKA 1RAVA 3CR6A 5DPQA 5LJBA 1VWBB 2XSTA 3WZQA 2CM9A 1E06A 2JU3A 2RTDB 4QZTA 3LTWA 1FTPA 3APXA 4LZVA 4XMHA 1GT4A 1S2PA 2OFAA 3Q6LA 3PQUA 3VG6A 3OE3A 2PY1A 3S5XA 3OJYC 2R73A 1SWDA 1UZ2X 2RTAA 2Y3EA 4O3YA 4YFQA 1KT6A 4C5PA 2RCTA 2OF9A 5H9LA 1OBPA 4YKMA 1Y52X 3APVA 4UU2A 1A57A 3PP6A 1BBPA 2YG2A 1HQQA 1ZRYA 2BC3A 1L6MA 3PK2A 4MISA 3ZW1A 4QAEA 4I3BA 4AZMA 4B55A 4BCSA 4EDEA 1I9HA 3U03A 4M7MA 2CZTA 1MEPA 1BSYA 4JO6A 2OFBA 1RXHA 4DNEA 4PSQA 3NADA 1IKJA 1KT3A 3JS1A 4I9SA 1NQMA 4O49A 2G7BA 3FIDA 3RY1A 5HZ5A 3HK1A 2UYWA 1LICA 1PBOA 3PEDA 3PPTA 1STSB 4CPEA 5B29A 4ORUA 1OBQA 1SWKA 4BX5B 4CK4A 2IZEB 1AQBA 2W2AA 4ES7A 2IZAA 3IA8A 4KT5A 2JN3A 3ZW2A 3T6LA 1QWDA 1VWHB 1D2UA 4Z2OA 2X8SA 3D97A 1SY2A 1KXOA 1R0UA 1VWCB 4RUNA 5K68A 3VG4A 4HPCA 2QMIA 4TQ2A 2FS6A 1X8OA 4CDCA 1X71A 4Y0RA 1AVEA 5IO7A 3N91A 4HPBA 4NW4A 2MO5A 4IB8A 1QY2A 1U17A 3MM0A 4YDAA 1GT1A 4QRLA 1KQWA 1CRBA 1SREA 2FLJA 1VWLB 2IZHB 3HOEA 4ZH9A 2OYBO 5IXGA 5AJCA 2FWVA 5HA1A 3HPEA 1OSPO 2IZDB 5H9KA 1VWRB 1NP4A 1RLBE 1W5RA 3SZIA 1LELA 1RBPA 3WZOA 2OFMX 4O3XB 2FKJA 4QYPA 2QO5A 1HBPA 3FA9A 1VWEB 1QY0A 4NV7A 5HA0A 3RZYA 3NQ3A 5L8IA 3WJBA 4Y5DA 1KL5A 5IRAA 4I60A 4FGIB 5B10O 5FENA 1TOWA 4YGHA 4ZJ0A 5K67A 1VWJB 5F6ZA 5LKEA 4YFRA 1DZMA 2MJIA 4OS8A 2ASNX 2IZIA 1SLDB 1IKEA 2CM4A 3BS2A 4HWMA 1VYFA 4MIRA 4BQUA 3HWEA 3WJEA 1X89A 3S5VA 3C76X 4YMYA 1HY2A 2QO6A 2WQAE 1N7YA 2C1QA 3B2IA 2ZAGA 3U9PC 2JMBA 2QCBA 1FENA 4AZNA 2RTMA 3VHIA 2QOSC 1ACDA 3AKMA 1LKEA 4GNYA 1HXZA 3NBXX 1BWYA 2G8CO 1GKAA 3CBSA 3KFHA 3NPOA 3BDRA 2X45A 3FA6A 4FBVA 4IBAA 3BY0A 1JV4A 3B2KA 1JYJA 3ZQ3A 3L4RA 3T2WA 2AT3X 2IFBA 3P6GA 1VWMB 4ON1A 1ERXA 4MVEA 4QGXA 2AT0X 4CPHA 1IFBA 1ZNEA 2RTQB 5HBSA 3SLOA 3WZPA 2RTBB 3ZZVA 3KFIA 3P6FA 4BVMA 4BX7A 3EBWA 1LF7A 3IFBA 3ZW0B 1DF8A 4XMCA 1EALA 3WJGA 2RD7C 5F58A 2RTNB 1HMTA 3RE6A 2R74A 3TGAA 1BSOA 1YWAA 2OFRX 1AVGI 1U18A 2CBSA 2WWPA 3BX7A 4O9SA 3ELZA 2GTLM 4ORSA 1U0XA 2WQ9A 1SWQA 1E5PA 3D4RA 3D9WA 3VGWA 5L8OA 4ALOA 4ZGUA 2A3FX 1ADLA 1B56A 1I78A 3RDUA 1G7NA 5EDCA 2AKQA 2A2GA 2WPUA 1DZJA 1IJ8A 2NNQA 1IFCA 1T68X 1BRQA 2A5BA 3FW5A 4HFOA 3APWA 5F6BA 4GRJA 5B27A 1SWSA 3STNA 1TW4A 1ML7A 2YMSA 5L3YA 2Z4HA 5JR8A 3GAQA 1IIUA 2Q4NA 2X34A 1HN2A 2IZGB 1VWOB 4YBUA 4GK9A 4YDBA 2MHDA 2FHLA 3FR2A 4NNSA 4WFUA 1JJJA 5FQ7E 1LPJA 1UYNX 2L9CA 2JU7A 2OL6O 1JJXA 1E02A 1EIIA 1EI5A 2F01A 1OEEA 2Y32A 2VDFA 2OY5O 3F8AA 4IMNA 1O1VA 2Q39A 3RWXA 2POAA 3EW1A 4L3RA 4TKHA 1JMXA 1WBIA 2WR6A 3CWKA 4IAXA 4ORYA 3MX7A 5KIDA 1YUPA 4OMXA 2UZ2A 1SWPA 1STPA 2ACPX 2K62A 3HWDA 5AJBA 1EQDA 3S60A 2BSZA 2HNXA 2W2BA 4O3ZA 4ORWA 3D96A 5AEOA 2EU7X 4LKTA 5BYPA 1JZUA 1DF3A 5IRUA 1ALBA 1FEMA 3TF6A 2FKGA 4A1HA 4CV7A 1CJ5A 2F09A 2AT6X 3ELXA 5HZ9A 1MX8A 1KZWA 1CBRA 1SWLA 5HCEC 1PEEA 5D4AA 1AELA 1SLFB 1UYOX 4IB9A 2LB6A 3NQKA 1Y9LA 4IAWA 1ICNA 3HTYA 1LFOA 1X8PA 1TXLA 2HLVA 3AKNA 3WJDA 1N43A 2A13A 2RTEB 5F7GA 4FBOA 1SWBA 1JMZA 1SRGA 1NBXA 1W6FA 2BT9A 1S7DA 1CBQA 2G5LA 5EDBA 3UEWA 1EIOA 2OVAA 1VYGA 3CQRA 3VG5A 1SXUA 1YWBA 1RSTB 2IZFB 2R56A 4ALBA 2QOMA 1GT3A 4BX6A 1SY3A 2IZBA 3D95A 2RCQA 3VE1A 3SOTA 1NDJA 4EKVA 3TZSA 1OBUA 1UREA 2OY8A 5IO6A 1HMSA 4GD9A 2JOZA 4YGZA 3MBTA 1YWDA 2ZAIA 1O8VA 1SWAA 2VFBA 3O22A 3FMZA 1LIFA 1NP1A 2L67A 1SWTA 2GC9A 3EMMA 4JHQA 4WFVA 3ZWEA 3VE2A 1DC9A 5LJGA 2GJ5A 3S26A 3JQOA 3PECA 3T6FA 1BJ7A 2X56A 2NNEA 3P6EA 3WYPA 1SY0A 4KC7A 5HTDA 2CAMA 2Z4IA 3FLLA 4ZHCA 5LJKA 1LCVA 2F73A 1Y53X 2RTPB 2FRSA 5H9NA 1GKAB 4QNIA 4A8ZA 4CDEA 1RXKA 4ZCBA 3UEUA 2ACOA 4U8UN 1B0OA 4Z28A 1I04A 2LKKA 1O1UA 2X8FA 4U9CA 4QGVA 1TVQA 4GGZA 3OBLA 4JGLA 2AMMX 4LQZA 4CPHB 5D48A 1LIBA 2JU8A 2FR3A 4U3QA 1GGLA 2KTSA 2N93A 1HQPA 4U8UO 2NNDA 5AQ6A 4L1NA 4EQAC 2CBRA 3VHHA 2NP1A 2AL0X 2RTRB 1KT5A 1QY1A 1RSUB 3WVMA 1ZNHA 4AZOA 4YBPA 2DJGA 3P24A 4EFGA 4M6SA 4COTA 1VYOA 1SRHA 2IZLB 4KIIA 4NLJA 2A2UA 3CBCA 1E2TA 4GNWA 4XMFA 1SWRA 2OVSA 4Z2PA 2PI3O 1KL3A 3KFGA 5BVTA 2JGSA 2WEWA 1VPRA 4Y0SA 1KL4A 5F2BA 4ARHA 5KHPA 3HOLA 4OMWA 3C78X 4BX5A 5CHKA 5K06A 2BLGA 3PH6A 2HKDA 4ODDA 5D47A 2Q2MA 5D8JA 1G5WA 4Z27A 3CKGA 2RTHB 3WYQA 1QFTA 3PDFA 4PJ2A 3SAOA 3RDSA 1QG5A 3NP1A 2WEXA 3I0AA 4DQ3A 4GKCA 4HPAA 2Q2PA 5H8TA 2RTOB 1LUQA 2QO4A 3ZUIA 1YIVA 2FR2A 5HZ6A 3Q34A 2ALLX 5HWZA 4NV8A 1KGLA 3V8UA 3KQ0A 4A60A 5DG4A 3NR3A 4UU3A 3O19A 1VWPB 3SLJA 4OELA 2X46A 4Y0PA 1MDCA 3KVNA 4IB6A 1X8QA 1SXYA 2DJFA 3BRNA 3CQNA 1PMPA 4MVKA 1G74A 2IZCB 3CMPA 1SXXA 4I9RA 4TNNA 2WUTA 4O4UA 4XMDA 1VWNB 5HAEA 3KZAA 3SZJA 3WXQA 1QABE 3NX2A 1PTSA 2WSJA 3VG7A 1D3SA 1MK5A 1I06A 1MUPA 1VWAB 1EPAA 1JQPA 4XMEA 2RTFB 1VWDB 4D6BA 2AF5A 1A3YA 1EW3A 1SLGB 2W2FA 3EM0A 2M4LA 2BS5A 1JIWI 4IRWA 1SWJA 1S44A 3KFFA 3ZW1B 2RN4A 1T0VA 2L68A 2RTJA 3QQ2A 4O4OA 2XKLA 3RDQA 5C0NA 3TGBA 1B4MA 3RKGA 4CPIA 1SLEB 5FQ8E 2X55A 2GTFX 1HBQA 3P6HA 3SZHA 1X8UA 1G85A 2A8GA 2DM5A 3STMX 1ERBA 4QZUA 3SLTA 3LHNA 1XCAA 3X00A 4RUUA 1OPBA 5HCCC 1GX9A 4GGRA 4FBRA 1SRJA 1YWCA 2VFCA 2GH7A 2OZQA 4ORXA 1YP6A 1A18A 3EC5A 4O4SA 4D6AA 4OS3A 1MM9A 1SY1A 1Y0GA 1AVDA 2RA6A 4GGTA 4OEMA 1N9MA 3P6DA 2HZQA 3MVFA 2LA7A 1GX8A 1NGLA 2FTBA 4IABA 1MOYA 4TJZA 1SWFA 2OF8A 3BU1A 1GX3A 5B2AO 2LFOA 4JNJA 5FAZA 3PQSA 3P02A 4CSBA 5LJDA 1K24A 1VWGB 1VWFB 2BS6A 4IB7A 1OEKA 1B8EA 2MM3A 2FHNX 3FA8A 5EZ2A 2QM9A 4GE1A 2I5ZO 1JBHA 1Y55X 2RTLA 4Y0QA 3MG5A 3OD9A 4NYRA 3BU9A 3FR5A 1XKIA 3BSZE 2FT9A 4A1YA 2G78A 2X4MA 1JJUA 3FR4A 1T8VA 4GH7A 1SRFA 3H3IA 3RDMA 1DZKA 1WUBA 2A5CA 3BLGA 3QKGA 5FQ6E 3AUMO 1OEJA 4OKAA 1ZNKA 1H91A 1X8NA 4DCBA 4EEJA 2OY1O 4U46A 1SMPI 4N7CA 3WOVA 3APUA 1DV9A 4Y59A 2A0AA 2ZSCA 2ANSA 3ZI8A 1BEBA 5B5FA 3RSWA 1LDQA 2LBAA 2P8GA 3E3CA 4YFPA 3VG2A 1SWOA 4N7DA 4OS0A 4YCEA 4ZFXA 1N9YA 1SA8A 1SXWA 5EEDA 3FIQA 1FELA 1VWQB 3FDCA 3WJFA 3RY2A 5LJHA 2RTKA 3VHMA 3U0DA 3FEKA 5HTEA 1HMRA 2X32A 4AYHA 2RTCB 4XMGA 2HMBA 1MVGA 2L5PA 2C1SA 1TOUA 2KD2A 2X8TA 4O4XA 3EYCA 2OL7A 4BBOA 1KOIA 3AEHA 4BX7B 4CPFA 1BM5A 2I5VO 1KT4A 4I3DA 5LJCA 2MF6A 4MVLA 5HZQA 1LCZA 2AH7X 1PBYA 4ZHFA 5HCDC 5CE4A 1SWGA 2HZRA 1KT7A 1STRB 2RTIB 3HWFA 4IMOA 1GM6A 3WJCA 4R0BA 1FE3A 1Z24A 4GDAA 4CDDA 4MVIA 1ZNDA 3STKA 4KCAA 2LBVA 4NLIA 1BSQA 1JYDA
chains in the Genus database with same CATH topology
4I95A 4WHIA 2OVDA 2RQ0A 1GXAA 4GU8A 4TLJA 3RBYA 3F6ZB 5BVQA 3FW4A 4AZRA 2GTLN 5LJEA 3GE2A 1PM1X 4YCHA 5H9AA 3HWGA 2AT5X 1ICMA 1A2DA 1EPBA 3I17A 3NX1A 4GZVA 4ZGFA 4FQBB 2Q9SA 4LZUA 3FA7A 3FELA 1EUOA 1AB0A 5FFHA 2GTLO 4AZPA 3NQ9A 1N0SA 1KZXA 5BVSA 1FDQA 3B2LA 4ZR2A 1KQXA 5L8NA 1IW2A 3ZUOA 3DTQA 5D45A 1P6PA 2KW1A 4QYNA 4YKOA 1BRPA 4KC8A 3B2HA 4U8UM 1LIEA 3BX8A 5LKFA 1CBSA 1DZPA 4BOEA 5CYBA 2BHVA 1QFVA 5EEEA 4ZHHA 3VPJE 2KT4B 4INNA 1BLRA 1GT5A 1I4UA 3K3LA 1CBIA 4KH8A 4AW8A 5HZ8A 3C77X 1Y9TA 4DQ4A 4ZHDA 4GDZA 2AT8X 1DFVA 1OPAA 1MX7A 3UEXA 3WBGA 3LV4A 2FS7A 4EXZA 2CZUA 4ZH6A 3G7XA 1LNMA 2HYSA 4HPDA 4I3CA 4WBKA 5F1EA 1YP7A 2MWHA 4ID2A 4NP1A 3JSQA 3TGCA 4ML7B 4LKPA 2OVEA 3F9DA 1ZNGA 1I05A 4NNTA 4AZQA 3VG3A 3FENA 4I6SA 3UAQA 1LIDA 4YGGA 5IO5A 4QGWA 4TKBA 2O62A 4GETA 1EXSA 3T1DA 3UEVA 2E4JA 4TKJA 3ZW0A 3TGBA 3B2JA 3FYFA 4YH0A 5EPQA 4O3WA 1E00A 3PH5A 3DSZA 3VU1A 5KICA 3P6CA 4QQ1A 2G79A 2JW1A 4ZHGA 2K23A 1QQSA 2KTDA 4K19A 4NYQA 3O2YA 4ORRA 3FEPA 1ZNLA 3EBKA 3CR6A 5DPQA 5LJBA 2XSTA 2CM9A 1E06A 2JU3A 4QZTA 1FTPA 3APXA 4LZVA 4XMHA 1GT4A 1S2PA 3Q6LA 3VG6A 3PQUA 3OE3A 2PY1A 3S5XA 3OJYC 2R73A 1UZ2X 4O3YA 4YFQA 1KT6A 2RCTA 5H9LA 1OBPA 4YKMA 3APVA 4UU2A 1A57A 3PP6A 1BBPA 2YG2A 1ZRYA 3ZW1A 1L6MA 4MISA 4QAEA 4I3BA 4AZMA 4EDEA 3U03A 4M7MA 2CZTA 1BSYA 4PSQA 3NADA 1IKJA 1KT3A 3JS1A 4I9SA 4O49A 2G7BA 5HZ5A 3HK1A 3PPTA 1LICA 1PBOA 3PEDA 5B29A 4ORUA 1OBQA 4CK4A 1AQBA 2W2AA 4ES7A 4KT5A 3IA8A 3ZW2A 2JN3A 1QWDA 1D2UA 2X8SA 3D97A 1SY2A 1KXOA 1R0UA 4RUNA 3VG4A 4HPCA 2QMIA 4TQ2A 2FS6A 1X8OA 1X71A 4Y0RA 5IO7A 3N91A 4HPBA 4NW4A 2MO5A 4IB8A 1QY2A 1U17A 4YDAA 1GT1A 4QRLA 1KQWA 1CRBA 2FLJA 3HOEA 4ZH9A 5AJCA 2FWVA 5HA1A 5H9KA 1NP4A 1RLBE 1RBPA 2OFMX 4O3XB 4QYPA 2QO5A 1HBPA 3FA9A 1QY0A 3RZYA 5HA0A 3NQ3A 5L8IA 3WJBA 4FGIB 5FENA 1TOWA 4YGHA 4ZJ0A 5F6ZA 5LKEA 4YFRA 1DZMA 2MJIA 4OS8A 2ASNX 1IKEA 2CM4A 3BS2A 4HWMA 1VYFA 4MIRA 4BQUA 3HWEA 3WJEA 1X89A 3S5VA 3C76X 4YMYA 2QO6A 2WQAE 3B2IA 2ZAGA 3U9PC 2JMBA 1FENA 4AZNA 2QOSC 1ACDA 3AKMA 1LKEA 4GNYA 3NBXX 1BWYA 3CBSA 1GKAA 3KFHA 3NPOA 4IBAA 3BDRA 2X45A 3FA6A 4FBVA 3VG2A 3BY0A 1JV4A 3B2KA 1JYJA 3ZQ3A 3L4RA 2AT3X 2IFBA 3P6GA 4ON1A 1ERXA 4MVEA 4QGXA 2AT0X 1IFBA 1ZNEA 3ZZVA 5HBSA 3KFIA 3P6FA 4BVMA 3EBWA 1LF7A 3IFBA 3ZW0B 4XMCA 1EALA 3WJGA 2RD7C 5F58A 1HMTA 2R74A 3TGAA 1BSOA 1YWAA 2OFRX 1AVGI 1U18A 2CBSA 2WWPA 3BX7A 4O9SA 3ELZA 2GTLM 4ORSA 1U0XA 2WQ9A 3D4RA 1E5PA 5L8OA 4ALOA 4ZGUA 2A3FX 1ADLA 1B56A 1G7NA 5EDCA 2AKQA 2A2GA 1DZJA 2NNQA 1IFCA 1T68X 1BRQA 3FW5A 4HFOA 5F6BA 3APWA 4GRJA 5B27A 3STNA 1TW4A 1ML7A 2YMSA 2Z4HA 5JR8A 3GAQA 1IIUA 2Q4NA 4YDBA 1HN2A 4YBUA 4GK9A 2MHDA 3FR2A 4NNSA 4WFUA 1JJJA 5FQ7E 1LPJA 2L9CA 2JU7A 1JJXA 1E02A 1EIIA 1EI5A 1OEEA 3F8AA 4IMNA 1O1VA 2Q39A 3RWXA 2POAA 4L3RA 4TKHA 4IAXA 2WR6A 3CWKA 4ORYA 5KIDA 3MX7A 1YUPA 4OMXA 2ACPX 3HWDA 2K62A 5AJBA 1EQDA 3S60A 2HNXA 2W2BA 4O3ZA 4ORWA 3D96A 5AEOA 2EU7X 4LKTA 5BYPA 1JZUA 1DF3A 1ALBA 1FEMA 3TF6A 4A1HA 4CV7A 1CJ5A 2F09A 2AT6X 3ELXA 5HZ9A 1MX8A 1KZWA 1CBRA 5HCEC 1PEEA 5D4AA 1AELA 4IB9A 2LB6A 3NQKA 1Y9LA 4IAWA 1ICNA 3HTYA 1LFOA 1X8PA 1TXLA 2HLVA 3AKNA 2A13A 5F7GA 4FBOA 2BT9A 3UEWA 1S7DA 1CBQA 5EDBA 1EIOA 2OVAA 1VYGA 3CQRA 3VG5A 1SXUA 1YWBA 2R56A 4ALBA 1GT3A 1SY3A 3D95A 2RCQA 3VE1A 3SOTA 3TZSA 1OBUA 1UREA 5IO6A 1HMSA 2JOZA 4YGZA 3MBTA 1YWDA 2ZAIA 1O8VA 3O22A 3FMZA 1LIFA 1NP1A 2L67A 2GC9A 3EMMA 4WFVA 3ZWEA 3VE2A 1DC9A 5LJGA 2GJ5A 3S26A 3JQOA 3PECA 1BJ7A 2NNEA 3P6EA 1SY0A 4KC7A 5HTDA 2Z4IA 3FLLA 4ZHCA 5LJKA 2F73A 5H9NA 2FRSA 1GKAB 4QNIA 4A8ZA 4ZCBA 3UEUA 2ACOA 4U8UN 1B0OA 1I04A 2LKKA 1O1UA 2X8FA 4U9CA 4QGVA 1TVQA 3OBLA 4JGLA 2AMMX 4LQZA 5D48A 1LIBA 2JU8A 2FR3A 4U3QA 1GGLA 2KTSA 2N93A 1HQPA 4U8UO 2NNDA 5AQ6A 4L1NA 4EQAC 2CBRA 2NP1A 2AL0X 4YBPA 1KT5A 1QY1A 4AZOA 3WVMA 1ZNHA 3P24A 4EFGA 4M6SA 4COTA 4KIIA 4NLJA 2A2UA 3CBCA 4GNWA 4XMFA 2OVSA 3KFGA 5BVTA 2WEWA 1VPRA 4Y0SA 4ARHA 5KHPA 3HOLA 4OMWA 3C78X 5K06A 2BLGA 3PH6A 4ODDA 5D47A 2Q2MA 5D8JA 1G5WA 1QFTA 4PJ2A 3SAOA 1QG5A 3NP1A 2WEXA 3I0AA 4DQ3A 4GKCA 4HPAA 2Q2PA 5H8TA 3ZUIA 2QO4A 1YIVA 2FR2A 5HZ6A 2ALLX 5HWZA 1KGLA 3V8UA 3KQ0A 4A60A 5DG4A 3NR3A 4UU3A 3O19A 2X46A 4Y0PA 1MDCA 4IB6A 1X8QA 1SXYA 3BRNA 3CQNA 1PMPA 4MVKA 1G74A 3CMPA 1SXXA 4I9RA 4TNNA 2WUTA 4O4UA 4XMDA 5HAEA 3KZAA 3WXQA 1QABE 3NX2A 2WSJA 3VG7A 1D3SA 1I06A 1MUPA 4XMEA 1EPAA 4D6BA 1A3YA 1EW3A 2W2FA 3EM0A 2M4LA 2BS5A 1JIWI 1S44A 3KFFA 3ZW1B 2RN4A 1T0VA 2L68A 4O4OA 1B4MA 2XKLA 5C0NA 3RKGA 5FQ8E 2GTFX 1HBQA 3P6HA 1X8UA 1G85A 2DM5A 3STMX 1ERBA 4QZUA 3LHNA 1XCAA 5HCCC 4RUUA 1OPBA 1GX9A 4FBRA 1YWCA 4ORXA 2OZQA 1YP6A 1A18A 4O4SA 4D6AA 4OS3A 2RA6A 1SY1A 3P6DA 2HZQA 3MVFA 2LA7A 1GX8A 1NGLA 2FTBA 4IABA 4TJZA 3BU1A 2LFOA 5FAZA 3PQSA 3P02A 4CSBA 5LJDA 2BS6A 4IB7A 1OEKA 1B8EA 2MM3A 3FA8A 5EZ2A 2QM9A 4GE1A 1JBHA 4Y0QA 3OD9A 4NYRA 3BU9A 3FR5A 1XKIA 3BSZE 2FT9A 4A1YA 2G78A 3FR4A 1T8VA 4GH7A 3H3IA 1DZKA 3BLGA 3QKGA 5FQ6E 1OEJA 1ZNKA 1H91A 1X8NA 4EEJA 1SMPI 4N7CA 3WOVA 3APUA 1DV9A 2A0AA 2ANSA 3ZI8A 1BEBA 3RSWA 2P8GA 2LBAA 3E3CA 4YFPA 4OS0A 4N7DA 4YCEA 4ZFXA 1SA8A 1SXWA 5EEDA 3WJFA 3FIQA 1FELA 3WJDA 5LJHA 3U0DA 3FEKA 5HTEA 1HMRA 4AYHA 4XMGA 2HMBA 1MVGA 2L5PA 1TOUA 2KD2A 2X8TA 4O4XA 3EYCA 1KOIA 1BM5A 4I3DA 1KT4A 5LJCA 4MVLA 2AH7X 5HZQA 4ZHFA 5HCDC 5CE4A 2HZRA 1KT7A 4IMOA 3HWFA 1GM6A 3WJCA 4R0BA 1FE3A 1Z24A 4MVIA 1ZNDA 3STKA 4KCAA 2LBVA 4NLIA 1BSQA 1JYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U8U O;  2GTL O;  4U8U N;  2GTL N;  4U8U M;  2GTL M; 
#chains in the Genus database with same CATH topology
 4I95 A;  4WHI A;  2OVD A;  2RQ0 A;  1GXA A;  1SWU A;  4GU8 A;  4TLJ A;  3RBY A;  3F6Z B;  5BVQ A;  3FW4 A;  4AZR A;  4Z6J A;  2GTL N;  5LJE A;  3GE2 A;  1PM1 X;  4YCH A;  5H9A A;  1RXJ A;  3HWG A;  2AT5 X;  1ICM A;  3WZN A;  1A2D A;  1EPB A;  3I17 A;  2OL8 O;  4BJ8 A;  3NX1 A;  4GZV A;  4ZGF A;  4FQB B;  2Q9S A;  4LZU A;  3FA7 A;  3FEL A;  1EUO A;  2Y3F A;  4YVB A;  1AB0 A;  5FFH A;  2GTL O;  4AZP A;  3NQ9 A;  3CKF A;  1N0S A;  1N4J A;  1NQN A;  1KZX A;  5BVS A;  1FDQ A;  3B2L A;  4ZR2 A;  1KQX A;  5L8N A;  1HXL A;  5B11 O;  1IW2 A;  3ZUO A;  3DTQ A;  5D45 A;  1P6P A;  2KW1 A;  4QYN A;  4YKO A;  1BRP A;  4KC8 A;  3B2H A;  4U8U M;  1LIE A;  5JD2 A;  3BX8 A;  5B3M O;  5LKF A;  1SWH A;  1CBS A;  1DZP A;  4BOE A;  3RE5 A;  5IRW A;  5CYB A;  4GJS A;  2IZK A;  2BHV A;  1QFV A;  5EEE A;  4ZHH A;  3VPJ E;  2KT4 B;  1LCW A;  4INN A;  1BLR A;  1GT5 A;  1I4U A;  1SWC A;  1SWE A;  3K3L A;  1CBI A;  4KH8 A;  4AW8 A;  5HZ8 A;  1SWN A;  1Y9T A;  3C77 X;  4DQ4 A;  4ZHD A;  2FGS A;  2RTG B;  4GDZ A;  2AT8 X;  1DFV A;  1OPA A;  1MX7 A;  3T2X A;  3UEX A;  3WBG A;  3LV4 A;  2FS7 A;  4BGF A;  4EXZ A;  2CZU A;  4ZH6 A;  3G7X A;  1LNM A;  2HYS A;  4HPD A;  4I3C A;  1FJ1 E;  4WBK A;  5F1E A;  1SRI A;  1YP7 A;  2MWH A;  4ID2 A;  4NP1 A;  5CSE A;  4BX6 B;  3JSQ A;  3TGC A;  4ML7 B;  4LKP A;  2OVE A;  3F9D A;  1ZNG A;  1I05 A;  4CDF A;  3EW2 A;  4NNT A;  4GJV A;  4GUZ A;  4AZQ A;  3VG3 A;  3FEN A;  4I6S A;  3UAQ A;  2IZJ A;  1LID A;  4YGG A;  1VWK B;  1W4T A;  4QGW A;  5IO5 A;  4TKB A;  2O62 A;  4GET A;  1EXS A;  1VWI B;  2OY7 A;  2E4J A;  4TKJ A;  3T1D A;  3UEV A;  3B2J A;  3FYF A;  4YH0 A;  3ZW0 A;  1NC9 A;  5EPQ A;  4O3W A;  5B5G A;  1E00 A;  3RDX A;  3PH5 A;  3DSZ A;  3VU1 A;  5KIC A;  3P6C A;  4MEE A;  4QQ1 A;  2G79 A;  2JW1 A;  4ZHG A;  2K23 A;  3RDO A;  1QQS A;  2KTD A;  4K19 A;  1K3B A;  1LDO A;  1KFF A;  2AVI A;  3O2Y A;  3FEP A;  4NYQ A;  4ORR A;  4Z2V A;  1ZNL A;  2C4I A;  3EBK A;  1RAV A;  3CR6 A;  5DPQ A;  5LJB A;  1VWB B;  2XST A;  3WZQ A;  2CM9 A;  1E06 A;  2JU3 A;  2RTD B;  4QZT A;  3LTW A;  1FTP A;  3APX A;  4LZV A;  4XMH A;  1GT4 A;  1S2P A;  2OFA A;  3Q6L A;  3PQU A;  3VG6 A;  3OE3 A;  2PY1 A;  3S5X A;  3OJY C;  2R73 A;  1SWD A;  1UZ2 X;  2RTA A;  2Y3E A;  4O3Y A;  4YFQ A;  1KT6 A;  4C5P A;  2RCT A;  2OF9 A;  5H9L A;  1OBP A;  4YKM A;  1Y52 X;  3APV A;  4UU2 A;  1A57 A;  3PP6 A;  1BBP A;  2YG2 A;  1HQQ A;  1ZRY A;  2BC3 A;  1L6M A;  3PK2 A;  4MIS A;  3ZW1 A;  4QAE A;  4I3B A;  4AZM A;  4B55 A;  4BCS A;  4EDE A;  1I9H A;  3U03 A;  4M7M A;  2CZT A;  1MEP A;  1BSY A;  4JO6 A;  2OFB A;  1RXH A;  4DNE A;  4PSQ A;  3NAD A;  1IKJ A;  1KT3 A;  3JS1 A;  4I9S A;  1NQM A;  4O49 A;  2G7B A;  3FID A;  3RY1 A;  5HZ5 A;  3HK1 A;  2UYW A;  1LIC A;  1PBO A;  3PED A;  3PPT A;  1STS B;  4CPE A;  5B29 A;  4ORU A;  1OBQ A;  1SWK A;  4BX5 B;  4CK4 A;  2IZE B;  1AQB A;  2W2A A;  4ES7 A;  2IZA A;  3IA8 A;  4KT5 A;  2JN3 A;  3ZW2 A;  3T6L A;  1QWD A;  1VWH B;  1D2U A;  4Z2O A;  2X8S A;  3D97 A;  1SY2 A;  1KXO A;  1R0U A;  1VWC B;  4RUN A;  5K68 A;  3VG4 A;  4HPC A;  2QMI A;  4TQ2 A;  2FS6 A;  1X8O A;  4CDC A;  1X71 A;  4Y0R A;  1AVE A;  5IO7 A;  3N91 A;  4HPB A;  4NW4 A;  2MO5 A;  4IB8 A;  1QY2 A;  1U17 A;  3MM0 A;  4YDA A;  1GT1 A;  4QRL A;  1KQW A;  1CRB A;  1SRE A;  2FLJ A;  1VWL B;  2IZH B;  3HOE A;  4ZH9 A;  2OYB O;  5IXG A;  5AJC A;  2FWV A;  5HA1 A;  3HPE A;  1OSP O;  2IZD B;  5H9K A;  1VWR B;  1NP4 A;  1RLB E;  1W5R A;  3SZI A;  1LEL A;  1RBP A;  3WZO A;  2OFM X;  4O3X B;  2FKJ A;  4QYP A;  2QO5 A;  1HBP A;  3FA9 A;  1VWE B;  1QY0 A;  4NV7 A;  5HA0 A;  3RZY A;  3NQ3 A;  5L8I A;  3WJB A;  4Y5D A;  1KL5 A;  5IRA A;  4I60 A;  4FGI B;  5B10 O;  5FEN A;  1TOW A;  4YGH A;  4ZJ0 A;  5K67 A;  1VWJ B;  5F6Z A;  5LKE A;  4YFR A;  1DZM A;  2MJI A;  4OS8 A;  2ASN X;  2IZI A;  1SLD B;  1IKE A;  2CM4 A;  3BS2 A;  4HWM A;  1VYF A;  4MIR A;  4BQU A;  3HWE A;  3WJE A;  1X89 A;  3S5V A;  3C76 X;  4YMY A;  1HY2 A;  2QO6 A;  2WQA E;  1N7Y A;  2C1Q A;  3B2I A;  2ZAG A;  3U9P C;  2JMB A;  2QCB A;  1FEN A;  4AZN A;  2RTM A;  3VHI A;  2QOS C;  1ACD A;  3AKM A;  1LKE A;  4GNY A;  1HXZ A;  3NBX X;  1BWY A;  2G8C O;  1GKA A;  3CBS A;  3KFH A;  3NPO A;  3BDR A;  2X45 A;  3FA6 A;  4FBV A;  4IBA A;  3BY0 A;  1JV4 A;  3B2K A;  1JYJ A;  3ZQ3 A;  3L4R A;  3T2W A;  2AT3 X;  2IFB A;  3P6G A;  1VWM B;  4ON1 A;  1ERX A;  4MVE A;  4QGX A;  2AT0 X;  4CPH A;  1IFB A;  1ZNE A;  2RTQ B;  5HBS A;  3SLO A;  3WZP A;  2RTB B;  3ZZV A;  3KFI A;  3P6F A;  4BVM A;  4BX7 A;  3EBW A;  1LF7 A;  3IFB A;  3ZW0 B;  1DF8 A;  4XMC A;  1EAL A;  3WJG A;  2RD7 C;  5F58 A;  2RTN B;  1HMT A;  3RE6 A;  2R74 A;  3TGA A;  1BSO A;  1YWA A;  2OFR X;  1AVG I;  1U18 A;  2CBS A;  2WWP A;  3BX7 A;  4O9S A;  3ELZ A;  2GTL M;  4ORS A;  1U0X A;  2WQ9 A;  1SWQ A;  1E5P A;  3D4R A;  3D9W A;  3VGW A;  5L8O A;  4ALO A;  4ZGU A;  2A3F X;  1ADL A;  1B56 A;  1I78 A;  3RDU A;  1G7N A;  5EDC A;  2AKQ A;  2A2G A;  2WPU A;  1DZJ A;  1IJ8 A;  2NNQ A;  1IFC A;  1T68 X;  1BRQ A;  2A5B A;  3FW5 A;  4HFO A;  3APW A;  5F6B A;  4GRJ A;  5B27 A;  1SWS A;  3STN A;  1TW4 A;  1ML7 A;  2YMS A;  5L3Y A;  2Z4H A;  5JR8 A;  3GAQ A;  1IIU A;  2Q4N A;  2X34 A;  1HN2 A;  2IZG B;  1VWO B;  4YBU A;  4GK9 A;  4YDB A;  2MHD A;  2FHL A;  3FR2 A;  4NNS A;  4WFU A;  1JJJ A;  5FQ7 E;  1LPJ A;  1UYN X;  2L9C A;  2JU7 A;  2OL6 O;  1JJX A;  1E02 A;  1EII A;  1EI5 A;  2F01 A;  1OEE A;  2Y32 A;  2VDF A;  2OY5 O;  3F8A A;  4IMN A;  1O1V A;  2Q39 A;  3RWX A;  2POA A;  3EW1 A;  4L3R A;  4TKH A;  1JMX A;  1WBI A;  2WR6 A;  3CWK A;  4IAX A;  4ORY A;  3MX7 A;  5KID A;  1YUP A;  4OMX A;  2UZ2 A;  1SWP A;  1STP A;  2ACP X;  2K62 A;  3HWD A;  5AJB A;  1EQD A;  3S60 A;  2BSZ A;  2HNX A;  2W2B A;  4O3Z A;  4ORW A;  3D96 A;  5AEO A;  2EU7 X;  4LKT A;  5BYP A;  1JZU A;  1DF3 A;  5IRU A;  1ALB A;  1FEM A;  3TF6 A;  2FKG A;  4A1H A;  4CV7 A;  1CJ5 A;  2F09 A;  2AT6 X;  3ELX A;  5HZ9 A;  1MX8 A;  1KZW A;  1CBR A;  1SWL A;  5HCE C;  1PEE A;  5D4A A;  1AEL A;  1SLF B;  1UYO X;  4IB9 A;  2LB6 A;  3NQK A;  1Y9L A;  4IAW A;  1ICN A;  3HTY A;  1LFO A;  1X8P A;  1TXL A;  2HLV A;  3AKN A;  3WJD A;  1N43 A;  2A13 A;  2RTE B;  5F7G A;  4FBO A;  1SWB A;  1JMZ A;  1SRG A;  1NBX A;  1W6F A;  2BT9 A;  1S7D A;  1CBQ A;  2G5L A;  5EDB A;  3UEW A;  1EIO A;  2OVA A;  1VYG A;  3CQR A;  3VG5 A;  1SXU A;  1YWB A;  1RST B;  2IZF B;  2R56 A;  4ALB A;  2QOM A;  1GT3 A;  4BX6 A;  1SY3 A;  2IZB A;  3D95 A;  2RCQ A;  3VE1 A;  3SOT A;  1NDJ A;  4EKV A;  3TZS A;  1OBU A;  1URE A;  2OY8 A;  5IO6 A;  1HMS A;  4GD9 A;  2JOZ A;  4YGZ A;  3MBT A;  1YWD A;  2ZAI A;  1O8V A;  1SWA A;  2VFB A;  3O22 A;  3FMZ A;  1LIF A;  1NP1 A;  2L67 A;  1SWT A;  2GC9 A;  3EMM A;  4JHQ A;  4WFV A;  3ZWE A;  3VE2 A;  1DC9 A;  5LJG A;  2GJ5 A;  3S26 A;  3JQO A;  3PEC A;  3T6F A;  1BJ7 A;  2X56 A;  2NNE A;  3P6E A;  3WYP A;  1SY0 A;  4KC7 A;  5HTD A;  2CAM A;  2Z4I A;  3FLL A;  4ZHC A;  5LJK A;  1LCV A;  2F73 A;  1Y53 X;  2RTP B;  2FRS A;  5H9N A;  1GKA B;  4QNI A;  4A8Z A;  4CDE A;  1RXK A;  4ZCB A;  3UEU A;  2ACO A;  4U8U N;  1B0O A;  4Z28 A;  1I04 A;  2LKK A;  1O1U A;  2X8F A;  4U9C A;  4QGV A;  1TVQ A;  4GGZ A;  3OBL A;  4JGL A;  2AMM X;  4LQZ A;  4CPH B;  5D48 A;  1LIB A;  2JU8 A;  2FR3 A;  4U3Q A;  1GGL A;  2KTS A;  2N93 A;  1HQP A;  4U8U O;  2NND A;  5AQ6 A;  4L1N A;  4EQA C;  2CBR A;  3VHH A;  2NP1 A;  2AL0 X;  2RTR B;  1KT5 A;  1QY1 A;  1RSU B;  3WVM A;  1ZNH A;  4AZO A;  4YBP A;  2DJG A;  3P24 A;  4EFG A;  4M6S A;  4COT A;  1VYO A;  1SRH A;  2IZL B;  4KII A;  4NLJ A;  2A2U A;  3CBC A;  1E2T A;  4GNW A;  4XMF A;  1SWR A;  2OVS A;  4Z2P A;  2PI3 O;  1KL3 A;  3KFG A;  5BVT A;  2JGS A;  2WEW A;  1VPR A;  4Y0S A;  1KL4 A;  5F2B A;  4ARH A;  5KHP A;  3HOL A;  4OMW A;  3C78 X;  4BX5 A;  5CHK A;  5K06 A;  2BLG A;  3PH6 A;  2HKD A;  4ODD A;  5D47 A;  2Q2M A;  5D8J A;  1G5W A;  4Z27 A;  3CKG A;  2RTH B;  3WYQ A;  1QFT A;  3PDF A;  4PJ2 A;  3SAO A;  3RDS A;  1QG5 A;  3NP1 A;  2WEX A;  3I0A A;  4DQ3 A;  4GKC A;  4HPA A;  2Q2P A;  5H8T A;  2RTO B;  1LUQ A;  2QO4 A;  3ZUI A;  1YIV A;  2FR2 A;  5HZ6 A;  3Q34 A;  2ALL X;  5HWZ A;  4NV8 A;  1KGL A;  3V8U A;  3KQ0 A;  4A60 A;  5DG4 A;  3NR3 A;  4UU3 A;  3O19 A;  1VWP B;  3SLJ A;  4OEL A;  2X46 A;  4Y0P A;  1MDC A;  3KVN A;  4IB6 A;  1X8Q A;  1SXY A;  2DJF A;  3BRN A;  3CQN A;  1PMP A;  4MVK A;  1G74 A;  2IZC B;  3CMP A;  1SXX A;  4I9R A;  4TNN A;  2WUT A;  4O4U A;  4XMD A;  1VWN B;  5HAE A;  3KZA A;  3SZJ A;  3WXQ A;  1QAB E;  3NX2 A;  1PTS A;  2WSJ A;  3VG7 A;  1D3S A;  1MK5 A;  1I06 A;  1MUP A;  1VWA B;  1EPA A;  1JQP A;  4XME A;  2RTF B;  1VWD B;  4D6B A;  2AF5 A;  1A3Y A;  1EW3 A;  1SLG B;  2W2F A;  3EM0 A;  2M4L A;  2BS5 A;  1JIW I;  4IRW A;  1SWJ A;  1S44 A;  3KFF A;  3ZW1 B;  2RN4 A;  1T0V A;  2L68 A;  2RTJ A;  3QQ2 A;  4O4O A;  2XKL A;  3RDQ A;  5C0N A;  3TGB A;  1B4M A;  3RKG A;  4CPI A;  1SLE B;  5FQ8 E;  2X55 A;  2GTF X;  1HBQ A;  3P6H A;  3SZH A;  1X8U A;  1G85 A;  2A8G A;  2DM5 A;  3STM X;  1ERB A;  4QZU A;  3SLT A;  3LHN A;  1XCA A;  3X00 A;  4RUU A;  1OPB A;  5HCC C;  1GX9 A;  4GGR A;  4FBR A;  1SRJ A;  1YWC A;  2VFC A;  2GH7 A;  2OZQ A;  4ORX A;  1YP6 A;  1A18 A;  3EC5 A;  4O4S A;  4D6A A;  4OS3 A;  1MM9 A;  1SY1 A;  1Y0G A;  1AVD A;  2RA6 A;  4GGT A;  4OEM A;  1N9M A;  3P6D A;  2HZQ A;  3MVF A;  2LA7 A;  1GX8 A;  1NGL A;  2FTB A;  4IAB A;  1MOY A;  4TJZ A;  1SWF A;  2OF8 A;  3BU1 A;  1GX3 A;  5B2A O;  2LFO A;  4JNJ A;  5FAZ A;  3PQS A;  3P02 A;  4CSB A;  5LJD A;  1K24 A;  1VWG B;  1VWF B;  2BS6 A;  4IB7 A;  1OEK A;  1B8E A;  2MM3 A;  2FHN X;  3FA8 A;  5EZ2 A;  2QM9 A;  4GE1 A;  2I5Z O;  1JBH A;  1Y55 X;  2RTL A;  4Y0Q A;  3MG5 A;  3OD9 A;  4NYR A;  3BU9 A;  3FR5 A;  1XKI A;  3BSZ E;  2FT9 A;  4A1Y A;  2G78 A;  2X4M A;  1JJU A;  3FR4 A;  1T8V A;  4GH7 A;  1SRF A;  3H3I A;  3RDM A;  1DZK A;  1WUB A;  2A5C A;  3BLG A;  3QKG A;  5FQ6 E;  3AUM O;  1OEJ A;  4OKA A;  1ZNK A;  1H91 A;  1X8N A;  4DCB A;  4EEJ A;  2OY1 O;  4U46 A;  1SMP I;  4N7C A;  3WOV A;  3APU A;  1DV9 A;  4Y59 A;  2A0A A;  2ZSC A;  2ANS A;  3ZI8 A;  1BEB A;  5B5F A;  3RSW A;  1LDQ A;  2LBA A;  2P8G A;  3E3C A;  4YFP A;  3VG2 A;  1SWO A;  4N7D A;  4OS0 A;  4YCE A;  4ZFX A;  1N9Y A;  1SA8 A;  1SXW A;  5EED A;  3FIQ A;  1FEL A;  1VWQ B;  3FDC A;  3WJF A;  3RY2 A;  5LJH A;  2RTK A;  3VHM A;  3U0D A;  3FEK A;  5HTE A;  1HMR A;  2X32 A;  4AYH A;  2RTC B;  4XMG A;  2HMB A;  1MVG A;  2L5P A;  2C1S A;  1TOU A;  2KD2 A;  2X8T A;  4O4X A;  3EYC A;  2OL7 A;  4BBO A;  1KOI A;  3AEH A;  4BX7 B;  4CPF A;  1BM5 A;  2I5V O;  1KT4 A;  4I3D A;  5LJC A;  2MF6 A;  4MVL A;  5HZQ A;  1LCZ A;  2AH7 X;  1PBY A;  4ZHF A;  5HCD C;  5CE4 A;  1SWG A;  2HZR A;  1KT7 A;  1STR B;  2RTI B;  3HWF A;  4IMO A;  1GM6 A;  3WJC A;  4R0B A;  1FE3 A;  1Z24 A;  4GDA A;  4CDD A;  4MVI A;  1ZND A;  3STK A;  4KCA A;  2LBV A;  4NLI A;  1BSQ A;  1JYD A; 
#chains in the Genus database with same CATH homology
 4I95 A;  4WHI A;  2OVD A;  2RQ0 A;  1GXA A;  4GU8 A;  4TLJ A;  3RBY A;  3F6Z B;  5BVQ A;  3FW4 A;  4AZR A;  2GTL N;  5LJE A;  3GE2 A;  1PM1 X;  4YCH A;  5H9A A;  3HWG A;  2AT5 X;  1ICM A;  1A2D A;  1EPB A;  3I17 A;  3NX1 A;  4GZV A;  4ZGF A;  4FQB B;  2Q9S A;  4LZU A;  3FA7 A;  3FEL A;  1EUO A;  1AB0 A;  5FFH A;  2GTL O;  4AZP A;  3NQ9 A;  1N0S A;  1KZX A;  5BVS A;  1FDQ A;  3B2L A;  4ZR2 A;  1KQX A;  5L8N A;  1IW2 A;  3ZUO A;  3DTQ A;  5D45 A;  1P6P A;  2KW1 A;  4QYN A;  4YKO A;  1BRP A;  4KC8 A;  3B2H A;  4U8U M;  1LIE A;  3BX8 A;  5LKF A;  1CBS A;  1DZP A;  4BOE A;  5CYB A;  2BHV A;  1QFV A;  5EEE A;  4ZHH A;  3VPJ E;  2KT4 B;  4INN A;  1BLR A;  1GT5 A;  1I4U A;  3K3L A;  1CBI A;  4KH8 A;  4AW8 A;  5HZ8 A;  3C77 X;  1Y9T A;  4DQ4 A;  4ZHD A;  4GDZ A;  2AT8 X;  1DFV A;  1OPA A;  1MX7 A;  3UEX A;  3WBG A;  3LV4 A;  2FS7 A;  4EXZ A;  2CZU A;  4ZH6 A;  3G7X A;  1LNM A;  2HYS A;  4HPD A;  4I3C A;  4WBK A;  5F1E A;  1YP7 A;  2MWH A;  4ID2 A;  4NP1 A;  3JSQ A;  3TGC A;  4ML7 B;  4LKP A;  2OVE A;  3F9D A;  1ZNG A;  1I05 A;  4NNT A;  4AZQ A;  3VG3 A;  3FEN A;  4I6S A;  3UAQ A;  1LID A;  4YGG A;  5IO5 A;  4QGW A;  4TKB A;  2O62 A;  4GET A;  1EXS A;  3T1D A;  3UEV A;  2E4J A;  4TKJ A;  3ZW0 A;  3TGB A;  3B2J A;  3FYF A;  4YH0 A;  5EPQ A;  4O3W A;  1E00 A;  3PH5 A;  3DSZ A;  3VU1 A;  5KIC A;  3P6C A;  4QQ1 A;  2G79 A;  2JW1 A;  4ZHG A;  2K23 A;  1QQS A;  2KTD A;  4K19 A;  4NYQ A;  3O2Y A;  4ORR A;  3FEP A;  1ZNL A;  3EBK A;  3CR6 A;  5DPQ A;  5LJB A;  2XST A;  2CM9 A;  1E06 A;  2JU3 A;  4QZT A;  1FTP A;  3APX A;  4LZV A;  4XMH A;  1GT4 A;  1S2P A;  3Q6L A;  3VG6 A;  3PQU A;  3OE3 A;  2PY1 A;  3S5X A;  3OJY C;  2R73 A;  1UZ2 X;  4O3Y A;  4YFQ A;  1KT6 A;  2RCT A;  5H9L A;  1OBP A;  4YKM A;  3APV A;  4UU2 A;  1A57 A;  3PP6 A;  1BBP A;  2YG2 A;  1ZRY A;  3ZW1 A;  1L6M A;  4MIS A;  4QAE A;  4I3B A;  4AZM A;  4EDE A;  3U03 A;  4M7M A;  2CZT A;  1BSY A;  4PSQ A;  3NAD A;  1IKJ A;  1KT3 A;  3JS1 A;  4I9S A;  4O49 A;  2G7B A;  5HZ5 A;  3HK1 A;  3PPT A;  1LIC A;  1PBO A;  3PED A;  5B29 A;  4ORU A;  1OBQ A;  4CK4 A;  1AQB A;  2W2A A;  4ES7 A;  4KT5 A;  3IA8 A;  3ZW2 A;  2JN3 A;  1QWD A;  1D2U A;  2X8S A;  3D97 A;  1SY2 A;  1KXO A;  1R0U A;  4RUN A;  3VG4 A;  4HPC A;  2QMI A;  4TQ2 A;  2FS6 A;  1X8O A;  1X71 A;  4Y0R A;  5IO7 A;  3N91 A;  4HPB A;  4NW4 A;  2MO5 A;  4IB8 A;  1QY2 A;  1U17 A;  4YDA A;  1GT1 A;  4QRL A;  1KQW A;  1CRB A;  2FLJ A;  3HOE A;  4ZH9 A;  5AJC A;  2FWV A;  5HA1 A;  5H9K A;  1NP4 A;  1RLB E;  1RBP A;  2OFM X;  4O3X B;  4QYP A;  2QO5 A;  1HBP A;  3FA9 A;  1QY0 A;  3RZY A;  5HA0 A;  3NQ3 A;  5L8I A;  3WJB A;  4FGI B;  5FEN A;  1TOW A;  4YGH A;  4ZJ0 A;  5F6Z A;  5LKE A;  4YFR A;  1DZM A;  2MJI A;  4OS8 A;  2ASN X;  1IKE A;  2CM4 A;  3BS2 A;  4HWM A;  1VYF A;  4MIR A;  4BQU A;  3HWE A;  3WJE A;  1X89 A;  3S5V A;  3C76 X;  4YMY A;  2QO6 A;  2WQA E;  3B2I A;  2ZAG A;  3U9P C;  2JMB A;  1FEN A;  4AZN A;  2QOS C;  1ACD A;  3AKM A;  1LKE A;  4GNY A;  3NBX X;  1BWY A;  3CBS A;  1GKA A;  3KFH A;  3NPO A;  4IBA A;  3BDR A;  2X45 A;  3FA6 A;  4FBV A;  3VG2 A;  3BY0 A;  1JV4 A;  3B2K A;  1JYJ A;  3ZQ3 A;  3L4R A;  2AT3 X;  2IFB A;  3P6G A;  4ON1 A;  1ERX A;  4MVE A;  4QGX A;  2AT0 X;  1IFB A;  1ZNE A;  3ZZV A;  5HBS A;  3KFI A;  3P6F A;  4BVM A;  3EBW A;  1LF7 A;  3IFB A;  3ZW0 B;  4XMC A;  1EAL A;  3WJG A;  2RD7 C;  5F58 A;  1HMT A;  2R74 A;  3TGA A;  1BSO A;  1YWA A;  2OFR X;  1AVG I;  1U18 A;  2CBS A;  2WWP A;  3BX7 A;  4O9S A;  3ELZ A;  2GTL M;  4ORS A;  1U0X A;  2WQ9 A;  3D4R A;  1E5P A;  5L8O A;  4ALO A;  4ZGU A;  2A3F X;  1ADL A;  1B56 A;  1G7N A;  5EDC A;  2AKQ A;  2A2G A;  1DZJ A;  2NNQ A;  1IFC A;  1T68 X;  1BRQ A;  3FW5 A;  4HFO A;  5F6B A;  3APW A;  4GRJ A;  5B27 A;  3STN A;  1TW4 A;  1ML7 A;  2YMS A;  2Z4H A;  5JR8 A;  3GAQ A;  1IIU A;  2Q4N A;  4YDB A;  1HN2 A;  4YBU A;  4GK9 A;  2MHD A;  3FR2 A;  4NNS A;  4WFU A;  1JJJ A;  5FQ7 E;  1LPJ A;  2L9C A;  2JU7 A;  1JJX A;  1E02 A;  1EII A;  1EI5 A;  1OEE A;  3F8A A;  4IMN A;  1O1V A;  2Q39 A;  3RWX A;  2POA A;  4L3R A;  4TKH A;  4IAX A;  2WR6 A;  3CWK A;  4ORY A;  5KID A;  3MX7 A;  1YUP A;  4OMX A;  2ACP X;  3HWD A;  2K62 A;  5AJB A;  1EQD A;  3S60 A;  2HNX A;  2W2B A;  4O3Z A;  4ORW A;  3D96 A;  5AEO A;  2EU7 X;  4LKT A;  5BYP A;  1JZU A;  1DF3 A;  1ALB A;  1FEM A;  3TF6 A;  4A1H A;  4CV7 A;  1CJ5 A;  2F09 A;  2AT6 X;  3ELX A;  5HZ9 A;  1MX8 A;  1KZW A;  1CBR A;  5HCE C;  1PEE A;  5D4A A;  1AEL A;  4IB9 A;  2LB6 A;  3NQK A;  1Y9L A;  4IAW A;  1ICN A;  3HTY A;  1LFO A;  1X8P A;  1TXL A;  2HLV A;  3AKN A;  2A13 A;  5F7G A;  4FBO A;  2BT9 A;  3UEW A;  1S7D A;  1CBQ A;  5EDB A;  1EIO A;  2OVA A;  1VYG A;  3CQR A;  3VG5 A;  1SXU A;  1YWB A;  2R56 A;  4ALB A;  1GT3 A;  1SY3 A;  3D95 A;  2RCQ A;  3VE1 A;  3SOT A;  3TZS A;  1OBU A;  1URE A;  5IO6 A;  1HMS A;  2JOZ A;  4YGZ A;  3MBT A;  1YWD A;  2ZAI A;  1O8V A;  3O22 A;  3FMZ A;  1LIF A;  1NP1 A;  2L67 A;  2GC9 A;  3EMM A;  4WFV A;  3ZWE A;  3VE2 A;  1DC9 A;  5LJG A;  2GJ5 A;  3S26 A;  3JQO A;  3PEC A;  1BJ7 A;  2NNE A;  3P6E A;  1SY0 A;  4KC7 A;  5HTD A;  2Z4I A;  3FLL A;  4ZHC A;  5LJK A;  2F73 A;  5H9N A;  2FRS A;  1GKA B;  4QNI A;  4A8Z A;  4ZCB A;  3UEU A;  2ACO A;  4U8U N;  1B0O A;  1I04 A;  2LKK A;  1O1U A;  2X8F A;  4U9C A;  4QGV A;  1TVQ A;  3OBL A;  4JGL A;  2AMM X;  4LQZ A;  5D48 A;  1LIB A;  2JU8 A;  2FR3 A;  4U3Q A;  1GGL A;  2KTS A;  2N93 A;  1HQP A;  4U8U O;  2NND A;  5AQ6 A;  4L1N A;  4EQA C;  2CBR A;  2NP1 A;  2AL0 X;  4YBP A;  1KT5 A;  1QY1 A;  4AZO A;  3WVM A;  1ZNH A;  3P24 A;  4EFG A;  4M6S A;  4COT A;  4KII A;  4NLJ A;  2A2U A;  3CBC A;  4GNW A;  4XMF A;  2OVS A;  3KFG A;  5BVT A;  2WEW A;  1VPR A;  4Y0S A;  4ARH A;  5KHP A;  3HOL A;  4OMW A;  3C78 X;  5K06 A;  2BLG A;  3PH6 A;  4ODD A;  5D47 A;  2Q2M A;  5D8J A;  1G5W A;  1QFT A;  4PJ2 A;  3SAO A;  1QG5 A;  3NP1 A;  2WEX A;  3I0A A;  4DQ3 A;  4GKC A;  4HPA A;  2Q2P A;  5H8T A;  3ZUI A;  2QO4 A;  1YIV A;  2FR2 A;  5HZ6 A;  2ALL X;  5HWZ A;  1KGL A;  3V8U A;  3KQ0 A;  4A60 A;  5DG4 A;  3NR3 A;  4UU3 A;  3O19 A;  2X46 A;  4Y0P A;  1MDC A;  4IB6 A;  1X8Q A;  1SXY A;  3BRN A;  3CQN A;  1PMP A;  4MVK A;  1G74 A;  3CMP A;  1SXX A;  4I9R A;  4TNN A;  2WUT A;  4O4U A;  4XMD A;  5HAE A;  3KZA A;  3WXQ A;  1QAB E;  3NX2 A;  2WSJ A;  3VG7 A;  1D3S A;  1I06 A;  1MUP A;  4XME A;  1EPA A;  4D6B A;  1A3Y A;  1EW3 A;  2W2F A;  3EM0 A;  2M4L A;  2BS5 A;  1JIW I;  1S44 A;  3KFF A;  3ZW1 B;  2RN4 A;  1T0V A;  2L68 A;  4O4O A;  1B4M A;  2XKL A;  5C0N A;  3RKG A;  5FQ8 E;  2GTF X;  1HBQ A;  3P6H A;  1X8U A;  1G85 A;  2DM5 A;  3STM X;  1ERB A;  4QZU A;  3LHN A;  1XCA A;  5HCC C;  4RUU A;  1OPB A;  1GX9 A;  4FBR A;  1YWC A;  4ORX A;  2OZQ A;  1YP6 A;  1A18 A;  4O4S A;  4D6A A;  4OS3 A;  2RA6 A;  1SY1 A;  3P6D A;  2HZQ A;  3MVF A;  2LA7 A;  1GX8 A;  1NGL A;  2FTB A;  4IAB A;  4TJZ A;  3BU1 A;  2LFO A;  5FAZ A;  3PQS A;  3P02 A;  4CSB A;  5LJD A;  2BS6 A;  4IB7 A;  1OEK A;  1B8E A;  2MM3 A;  3FA8 A;  5EZ2 A;  2QM9 A;  4GE1 A;  1JBH A;  4Y0Q A;  3OD9 A;  4NYR A;  3BU9 A;  3FR5 A;  1XKI A;  3BSZ E;  2FT9 A;  4A1Y A;  2G78 A;  3FR4 A;  1T8V A;  4GH7 A;  3H3I A;  1DZK A;  3BLG A;  3QKG A;  5FQ6 E;  1OEJ A;  1ZNK A;  1H91 A;  1X8N A;  4EEJ A;  1SMP I;  4N7C A;  3WOV A;  3APU A;  1DV9 A;  2A0A A;  2ANS A;  3ZI8 A;  1BEB A;  3RSW A;  2P8G A;  2LBA A;  3E3C A;  4YFP A;  4OS0 A;  4N7D A;  4YCE A;  4ZFX A;  1SA8 A;  1SXW A;  5EED A;  3WJF A;  3FIQ A;  1FEL A;  3WJD A;  5LJH A;  3U0D A;  3FEK A;  5HTE A;  1HMR A;  4AYH A;  4XMG A;  2HMB A;  1MVG A;  2L5P A;  1TOU A;  2KD2 A;  2X8T A;  4O4X A;  3EYC A;  1KOI A;  1BM5 A;  4I3D A;  1KT4 A;  5LJC A;  4MVL A;  2AH7 X;  5HZQ A;  4ZHF A;  5HCD C;  5CE4 A;  2HZR A;  1KT7 A;  4IMO A;  3HWF A;  1GM6 A;  3WJC A;  4R0B A;  1FE3 A;  1Z24 A;  4MVI A;  1ZND A;  3STK A;  4KCA A;  2LBV A;  4NLI A;  1BSQ A;  1JYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...