4U8VD

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB
total genus 53
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u8vD00
1OY3D 3LJNA 1MYOA 3B95A 3JXIA 4ZFHA 5CERB 3JUEA 4U96D 2A5EA 1MX2A 5EN5D 4A63B 5AAOA 4GMRA 2AJAA 3ZU7B 3KEAA 5ENSD 1S70B 5JA4D 4DX7D 3V2OA 2ZGGA 1BI7B 3TWSA 3TWWA 4ZHBA 1QYMA 4YDYA 5BXUA 3Q9UC 4NIKA 3NOCD 3UI2A 2F8YA 3EHRA 4K5AB 5HRYA 4DUIA 5EIDA 3D9HA 3J5PA 2RFAA 4JB8P 4O1PA 5HS0A 4ATZD 4LNUD 4O60A 5EILA 4HI8A 4CYMD 4F6RD 5BXOA 2DWZA 4HRLA 1N0RA 1OT8A 2B0OE 5AARA 2P2CP 2XENA 2V4HC 2BKGA 4HRNA 4U95D 5AQAA 2JABA 3SO8A 5CECB 4LG6A 5HKPA 3TWTA 1IXVA 1YCSB 3F6QA 1BD8A 4N5QA 1MJ0A 4DX1A 5KBAA 5AN8A 2ZGDA 3TWXA 4CZ2D 2RFMA 4Z68A 2ETCA 3EHQA 5AQBA 5KNHD 3TWUA 3V30A 3ZKJA 1K3ZD 3C5RA 5D66A 3HRAA 3DEPA 3EU9A 4YDWA 1MX4A 4LSZE 1IKND 2DZNA 3T8KA 5ENOD 4BETA 3V2XA 4G8LA 5KNGA 2ETBA 1D9SA 5AQ9A 1UOHA 3V31A 4B93B 1SW6A 5CEDB 2VGEA 2XZDG 4BEPA 1NFIE 4DRXE 4UUCA 4HQDA 1SVXA 1DC2A 1IHBA 4DX2A 4RLYA 3JXJA 3B7BA 5ENPD 4BESA 5CBNA 2BKKB 2L6BA 1BU9A 3IXEA 2Y1LE 1DCQA 4K5CA 5CBOA 1K1BA 4HI9A 5FINA 5AQ7A 2F37A 3TWVA 5EYLA 5EIBE 2ETAA 1BI8B 3ZUVB 4DX5D 4OAUC 4TUMA 1WDYA 3W9FA 4OAVB 3W9GA 2PNNA 4C48B 2KXPC 1BLXB 4QQIA 2QYJA 4HBDA 5ITZF 1N0QA 5JMND 4J7WA 2XEEA 2MYOA 4U8YD 2DVWA 3Q9NC 4DX6D 2XEHA 2NYJA 3AAAC 4K5BA 3UXGA 3TWRA 2Y0BG 3T9KA 3NOGD 3J5QB 3NBNB 4HB5A 3HG0D 5KWDA 4U8VD 2FO1E 1MX6A 2KBXA 3TWQA 1N11A 4G8KA 5FIOA 1WG0A 4HLLA 1A5EA 2XZTG 4GPMA 1AWCB 2J8SD 2F8XK 2QC9A 5ENRD 2DZOA 4QFVA 1TR4A 3DEOA 3V79K 3AJIA 4HNAD 5ENQD 4BSZB 1G3NB 4HRMB 1K1AA 4O1OA 5EYPF 1AP7A 5ENTD 4F1PA 3UTMA 1YMPA 3ZNGA 2HE0A 5CEAA 2V5QC 4J8YA 1YYHA 4BERA
chains in the Genus database with same CATH superfamily
2WVIA 3PZ4A 5CERB 2CHWA 2J4BA 4DPRA 1H2UA 2J07A 2AVPA 3HIZA 4JC8A 4O60A 4A3TA 5J90A 3RJVA 2DIWA 3SNXA 3DPDA 4BWRA 3FDHA 3Q73A 4EZLA 3TGOA 2LAHA 4Q94A 4CZ2D 4HORA 5EDSA 2L0TB 4KXKB 3C5RA 2ZISA 3ASDA 4ANWA 4YDOA 3T8KA 2DZNA 3UMVA 4BETA 5AQ9A 3LVRE 4U63A 4GTVA 1NFIE 4NRHB 4UI9J 3MZLB 4WWOA 2FI7A 2JEKA 3I4RB 4ABNA 3P2BA 3CKCA 4GZ3A 4TRQA 1KPSB 4HLEA 4HI9A 5EYLA 3PNTB 4J8FA 1YA0A 3ENEA 2E0IA 3E4BA 4OAVB 2IY0C 3RIBA 1JCRA 3EHMA 3X2QE 2CFZA 3T9KA 3DSTA 3JQ1A 3IKOB 1N95A 3CHMA 4PH4B 3JYSA 5T8IA 3KAEA 3FUDA 3LPZA 3LKUA 1Y6IA 5CEAA 1PY1A 4XX5A 3U64A 4Y6CA 3B95A 3JUEA 5AAOA 2JLBA 4JVSA 2XEVA 3B7RL 3U3WA 4ZHBA 1FVFA 4G24A 1N0RA 1QBQA 4CRWA 2V4HC 4U07A 2CFUA 4N5QA 1BD8A 3FH8A 4FJZA 1UG3A 4MLPA 3L54A 3G2TA 3E34A 4L2YA 2YNQA 4MS6A 2J4DA 1UN8A 3L16A 1MHQA 5B1AE 3FEXA 4HOQA 4I9EA 4GU5A 2QZAA 2XQ0A 2VGXB 2KZTA 4K03A 2UWJG 3ZHEA 4CEMA 4GA2A 2WQ6A 4AXHA 3KEZA 3MV3B 1DCQA 2WXMA 3LDZA 2X3MA 3E30A 1WDYA 3CHOA 1LD7A 4PS7A 4L1BA 4J7WA 3BU8A 2Y0BG 4Q96A 3CV0A 3J5QB 3R7QA 5FTPA 1MX6A 4FHKA 4G23A 5BNWA 3FTXA 3ASOE 3EU5A 2HR2A 3LY8A 3AJIA 1ELKA 4UI9K 5FQ7A 3DSXA 3AG1E 2R17C 1MYOA 2H6HA 3UKUG 4MRUA 1IQUA 4BTBA 2A5EA 3ASHA 4APOA 4BT8A 2IF4A 2WM9A 1S70B 4IYPA 3ONKA 4GTTA 3NZSA 5HRYA 2RFAA 3LCAA 4O1PA 1D8EA 4HRLA 5E75A 3ZIMA 1E8XA 1Z6TA 3U4TA 3UUXA 4B0ZA 1LTXA 5EKQD 1XNFA 5AN8A 3TWXA 3ZEFA 1N54A 3ZXSA 3CGHA 3U9WA 2ETCA 3L08A 3O4ZA 1MX4A 2GRMA 3OXGA 4KVOA 3ZGQA 4ATGA 1H2VC 4I1OB 3VTYA 1NP7A 2DYSE 5BV0A 1OXJA 3PZDA 1Q2ZA 1H6PA 3B7BA 4LRZA 4BESA 4I6GA 4M3OA 3IXEA 5EX0A 5FINA 4CDMA 1ZBPA 2Y4UA 4EQFA 4F3VA 3MGBA 3SD5A 3RU0A 4TV3A 3PS6A 4AY6A 3TWQA 5JHAA 1S63A 3RK6A 4B94A 2I9CA 2LXMA 4BY6A 4HNAD 2WXGA 5ENQD 2WXRA 5D2MC 3G2VA 4FHJA 1HF8A 3PZ2A 4U96D 2VSYA 1BI7B 1X5BA 4U8HA 4N39A 3R9MA 3ZPJA 2B0OE 2GGFA 4YVOA 1MZCA 4FLHA 4CCAA 5LOZA 5CECB 3CK9A 5KCMA 2RFMA 3QOUA 3FTVA 1KZOA 3ZXPA 2R05A 2ONDA 4YDWA 1JCQA 2BF0X 2MOWA 2EIJE 4JW1A 3ZYKA 2PZIA 2Y4TA 1OWOA 3QWWA 3ZN3A 3PE4A 2FEZA 3AG2E 4FJYA 5G05J 2AXUA 3D3MA 4DX2A 4GCNA 5M72A 2L6BA 3CSFA 3S7DA 4KMOA 3PH0C 5CHEE 5EIBE 1HH8A 3UINC 4GTRA 4FP7A 4M7CA 1NA3A 3Q9NC 2DYRE 4L23A 4G26A 2R5SA 3CK7A 2E2EA 4HLLA 4A1GA 4ACKA 4AY5A 3TG4A 2DZOA 2QYUA 4EECA 3PRZA 4F1PA 2X6IA 3DPYA 3DSSA 3ZNGA 1TN7A 3MKRA 3LYAA 4HOSA 2PQRA 3CVUA 5ENSD 1N52A 1H6KA 3NOCD 5EIDA 4CYMD 5BXOA 3ABKE 1S0PA 4JEUA 3QAQA 2R59A 4XZ4A 3PE3A 2R2LA 1NL4A 5AQBA 4PUCA 4FU3A 3HXDA 3CHQA 5D66A 1TEZA 2CHZA 3FUJA 1MQSA 1SA5A 4MBGA 1QNFA 4APFA 2WXFA 1KT0A 2X6JA 2OVBA 3C3RA 3D9OA 2KM4A 3MCXA 2UY1B 3FTYA 1JWGA 3FY4A 3CVWA 5E76A 4KT6B 3UIPC 4URKA 5KJKA 3TL5A 2XRYA 4I2ZA 3TWVA 1BI8B 4OAUC 2L9BA 3FTSA 1TNUA 3PZ1A 3W9FA 2YQ8A 4G25A 4H7YA 4I9CA 3DSWA 3TG5A 2RKKA 3ZYLA 3QB2A 2WXJA 5B1BE 1HE8A 3UQ3A 5FIOA 2I1KA 1O5MA 3Q15A 3S2AA 2XHEA 4N3CA 3MKQA 2VYIA 4W9RA 2HO1A 3C3OA 2GRRB 5CCMA 4WUYA 3FUEA 3DWLG 1O1TA 3JXIA 3K9IA 2HM8A 4HOTA 4G11A 3CEQA 1Y8MA 4GAAA 3IEGA 2RG8A 2LNIA 3TWSA 1QYMA 4GA1A 2GROB 3BEEA 3HXFA 2F8YA 2KATA 4JB8P 2IEJA 5AARA 5EX3A 2WXOA 2PM7A 2JABA 4F1SA 1YCSB 3F6QA 1FT2A 4J6IA 5A6CA 1KLXA 3TWUA 3KSLA 1EF1C 5KJLA 3Q47B 3CVQA 4AVXA 5ANRA 4EBAG 4BEPA 2KCKA 3SFYA 3Q79A 1SVXA 1Z3YA 4O6FA 1HXIA 5ENPD 4HS2A 1BU9A 1LD8A 2CG3A 5G2NA 3AS8A 3G2WA 3ZUVB 3RO3A 4LCTA 4N2SA 2DVWA 3ZFWA 2WXLA 5B3SE 1PC2A 1OWPA 3DRAA 3LS8A 4HB5A 3T5VA 1N11A 1A5EA 2MRIA 2QFCA 3E33A 4HXIA 4O1OA 3FU0A 3UTMA 4G2VA 2WXPA 5CMYA 3MA5A 4K5AB 5LCWC 4ANVA 5BT1A 3UM2A 4UWFA 3ML9A 2LUHA 3KEAA 1TNBA 4U0UA 3DBSA 2ZU6B 2GRQB 3AG4E 1HO8A 1SZ9A 3MJWA 3D9HA 3J5PA 5EILA 3CQCB 2DWZA 1SA4A 3NB2A 4AJWA 4LERA 1OCRE 5KJNA 2NC9A 2M63A 4DX1A 1N4RA 3C3QA 2Y69E 3CHRA 4JPSA 3P1UA 2Q7FA 1HS6A 5H7PA 4AV7A 1OWMA 4G8LA 5KNGA 2EIME 2CG2A 2EINE 2X6HA 4XEIG 1U3DA 4N5CA 2ZIRA 1DC2A 4BTAA 2BEDA 1OCOE 2V4LA 2XGSA 4FA6A 2Y1LE 3SHFA 2PM6A 4UWGA 4OYSA 1Z3XA 1O1RA 4U8YD 4J8DA 2XGOA 4RG6A 3HVEB 4N3AA 1BPOA 1IHGA 3PREA 3CVLA 2J8SD 1K8KG 2QC9A 3EUVA 3HXEA 2IU1A 4UQXA 1WAO1 1NI1A 3HHMA 3B7TA 4ZFHA 3S7FA 3L22A 4DI4A 4B89A 5DIZA 3FUHA 2LSUA 5JA4D 4DX7D 3V2OA 4TXRA 4DJAA 5A7DB 3QC1A 4PS3A 3Q9UC 2IFUA 3PZ3A 4U04A 1NZNA 3PEVB 1TN8A 1UN9A 4E85A 1TNZA 2X6KA 3APCA 2GRLA 4U95D 4FC8A 3CHSA 4KZ0A 2P9KG 3TWTA 1H2TC 4V3IA 3JUIA 3IHYA 4R7LA 2VSOE 1TNYA 5ENNA 1TYQG 4LSZE 3HVEA 3FUKA 3BQOA 1EDUA 2VGEA 4C9BB 4FULA 4DLOA 2X6FA 3Q4AB 4HQDA 3VLEA 1N4QA 2H6GA 2R03A 3PUKA 1TN6A 4G1TA 2MHKA 4GZCA 3FHEA 2PNNA 3CR3A 4RQIA 1N0QA 4K5BA 3CSTA 3UX4A 3HG0D 3I5PA 4IRUA 4EPZA 2LO6A 3T8MA 2IQCA 4WNFA 1D8DA 1QQEA 3KSQA 4C0MA 4E6HA 2OOEA 4UWHA 5FJYA 3UKRG 3DSVA 1YYHA 5LFAA 2EILE 3LJNA 4GYOA 3UIOC 2BUGA 2IO2C 1QZ2A 2AJAA 2WQ7A 3FUNA 2WQHA 3LEWA 4YVQC 3SFXA 1XGWA 3QWPA 4GTQA 3D9NA 2P9NG 1IXVA 5KBAA 1OCZE 2XPIA 3EHQA 4XKBA 3FP3A 1D9SA 3SFZA 4RSYA 4UQZA 2XZDG 2WXHA 3D9JA 4OVVA 4LUNU 4RLYA 2XGMA 4CDRA 5DBKA 5CBNA 3SBSA 3Q49B 1X81A 3EDTB 4J8EA 4XE0A 4JA9A 1K1BA 3PUJA 3UT7A 2VTBB 4AIFA 1HZ4A 1BLXB 3GW4A 2AWIA 2XEHA 3AAAC 3G2UA 4WNGA 1H6OA 3GZ1A 3B7UX 4G8KA 2DBAA 5J08A 2KCLA 4A55A 2F8XK 2X38A 4BSZB 4DLQA 2XCCA 2BTDA 2IONA 2YHCA 4U0ZA 1S64A 1MX2A 3Q78A 3SI5A 5FQ6A 4KBQA 2AXZA 4GCOA 4YDYA 2WXKA 4TUUA 4ANXA 4UWKA 2P2CP 2XENA 3GZSA 3QKYA 4ANUA 4B8AA 3NF1A 2LAIA 3HXCA 4Z68A 3UM3A 3RSEG 3SBTB 5CMWA 3EU9A 3B13A 3AU4A 3FU5A 3GZ2A 3DXMG 4CDNA 2I2OA 2ETBA 4JEHA 3JCKC 3LY7A 3HYMB 5CEDB 4I1MA 3OXLA 3Q75A 3VTXA 4ME2A 3BUAA 1PAQA 3LJ3A 3MV2B 3RO2A 2IO3C 3KD7A 4P29A 3KS2A 4N2QA 4CT4A 5CBOA 1O1SA 3DSUA 5AQ7A 2UY1A 2WXNA 3CVPA 3ZHEB 3FUMA 1N4PA 1B89A 2C0LA 2QYJA 2ILRA 4HBDA 5C2YA 4RVBA 3N71A 1H19A 3CQGB 3CVYA 2H6FA 4AP2A 2OV8A 1HG5A 4AOFA 2ZXWE 4YNDA 3QJZA 3C98A 2FO7A 1W3BA 2WXIA 3TAXA 4I6JA 3UT8A 3AG3E 1HFAA 3MKQB 3AS5A 3DXKG 5ARFA 4ACLA 1E8YA 1OY3D 3ZRHA 4GZ5A 2NXPA 3UPVA 1DVPA 2F0YA 3SZ7A 3WXXA 5LCWJ 4KZCA 2DCPA 1ZB1A 1E7UA 4JHJA 3TXMA 3Q7AA 5JJTA 1A17A 4XI0A 3I4GA 3L9TA 4NURA 4ILHB 2C2LA 4PDXA 2EIKE 5BV1A 3TXNA 4CGVA 2ZGDA 3LXUX 3V30A 4H7XA 5AIJA 2GRPB 3WG7E 3HRAA 3D9LA 3E37A 3CHPA 4I43A 3CKBA 1EYHA 5BUZA 3MX3A 4JZYA 2WPVA 5JJ6A 4GZ6A 3FUIA 1E7VA 3PDNA 5T3RA 3D9KA 4EZKA 2P9IG 4FLBA 5FT9A 4IULA 4PS8A 2MYOA 3PNLB 2NYJA 2OEWA 4WAFA 2I6HA 2GW1A 2OCCE 3Q5MA 2VQ2A 1IYGA 5FZSA 4HFGA 5LX8A 3T5XA 1ELWA 3FH7A 2XCBA 5G05C 1G3NB 4L9PA 3FUFA 1YMPA 2LSVA 4RG9A 2A4ZA 3CVXA 4ILGA 1OWLA 1IQRA 2WMNA 5EN5D 4GB9A 3ZYMA 4A63B 2ZGGA 2P9SG 3EHNA 3AS4A 5BXUA 3BG1B 4N3BA 5IY5E 5G55A 1OT8A 2V0PA 2Y3AA 3OXFA 2BKGA 1N9AA 1OCCE 2GRNB 3ABME 3UM0A 3IHVA 1TNOA 1K3ZD 3VLDA 3DEPA 4UWLA 1DCEA 1JUQA 4B93B 1N4SA 2P9LG 5JHBA 1ELRA 2P9UG 4JD2G 2I1JA 4GYWA 3D9MA 4GMLA 3NQPA 3FTWA 1JCSA 4K5CA 4J8SA 2IJGX 2VGYA 3APDA 5JMND 3CK8A 3NAWA 4F7AA 4JHKA 1RW2A 3SGHA 3R7RA 3ULEG 5ENRD 4QFVA 1TR4A 3V79K 3Q7FA 3RKVA 1L5JA 2HE0A 1OWNA 2V5QC 3FULA 3FWVA 5KNHD 2XPYA 4TXPA 3O48A 2WXQA 4L2LA 3CIAA 2KC7A 4MKTA 5AJLA 1JPLA 2C0MA 4DUIA 4CGWA 4LNUD 1UJKA 4U0SA 1INZA 3UT4A 1DNPA 5JJ7A 3EJNA 2J09A 4EZJA 5G04J 4U7EB 2PL2A 1SQMA 1IKND 3V2XA 1U3CA 3UM1A 3FFLA 3V31A 1E8WA 1P5QA 3FEYA 3IV0A 3ABLE 4X8QA 4HOUA 2BKKB 1U2VG 2KCVA 5CRUA 4UQYA 4A1SA 1NA0A 4NACA 3W9GA 4C48B 2KXPC 4TXQA 5A23A 3QNKA 5ANLA 3EIJA 2XEEA 4WNEA 3UXGA 3NOGD 3NBNB 1LF8A 4U8VD 2EQXA 1H0AA 3IBEA 4LNGA 4LEUA 3GYZA 2XZTG 5G04C 4BT9A 3MYVA 2YHEA 1AP7A 3FH5A 4GMJA 5LP0A 1N94A 4JA7A 1E96B 4GTSA 4WWNA 5FQ4A 2RD0A 3ZU7B 3NZUA 2WB2A 2FULA 4GA0A 3TWWA 1HX8A 1WM5A 4NIKA 4CT0A 3ZYQA 3ZW3A 2YINA 4WNDA 3ONLA 4ILIA 4HRNA 4K0RA 5AQAA 3LY9A 4J0UA 1MJ0A 4FADA 4GPKA 3RRMB 3G2SA 2P58C 5FZQA 4JHRA 3SQVA 3D9PA 4DK5A 3L82A 5D0OD 1SW6A 4BSXA 3L13A 1OUVA 3QWVA 3U66A 4GTPA 3QARA 1IHBA 5CCLA 3QDNA 5FWQA 1HU3A 3ASFA 5AENA 5HQ8A 3ESKA 3RAUA 5D0QD 5ITZF 4XIFA 5AJDA 1E8ZA 4C0EA 4DX6D 2VTBA 5KWDA 2KBXA 5ARGA 3DEOA 2PQNA 4AM9A 1HG2A 1K1AA 1KZPA 2WMOA 3ML8A 4JL0A 5ENTD 1TJCA 4J8YA 2R02A 4HVBA 2IOLA 3RRNB 5KJMA 4LNBA 4Y6WA 2CHXA 5BW8C 3UI2A 3VLFA 3EHRA 5HS0A 4F6RD 5HI7A 4XKCA 2L0IA 4GTMA 3EIQC 3ULYA 2XRZA 4LG6A 4GTOA 4B8CB 1V54E 5CRVA 2A5UA 3ZKJA 2VGXA 3HDXA 1FPPA 5ENOD 3URZA 3APFA 3E32A 4NQ0A 3ASNE 3FTUA 3R9AB 4DRXE 4L7TA 4UUCA 3CVVA 4D10C 4GZDA 3JXJA 2H6IA 3I3NA 3S7BA 4F53A 3ULQA 2ETAA 2OVFA 4TUMA 2J9QA 2XPZA 1V55E 2AW6A 5T4YA 4QQIA 4KYOB 5FZRA 3OTNA 3HXBA 2P9PG 3ISMC 2OEVA 4I17A 3BG0B 3C72A 2FBNA 3OAWA 3QK0A 4EBAA 4GPMA 5FQ8A 1FVHA 5C1DA 4KVMA 4HRMB 2VSNA 2VJ8A 2HYZA 3CLJA 2B6CA 1E90A 2J49A 3PVLA 3TJPA 1ZU2A 2V8SE 4EHMA 4GMRA 2V5FA 4I1AA 3CVNA 3AU5A 3ESLA 3L6AA 4ATZD 1UW4B 4HI8A 3ZVVA 4AEZC 1WY6A 2IOSA 4DI3A 3SO8A 5HKPA 2XS8A 2LXLA 4XI9A 4BX9A 4WWPA 4IN3B 3LVQE 4I6EA 5BPPA 3ASGA 3SY2A 1GW6A 2VSXE 1UOHA 4BX8A 2KZTB 2QY7A 1RZ4A 3S7JA 4JXTA 4BFRA 5AYWD 3FU6A 1TJFA 1SZAA 4UI9C 4YDEA 2J08A 2F37A 2L6JA 4DX5D 4OVUA 3PEUB 3RRUA 4Q69A 1KT1A 3FU3A 3L17A 2FF4A 1UJJA 2AXVA 1JWFA 3B7SA 3TWRA 3MEKA 1EPUA 3FTZA 1FCHA 2FO1E 4GYYA 1FT1A 1WG0A 1AWCB 2NSZA 4A3VA 4I2WA 3JQ0A 1Z5SC 5EYPF 2XS1A 3D9IA 1VDYA 3SF4A 4BERA
chains in the Genus database with same CATH topology
1OY3D 3LJNA 1MYOA 3B95A 3JXIA 4ZFHA 5CERB 3JUEA 4U96D 2A5EA 1MX2A 5EN5D 4A63B 5AAOA 4GMRA 2AJAA 3ZU7B 3KEAA 5ENSD 1S70B 5JA4D 4DX7D 3V2OA 2ZGGA 1BI7B 3TWSA 3TWWA 4ZHBA 1QYMA 4YDYA 5BXUA 3Q9UC 4NIKA 3NOCD 3UI2A 2F8YA 3EHRA 4K5AB 5HRYA 4DUIA 5EIDA 3D9HA 3J5PA 2RFAA 4JB8P 4O1PA 5HS0A 4ATZD 4LNUD 4O60A 5EILA 4HI8A 4CYMD 4F6RD 5BXOA 2DWZA 4HRLA 1N0RA 1OT8A 2B0OE 5AARA 2P2CP 2XENA 2V4HC 2BKGA 4HRNA 4U95D 5AQAA 2JABA 3SO8A 5CECB 4LG6A 5HKPA 3TWTA 1IXVA 1YCSB 3F6QA 1BD8A 4N5QA 1MJ0A 4DX1A 5KBAA 5AN8A 2ZGDA 3TWXA 4CZ2D 2RFMA 4Z68A 2ETCA 3EHQA 5AQBA 5KNHD 3TWUA 3V30A 3ZKJA 1K3ZD 3C5RA 5D66A 3HRAA 3DEPA 3EU9A 4YDWA 1MX4A 4LSZE 1IKND 2DZNA 3T8KA 5ENOD 4BETA 3V2XA 4G8LA 5KNGA 2ETBA 1D9SA 5AQ9A 1UOHA 3V31A 4B93B 1SW6A 5CEDB 2VGEA 2XZDG 4BEPA 1NFIE 4DRXE 4UUCA 4HQDA 1SVXA 1DC2A 1IHBA 4DX2A 4RLYA 3JXJA 3B7BA 5ENPD 4BESA 5CBNA 2BKKB 2L6BA 1BU9A 3IXEA 2Y1LE 1DCQA 4K5CA 5CBOA 1K1BA 4HI9A 5FINA 5AQ7A 2F37A 3TWVA 5EYLA 5EIBE 2ETAA 1BI8B 3ZUVB 4DX5D 4OAUC 4TUMA 1WDYA 3W9FA 4OAVB 3W9GA 2PNNA 4C48B 2KXPC 1BLXB 4QQIA 2QYJA 4HBDA 5ITZF 1N0QA 5JMND 4J7WA 2XEEA 2MYOA 4U8YD 2DVWA 3Q9NC 4DX6D 2XEHA 2NYJA 3AAAC 4K5BA 3UXGA 3TWRA 2Y0BG 3T9KA 3NOGD 3J5QB 3NBNB 4HB5A 3HG0D 5KWDA 4U8VD 2FO1E 1MX6A 2KBXA 3TWQA 1N11A 4G8KA 5FIOA 1WG0A 4HLLA 1A5EA 2XZTG 4GPMA 1AWCB 2J8SD 2F8XK 2QC9A 5ENRD 2DZOA 4QFVA 1TR4A 3DEOA 3V79K 3AJIA 4HNAD 5ENQD 4BSZB 1G3NB 4HRMB 1K1AA 4O1OA 5EYPF 1AP7A 5ENTD 4F1PA 3UTMA 1YMPA 3ZNGA 2HE0A 5CEAA 2V5QC 4J8YA 1YYHA 4BERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OY3 D;  3LJN A;  1MYO A;  3B95 A;  3JXI A;  4ZFH A;  5CER B;  3JUE A;  4U96 D;  2A5E A;  1MX2 A;  5EN5 D;  4A63 B;  5AAO A;  4GMR A;  2AJA A;  3ZU7 B;  3KEA A;  5ENS D;  1S70 B;  5JA4 D;  4DX7 D;  3V2O A;  2ZGG A;  1BI7 B;  3TWS A;  3TWW A;  4ZHB A;  1QYM A;  4YDY A;  5BXU A;  3Q9U C;  4NIK A;  3NOC D;  3UI2 A;  2F8Y A;  3EHR A;  4K5A B;  5HRY A;  4DUI A;  5EID A;  3D9H A;  3J5P A;  2RFA A;  4JB8 P;  4O1P A;  5HS0 A;  4ATZ D;  4LNU D;  4O60 A;  5EIL A;  4HI8 A;  4CYM D;  4F6R D;  5BXO A;  2DWZ A;  4HRL A;  1N0R A;  1OT8 A;  2B0O E;  5AAR A;  2P2C P;  2XEN A;  2V4H C;  2BKG A;  4HRN A;  4U95 D;  5AQA A;  2JAB A;  3SO8 A;  5CEC B;  4LG6 A;  5HKP A;  3TWT A;  1IXV A;  1YCS B;  3F6Q A;  1BD8 A;  4N5Q A;  1MJ0 A;  4DX1 A;  5KBA A;  5AN8 A;  2ZGD A;  3TWX A;  4CZ2 D;  2RFM A;  4Z68 A;  2ETC A;  3EHQ A;  5AQB A;  5KNH D;  3TWU A;  3V30 A;  3ZKJ A;  1K3Z D;  3C5R A;  5D66 A;  3HRA A;  3DEP A;  3EU9 A;  4YDW A;  1MX4 A;  4LSZ E;  1IKN D;  2DZN A;  3T8K A;  5ENO D;  4BET A;  3V2X A;  4G8L A;  5KNG A;  2ETB A;  1D9S A;  5AQ9 A;  1UOH A;  3V31 A;  4B93 B;  1SW6 A;  5CED B;  2VGE A;  2XZD G;  4BEP A;  1NFI E;  4DRX E;  4UUC A;  4HQD A;  1SVX A;  1DC2 A;  1IHB A;  4DX2 A;  4RLY A;  3JXJ A;  3B7B A;  5ENP D;  4BES A;  5CBN A;  2BKK B;  2L6B A;  1BU9 A;  3IXE A;  2Y1L E;  1DCQ A;  4K5C A;  5CBO A;  1K1B A;  4HI9 A;  5FIN A;  5AQ7 A;  2F37 A;  3TWV A;  5EYL A;  5EIB E;  2ETA A;  1BI8 B;  3ZUV B;  4DX5 D;  4OAU C;  4TUM A;  1WDY A;  3W9F A;  4OAV B;  3W9G A;  2PNN A;  4C48 B;  2KXP C;  1BLX B;  4QQI A;  2QYJ A;  4HBD A;  5ITZ F;  1N0Q A;  5JMN D;  4J7W A;  2XEE A;  2MYO A;  4U8Y D;  2DVW A;  3Q9N C;  4DX6 D;  2XEH A;  2NYJ A;  3AAA C;  4K5B A;  3UXG A;  3TWR A;  2Y0B G;  3T9K A;  3NOG D;  3J5Q B;  3NBN B;  4HB5 A;  3HG0 D;  5KWD A;  4U8V D;  2FO1 E;  1MX6 A;  2KBX A;  3TWQ A;  1N11 A;  4G8K A;  5FIO A;  1WG0 A;  4HLL A;  1A5E A;  2XZT G;  4GPM A;  1AWC B;  2J8S D;  2F8X K;  2QC9 A;  5ENR D;  2DZO A;  4QFV A;  1TR4 A;  3DEO A;  3V79 K;  3AJI A;  4HNA D;  5ENQ D;  4BSZ B;  1G3N B;  4HRM B;  1K1A A;  4O1O A;  5EYP F;  1AP7 A;  5ENT D;  4F1P A;  3UTM A;  1YMP A;  3ZNG A;  2HE0 A;  5CEA A;  2V5Q C;  4J8Y A;  1YYH A;  4BER A; 
#chains in the Genus database with same CATH topology
 2WVI A;  3PZ4 A;  5CER B;  2CHW A;  2J4B A;  4DPR A;  1H2U A;  2J07 A;  2AVP A;  3HIZ A;  4JC8 A;  4O60 A;  4A3T A;  5J90 A;  3RJV A;  2DIW A;  3SNX A;  3DPD A;  4BWR A;  3FDH A;  3Q73 A;  4EZL A;  3TGO A;  2LAH A;  4Q94 A;  4CZ2 D;  4HOR A;  5EDS A;  2L0T B;  4KXK B;  3C5R A;  2ZIS A;  3ASD A;  4ANW A;  4YDO A;  3T8K A;  2DZN A;  3UMV A;  4BET A;  5AQ9 A;  3LVR E;  4U63 A;  4GTV A;  1NFI E;  4NRH B;  4UI9 J;  3MZL B;  4WWO A;  2FI7 A;  2JEK A;  3I4R B;  4ABN A;  3P2B A;  3CKC A;  4GZ3 A;  4TRQ A;  1KPS B;  4HLE A;  4HI9 A;  5EYL A;  3PNT B;  4J8F A;  1YA0 A;  3ENE A;  2E0I A;  3E4B A;  4OAV B;  2IY0 C;  3RIB A;  1JCR A;  3EHM A;  3X2Q E;  2CFZ A;  3T9K A;  3DST A;  3JQ1 A;  3IKO B;  1N95 A;  3CHM A;  4PH4 B;  3JYS A;  5T8I A;  3KAE A;  3FUD A;  3LPZ A;  3LKU A;  1Y6I A;  5CEA A;  1PY1 A;  4XX5 A;  3U64 A;  4Y6C A;  3B95 A;  3JUE A;  5AAO A;  2JLB A;  4JVS A;  2XEV A;  3B7R L;  3U3W A;  4ZHB A;  1FVF A;  4G24 A;  1N0R A;  1QBQ A;  4CRW A;  2V4H C;  4U07 A;  2CFU A;  4N5Q A;  1BD8 A;  3FH8 A;  4FJZ A;  1UG3 A;  4MLP A;  3L54 A;  3G2T A;  3E34 A;  4L2Y A;  2YNQ A;  4MS6 A;  2J4D A;  1UN8 A;  3L16 A;  1MHQ A;  5B1A E;  3FEX A;  4HOQ A;  4I9E A;  4GU5 A;  2QZA A;  2XQ0 A;  2VGX B;  2KZT A;  4K03 A;  2UWJ G;  3ZHE A;  4CEM A;  4GA2 A;  2WQ6 A;  4AXH A;  3KEZ A;  3MV3 B;  1DCQ A;  2WXM A;  3LDZ A;  2X3M A;  3E30 A;  1WDY A;  3CHO A;  1LD7 A;  4PS7 A;  4L1B A;  4J7W A;  3BU8 A;  2Y0B G;  4Q96 A;  3CV0 A;  3J5Q B;  3R7Q A;  5FTP A;  1MX6 A;  4FHK A;  4G23 A;  5BNW A;  3FTX A;  3ASO E;  3EU5 A;  2HR2 A;  3LY8 A;  3AJI A;  1ELK A;  4UI9 K;  5FQ7 A;  3DSX A;  3AG1 E;  2R17 C;  1MYO A;  2H6H A;  3UKU G;  4MRU A;  1IQU A;  4BTB A;  2A5E A;  3ASH A;  4APO A;  4BT8 A;  2IF4 A;  2WM9 A;  1S70 B;  4IYP A;  3ONK A;  4GTT A;  3NZS A;  5HRY A;  2RFA A;  3LCA A;  4O1P A;  1D8E A;  4HRL A;  5E75 A;  3ZIM A;  1E8X A;  1Z6T A;  3U4T A;  3UUX A;  4B0Z A;  1LTX A;  5EKQ D;  1XNF A;  5AN8 A;  3TWX A;  3ZEF A;  1N54 A;  3ZXS A;  3CGH A;  3U9W A;  2ETC A;  3L08 A;  3O4Z A;  1MX4 A;  2GRM A;  3OXG A;  4KVO A;  3ZGQ A;  4ATG A;  1H2V C;  4I1O B;  3VTY A;  1NP7 A;  2DYS E;  5BV0 A;  1OXJ A;  3PZD A;  1Q2Z A;  1H6P A;  3B7B A;  4LRZ A;  4BES A;  4I6G A;  4M3O A;  3IXE A;  5EX0 A;  5FIN A;  4CDM A;  1ZBP A;  2Y4U A;  4EQF A;  4F3V A;  3MGB A;  3SD5 A;  3RU0 A;  4TV3 A;  3PS6 A;  4AY6 A;  3TWQ A;  5JHA A;  1S63 A;  3RK6 A;  4B94 A;  2I9C A;  2LXM A;  4BY6 A;  4HNA D;  2WXG A;  5ENQ D;  2WXR A;  5D2M C;  3G2V A;  4FHJ A;  1HF8 A;  3PZ2 A;  4U96 D;  2VSY A;  1BI7 B;  1X5B A;  4U8H A;  4N39 A;  3R9M A;  3ZPJ A;  2B0O E;  2GGF A;  4YVO A;  1MZC A;  4FLH A;  4CCA A;  5LOZ A;  5CEC B;  3CK9 A;  5KCM A;  2RFM A;  3QOU A;  3FTV A;  1KZO A;  3ZXP A;  2R05 A;  2OND A;  4YDW A;  1JCQ A;  2BF0 X;  2MOW A;  2EIJ E;  4JW1 A;  3ZYK A;  2PZI A;  2Y4T A;  1OWO A;  3QWW A;  3ZN3 A;  3PE4 A;  2FEZ A;  3AG2 E;  4FJY A;  5G05 J;  2AXU A;  3D3M A;  4DX2 A;  4GCN A;  5M72 A;  2L6B A;  3CSF A;  3S7D A;  4KMO A;  3PH0 C;  5CHE E;  5EIB E;  1HH8 A;  3UIN C;  4GTR A;  4FP7 A;  4M7C A;  1NA3 A;  3Q9N C;  2DYR E;  4L23 A;  4G26 A;  2R5S A;  3CK7 A;  2E2E A;  4HLL A;  4A1G A;  4ACK A;  4AY5 A;  3TG4 A;  2DZO A;  2QYU A;  4EEC A;  3PRZ A;  4F1P A;  2X6I A;  3DPY A;  3DSS A;  3ZNG A;  1TN7 A;  3MKR A;  3LYA A;  4HOS A;  2PQR A;  3CVU A;  5ENS D;  1N52 A;  1H6K A;  3NOC D;  5EID A;  4CYM D;  5BXO A;  3ABK E;  1S0P A;  4JEU A;  3QAQ A;  2R59 A;  4XZ4 A;  3PE3 A;  2R2L A;  1NL4 A;  5AQB A;  4PUC A;  4FU3 A;  3HXD A;  3CHQ A;  5D66 A;  1TEZ A;  2CHZ A;  3FUJ A;  1MQS A;  1SA5 A;  4MBG A;  1QNF A;  4APF A;  2WXF A;  1KT0 A;  2X6J A;  2OVB A;  3C3R A;  3D9O A;  2KM4 A;  3MCX A;  2UY1 B;  3FTY A;  1JWG A;  3FY4 A;  3CVW A;  5E76 A;  4KT6 B;  3UIP C;  4URK A;  5KJK A;  3TL5 A;  2XRY A;  4I2Z A;  3TWV A;  1BI8 B;  4OAU C;  2L9B A;  3FTS A;  1TNU A;  3PZ1 A;  3W9F A;  2YQ8 A;  4G25 A;  4H7Y A;  4I9C A;  3DSW A;  3TG5 A;  2RKK A;  3ZYL A;  3QB2 A;  2WXJ A;  5B1B E;  1HE8 A;  3UQ3 A;  5FIO A;  2I1K A;  1O5M A;  3Q15 A;  3S2A A;  2XHE A;  4N3C A;  3MKQ A;  2VYI A;  4W9R A;  2HO1 A;  3C3O A;  2GRR B;  5CCM A;  4WUY A;  3FUE A;  3DWL G;  1O1T A;  3JXI A;  3K9I A;  2HM8 A;  4HOT A;  4G11 A;  3CEQ A;  1Y8M A;  4GAA A;  3IEG A;  2RG8 A;  2LNI A;  3TWS A;  1QYM A;  4GA1 A;  2GRO B;  3BEE A;  3HXF A;  2F8Y A;  2KAT A;  4JB8 P;  2IEJ A;  5AAR A;  5EX3 A;  2WXO A;  2PM7 A;  2JAB A;  4F1S A;  1YCS B;  3F6Q A;  1FT2 A;  4J6I A;  5A6C A;  1KLX A;  3TWU A;  3KSL A;  1EF1 C;  5KJL A;  3Q47 B;  3CVQ A;  4AVX A;  5ANR A;  4EBA G;  4BEP A;  2KCK A;  3SFY A;  3Q79 A;  1SVX A;  1Z3Y A;  4O6F A;  1HXI A;  5ENP D;  4HS2 A;  1BU9 A;  1LD8 A;  2CG3 A;  5G2N A;  3AS8 A;  3G2W A;  3ZUV B;  3RO3 A;  4LCT A;  4N2S A;  2DVW A;  3ZFW A;  2WXL A;  5B3S E;  1PC2 A;  1OWP A;  3DRA A;  3LS8 A;  4HB5 A;  3T5V A;  1N11 A;  1A5E A;  2MRI A;  2QFC A;  3E33 A;  4HXI A;  4O1O A;  3FU0 A;  3UTM A;  4G2V A;  2WXP A;  5CMY A;  3MA5 A;  4K5A B;  5LCW C;  4ANV A;  5BT1 A;  3UM2 A;  4UWF A;  3ML9 A;  2LUH A;  3KEA A;  1TNB A;  4U0U A;  3DBS A;  2ZU6 B;  2GRQ B;  3AG4 E;  1HO8 A;  1SZ9 A;  3MJW A;  3D9H A;  3J5P A;  5EIL A;  3CQC B;  2DWZ A;  1SA4 A;  3NB2 A;  4AJW A;  4LER A;  1OCR E;  5KJN A;  2NC9 A;  2M63 A;  4DX1 A;  1N4R A;  3C3Q A;  2Y69 E;  3CHR A;  4JPS A;  3P1U A;  2Q7F A;  1HS6 A;  5H7P A;  4AV7 A;  1OWM A;  4G8L A;  5KNG A;  2EIM E;  2CG2 A;  2EIN E;  2X6H A;  4XEI G;  1U3D A;  4N5C A;  2ZIR A;  1DC2 A;  4BTA A;  2BED A;  1OCO E;  2V4L A;  2XGS A;  4FA6 A;  2Y1L E;  3SHF A;  2PM6 A;  4UWG A;  4OYS A;  1Z3X A;  1O1R A;  4U8Y D;  4J8D A;  2XGO A;  4RG6 A;  3HVE B;  4N3A A;  1BPO A;  1IHG A;  3PRE A;  3CVL A;  2J8S D;  1K8K G;  2QC9 A;  3EUV A;  3HXE A;  2IU1 A;  4UQX A;  1WAO 1;  1NI1 A;  3HHM A;  3B7T A;  4ZFH A;  3S7F A;  3L22 A;  4DI4 A;  4B89 A;  5DIZ A;  3FUH A;  2LSU A;  5JA4 D;  4DX7 D;  3V2O A;  4TXR A;  4DJA A;  5A7D B;  3QC1 A;  4PS3 A;  3Q9U C;  2IFU A;  3PZ3 A;  4U04 A;  1NZN A;  3PEV B;  1TN8 A;  1UN9 A;  4E85 A;  1TNZ A;  2X6K A;  3APC A;  2GRL A;  4U95 D;  4FC8 A;  3CHS A;  4KZ0 A;  2P9K G;  3TWT A;  1H2T C;  4V3I A;  3JUI A;  3IHY A;  4R7L A;  2VSO E;  1TNY A;  5ENN A;  1TYQ G;  4LSZ E;  3HVE A;  3FUK A;  3BQO A;  1EDU A;  2VGE A;  4C9B B;  4FUL A;  4DLO A;  2X6F A;  3Q4A B;  4HQD A;  3VLE A;  1N4Q A;  2H6G A;  2R03 A;  3PUK A;  1TN6 A;  4G1T A;  2MHK A;  4GZC A;  3FHE A;  2PNN A;  3CR3 A;  4RQI A;  1N0Q A;  4K5B A;  3CST A;  3UX4 A;  3HG0 D;  3I5P A;  4IRU A;  4EPZ A;  2LO6 A;  3T8M A;  2IQC A;  4WNF A;  1D8D A;  1QQE A;  3KSQ A;  4C0M A;  4E6H A;  2OOE A;  4UWH A;  5FJY A;  3UKR G;  3DSV A;  1YYH A;  5LFA A;  2EIL E;  3LJN A;  4GYO A;  3UIO C;  2BUG A;  2IO2 C;  1QZ2 A;  2AJA A;  2WQ7 A;  3FUN A;  2WQH A;  3LEW A;  4YVQ C;  3SFX A;  1XGW A;  3QWP A;  4GTQ A;  3D9N A;  2P9N G;  1IXV A;  5KBA A;  1OCZ E;  2XPI A;  3EHQ A;  4XKB A;  3FP3 A;  1D9S A;  3SFZ A;  4RSY A;  4UQZ A;  2XZD G;  2WXH A;  3D9J A;  4OVV A;  4LUN U;  4RLY A;  2XGM A;  4CDR A;  5DBK A;  5CBN A;  3SBS A;  3Q49 B;  1X81 A;  3EDT B;  4J8E A;  4XE0 A;  4JA9 A;  1K1B A;  3PUJ A;  3UT7 A;  2VTB B;  4AIF A;  1HZ4 A;  1BLX B;  3GW4 A;  2AWI A;  2XEH A;  3AAA C;  3G2U A;  4WNG A;  1H6O A;  3GZ1 A;  3B7U X;  4G8K A;  2DBA A;  5J08 A;  2KCL A;  4A55 A;  2F8X K;  2X38 A;  4BSZ B;  4DLQ A;  2XCC A;  2BTD A;  2ION A;  2YHC A;  4U0Z A;  1S64 A;  1MX2 A;  3Q78 A;  3SI5 A;  5FQ6 A;  4KBQ A;  2AXZ A;  4GCO A;  4YDY A;  2WXK A;  4TUU A;  4ANX A;  4UWK A;  2P2C P;  2XEN A;  3GZS A;  3QKY A;  4ANU A;  4B8A A;  3NF1 A;  2LAI A;  3HXC A;  4Z68 A;  3UM3 A;  3RSE G;  3SBT B;  5CMW A;  3EU9 A;  3B13 A;  3AU4 A;  3FU5 A;  3GZ2 A;  3DXM G;  4CDN A;  2I2O A;  2ETB A;  4JEH A;  3JCK C;  3LY7 A;  3HYM B;  5CED B;  4I1M A;  3OXL A;  3Q75 A;  3VTX A;  4ME2 A;  3BUA A;  1PAQ A;  3LJ3 A;  3MV2 B;  3RO2 A;  2IO3 C;  3KD7 A;  4P29 A;  3KS2 A;  4N2Q A;  4CT4 A;  5CBO A;  1O1S A;  3DSU A;  5AQ7 A;  2UY1 A;  2WXN A;  3CVP A;  3ZHE B;  3FUM A;  1N4P A;  1B89 A;  2C0L A;  2QYJ A;  2ILR A;  4HBD A;  5C2Y A;  4RVB A;  3N71 A;  1H19 A;  3CQG B;  3CVY A;  2H6F A;  4AP2 A;  2OV8 A;  1HG5 A;  4AOF A;  2ZXW E;  4YND A;  3QJZ A;  3C98 A;  2FO7 A;  1W3B A;  2WXI A;  3TAX A;  4I6J A;  3UT8 A;  3AG3 E;  1HFA A;  3MKQ B;  3AS5 A;  3DXK G;  5ARF A;  4ACL A;  1E8Y A;  1OY3 D;  3ZRH A;  4GZ5 A;  2NXP A;  3UPV A;  1DVP A;  2F0Y A;  3SZ7 A;  3WXX A;  5LCW J;  4KZC A;  2DCP A;  1ZB1 A;  1E7U A;  4JHJ A;  3TXM A;  3Q7A A;  5JJT A;  1A17 A;  4XI0 A;  3I4G A;  3L9T A;  4NUR A;  4ILH B;  2C2L A;  4PDX A;  2EIK E;  5BV1 A;  3TXN A;  4CGV A;  2ZGD A;  3LXU X;  3V30 A;  4H7X A;  5AIJ A;  2GRP B;  3WG7 E;  3HRA A;  3D9L A;  3E37 A;  3CHP A;  4I43 A;  3CKB A;  1EYH A;  5BUZ A;  3MX3 A;  4JZY A;  2WPV A;  5JJ6 A;  4GZ6 A;  3FUI A;  1E7V A;  3PDN A;  5T3R A;  3D9K A;  4EZK A;  2P9I G;  4FLB A;  5FT9 A;  4IUL A;  4PS8 A;  2MYO A;  3PNL B;  2NYJ A;  2OEW A;  4WAF A;  2I6H A;  2GW1 A;  2OCC E;  3Q5M A;  2VQ2 A;  1IYG A;  5FZS A;  4HFG A;  5LX8 A;  3T5X A;  1ELW A;  3FH7 A;  2XCB A;  5G05 C;  1G3N B;  4L9P A;  3FUF A;  1YMP A;  2LSV A;  4RG9 A;  2A4Z A;  3CVX A;  4ILG A;  1OWL A;  1IQR A;  2WMN A;  5EN5 D;  4GB9 A;  3ZYM A;  4A63 B;  2ZGG A;  2P9S G;  3EHN A;  3AS4 A;  5BXU A;  3BG1 B;  4N3B A;  5IY5 E;  5G55 A;  1OT8 A;  2V0P A;  2Y3A A;  3OXF A;  2BKG A;  1N9A A;  1OCC E;  2GRN B;  3ABM E;  3UM0 A;  3IHV A;  1TNO A;  1K3Z D;  3VLD A;  3DEP A;  4UWL A;  1DCE A;  1JUQ A;  4B93 B;  1N4S A;  2P9L G;  5JHB A;  1ELR A;  2P9U G;  4JD2 G;  2I1J A;  4GYW A;  3D9M A;  4GML A;  3NQP A;  3FTW A;  1JCS A;  4K5C A;  4J8S A;  2IJG X;  2VGY A;  3APD A;  5JMN D;  3CK8 A;  3NAW A;  4F7A A;  4JHK A;  1RW2 A;  3SGH A;  3R7R A;  3ULE G;  5ENR D;  4QFV A;  1TR4 A;  3V79 K;  3Q7F A;  3RKV A;  1L5J A;  2HE0 A;  1OWN A;  2V5Q C;  3FUL A;  3FWV A;  5KNH D;  2XPY A;  4TXP A;  3O48 A;  2WXQ A;  4L2L A;  3CIA A;  2KC7 A;  4MKT A;  5AJL A;  1JPL A;  2C0M A;  4DUI A;  4CGW A;  4LNU D;  1UJK A;  4U0S A;  1INZ A;  3UT4 A;  1DNP A;  5JJ7 A;  3EJN A;  2J09 A;  4EZJ A;  5G04 J;  4U7E B;  2PL2 A;  1SQM A;  1IKN D;  3V2X A;  1U3C A;  3UM1 A;  3FFL A;  3V31 A;  1E8W A;  1P5Q A;  3FEY A;  3IV0 A;  3ABL E;  4X8Q A;  4HOU A;  2BKK B;  1U2V G;  2KCV A;  5CRU A;  4UQY A;  4A1S A;  1NA0 A;  4NAC A;  3W9G A;  4C48 B;  2KXP C;  4TXQ A;  5A23 A;  3QNK A;  5ANL A;  3EIJ A;  2XEE A;  4WNE A;  3UXG A;  3NOG D;  3NBN B;  1LF8 A;  4U8V D;  2EQX A;  1H0A A;  3IBE A;  4LNG A;  4LEU A;  3GYZ A;  2XZT G;  5G04 C;  4BT9 A;  3MYV A;  2YHE A;  1AP7 A;  3FH5 A;  4GMJ A;  5LP0 A;  1N94 A;  4JA7 A;  1E96 B;  4GTS A;  4WWN A;  5FQ4 A;  2RD0 A;  3ZU7 B;  3NZU A;  2WB2 A;  2FUL A;  4GA0 A;  3TWW A;  1HX8 A;  1WM5 A;  4NIK A;  4CT0 A;  3ZYQ A;  3ZW3 A;  2YIN A;  4WND A;  3ONL A;  4ILI A;  4HRN A;  4K0R A;  5AQA A;  3LY9 A;  4J0U A;  1MJ0 A;  4FAD A;  4GPK A;  3RRM B;  3G2S A;  2P58 C;  5FZQ A;  4JHR A;  3SQV A;  3D9P A;  4DK5 A;  3L82 A;  5D0O D;  1SW6 A;  4BSX A;  3L13 A;  1OUV A;  3QWV A;  3U66 A;  4GTP A;  3QAR A;  1IHB A;  5CCL A;  3QDN A;  5FWQ A;  1HU3 A;  3ASF A;  5AEN A;  5HQ8 A;  3ESK A;  3RAU A;  5D0Q D;  5ITZ F;  4XIF A;  5AJD A;  1E8Z A;  4C0E A;  4DX6 D;  2VTB A;  5KWD A;  2KBX A;  5ARG A;  3DEO A;  2PQN A;  4AM9 A;  1HG2 A;  1K1A A;  1KZP A;  2WMO A;  3ML8 A;  4JL0 A;  5ENT D;  1TJC A;  4J8Y A;  2R02 A;  4HVB A;  2IOL A;  3RRN B;  5KJM A;  4LNB A;  4Y6W A;  2CHX A;  5BW8 C;  3UI2 A;  3VLF A;  3EHR A;  5HS0 A;  4F6R D;  5HI7 A;  4XKC A;  2L0I A;  4GTM A;  3EIQ C;  3ULY A;  2XRZ A;  4LG6 A;  4GTO A;  4B8C B;  1V54 E;  5CRV A;  2A5U A;  3ZKJ A;  2VGX A;  3HDX A;  1FPP A;  5ENO D;  3URZ A;  3APF A;  3E32 A;  4NQ0 A;  3ASN E;  3FTU A;  3R9A B;  4DRX E;  4L7T A;  4UUC A;  3CVV A;  4D10 C;  4GZD A;  3JXJ A;  2H6I A;  3I3N A;  3S7B A;  4F53 A;  3ULQ A;  2ETA A;  2OVF A;  4TUM A;  2J9Q A;  2XPZ A;  1V55 E;  2AW6 A;  5T4Y A;  4QQI A;  4KYO B;  5FZR A;  3OTN A;  3HXB A;  2P9P G;  3ISM C;  2OEV A;  4I17 A;  3BG0 B;  3C72 A;  2FBN A;  3OAW A;  3QK0 A;  4EBA A;  4GPM A;  5FQ8 A;  1FVH A;  5C1D A;  4KVM A;  4HRM B;  2VSN A;  2VJ8 A;  2HYZ A;  3CLJ A;  2B6C A;  1E90 A;  2J49 A;  3PVL A;  3TJP A;  1ZU2 A;  2V8S E;  4EHM A;  4GMR A;  2V5F A;  4I1A A;  3CVN A;  3AU5 A;  3ESL A;  3L6A A;  4ATZ D;  1UW4 B;  4HI8 A;  3ZVV A;  4AEZ C;  1WY6 A;  2IOS A;  4DI3 A;  3SO8 A;  5HKP A;  2XS8 A;  2LXL A;  4XI9 A;  4BX9 A;  4WWP A;  4IN3 B;  3LVQ E;  4I6E A;  5BPP A;  3ASG A;  3SY2 A;  1GW6 A;  2VSX E;  1UOH A;  4BX8 A;  2KZT B;  2QY7 A;  1RZ4 A;  3S7J A;  4JXT A;  4BFR A;  5AYW D;  3FU6 A;  1TJF A;  1SZA A;  4UI9 C;  4YDE A;  2J08 A;  2F37 A;  2L6J A;  4DX5 D;  4OVU A;  3PEU B;  3RRU A;  4Q69 A;  1KT1 A;  3FU3 A;  3L17 A;  2FF4 A;  1UJJ A;  2AXV A;  1JWF A;  3B7S A;  3TWR A;  3MEK A;  1EPU A;  3FTZ A;  1FCH A;  2FO1 E;  4GYY A;  1FT1 A;  1WG0 A;  1AWC B;  2NSZ A;  4A3V A;  4I2W A;  3JQ0 A;  1Z5S C;  5EYP F;  2XS1 A;  3D9I A;  1VDY A;  3SF4 A;  4BER A; 
#chains in the Genus database with same CATH homology
 1OY3 D;  3LJN A;  1MYO A;  3B95 A;  3JXI A;  4ZFH A;  5CER B;  3JUE A;  4U96 D;  2A5E A;  1MX2 A;  5EN5 D;  4A63 B;  5AAO A;  4GMR A;  2AJA A;  3ZU7 B;  3KEA A;  5ENS D;  1S70 B;  5JA4 D;  4DX7 D;  3V2O A;  2ZGG A;  1BI7 B;  3TWS A;  3TWW A;  4ZHB A;  1QYM A;  4YDY A;  5BXU A;  3Q9U C;  4NIK A;  3NOC D;  3UI2 A;  2F8Y A;  3EHR A;  4K5A B;  5HRY A;  4DUI A;  5EID A;  3D9H A;  3J5P A;  2RFA A;  4JB8 P;  4O1P A;  5HS0 A;  4ATZ D;  4LNU D;  4O60 A;  5EIL A;  4HI8 A;  4CYM D;  4F6R D;  5BXO A;  2DWZ A;  4HRL A;  1N0R A;  1OT8 A;  2B0O E;  5AAR A;  2P2C P;  2XEN A;  2V4H C;  2BKG A;  4HRN A;  4U95 D;  5AQA A;  2JAB A;  3SO8 A;  5CEC B;  4LG6 A;  5HKP A;  3TWT A;  1IXV A;  1YCS B;  3F6Q A;  1BD8 A;  4N5Q A;  1MJ0 A;  4DX1 A;  5KBA A;  5AN8 A;  2ZGD A;  3TWX A;  4CZ2 D;  2RFM A;  4Z68 A;  2ETC A;  3EHQ A;  5AQB A;  5KNH D;  3TWU A;  3V30 A;  3ZKJ A;  1K3Z D;  3C5R A;  5D66 A;  3HRA A;  3DEP A;  3EU9 A;  4YDW A;  1MX4 A;  4LSZ E;  1IKN D;  2DZN A;  3T8K A;  5ENO D;  4BET A;  3V2X A;  4G8L A;  5KNG A;  2ETB A;  1D9S A;  5AQ9 A;  1UOH A;  3V31 A;  4B93 B;  1SW6 A;  5CED B;  2VGE A;  2XZD G;  4BEP A;  1NFI E;  4DRX E;  4UUC A;  4HQD A;  1SVX A;  1DC2 A;  1IHB A;  4DX2 A;  4RLY A;  3JXJ A;  3B7B A;  5ENP D;  4BES A;  5CBN A;  2BKK B;  2L6B A;  1BU9 A;  3IXE A;  2Y1L E;  1DCQ A;  4K5C A;  5CBO A;  1K1B A;  4HI9 A;  5FIN A;  5AQ7 A;  2F37 A;  3TWV A;  5EYL A;  5EIB E;  2ETA A;  1BI8 B;  3ZUV B;  4DX5 D;  4OAU C;  4TUM A;  1WDY A;  3W9F A;  4OAV B;  3W9G A;  2PNN A;  4C48 B;  2KXP C;  1BLX B;  4QQI A;  2QYJ A;  4HBD A;  5ITZ F;  1N0Q A;  5JMN D;  4J7W A;  2XEE A;  2MYO A;  4U8Y D;  2DVW A;  3Q9N C;  4DX6 D;  2XEH A;  2NYJ A;  3AAA C;  4K5B A;  3UXG A;  3TWR A;  2Y0B G;  3T9K A;  3NOG D;  3J5Q B;  3NBN B;  4HB5 A;  3HG0 D;  5KWD A;  4U8V D;  2FO1 E;  1MX6 A;  2KBX A;  3TWQ A;  1N11 A;  4G8K A;  5FIO A;  1WG0 A;  4HLL A;  1A5E A;  2XZT G;  4GPM A;  1AWC B;  2J8S D;  2F8X K;  2QC9 A;  5ENR D;  2DZO A;  4QFV A;  1TR4 A;  3DEO A;  3V79 K;  3AJI A;  4HNA D;  5ENQ D;  4BSZ B;  1G3N B;  4HRM B;  1K1A A;  4O1O A;  5EYP F;  1AP7 A;  5ENT D;  4F1P A;  3UTM A;  1YMP A;  3ZNG A;  2HE0 A;  5CEA A;  2V5Q C;  4J8Y A;  1YYH A;  4BER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...