4U8VD

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB
total genus 53
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u8vD00
5JA4D 5HRYA 2ZGDA 1MJ0A 3TWVA 5KNGA 5ENPD 4DX5D 5CERB 2BKKB 1BU9A 1SW6A 4K5BA 5KNHD 2V4HC 4HBDA 4HI9A 4HRLA 4HI8A 5AARA 4F1PA 4B93B 2BKGA 1QYMA 3W9FA 1AWCB 1BI7B 4U96D 2P2CP 1DC2A 3UI2A 5ENOD 3B95A 4U95D 1K1AA 4LNUD 1TR4A 3AAAC 2J8SD 2XENA 4JB8P 4DX1A 2XZDG 2F8XK 5CECB 2QYJA 3JUEA 5ITZF 3UXGA 1BD8A 3HG0D 2ETCA 2ETBA 1N11A 2F37A 5AN8A 1IXVA 2KXPC 4J7WA 3TWQA 4DX7D 4GPMA 2XZTG 2DZNA 5CBNA 1MYOA 3TWXA 2Y0BG 3IXEA 4QQIA 5HKPA 5BXUA 3HRAA 4QFVA 4O60A 3NOCD 5ENRD 3UTMA 3ZUVB 4CZ2D 1AP7A 1D9SA 5KBAA 2MYOA 4K5CA 1K1BA 1SVXA 5EIDA 4HRNA 5ENTD 5CEDB 3TWSA 1YYHA 4RLYA 3J5PA 2XEEA 4BESA 1N0RA 4BERA 4DX6D 1BI8B 2FO1E 2AJAA 3ZU7B 1WDYA 4LG6A 4A63B 2XEHA 4HNAD 5KWDA 5EILA 2L6BA 4ZFHA 1K3ZD 2VGEA 2JABA 4Z68A 3D9HA 3C5RA 4ATZD 3V2OA 2PNNA 4G8KA 3TWWA 5AAOA 1IKND 5EIBE 3TWTA 4DRXE 1UOHA 4N5QA 5FINA 3AJIA 4UUCA 2DZOA 2Y1LE 3B7BA 2HE0A 3EHRA 4K5AB 4U8YD 1NFIE 3JXIA 5AQAA 3T8KA 1IHBA 3F6QA 3ZNGA 5EYPF 4CYMD 3V79K 5D66A 4NIKA 2B0OE 5JMND 4BEPA 4LSZE 4ZHBA 4OAVB 5EN5D 1MX6A 4GMRA 4F6RD 5ENQD 3V30A 3LJNA 1S70B 5FIOA 5BXOA 3TWRA 4HRMB 4O1OA 1BLXB 4C48B 1N0QA 5CBOA 4DX2A 5AQ9A 3Q9NC 3J5QB 2A5EA 3Q9UC 5AQ7A 5HS0A 2ETAA 1YCSB 3DEOA 3ZKJA 2ZGGA 3T9KA 4J8YA 4HB5A 4G8LA 3TWUA 1OT8A 1YMPA 1A5EA 2RFAA 4BETA 2QC9A 4TUMA 1WG0A 3KEAA 4HLLA 2V5QC 1MX4A 3SO8A 3V31A 1G3NB 4OAUC 5EYLA 5AQBA 2RFMA 2F8YA 1MX2A 3DEPA 5ENSD 1OY3D 4BSZB 4YDWA 2DVWA 4HQDA 4O1PA 4DUIA 4U8VD 2KBXA 1DCQA 3NBNB 3NOGD 2NYJA 3V2XA 2DWZA 4YDYA 5CEAA 3W9GA 3EHQA 3JXJA 3EU9A
chains in the Genus database with same CATH superfamily
2VTBA 1SW6A 2EINE 4HRLA 4HOTA 2PZIA 5AARA 3B95A 4URKA 3AAAC 1H6KA 5DBKA 1IQUA 3IV0A 5BW8C 4JEHA 3CHMA 1N4SA 2XS8A 3O48A 4L1BA 2WXLA 2DCPA 2XGSA 2WXJA 3U3WA 3E4BA 1E7UA 3UT4A 4HRNA 4UI9K 5FQ8A 3CK9A 4GZ5A 1H0AA 3UMVA 4CGWA 4ATZD 4BESA 4JD2G 2OEVA 4OAVB 3LJNA 1TNUA 1N0QA 2ONDA 3PEVB 4CDRA 2A5EA 4AY6A 2VSXE 3DEOA 4J8YA 4EZLA 2YQ8A 5AQBA 4MS6A 1O5MA 1PC2A 1X81A 4G11A 3FEXA 1DCQA 3C3QA 2X6IA 3ABLE 3ZU7B 1OXJA 4NURA 3KEZA 4BTAA 5ENPD 3C98A 2V4HC 3DSTA 2LSUA 1QZ2A 3MCXA 4ILIA 3UT8A 2B6CA 3ASFA 3FH8A 2X6HA 3RU0A 3FWVA 1NZNA 2J08A 3E32A 4UQYA 4OVVA 1TJCA 1YYHA 3DWLG 4G23A 3CR3A 4XKBA 5G04J 4ZFHA 4M3OA 1GW6A 3AJIA 3FH5A 2DZOA 3PNLB 4KBQA 2A4ZA 5AYWD 4I9EA 3CQCB 4TXPA 1BLXB 1OCCE 5AQ9A 2ZIRA 2P9SG 3QWVA 5FZSA 1O1SA 4BETA 3R9AB 1LD8A 3FUDA 3DRAA 1QBQA 4Q94A 3B13A 3SFXA 2VSOE 4WWNA 4J0UA 1H19A 2CHZA 4I2WA 1TNZA 4L2YA 4ANWA 1TEZA 5AIJA 3MEKA 3KD7A 5CRVA 3WG7E 2OOEA 1BI7B 1O1RA 1WY6A 2R5SA 3HHMA 3T5XA 2ILRA 3C3RA 4JB8P 3LY7A 4WNDA 4ANVA 3I4GA 2XRZA 4TV3A 3CVXA 3CK7A 1DCEA 2KZTA 3DXKG 3TWXA 4FHKA 2BTDA 3SGHA 5A23A 5LCWC 5C2YA 4RG9A 3J5PA 2XEEA 3G2UA 4R7LA 2AJAA 1WDYA 3SBTB 3EIQC 4Z68A 3C5RA 4DJAA 1VDYA 4CT4A 3ZRHA 2IOSA 3ZYQA 4OYSA 3OTNA 4ACKA 3MV2B 4ACLA 2OEWA 3D9KA 2I9CA 3S7JA 5D0QD 4MKTA 5KJKA 3L16A 2GRPB 2QC9A 2V5QC 5CCLA 1H2VC 3L13A 1FVFA 1OWPA 4HQDA 3DXMG 3AU5A 4A55A 3I3NA 3NOGD 3D9IA 1XGWA 4M7CA 3FUNA 5KNGA 4APOA 5KNHD 2WXFA 3GZSA 3RO3A 4TRQA 4KVOA 4N3AA 2L0IA 4KVMA 2UY1A 5ENOD 4YDEA 2I6HA 3HXEA 4Y6CA 3SFZA 5BUZA 1N94A 2ETBA 5AN8A 1IXVA 1N4RA 1HX8A 1MYOA 3FP3A 5EDSA 4CZ2D 3ML8A 4L23A 2FEZA 2MYOA 5CEDB 1DVPA 1D8EA 3SF4A 2Y4UA 4GA0A 2VGEA 3QAQA 5EX3A 3UM0A 2EIME 3D9JA 1TN8A 1ELKA 4AXHA 3LKUA 3TWRA 3RO2A 2CFUA 4GZ6A 4J6IA 5H7PA 5AQ7A 4GMLA 1QNFA 4MBGA 4FJZA 1H6PA 3V31A 1UW4B 4UQXA 4DPRA 3Q73A 3B7RL 4O1PA 2KBXA 2R05A 4GTMA 3ZFWA 2DWZA 3G2WA 3P2BA 2LAHA 2HYZA 3EHMA 4HBDA 3S2AA 2P9IG 3ONKA 1EYHA 5FJYA 3UI2A 2E0IA 1EPUA 3CEQA 4LEUA 2AXUA 4U63A 3PZ1A 1E90A 1KT1A 3LY8A 5AJLA 2DBAA 3QOUA 1HF8A 4CDMA 2L6JA 4GTRA 3TWQA 4ANXA 1HZ4A 2Y0BG 2P58C 4O60A 2GGFA 3LVQE 2WXMA 3RRUA 5T8IA 3MKQB 4GYWA 2VGYA 1S64A 2J09A 4A63B 3AG3E 2ZXWE 4AJWA 2OVBA 5FINA 1V55E 4NACA 4CYMD 5AQAA 3ZNGA 2HR2A 2UWJG 3ISMC 2B0OE 5JMND 4LSZE 3OXLA 3QWWA 2J4DA 2QFCA 3DSUA 3QB2A 4C48B 4KZCA 5B1AE 4F7AA 4WNGA 2KC7A 2C2LA 2EQXA 2FO7A 2ZGGA 3ZYLA 5FQ6A 2IEJA 3I5PA 4CRWA 3LDZA 3FTZA 3EUVA 1QQEA 2XRYA 4IN3B 5E75A 3ZGQA 2WMOA 3TXMA 4GTOA 2WXOA 4EPZA 5JHAA 4GA2A 1P5QA 5CEAA 1SZ9A 4XE0A 1Q2ZA 5CERB 2BKKB 4H7YA 5FTPA 1QYMA 4FU3A 3B7TA 2R59A 2V4LA 2X38A 3PREA 3NZSA 3ABME 4U04A 2LSVA 4LNGA 1U3CA 2QYJA 3CGHA 1JWGA 3GYZA 1BD8A 2ETCA 4GA1A 1ELRA 1N11A 1E7VA 4GTTA 4TUUA 3NB2A 4UWFA 3HVEA 1AP7A 4AV7A 3N71A 4DK5A 4JC8A 3TWSA 3GZ2A 3QWPA 4GCNA 2XEHA 3FUKA 2H6FA 3ASGA 1EDUA 3GZ1A 4TXRA 3U66A 1N4QA 2P9UG 3T8KA 3TG5A 3F6QA 3FU5A 4RQIA 2DYRE 2WXQA 3FUFA 5ENQD 3JYSA 4ILHB 5BXOA 5FIOA 2GRLA 1IQRA 2Y69E 4CDNA 3CIAA 2GRRB 1Z5SC 2DYSE 4GZCA 3TWUA 2WXNA 3APDA 2X3MA 5KJNA 1N95A 3ZYKA 3AG2E 3NBNB 2OVFA 3ENEA 4OVUA 3SY2A 3E33A 3FU6A 4JZYA 4YVQC 2IJGX 1NA3A 2WXKA 5B1BE 1HXIA 1K1AA 1TN6A 3E30A 3HVEB 1XNFA 3VLFA 2OCCE 3JUEA 2IO3C 4AY5A 5HQ8A 4G2VA 3LXUX 4Y6WA 1KZPA 3G2SA 3UTMA 1E8XA 5CRUA 3CLJA 4F53A 2HM8A 3ML9A 1N0RA 3SQVA 4FADA 3CHQA 1HU3A 4LG6A 3ZIMA 3FTWA 2V8SE 1OWLA 4GTQA 4D10C 2LNIA 1IKND 5FWQA 4JHKA 1A17A 4W9RA 4APFA 2YHCA 1L5JA 5E76A 4I17A 2JLBA 1INZA 3FTVA 4LCTA 3BG0B 3MV3B 3ZKJA 4BFRA 4HB5A 2RG8A 3EDTB 2RFAA 3SO8A 1IHGA 2PQRA 2LAIA 2F8YA 2CG2A 3DSSA 4YDWA 5ARGA 3UM1A 4C0MA 5CCMA 2XS1A 3HIZA 4J8EA 4MRUA 3CQGB 4HI9A 1KT0A 4ILGA 2BKGA 4JHJA 3PVLA 2IONA 3ZYMA 4UWKA 4C0EA 4U95D 2ZISA 4V3IA 1TR4A 4LRZA 1OUVA 4N2QA 4J8DA 1OCRE 1JWFA 4I1MA 4WWOA 2F37A 1D8DA 5T4YA 2WQ6A 4IYPA 4DX7D 2PQNA 3L82A 4ATGA 1ZBPA 5BXUA 2PM6A 4EHMA 3R7RA 3BEEA 4HOQA 4JPSA 4HORA 5G55A 4N3CA 5KWDA 3DSVA 4GTPA 4EECA 3D9HA 3D3MA 5EIBE 3CVYA 4U8YD 3IHVA 4BWRA 1HFAA 1SA4A 1NI1A 3KAEA 2VTBB 4WNFA 5HI7A 1MX6A 4F6RD 3RJVA 4HRMB 3FUEA 3IKOB 4DX2A 3FH7A 3FY4A 3Q49B 5HS0A 2Y4TA 2VGXA 3QC1A 2IU1A 1PY1A 3L22A 1G3NB 3BQOA 5EYLA 3ZPJA 2P9KG 5LFAA 4RVBA 5FQ7A 4PDXA 4DUIA 3UPVA 2R2LA 3EHQA 2C0LA 5DIZA 1Y8MA 1WM5A 3IHYA 2XCCA 3CHSA 2WB2A 4AM9A 4B93B 1B89A 3C3OA 1OWOA 1Y6IA 3OXFA 4N39A 3ULYA 3UINC 4EBAG 1PAQA 1SA5A 4UWLA 3ESKA 4EZKA 4ABNA 2KZTB 4KXKB 1FCHA 2EIKE 4FLHA 1JCQA 4U0UA 2WQHA 4G26A 1SVXA 4JVSA 1ELWA 2AXZA 3ASOE 2GW1A 3U64A 3JCKC 5ANLA 2L6BA 3SI5A 3UIOC 3AG4E 3Q47B 3IBEA 3ZW3A 4BX8A 4XKCA 3ZXSA 3MGBA 1UOHA 4UUCA 3JXIA 2Q7FA 2I1KA 4HOSA 1S63A 5B3SE 4C9BB 3LJ3A 5J08A 5KJMA 3V30A 2WXIA 3D9PA 5BV1A 3ZN3A 4A1SA 3ZVVA 4Q69A 2R02A 3E34A 1O1TA 4KT6B 3UKRG 3QKYA 4BT8A 3PRZA 1E8WA 2AVPA 4ANUA 5AJDA 2V0PA 1NP7A 3CVLA 2FULA 3PZDA 5HRYA 5J90A 1FT2A 1BU9A 5LCWJ 2F0YA 4I2ZA 3JUIA 4B0ZA 4U7EB 3W9FA 3S7DA 3CV0A 4WNEA 3UM2A 2J8SD 4K0RA 2XZDG 3MKQA 3DSWA 2XPYA 3FDHA 3VTYA 2WXRA 2PL2A 2LUHA 3PZ4A 1S0PA 5ENNA 4DI3A 2BEDA 2EIJE 2DZNA 5KCMA 5KBAA 1HO8A 3FTSA 1MZCA 1OWNA 3KS2A 3VLDA 4GU5A 2WQ7A 3G2VA 4L7TA 3V2OA 3MJWA 4N5QA 4IULA 1SZAA 4E85A 4BTBA 2QY7A 2XPZA 5G05C 4WWPA 2IFUA 3SHFA 4GMRA 1NL4A 4E6HA 4MLPA 5CBOA 4HVBA 4WAFA 3FULA 1KPSB 2CHWA 4HOUA 4IRUA 4YNDA 4UI9C 1E8YA 1BPOA 2RFMA 1MX2A 5ENSD 3HXCA 2I1JA 3TL5A 2NYJA 3Q4AB 2AW6A 3EU9A 4PUCA 4F3VA 4DI4A 5JA4D 1ZB1A 3TWVA 2A5UA 5D2MC 3AS8A 3QNKA 1ZU2A 3HXBA 5KJLA 3SD5A 2NC9A 3PZ2A 4KMOA 4A3VA 3L08A 5JJ7A 3RK6A 3S7FA 3PUJA 4DX1A 2FBNA 5G05J 3DPDA 4AOFA 3KSLA 3CKCA 4B8CB 2KCVA 2IOLA 2X6JA 4LERA 5ARFA 4AP2A 4XX5A 4GPMA 2VSYA 3CHRA 5HKPA 4NRHB 4XZ4A 2XCBA 5ENTD 2CG3A 3VTXA 3RRNB 1BI8B 4BSXA 4UQZA 2XHEA 1Z3YA 2WMNA 4I6EA 1W3BA 1K3ZD 3ZXPA 4A1GA 3TWWA 4CCAA 3D9MA 4K5AB 2MHKA 2WM9A 2JEKA 3EJNA 4BX9A 1UJJA 3TAXA 2WXHA 4GYYA 4N5CA 4I1AA 3Q15A 3L17A 2UY1B 2GRMA 4U07A 3CVUA 4FLBA 4XI9A 4HLLA 3EHNA 1LTXA 4P29A 4OAUC 1LD7A 3DEPA 4HXIA 4JL0A 2XEVA 4DLOA 4I1OB 3UQ3A 2IY0C 4AIFA 2GRNB 3MZLB 4LNBA 2H6IA 4J8SA 3CK8A 4JW1A 2H6GA 3LY9A 1HG5A 3FUMA 2R17C 3CSTA 2P9LG 5BNWA 4KZ0A 3UT7A 2OV8A 1Z6TA 1OCOE 2IF4A 3ABKE 5FZQA 4G25A 1UG3A 2F8XK 3FU0A 2EILE 3ZHEA 1JUQA 3DBSA 1OCZE 3RSEG 4HLEA 1HH8A 3Q7AA 2QZAA 4B89A 3CVWA 2KATA 3B7SA 3NAWA 5BT1A 2VSNA 3AU4A 1E96B 4RG6A 4AEZC 3CVPA 3FTYA 1NFIE 1HS6A 5EYPF 4GYOA 2J07A 4ZHBA 3PEUB 2FF4A 5EN5D 3PS6A 4ME2A 4DLQA 1HG2A 4O1OA 3MX3A 1V54E 3AS4A 3MYVA 3J5QB 1YCSB 2J9QA 1KLXA 3FUJA 4G8LA 3Q7FA 4N2SA 4CT0A 4PS3A 2ZU6B 4U8HA 4U0SA 3LEWA 5IY5E 4BSZB 4GTSA 2MOWA 3CVNA 3PUKA 2MRIA 2XGOA 4RSYA 3UKUG 1N52A 5CMWA 2KM4A 3FTUA 4XEIG 1YMPA 3JXJA 1OWMA 3FU3A 4DX5D 4H7XA 1TNOA 4HI8A 4U0ZA 1AWCB 1TN7A 4U96D 4XI0A 4JEUA 4LNUD 1FT1A 1U3DA 3FHEA 1TJFA 2BUGA 5CECB 4I9CA 4GB9A 3TG4A 3CVVA 2VQ2A 4X8QA 3FFLA 1UN8A 3JQ0A 2BF0X 2GROB 2RD0A 3L54A 3CVQA 5CBNA 1N4PA 2L0TB 2DIWA 1SQMA 3NOCD 3MA5A 5CHEE 2YINA 1JCRA 3RAUA 4DX6D 3OAWA 1UN9A 5M72A 4HNAD 3EIJA 2JABA 2VJ8A 4PS7A 3ZEFA 3SNXA 2PNNA 3LCAA 3UXGA 2Y1LE 3B7BA 1MQSA 4FULA 4JHRA 3HXFA 5D66A 4NIKA 3QK0A 5JJTA 5A6CA 4BEPA 3LS8A 2E2EA 2QYUA 4GAAA 3ESLA 4I6JA 3RIBA 1Z3XA 3U4TA 4L2LA 3PNTB 3QDNA 1WAO1 2M63A 3SBSA 3T9KA 5EKQD 2X6KA 4TUMA 1UJKA 1HE8A 3DPYA 1MX4A 1KZOA 3ASDA 2DVWA 2AXVA 3CHOA 4U8VD 4UWHA 4CEMA 3W9GA 5FQ4A 2ZGDA 3K9IA 1MJ0A 3O4ZA 4F1PA 3BG1B 3UUXA 1DC2A 4B8AA 4FHJA 1DNPA 2GRQB 3D9LA 3C72A 3QARA 4YVOA 2LXMA 5JHBA 3HG0D 2Y3AA 2H6HA 5BPPA 3OXGA 4F1SA 3TGOA 1D9SA 1JCSA 3U9WA 3E37A 5ANRA 3G2TA 2KCLA 1K8KG 1K1BA 4K5CA 5EX0A 3TJPA 1LF8A 4RLYA 3QJZA 3HYMB 2FI7A 5AENA 2J4BA 4B94A 2WXPA 5D0OD 3BU8A 1H6OA 3L9TA 3Q78A 1N9AA 3BUAA 3P1UA 3MKRA 2YNQA 2WVIA 2WXGA 1YA0A 2NXPA 3FTXA 2LO6A 1NA0A 3UIPC 4UI9J 2HO1A 5BV0A 4FJYA 1TYQG 2NSZA 3PZ3A 3S7BA 1RZ4A 3V2XA 4G1TA 3ZUVB 3HXDA 3DSXA 5FT9A 2P2CP 4PH4B 3NF1A 3AS5A 4I43A 4XIFA 2CHXA 3LYAA 2XENA 3X2QE 4A3TA 3LVRE 5T3RA 3TXNA 3FUHA 3IEGA 5ITZF 3JQ1A 3Q79A 3R9MA 2XGMA 5A7DB 2P9NG 3NZUA 5JJ6A 3NQPA 2RKKA 4J7WA 1TNYA 3GW4A 2XZTG 4BT9A 2VYIA 3IXEA 2L9BA 3HRAA 4QFVA 5ENRD 3RRMB 1FVHA 3URZA 4JA7A 1RW2A 3PE4A 4BERA 2FO1E 5G2NA 4G24A 4AVXA 4CGVA 2PM7A 3ZHEB 4EBAA 4G8KA 3KSQA 3LPZA 2HE0A 3EHRA 1IHBA 5CMYA 3VLEA 1S70B 4GCOA 1H2UA 4NQ0A 3ONLA 2VGXB 3Q9NC 4FP7A 3Q9UC 4J8FA 5C1DA 3D9OA 4PS8A 3ULQA 1OT8A 1A5EA 3PDNA 5G04C 1WG0A 3UX4A 3UM3A 4UWGA 1OY3D 3T5VA 2C0MA 5LOZA 2XQ0A 5FZRA 3SZ7A 4YDYA 4FA6A 2WPVA 4K5BA 3ASNE 1U2VG 2X6FA 3PE3A 1FPPA 1X5BA 3HDXA 4HS2A 4FC8A 3CKBA 4GPKA 3Q75A 3D9NA 1TNBA 3APCA 5LX8A 4WUYA 4KYOB 3R7QA 2KXPC 4EQFA 4TXQA 5LP0A 3ULEG 2IQCA 4QQIA 3PH0C 4LUNU 3APFA 2XPIA 5EIDA 4O6FA 3CSFA 4GMJA 4GZ3A 4K03A 3AG1E 4N3BA 2LXLA 5EILA 1JPLA 1N54A 4YDOA 2V5FA 5AAOA 3TWTA 4DRXE 3L6AA 2I2OA 4BY6A 3B7UX 3V79K 2J49A 2YHEA 2P9PG 3RKVA 2KCKA 3WXXA 3FEYA 4JXTA 1IYGA 1H2TC 3ASHA 2ETAA 3Q5MA 3SFYA 4GZDA 1E8ZA 2R03A 1MHQA 3KEAA 3EU5A 3I4RB 2CFZA 4I6GA 4Q96A 4HFGA 3CHPA 4GTVA 2IO2C 4JA9A 3T8MA 2AWIA 4L9PA 4EZJA 3FUIA 1EF1C
chains in the Genus database with same CATH topology
5JA4D 5HRYA 2ZGDA 1MJ0A 3TWVA 5KNGA 5ENPD 4DX5D 5CERB 2BKKB 1BU9A 1SW6A 4K5BA 5KNHD 2V4HC 4HBDA 4HI9A 4HRLA 4HI8A 5AARA 4F1PA 4B93B 2BKGA 1QYMA 3W9FA 1AWCB 1BI7B 4U96D 2P2CP 1DC2A 3UI2A 5ENOD 3B95A 4U95D 1K1AA 4LNUD 1TR4A 3AAAC 2J8SD 2XENA 4JB8P 4DX1A 2XZDG 2F8XK 5CECB 2QYJA 3JUEA 5ITZF 3UXGA 1BD8A 3HG0D 2ETCA 2ETBA 1N11A 2F37A 5AN8A 1IXVA 2KXPC 4J7WA 3TWQA 4DX7D 4GPMA 2XZTG 2DZNA 5CBNA 1MYOA 3TWXA 2Y0BG 3IXEA 4QQIA 5HKPA 5BXUA 3HRAA 4QFVA 4O60A 3NOCD 5ENRD 3UTMA 3ZUVB 4CZ2D 1AP7A 1D9SA 5KBAA 2MYOA 4K5CA 1K1BA 1SVXA 5EIDA 4HRNA 5ENTD 5CEDB 3TWSA 1YYHA 4RLYA 3J5PA 2XEEA 4BESA 1N0RA 4BERA 4DX6D 1BI8B 2FO1E 2AJAA 3ZU7B 1WDYA 4LG6A 4A63B 2XEHA 4HNAD 5KWDA 5EILA 2L6BA 4ZFHA 1K3ZD 2VGEA 2JABA 4Z68A 3D9HA 3C5RA 4ATZD 3V2OA 2PNNA 4G8KA 3TWWA 5AAOA 1IKND 5EIBE 3TWTA 4DRXE 1UOHA 4N5QA 5FINA 3AJIA 4UUCA 2DZOA 2Y1LE 3B7BA 2HE0A 3EHRA 4K5AB 4U8YD 1NFIE 3JXIA 5AQAA 3T8KA 1IHBA 3F6QA 3ZNGA 5EYPF 4CYMD 3V79K 5D66A 4NIKA 2B0OE 5JMND 4BEPA 4LSZE 4ZHBA 4OAVB 5EN5D 1MX6A 4GMRA 4F6RD 5ENQD 3V30A 3LJNA 1S70B 5FIOA 5BXOA 3TWRA 4HRMB 4O1OA 1BLXB 4C48B 1N0QA 5CBOA 4DX2A 5AQ9A 3Q9NC 3J5QB 2A5EA 3Q9UC 5AQ7A 5HS0A 2ETAA 1YCSB 3DEOA 3ZKJA 2ZGGA 3T9KA 4J8YA 4HB5A 4G8LA 3TWUA 1OT8A 1YMPA 1A5EA 2RFAA 4BETA 2QC9A 4TUMA 1WG0A 3KEAA 4HLLA 2V5QC 1MX4A 3SO8A 3V31A 1G3NB 4OAUC 5EYLA 5AQBA 2RFMA 2F8YA 1MX2A 3DEPA 5ENSD 1OY3D 4BSZB 4YDWA 2DVWA 4HQDA 4O1PA 4DUIA 4U8VD 2KBXA 1DCQA 3NBNB 3NOGD 2NYJA 3V2XA 2DWZA 4YDYA 5CEAA 3W9GA 3EHQA 3JXJA 3EU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA4 D;  5HRY A;  2ZGD A;  1MJ0 A;  3TWV A;  5KNG A;  5ENP D;  4DX5 D;  5CER B;  2BKK B;  1BU9 A;  1SW6 A;  4K5B A;  5KNH D;  2V4H C;  4HBD A;  4HI9 A;  4HRL A;  4HI8 A;  5AAR A;  4F1P A;  4B93 B;  2BKG A;  1QYM A;  3W9F A;  1AWC B;  1BI7 B;  4U96 D;  2P2C P;  1DC2 A;  3UI2 A;  5ENO D;  3B95 A;  4U95 D;  1K1A A;  4LNU D;  1TR4 A;  3AAA C;  2J8S D;  2XEN A;  4JB8 P;  4DX1 A;  2XZD G;  2F8X K;  5CEC B;  2QYJ A;  3JUE A;  5ITZ F;  3UXG A;  1BD8 A;  3HG0 D;  2ETC A;  2ETB A;  1N11 A;  2F37 A;  5AN8 A;  1IXV A;  2KXP C;  4J7W A;  3TWQ A;  4DX7 D;  4GPM A;  2XZT G;  2DZN A;  5CBN A;  1MYO A;  3TWX A;  2Y0B G;  3IXE A;  4QQI A;  5HKP A;  5BXU A;  3HRA A;  4QFV A;  4O60 A;  3NOC D;  5ENR D;  3UTM A;  3ZUV B;  4CZ2 D;  1AP7 A;  1D9S A;  5KBA A;  2MYO A;  4K5C A;  1K1B A;  1SVX A;  5EID A;  4HRN A;  5ENT D;  5CED B;  3TWS A;  1YYH A;  4RLY A;  3J5P A;  2XEE A;  4BES A;  1N0R A;  4BER A;  4DX6 D;  1BI8 B;  2FO1 E;  2AJA A;  3ZU7 B;  1WDY A;  4LG6 A;  4A63 B;  2XEH A;  4HNA D;  5KWD A;  5EIL A;  2L6B A;  4ZFH A;  1K3Z D;  2VGE A;  2JAB A;  4Z68 A;  3D9H A;  3C5R A;  4ATZ D;  3V2O A;  2PNN A;  4G8K A;  3TWW A;  5AAO A;  1IKN D;  5EIB E;  3TWT A;  4DRX E;  1UOH A;  4N5Q A;  5FIN A;  3AJI A;  4UUC A;  2DZO A;  2Y1L E;  3B7B A;  2HE0 A;  3EHR A;  4K5A B;  4U8Y D;  1NFI E;  3JXI A;  5AQA A;  3T8K A;  1IHB A;  3F6Q A;  3ZNG A;  5EYP F;  4CYM D;  3V79 K;  5D66 A;  4NIK A;  2B0O E;  5JMN D;  4BEP A;  4LSZ E;  4ZHB A;  4OAV B;  5EN5 D;  1MX6 A;  4GMR A;  4F6R D;  5ENQ D;  3V30 A;  3LJN A;  1S70 B;  5FIO A;  5BXO A;  3TWR A;  4HRM B;  4O1O A;  1BLX B;  4C48 B;  1N0Q A;  5CBO A;  4DX2 A;  5AQ9 A;  3Q9N C;  3J5Q B;  2A5E A;  3Q9U C;  5AQ7 A;  5HS0 A;  2ETA A;  1YCS B;  3DEO A;  3ZKJ A;  2ZGG A;  3T9K A;  4J8Y A;  4HB5 A;  4G8L A;  3TWU A;  1OT8 A;  1YMP A;  1A5E A;  2RFA A;  4BET A;  2QC9 A;  4TUM A;  1WG0 A;  3KEA A;  4HLL A;  2V5Q C;  1MX4 A;  3SO8 A;  3V31 A;  1G3N B;  4OAU C;  5EYL A;  5AQB A;  2RFM A;  2F8Y A;  1MX2 A;  3DEP A;  5ENS D;  1OY3 D;  4BSZ B;  4YDW A;  2DVW A;  4HQD A;  4O1P A;  4DUI A;  4U8V D;  2KBX A;  1DCQ A;  3NBN B;  3NOG D;  2NYJ A;  3V2X A;  2DWZ A;  4YDY A;  5CEA A;  3W9G A;  3EHQ A;  3JXJ A;  3EU9 A; 
#chains in the Genus database with same CATH topology
 2VTB A;  1SW6 A;  2EIN E;  4HRL A;  4HOT A;  2PZI A;  5AAR A;  3B95 A;  4URK A;  3AAA C;  1H6K A;  5DBK A;  1IQU A;  3IV0 A;  5BW8 C;  4JEH A;  3CHM A;  1N4S A;  2XS8 A;  3O48 A;  4L1B A;  2WXL A;  2DCP A;  2XGS A;  2WXJ A;  3U3W A;  3E4B A;  1E7U A;  3UT4 A;  4HRN A;  4UI9 K;  5FQ8 A;  3CK9 A;  4GZ5 A;  1H0A A;  3UMV A;  4CGW A;  4ATZ D;  4BES A;  4JD2 G;  2OEV A;  4OAV B;  3LJN A;  1TNU A;  1N0Q A;  2OND A;  3PEV B;  4CDR A;  2A5E A;  4AY6 A;  2VSX E;  3DEO A;  4J8Y A;  4EZL A;  2YQ8 A;  5AQB A;  4MS6 A;  1O5M A;  1PC2 A;  1X81 A;  4G11 A;  3FEX A;  1DCQ A;  3C3Q A;  2X6I A;  3ABL E;  3ZU7 B;  1OXJ A;  4NUR A;  3KEZ A;  4BTA A;  5ENP D;  3C98 A;  2V4H C;  3DST A;  2LSU A;  1QZ2 A;  3MCX A;  4ILI A;  3UT8 A;  2B6C A;  3ASF A;  3FH8 A;  2X6H A;  3RU0 A;  3FWV A;  1NZN A;  2J08 A;  3E32 A;  4UQY A;  4OVV A;  1TJC A;  1YYH A;  3DWL G;  4G23 A;  3CR3 A;  4XKB A;  5G04 J;  4ZFH A;  4M3O A;  1GW6 A;  3AJI A;  3FH5 A;  2DZO A;  3PNL B;  4KBQ A;  2A4Z A;  5AYW D;  4I9E A;  3CQC B;  4TXP A;  1BLX B;  1OCC E;  5AQ9 A;  2ZIR A;  2P9S G;  3QWV A;  5FZS A;  1O1S A;  4BET A;  3R9A B;  1LD8 A;  3FUD A;  3DRA A;  1QBQ A;  4Q94 A;  3B13 A;  3SFX A;  2VSO E;  4WWN A;  4J0U A;  1H19 A;  2CHZ A;  4I2W A;  1TNZ A;  4L2Y A;  4ANW A;  1TEZ A;  5AIJ A;  3MEK A;  3KD7 A;  5CRV A;  3WG7 E;  2OOE A;  1BI7 B;  1O1R A;  1WY6 A;  2R5S A;  3HHM A;  3T5X A;  2ILR A;  3C3R A;  4JB8 P;  3LY7 A;  4WND A;  4ANV A;  3I4G A;  2XRZ A;  4TV3 A;  3CVX A;  3CK7 A;  1DCE A;  2KZT A;  3DXK G;  3TWX A;  4FHK A;  2BTD A;  3SGH A;  5A23 A;  5LCW C;  5C2Y A;  4RG9 A;  3J5P A;  2XEE A;  3G2U A;  4R7L A;  2AJA A;  1WDY A;  3SBT B;  3EIQ C;  4Z68 A;  3C5R A;  4DJA A;  1VDY A;  4CT4 A;  3ZRH A;  2IOS A;  3ZYQ A;  4OYS A;  3OTN A;  4ACK A;  3MV2 B;  4ACL A;  2OEW A;  3D9K A;  2I9C A;  3S7J A;  5D0Q D;  4MKT A;  5KJK A;  3L16 A;  2GRP B;  2QC9 A;  2V5Q C;  5CCL A;  1H2V C;  3L13 A;  1FVF A;  1OWP A;  4HQD A;  3DXM G;  3AU5 A;  4A55 A;  3I3N A;  3NOG D;  3D9I A;  1XGW A;  4M7C A;  3FUN A;  5KNG A;  4APO A;  5KNH D;  2WXF A;  3GZS A;  3RO3 A;  4TRQ A;  4KVO A;  4N3A A;  2L0I A;  4KVM A;  2UY1 A;  5ENO D;  4YDE A;  2I6H A;  3HXE A;  4Y6C A;  3SFZ A;  5BUZ A;  1N94 A;  2ETB A;  5AN8 A;  1IXV A;  1N4R A;  1HX8 A;  1MYO A;  3FP3 A;  5EDS A;  4CZ2 D;  3ML8 A;  4L23 A;  2FEZ A;  2MYO A;  5CED B;  1DVP A;  1D8E A;  3SF4 A;  2Y4U A;  4GA0 A;  2VGE A;  3QAQ A;  5EX3 A;  3UM0 A;  2EIM E;  3D9J A;  1TN8 A;  1ELK A;  4AXH A;  3LKU A;  3TWR A;  3RO2 A;  2CFU A;  4GZ6 A;  4J6I A;  5H7P A;  5AQ7 A;  4GML A;  1QNF A;  4MBG A;  4FJZ A;  1H6P A;  3V31 A;  1UW4 B;  4UQX A;  4DPR A;  3Q73 A;  3B7R L;  4O1P A;  2KBX A;  2R05 A;  4GTM A;  3ZFW A;  2DWZ A;  3G2W A;  3P2B A;  2LAH A;  2HYZ A;  3EHM A;  4HBD A;  3S2A A;  2P9I G;  3ONK A;  1EYH A;  5FJY A;  3UI2 A;  2E0I A;  1EPU A;  3CEQ A;  4LEU A;  2AXU A;  4U63 A;  3PZ1 A;  1E90 A;  1KT1 A;  3LY8 A;  5AJL A;  2DBA A;  3QOU A;  1HF8 A;  4CDM A;  2L6J A;  4GTR A;  3TWQ A;  4ANX A;  1HZ4 A;  2Y0B G;  2P58 C;  4O60 A;  2GGF A;  3LVQ E;  2WXM A;  3RRU A;  5T8I A;  3MKQ B;  4GYW A;  2VGY A;  1S64 A;  2J09 A;  4A63 B;  3AG3 E;  2ZXW E;  4AJW A;  2OVB A;  5FIN A;  1V55 E;  4NAC A;  4CYM D;  5AQA A;  3ZNG A;  2HR2 A;  2UWJ G;  3ISM C;  2B0O E;  5JMN D;  4LSZ E;  3OXL A;  3QWW A;  2J4D A;  2QFC A;  3DSU A;  3QB2 A;  4C48 B;  4KZC A;  5B1A E;  4F7A A;  4WNG A;  2KC7 A;  2C2L A;  2EQX A;  2FO7 A;  2ZGG A;  3ZYL A;  5FQ6 A;  2IEJ A;  3I5P A;  4CRW A;  3LDZ A;  3FTZ A;  3EUV A;  1QQE A;  2XRY A;  4IN3 B;  5E75 A;  3ZGQ A;  2WMO A;  3TXM A;  4GTO A;  2WXO A;  4EPZ A;  5JHA A;  4GA2 A;  1P5Q A;  5CEA A;  1SZ9 A;  4XE0 A;  1Q2Z A;  5CER B;  2BKK B;  4H7Y A;  5FTP A;  1QYM A;  4FU3 A;  3B7T A;  2R59 A;  2V4L A;  2X38 A;  3PRE A;  3NZS A;  3ABM E;  4U04 A;  2LSV A;  4LNG A;  1U3C A;  2QYJ A;  3CGH A;  1JWG A;  3GYZ A;  1BD8 A;  2ETC A;  4GA1 A;  1ELR A;  1N11 A;  1E7V A;  4GTT A;  4TUU A;  3NB2 A;  4UWF A;  3HVE A;  1AP7 A;  4AV7 A;  3N71 A;  4DK5 A;  4JC8 A;  3TWS A;  3GZ2 A;  3QWP A;  4GCN A;  2XEH A;  3FUK A;  2H6F A;  3ASG A;  1EDU A;  3GZ1 A;  4TXR A;  3U66 A;  1N4Q A;  2P9U G;  3T8K A;  3TG5 A;  3F6Q A;  3FU5 A;  4RQI A;  2DYR E;  2WXQ A;  3FUF A;  5ENQ D;  3JYS A;  4ILH B;  5BXO A;  5FIO A;  2GRL A;  1IQR A;  2Y69 E;  4CDN A;  3CIA A;  2GRR B;  1Z5S C;  2DYS E;  4GZC A;  3TWU A;  2WXN A;  3APD A;  2X3M A;  5KJN A;  1N95 A;  3ZYK A;  3AG2 E;  3NBN B;  2OVF A;  3ENE A;  4OVU A;  3SY2 A;  3E33 A;  3FU6 A;  4JZY A;  4YVQ C;  2IJG X;  1NA3 A;  2WXK A;  5B1B E;  1HXI A;  1K1A A;  1TN6 A;  3E30 A;  3HVE B;  1XNF A;  3VLF A;  2OCC E;  3JUE A;  2IO3 C;  4AY5 A;  5HQ8 A;  4G2V A;  3LXU X;  4Y6W A;  1KZP A;  3G2S A;  3UTM A;  1E8X A;  5CRU A;  3CLJ A;  4F53 A;  2HM8 A;  3ML9 A;  1N0R A;  3SQV A;  4FAD A;  3CHQ A;  1HU3 A;  4LG6 A;  3ZIM A;  3FTW A;  2V8S E;  1OWL A;  4GTQ A;  4D10 C;  2LNI A;  1IKN D;  5FWQ A;  4JHK A;  1A17 A;  4W9R A;  4APF A;  2YHC A;  1L5J A;  5E76 A;  4I17 A;  2JLB A;  1INZ A;  3FTV A;  4LCT A;  3BG0 B;  3MV3 B;  3ZKJ A;  4BFR A;  4HB5 A;  2RG8 A;  3EDT B;  2RFA A;  3SO8 A;  1IHG A;  2PQR A;  2LAI A;  2F8Y A;  2CG2 A;  3DSS A;  4YDW A;  5ARG A;  3UM1 A;  4C0M A;  5CCM A;  2XS1 A;  3HIZ A;  4J8E A;  4MRU A;  3CQG B;  4HI9 A;  1KT0 A;  4ILG A;  2BKG A;  4JHJ A;  3PVL A;  2ION A;  3ZYM A;  4UWK A;  4C0E A;  4U95 D;  2ZIS A;  4V3I A;  1TR4 A;  4LRZ A;  1OUV A;  4N2Q A;  4J8D A;  1OCR E;  1JWF A;  4I1M A;  4WWO A;  2F37 A;  1D8D A;  5T4Y A;  2WQ6 A;  4IYP A;  4DX7 D;  2PQN A;  3L82 A;  4ATG A;  1ZBP A;  5BXU A;  2PM6 A;  4EHM A;  3R7R A;  3BEE A;  4HOQ A;  4JPS A;  4HOR A;  5G55 A;  4N3C A;  5KWD A;  3DSV A;  4GTP A;  4EEC A;  3D9H A;  3D3M A;  5EIB E;  3CVY A;  4U8Y D;  3IHV A;  4BWR A;  1HFA A;  1SA4 A;  1NI1 A;  3KAE A;  2VTB B;  4WNF A;  5HI7 A;  1MX6 A;  4F6R D;  3RJV A;  4HRM B;  3FUE A;  3IKO B;  4DX2 A;  3FH7 A;  3FY4 A;  3Q49 B;  5HS0 A;  2Y4T A;  2VGX A;  3QC1 A;  2IU1 A;  1PY1 A;  3L22 A;  1G3N B;  3BQO A;  5EYL A;  3ZPJ A;  2P9K G;  5LFA A;  4RVB A;  5FQ7 A;  4PDX A;  4DUI A;  3UPV A;  2R2L A;  3EHQ A;  2C0L A;  5DIZ A;  1Y8M A;  1WM5 A;  3IHY A;  2XCC A;  3CHS A;  2WB2 A;  4AM9 A;  4B93 B;  1B89 A;  3C3O A;  1OWO A;  1Y6I A;  3OXF A;  4N39 A;  3ULY A;  3UIN C;  4EBA G;  1PAQ A;  1SA5 A;  4UWL A;  3ESK A;  4EZK A;  4ABN A;  2KZT B;  4KXK B;  1FCH A;  2EIK E;  4FLH A;  1JCQ A;  4U0U A;  2WQH A;  4G26 A;  1SVX A;  4JVS A;  1ELW A;  2AXZ A;  3ASO E;  2GW1 A;  3U64 A;  3JCK C;  5ANL A;  2L6B A;  3SI5 A;  3UIO C;  3AG4 E;  3Q47 B;  3IBE A;  3ZW3 A;  4BX8 A;  4XKC A;  3ZXS A;  3MGB A;  1UOH A;  4UUC A;  3JXI A;  2Q7F A;  2I1K A;  4HOS A;  1S63 A;  5B3S E;  4C9B B;  3LJ3 A;  5J08 A;  5KJM A;  3V30 A;  2WXI A;  3D9P A;  5BV1 A;  3ZN3 A;  4A1S A;  3ZVV A;  4Q69 A;  2R02 A;  3E34 A;  1O1T A;  4KT6 B;  3UKR G;  3QKY A;  4BT8 A;  3PRZ A;  1E8W A;  2AVP A;  4ANU A;  5AJD A;  2V0P A;  1NP7 A;  3CVL A;  2FUL A;  3PZD A;  5HRY A;  5J90 A;  1FT2 A;  1BU9 A;  5LCW J;  2F0Y A;  4I2Z A;  3JUI A;  4B0Z A;  4U7E B;  3W9F A;  3S7D A;  3CV0 A;  4WNE A;  3UM2 A;  2J8S D;  4K0R A;  2XZD G;  3MKQ A;  3DSW A;  2XPY A;  3FDH A;  3VTY A;  2WXR A;  2PL2 A;  2LUH A;  3PZ4 A;  1S0P A;  5ENN A;  4DI3 A;  2BED A;  2EIJ E;  2DZN A;  5KCM A;  5KBA A;  1HO8 A;  3FTS A;  1MZC A;  1OWN A;  3KS2 A;  3VLD A;  4GU5 A;  2WQ7 A;  3G2V A;  4L7T A;  3V2O A;  3MJW A;  4N5Q A;  4IUL A;  1SZA A;  4E85 A;  4BTB A;  2QY7 A;  2XPZ A;  5G05 C;  4WWP A;  2IFU A;  3SHF A;  4GMR A;  1NL4 A;  4E6H A;  4MLP A;  5CBO A;  4HVB A;  4WAF A;  3FUL A;  1KPS B;  2CHW A;  4HOU A;  4IRU A;  4YND A;  4UI9 C;  1E8Y A;  1BPO A;  2RFM A;  1MX2 A;  5ENS D;  3HXC A;  2I1J A;  3TL5 A;  2NYJ A;  3Q4A B;  2AW6 A;  3EU9 A;  4PUC A;  4F3V A;  4DI4 A;  5JA4 D;  1ZB1 A;  3TWV A;  2A5U A;  5D2M C;  3AS8 A;  3QNK A;  1ZU2 A;  3HXB A;  5KJL A;  3SD5 A;  2NC9 A;  3PZ2 A;  4KMO A;  4A3V A;  3L08 A;  5JJ7 A;  3RK6 A;  3S7F A;  3PUJ A;  4DX1 A;  2FBN A;  5G05 J;  3DPD A;  4AOF A;  3KSL A;  3CKC A;  4B8C B;  2KCV A;  2IOL A;  2X6J A;  4LER A;  5ARF A;  4AP2 A;  4XX5 A;  4GPM A;  2VSY A;  3CHR A;  5HKP A;  4NRH B;  4XZ4 A;  2XCB A;  5ENT D;  2CG3 A;  3VTX A;  3RRN B;  1BI8 B;  4BSX A;  4UQZ A;  2XHE A;  1Z3Y A;  2WMN A;  4I6E A;  1W3B A;  1K3Z D;  3ZXP A;  4A1G A;  3TWW A;  4CCA A;  3D9M A;  4K5A B;  2MHK A;  2WM9 A;  2JEK A;  3EJN A;  4BX9 A;  1UJJ A;  3TAX A;  2WXH A;  4GYY A;  4N5C A;  4I1A A;  3Q15 A;  3L17 A;  2UY1 B;  2GRM A;  4U07 A;  3CVU A;  4FLB A;  4XI9 A;  4HLL A;  3EHN A;  1LTX A;  4P29 A;  4OAU C;  1LD7 A;  3DEP A;  4HXI A;  4JL0 A;  2XEV A;  4DLO A;  4I1O B;  3UQ3 A;  2IY0 C;  4AIF A;  2GRN B;  3MZL B;  4LNB A;  2H6I A;  4J8S A;  3CK8 A;  4JW1 A;  2H6G A;  3LY9 A;  1HG5 A;  3FUM A;  2R17 C;  3CST A;  2P9L G;  5BNW A;  4KZ0 A;  3UT7 A;  2OV8 A;  1Z6T A;  1OCO E;  2IF4 A;  3ABK E;  5FZQ A;  4G25 A;  1UG3 A;  2F8X K;  3FU0 A;  2EIL E;  3ZHE A;  1JUQ A;  3DBS A;  1OCZ E;  3RSE G;  4HLE A;  1HH8 A;  3Q7A A;  2QZA A;  4B89 A;  3CVW A;  2KAT A;  3B7S A;  3NAW A;  5BT1 A;  2VSN A;  3AU4 A;  1E96 B;  4RG6 A;  4AEZ C;  3CVP A;  3FTY A;  1NFI E;  1HS6 A;  5EYP F;  4GYO A;  2J07 A;  4ZHB A;  3PEU B;  2FF4 A;  5EN5 D;  3PS6 A;  4ME2 A;  4DLQ A;  1HG2 A;  4O1O A;  3MX3 A;  1V54 E;  3AS4 A;  3MYV A;  3J5Q B;  1YCS B;  2J9Q A;  1KLX A;  3FUJ A;  4G8L A;  3Q7F A;  4N2S A;  4CT0 A;  4PS3 A;  2ZU6 B;  4U8H A;  4U0S A;  3LEW A;  5IY5 E;  4BSZ B;  4GTS A;  2MOW A;  3CVN A;  3PUK A;  2MRI A;  2XGO A;  4RSY A;  3UKU G;  1N52 A;  5CMW A;  2KM4 A;  3FTU A;  4XEI G;  1YMP A;  3JXJ A;  1OWM A;  3FU3 A;  4DX5 D;  4H7X A;  1TNO A;  4HI8 A;  4U0Z A;  1AWC B;  1TN7 A;  4U96 D;  4XI0 A;  4JEU A;  4LNU D;  1FT1 A;  1U3D A;  3FHE A;  1TJF A;  2BUG A;  5CEC B;  4I9C A;  4GB9 A;  3TG4 A;  3CVV A;  2VQ2 A;  4X8Q A;  3FFL A;  1UN8 A;  3JQ0 A;  2BF0 X;  2GRO B;  2RD0 A;  3L54 A;  3CVQ A;  5CBN A;  1N4P A;  2L0T B;  2DIW A;  1SQM A;  3NOC D;  3MA5 A;  5CHE E;  2YIN A;  1JCR A;  3RAU A;  4DX6 D;  3OAW A;  1UN9 A;  5M72 A;  4HNA D;  3EIJ A;  2JAB A;  2VJ8 A;  4PS7 A;  3ZEF A;  3SNX A;  2PNN A;  3LCA A;  3UXG A;  2Y1L E;  3B7B A;  1MQS A;  4FUL A;  4JHR A;  3HXF A;  5D66 A;  4NIK A;  3QK0 A;  5JJT A;  5A6C A;  4BEP A;  3LS8 A;  2E2E A;  2QYU A;  4GAA A;  3ESL A;  4I6J A;  3RIB A;  1Z3X A;  3U4T A;  4L2L A;  3PNT B;  3QDN A;  1WAO 1;  2M63 A;  3SBS A;  3T9K A;  5EKQ D;  2X6K A;  4TUM A;  1UJK A;  1HE8 A;  3DPY A;  1MX4 A;  1KZO A;  3ASD A;  2DVW A;  2AXV A;  3CHO A;  4U8V D;  4UWH A;  4CEM A;  3W9G A;  5FQ4 A;  2ZGD A;  3K9I A;  1MJ0 A;  3O4Z A;  4F1P A;  3BG1 B;  3UUX A;  1DC2 A;  4B8A A;  4FHJ A;  1DNP A;  2GRQ B;  3D9L A;  3C72 A;  3QAR A;  4YVO A;  2LXM A;  5JHB A;  3HG0 D;  2Y3A A;  2H6H A;  5BPP A;  3OXG A;  4F1S A;  3TGO A;  1D9S A;  1JCS A;  3U9W A;  3E37 A;  5ANR A;  3G2T A;  2KCL A;  1K8K G;  1K1B A;  4K5C A;  5EX0 A;  3TJP A;  1LF8 A;  4RLY A;  3QJZ A;  3HYM B;  2FI7 A;  5AEN A;  2J4B A;  4B94 A;  2WXP A;  5D0O D;  3BU8 A;  1H6O A;  3L9T A;  3Q78 A;  1N9A A;  3BUA A;  3P1U A;  3MKR A;  2YNQ A;  2WVI A;  2WXG A;  1YA0 A;  2NXP A;  3FTX A;  2LO6 A;  1NA0 A;  3UIP C;  4UI9 J;  2HO1 A;  5BV0 A;  4FJY A;  1TYQ G;  2NSZ A;  3PZ3 A;  3S7B A;  1RZ4 A;  3V2X A;  4G1T A;  3ZUV B;  3HXD A;  3DSX A;  5FT9 A;  2P2C P;  4PH4 B;  3NF1 A;  3AS5 A;  4I43 A;  4XIF A;  2CHX A;  3LYA A;  2XEN A;  3X2Q E;  4A3T A;  3LVR E;  5T3R A;  3TXN A;  3FUH A;  3IEG A;  5ITZ F;  3JQ1 A;  3Q79 A;  3R9M A;  2XGM A;  5A7D B;  2P9N G;  3NZU A;  5JJ6 A;  3NQP A;  2RKK A;  4J7W A;  1TNY A;  3GW4 A;  2XZT G;  4BT9 A;  2VYI A;  3IXE A;  2L9B A;  3HRA A;  4QFV A;  5ENR D;  3RRM B;  1FVH A;  3URZ A;  4JA7 A;  1RW2 A;  3PE4 A;  4BER A;  2FO1 E;  5G2N A;  4G24 A;  4AVX A;  4CGV A;  2PM7 A;  3ZHE B;  4EBA A;  4G8K A;  3KSQ A;  3LPZ A;  2HE0 A;  3EHR A;  1IHB A;  5CMY A;  3VLE A;  1S70 B;  4GCO A;  1H2U A;  4NQ0 A;  3ONL A;  2VGX B;  3Q9N C;  4FP7 A;  3Q9U C;  4J8F A;  5C1D A;  3D9O A;  4PS8 A;  3ULQ A;  1OT8 A;  1A5E A;  3PDN A;  5G04 C;  1WG0 A;  3UX4 A;  3UM3 A;  4UWG A;  1OY3 D;  3T5V A;  2C0M A;  5LOZ A;  2XQ0 A;  5FZR A;  3SZ7 A;  4YDY A;  4FA6 A;  2WPV A;  4K5B A;  3ASN E;  1U2V G;  2X6F A;  3PE3 A;  1FPP A;  1X5B A;  3HDX A;  4HS2 A;  4FC8 A;  3CKB A;  4GPK A;  3Q75 A;  3D9N A;  1TNB A;  3APC A;  5LX8 A;  4WUY A;  4KYO B;  3R7Q A;  2KXP C;  4EQF A;  4TXQ A;  5LP0 A;  3ULE G;  2IQC A;  4QQI A;  3PH0 C;  4LUN U;  3APF A;  2XPI A;  5EID A;  4O6F A;  3CSF A;  4GMJ A;  4GZ3 A;  4K03 A;  3AG1 E;  4N3B A;  2LXL A;  5EIL A;  1JPL A;  1N54 A;  4YDO A;  2V5F A;  5AAO A;  3TWT A;  4DRX E;  3L6A A;  2I2O A;  4BY6 A;  3B7U X;  3V79 K;  2J49 A;  2YHE A;  2P9P G;  3RKV A;  2KCK A;  3WXX A;  3FEY A;  4JXT A;  1IYG A;  1H2T C;  3ASH A;  2ETA A;  3Q5M A;  3SFY A;  4GZD A;  1E8Z A;  2R03 A;  1MHQ A;  3KEA A;  3EU5 A;  3I4R B;  2CFZ A;  4I6G A;  4Q96 A;  4HFG A;  3CHP A;  4GTV A;  2IO2 C;  4JA9 A;  3T8M A;  2AWI A;  4L9P A;  4EZJ A;  3FUI A;  1EF1 C; 
#chains in the Genus database with same CATH homology
 5JA4 D;  5HRY A;  2ZGD A;  1MJ0 A;  3TWV A;  5KNG A;  5ENP D;  4DX5 D;  5CER B;  2BKK B;  1BU9 A;  1SW6 A;  4K5B A;  5KNH D;  2V4H C;  4HBD A;  4HI9 A;  4HRL A;  4HI8 A;  5AAR A;  4F1P A;  4B93 B;  2BKG A;  1QYM A;  3W9F A;  1AWC B;  1BI7 B;  4U96 D;  2P2C P;  1DC2 A;  3UI2 A;  5ENO D;  3B95 A;  4U95 D;  1K1A A;  4LNU D;  1TR4 A;  3AAA C;  2J8S D;  2XEN A;  4JB8 P;  4DX1 A;  2XZD G;  2F8X K;  5CEC B;  2QYJ A;  3JUE A;  5ITZ F;  3UXG A;  1BD8 A;  3HG0 D;  2ETC A;  2ETB A;  1N11 A;  2F37 A;  5AN8 A;  1IXV A;  2KXP C;  4J7W A;  3TWQ A;  4DX7 D;  4GPM A;  2XZT G;  2DZN A;  5CBN A;  1MYO A;  3TWX A;  2Y0B G;  3IXE A;  4QQI A;  5HKP A;  5BXU A;  3HRA A;  4QFV A;  4O60 A;  3NOC D;  5ENR D;  3UTM A;  3ZUV B;  4CZ2 D;  1AP7 A;  1D9S A;  5KBA A;  2MYO A;  4K5C A;  1K1B A;  1SVX A;  5EID A;  4HRN A;  5ENT D;  5CED B;  3TWS A;  1YYH A;  4RLY A;  3J5P A;  2XEE A;  4BES A;  1N0R A;  4BER A;  4DX6 D;  1BI8 B;  2FO1 E;  2AJA A;  3ZU7 B;  1WDY A;  4LG6 A;  4A63 B;  2XEH A;  4HNA D;  5KWD A;  5EIL A;  2L6B A;  4ZFH A;  1K3Z D;  2VGE A;  2JAB A;  4Z68 A;  3D9H A;  3C5R A;  4ATZ D;  3V2O A;  2PNN A;  4G8K A;  3TWW A;  5AAO A;  1IKN D;  5EIB E;  3TWT A;  4DRX E;  1UOH A;  4N5Q A;  5FIN A;  3AJI A;  4UUC A;  2DZO A;  2Y1L E;  3B7B A;  2HE0 A;  3EHR A;  4K5A B;  4U8Y D;  1NFI E;  3JXI A;  5AQA A;  3T8K A;  1IHB A;  3F6Q A;  3ZNG A;  5EYP F;  4CYM D;  3V79 K;  5D66 A;  4NIK A;  2B0O E;  5JMN D;  4BEP A;  4LSZ E;  4ZHB A;  4OAV B;  5EN5 D;  1MX6 A;  4GMR A;  4F6R D;  5ENQ D;  3V30 A;  3LJN A;  1S70 B;  5FIO A;  5BXO A;  3TWR A;  4HRM B;  4O1O A;  1BLX B;  4C48 B;  1N0Q A;  5CBO A;  4DX2 A;  5AQ9 A;  3Q9N C;  3J5Q B;  2A5E A;  3Q9U C;  5AQ7 A;  5HS0 A;  2ETA A;  1YCS B;  3DEO A;  3ZKJ A;  2ZGG A;  3T9K A;  4J8Y A;  4HB5 A;  4G8L A;  3TWU A;  1OT8 A;  1YMP A;  1A5E A;  2RFA A;  4BET A;  2QC9 A;  4TUM A;  1WG0 A;  3KEA A;  4HLL A;  2V5Q C;  1MX4 A;  3SO8 A;  3V31 A;  1G3N B;  4OAU C;  5EYL A;  5AQB A;  2RFM A;  2F8Y A;  1MX2 A;  3DEP A;  5ENS D;  1OY3 D;  4BSZ B;  4YDW A;  2DVW A;  4HQD A;  4O1P A;  4DUI A;  4U8V D;  2KBX A;  1DCQ A;  3NBN B;  3NOG D;  2NYJ A;  3V2X A;  2DWZ A;  4YDY A;  5CEA A;  3W9G A;  3EHQ A;  3JXJ A;  3EU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...