4U8YD

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 50
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u8yD00
3JXJA 2JABA 2XZTG 1MX4A 5KBAA 3EHRA 1IXVA 4OAUC 3UXGA 5ENTD 3W9GA 5EIBE 3C5RA 4O1OA 5KWDA 4HB5A 4G8KA 3V2XA 3V2OA 3ZUVB 5D66A 2L6BA 5ENRD 1N0QA 4F6RD 1BI7B 3V31A 5JMND 4U96D 4DX1A 3J5PA 5EILA 3NOCD 2RFAA 4ATZD 4DRXE 4U95D 5AQ7A 5CEDB 5FINA 1MX6A 3UTMA 1K3ZD 2Y1LE 4U8VD 4Z68A 4QQIA 5CBNA 5JA4D 3V79K 4GMRA 1AWCB 5ENOD 1WG0A 1K1BA 3J5QB 4BERA 1IKND 1OY3D 1MJ0A 1MX2A 3HRAA 2XEEA 4K5CA 5ENSD 3ZKJA 4OAVB 4DX5D 5BXUA 4F1PA 2QC9A 1YMPA 4DUIA 1N0RA 3F6QA 3Q9NC 1WDYA 2FO1E 1TR4A 4HI8A 4UUCA 3T8KA 1DCQA 3TWWA 3T9KA 4JB8P 4C48B 5BXOA 5CERB 3KEAA 4O60A 5EN5D 3IXEA 2BKGA 4HRMB 2RFMA 4ZHBA 1S70B 3TWUA 4HBDA 1DC2A 5AQBA 2KBXA 3Q9UC 4LG6A 4BETA 5HS0A 5ITZF 4DX2A 3NOGD 2DWZA 3EHQA 5EYPF 3TWVA 2ZGDA 2DVWA 5FIOA 5ENPD 3B7BA 3TWTA 5CBOA 2XZDG 5EIDA 2V4HC 4NIKA 3SO8A 4HI9A 5CECB 4J8YA 3ZNGA 2ZGGA 2ETAA 2J8SD 2XENA 3B95A 2F8YA 4K5BA 1IHBA 2Y0BG 3TWXA 1YCSB 4CYMD 2MYOA 2F8XK 1BU9A 5CEAA 1BD8A 1G3NB 4LNUD 4LSZE 5KNGA 1SVXA 4K5AB 5AQ9A 1MYOA 4G8LA 4HQDA 4U8YD 4YDWA 1AP7A 2P2CP 4HRLA 3ZU7B 2XEHA 3TWRA 1K1AA 4A63B 3LJNA 5HKPA 1BLXB 2QYJA 1QYMA 4N5QA 1SW6A 4J7WA 3D9HA 2PNNA 2HE0A 1NFIE 2V5QC 4HLLA 5AN8A 2F37A 3TWSA 1YYHA 1BI8B 2DZOA 4RLYA 1N11A 4HNAD 4YDYA 3UI2A 5AAOA 3JXIA 4BSZB 4O1PA 1UOHA 2NYJA 3DEPA 3AAAC 2AJAA 3AJIA 4GPMA 4CZ2D 4BEPA 2KXPC 2BKKB 3V30A 3TWQA 3NBNB 3EU9A 2A5EA 2ETBA 5ENQD 4DX6D 2DZNA 3DEOA 5EYLA 3HG0D 4TUMA 5AARA 2B0OE 4DX7D 1D9SA 4BESA 1OT8A 4QFVA 2VGEA 4HRNA 1A5EA 5AQAA 5HRYA 2ETCA 4ZFHA 4B93B 3JUEA 5KNHD 3W9FA
chains in the Genus database with same CATH superfamily
5KBAA 3ASDA 4OAUC 3AG3E 3C5RA 5KWDA 4HOSA 2PM6A 5JJTA 4AY5A 3CKCA 1K3ZD 2YQ8A 3BG1B 4Z68A 4WNFA 3DSUA 4U0ZA 1WG0A 4L1BA 3ZFWA 3T8MA 5BUZA 2IY0C 4U0UA 2I9CA 3FTZA 2XEVA 5BXOA 1DVPA 2VSYA 3EIQC 3NZSA 5G04C 3RRUA 2WXMA 2KBXA 4LEUA 3WG7E 2DVWA 2L0TB 1U3CA 5ENPD 3VTYA 1EDUA 2ZIRA 3TG5A 1Z3XA 3HXCA 4K5BA 3IV0A 2GRQB 3LEWA 1H0AA 1X5BA 3EIJA 3CK7A 3I5PA 1INZA 5AENA 3D9IA 1FPPA 2YHEA 4HORA 4DLQA 1BI8B 4YVQC 3ZVVA 4G1TA 3BG0B 3NBNB 5D0QD 1HS6A 4XKBA 2F0YA 3FH7A 1D9SA 1O5MA 4GTSA 3FP3A 3PZ4A 1H6PA 1IXVA 3E33A 3FTXA 3EU5A 4BX8A 2P9KG 3V2OA 3RK6A 1ZB1A 1E8WA 3PUKA 5AQ7A 3FHEA 1N94A 4YVOA 5ENOD 2I1JA 3EHMA 5ENSD 3U9WA 4OAVB 3PNLB 4F1PA 2QC9A 3ENEA 4FLBA 4B94A 3S2AA 3GW4A 2IO3C 4EZLA 5B1AE 4O60A 3LDZA 3LXUX 2X6FA 4JL0A 4M7CA 4ANVA 4UWKA 3Q9UC 3IHVA 4ACKA 2OEWA 5FQ8A 1OWOA 3FUIA 3SO8A 2FO7A 2FULA 3ZNGA 4GZDA 2MYOA 2R17C 4OVVA 2J9QA 2P9NG 4HOTA 1AP7A 1YA0A 5FWQA 3TJPA 3CVVA 2AXUA 5HKPA 3QDNA 3S7BA 2OCCE 2MOWA 5EKQD 2PNNA 3NQPA 1N11A 4GZCA 4NURA 2WQHA 3MKQA 2WXHA 3NB2A 1N4SA 4DX6D 2ETBA 4WNDA 2B0OE 4HOUA 1HU3A 3AS4A 2XRYA 5HRYA 4G11A 5J08A 4J6IA 1MX4A 5G04J 4U8HA 4GMLA 3SF4A 3P1UA 4A3VA 2R5SA 4CT4A 4EBAG 4ATGA 4V3IA 2J09A 4QQIA 4KYOB 4OYSA 5DIZA 4I6EA 1BPOA 4I9CA 4A1GA 4HI8A 3T8KA 4U7EB 3PDNA 3L17A 5KJMA 3FEYA 4ZHBA 4O6FA 1S70B 3CVUA 4BTBA 2WQ7A 1SA4A 3CHSA 4DX2A 1D8EA 2LO6A 3ZYMA 5ENNA 2R03A 1JCQA 4BX9A 2VGXA 5M72A 2VSNA 5G05J 1BU9A 2CHZA 2P58C 3AU4A 4N39A 4E85A 4HLEA 5CHEE 2IF4A 2OOEA 5AQ9A 4C9BB 1HH8A 3Q79A 4EZKA 3CVWA 2XPIA 3LCAA 1JUQA 2X38A 4AJWA 3PE4A 2V5QC 1N4QA 1NA0A 4CGVA 4FADA 4BT8A 5CCMA 3KSQA 4N2QA 4CZ2D 2L9BA 2BKKB 5T3RA 3HHMA 3HXFA 3CEQA 3VLFA 5BW8C 4GTQA 4N3BA 4UQYA 4U63A 2NSZA 2FI7A 4H7XA 2A4ZA 4URKA 4I2WA 4FJYA 5H7PA 2WXPA 1BI7B 1LD8A 3E4BA 1ELRA 1MHQA 1IYGA 2LSVA 3D9LA 1MJ0A 3C3QA 2XCCA 3ZKJA 4YDEA 3PUJA 3G2UA 4JHRA 4D10C 2X6KA 1OWMA 1MQSA 4I1MA 3Q5MA 4WNGA 4FHJA 3MGBA 1KZOA 3UINC 3LY9A 4IYPA 2IU1A 3OXFA 3ZHEB 2P9UG 4EHMA 2F8YA 1YCSB 5BV1A 1IQRA 1BD8A 3R9MA 3B7UX 4HQDA 4MRUA 4HRLA 4ABNA 1TN7A 2QYJA 4A55A 4DJAA 5A7DB 2HR2A 1YYHA 3G2SA 3IBEA 5CRUA 3SFYA 4GAAA 4GMJA 3R7RA 3EU9A 2VTBA 4FA6A 4UQZA 3CKBA 2AXVA 3FUDA 3W9FA 2FF4A 4J8DA 1K8KG 3T5VA 1ZU2A 5ENTD 4G23A 1JPLA 5D66A 3R9AB 1N0QA 2DYSE 4DX1A 4XX5A 4EBAA 4J8FA 2EQXA 1IQUA 4TUUA 2ZU6B 1AWCB 3C3RA 1N95A 3FEXA 2AXZA 3FWVA 4GTTA 4YDOA 4YNDA 4XIFA 1S63A 3ZYQA 1EPUA 3U3WA 4LNBA 3FTSA 2J49A 2WXKA 5EDSA 1L5JA 1KT0A 3AG2E 5EN5D 4HRMB 2GRPB 2CHWA 2IOLA 3IKOB 4B89A 5IY5E 2VTBB 4WAFA 4Y6CA 3I4GA 3ULEG 3SQVA 4CYMD 1KLXA 4AEZC 3HVEB 3PEVB 5CMYA 5DBKA 1UJJA 3APCA 4R7LA 4C0MA 1V54E 2EINE 5AYWD 2P2CP 3MV2B 3QAQA 1E8ZA 3QJZA 4J7WA 1OWPA 3RJVA 5AAOA 2NYJA 1TJFA 3Q73A 3ZYLA 3QNKA 2GROB 2GW1A 2QFCA 3UT7A 5ENQD 5AARA 4F1SA 1OT8A 1Y8MA 1ELKA 2P9PG 1OCOE 1HZ4A 3JXJA 5BT1A 1KPSB 5J90A 1PY1A 2L6BA 1OCCE 3FULA 2KCLA 2EIJE 3VLEA 3CIAA 2UY1B 2BF0X 3J5QB 4AVXA 2VQ2A 4AOFA 3BEEA 1N0RA 3LKUA 4GA1A 5E75A 1RW2A 3SBSA 5CMWA 3NAWA 3C72A 4CT0A 2C0MA 1H6KA 4EPZA 2PM7A 2RG8A 1HG2A 1Y6IA 3FDHA 4MLPA 4W9RA 1NA3A 2V4HC 3EUVA 1N4PA 4NIKA 2WXIA 2J8SD 2ETAA 3B95A 2F8XK 3Q49B 4LCTA 5BPPA 3CHPA 1OWNA 2H6IA 4LNUD 5KNGA 5B3SE 3DSWA 1N52A 4U8YD 5JHBA 5FQ4A 2WXLA 3ZU7B 4MBGA 2EIKE 1PC2A 4JD2G 4AXHA 3PZ3A 4J8SA 4AP2A 2XS1A 4I9EA 4TV3A 5C1DA 3D9KA 3E37A 2CG3A 1HX8A 5LFAA 2QZAA 1U3DA 1UW4B 4GTRA 5E76A 3G2VA 2IONA 3W9GA 4HB5A 1TNZA 4UWLA 4FULA 2GRMA 1KT1A 3Q15A 2Y4UA 3E30A 5G05C 3V79K 4E6HA 2IEJA 2ILRA 2X3MA 1WM5A 2E0IA 4GCNA 2DCPA 3KD7A 1H2UA 3ZXPA 1N9AA 2P9IG 5FJYA 3ASNE 4CEMA 3DXKG 4WNEA 4CGWA 3G2WA 1DC2A 3GZ1A 4BETA 3RKVA 3NOGD 4OVUA 4B0ZA 1H2TC 1LF8A 2LXMA 3E34A 4ANUA 3L6AA 4XZ4A 4B8CB 3FTUA 1G3NB 5ARFA 2QYUA 1NP7A 3Q75A 3MCXA 3RRNB 2OVBA 3AS5A 1K1AA 2FBNA 4PS8A 2Y4TA 4GZ3A 3S7DA 4AY6A 4N5QA 2AWIA 2J08A 2F37A 5LCWJ 4KVOA 1VDYA 4UI9K 4RVBA 2IOSA 3CHOA 3LPZA 1TNYA 2BEDA 3DSXA 4LRZA 4HOQA 2VJ8A 3ZRHA 2KC7A 3JQ1A 3OXGA 3EHRA 1S0PA 3DSVA 1E7UA 5A6CA 3FTVA 5ENRD 4AIFA 3KEZA 2CFZA 3ML9A 4K0RA 2Y1LE 3TAXA 5CBNA 2EILE 3D9NA 2XGMA 1MX2A 1JWFA 2IQCA 1S64A 3CK8A 3KS2A 3FUNA 2V8SE 2KM4A 1YMPA 2WXNA 1WDYA 3UIOC 1XNFA 3D9JA 4JB8P 2I2OA 3EJNA 1Z3YA 2BKGA 5JHAA 4LUNU 4IRUA 4I17A 3TWVA 1DNPA 5EYPF 3TWTA 5LOZA 1FCHA 2XENA 2PZIA 1N4RA 4XE0A 3UKRG 4I6GA 2BUGA 3CVYA 4G8LA 3L16A 3LY8A 3MKQB 2VYIA 3CK9A 4LERA 4L7TA 4KMOA 3UMVA 4YDYA 3URZA 3CVPA 3QK0A 3AAAC 3AJIA 2XGSA 3FH8A 3FTYA 4HFGA 3UM2A 4BT9A 3TWQA 3FUJA 2DZNA 5EYLA 1OUVA 4BESA 4BFRA 1FVFA 3ESKA 3LY7A 2HM8A 5ANRA 1O1TA 3HXEA 3EDTB 4F7AA 3APFA 4U95D 4RG9A 1UN8A 3ASFA 1HG5A 3D9OA 1IKND 2XEEA 4DX5D 2WVIA 5BXUA 4UQXA 2FO1E 1DCQA 2B6CA 2VGXB 3ZPJA 3SFXA 2WPVA 3FTWA 3FUEA 2AVPA 1E90A 1TNUA 3RRMB 4A3TA 3TXMA 3TWUA 3LVRE 2XS8A 4F3VA 2XPZA 2DWZA 4WWPA 2MRIA 2XPYA 2XZDG 4EQFA 1ZBPA 4MKTA 2OVFA 3ONLA 4CRWA 4WUYA 3ZYKA 2KCVA 3S7FA 4G25A 3UQ3A 3ZXSA 2JEKA 5FTPA 3TWRA 4JA9A 2LUHA 2HE0A 4JXTA 4BEPA 1ELWA 1WAO1 1B89A 3DEOA 2GRRB 3JCKC 3RIBA 2LAIA 3LJ3A 3ASHA 4B93B 3SHFA 4JHJA 3FY4A 4G8KA 2L0IA 4BTAA 1U2VG 4GCOA 5EILA 3FU3A 4ILGA 1E96B 5JA4D 4PUCA 3CSTA 3CVNA 5KJLA 1OXJA 3MKRA 3QC1A 1NZNA 1UJKA 1TN8A 3AG1E 5CRVA 2IO2C 5LX8A 4TXRA 2J4DA 1TYQG 2YINA 4ILHB 3SGHA 1V55E 4CCAA 1E8YA 2VSXE 3DPDA 3UM1A 4L9PA 3G2TA 4IULA 4IN3B 1O1RA 4JPSA 1W3BA 5T4YA 3PREA 4GA0A 1TNOA 3O4ZA 3DPYA 2H6HA 3U64A 3RO2A 2WB2A 3UM0A 1TEZA 5FZQA 3IHYA 4WWNA 3ULYA 4JEUA 3PZ1A 3LS8A 4ME2A 2C0LA 1A5EA 4GTVA 3SBTB 2UWJG 2JABA 4UWFA 2KCKA 5T8IA 3CVXA 3C98A 3FFLA 2LXLA 3PE3A 3UKUG 3L13A 3L08A 4FP7A 5EX0A 3ABME 3Q4AB 5CEDB 2KZTA 4B8AA 3E32A 1SZAA 4ANXA 4BERA 1JWGA 2VSOE 3HRAA 1D8DA 2XRZA 3OTNA 3F6QA 3U66A 4JC8A 1H19A 2HYZA 4ILIA 3MX3A 2DYRE 3KEAA 2CHXA 2XHEA 2WXFA 5LCWC 1Z6TA 5KJNA 4GTOA 2J4BA 1JCRA 2I1KA 2ZGDA 3CLJA 4GYWA 3ZEFA 3DBSA 4APFA 4L2LA 5CEAA 3CV0A 4BSXA 4K5AB 4CDNA 4L23A 1N54A 1QYMA 2KZTB 4HXIA 2DZOA 2X6JA 3NF1A 4N3AA 4CDRA 4GYYA 3ESLA 1FT1A 2Q7FA 4N5CA 1QNFA 2WMOA 4AV7A 4QFVA 3NZUA 3FUMA 5AQAA 4ZFHA 1RZ4A 2ZXWE 2XZTG 5C2YA 5BV0A 2C2LA 3JQ0A 4GA2A 1HE8A 4G26A 4J8EA 1QQEA 3D9MA 1UG3A 3ABKE 1EF1C 2E2EA 2XGOA 5KCMA 3HXBA 4AM9A 3CQCB 2KATA 2R2LA 4JW1A 1K1BA 3OXLA 4KVMA 3S7JA 2WXGA 1SZ9A 2H6FA 2WMNA 3Q9NC 5FT9A 5BNWA 2ZISA 1XGWA 3CHMA 1E8XA 4GPKA 2CG2A 2WXJA 4GU5A 2OV8A 3ISMC 3FUFA 5FIOA 1SQMA 3HYMB 2YHCA 4NRHB 3FU0A 4J8YA 3TWXA 2Y0BG 2PL2A 3T5XA 1LTXA 2PQNA 3PZDA 3PRZA 4A63B 2XCBA 5FQ6A 1UN9A 3QOUA 5AN8A 2WXOA 3RSEG 5D2MC 2PQRA 4FU3A 2AJAA 5D0OD 4ANWA 2WM9A 3PZ2A 2GRLA 3RU0A 4XI9A 3KSLA 3TXNA 4GZ5A 5FZSA 3AS8A 3RO3A 4J0UA 4N2SA 3D9PA 2BTDA 5JMND 4U96D 4ATZD 1H2VC 3VLDA 2NXPA 1WY6A 4GB9A 1OCZE 4DLOA 3ABLE 2X6HA 3PH0C 3PNTB 4G2VA 3CVLA 5AJLA 3FUKA 4RQIA 3P2BA 3DRAA 2GRNB 4I1AA 3QWVA 1PAQA 5CERB 2P9LG 3IXEA 4Q69A 3TG4A 1KZPA 4L2YA 4HBDA 4FHKA 4I6JA 4PS7A 3FUHA 5CBOA 2P9SG 3CHRA 4DI4A 3SZ7A 4DPRA 2QY7A 3O48A 3CHQA 3CQGB 1SVXA 4BWRA 3SNXA 2A5UA 3WXXA 2EIME 3LJNA 4JEHA 4ACLA 3D9HA 1Z5SC 3QARA 4BSZB 4O1PA 1UOHA 4M3OA 4GPMA 3UIPC 2A5EA 3HG0D 3B7SA 3FU6A 4JA7A 2J07A 2VGEA 4HRNA 2Y69E 3I4RB 3CGHA 2XQ0A 3SY2A 3ZIMA 4DK5A 3UXGA 5EIBE 4O1OA 3BUAA 4U04A 3PS6A 4UWGA 3ZUVB 4F6RD 3V31A 3MV3B 4I2ZA 1OCRE 3NOCD 2RFAA 4G24A 4Q94A 4PS3A 4UWHA 1MX6A 1TN6A 4UI9C 3B7RL 2CFUA 1QBQA 4JVSA 2AW6A 3ULQA 3D3MA 2Y3AA 1HXIA 4UUCA 3Q78A 2LAHA 5JJ7A 4RG6A 3UT8A 3CVQA 3K9IA 3DSSA 3MJWA 2HO1A 4LG6A 5HS0A 5ITZF 3L9TA 3U4TA 2YNQA 1DCEA 5EIDA 5CECB 2IFUA 3BQOA 3B13A 1P5QA 1QZ2A 5FQ7A 3IEGA 1IHBA 3GYZA 4BY6A 1GW6A 3DXMG 1H6OA 3GZSA 4Y6WA 3MYVA 3UT4A 3ZN3A 3ZHEA 4RSYA 1FT2A 1SA5A 3HXDA 4F53A 4GYOA 3QKYA 3UM3A 3N71A 2WXRA 1NFIE 3MA5A 4X8QA 4HLLA 2WQ6A 3TWSA 4HNAD 4U0SA 4N3CA 2WXQA 3I3NA 3DEPA 4A1SA 4NQ0A 3L82A 4U07A 4I1OB 3LVQE 3ASGA 1X81A 2MHKA 4C0EA 2ETCA 4CDMA 4APOA 5ANLA 3SFZA 1NL4A 5ARGA 4KBQA 3V2XA 2RD0A 4KXKB 4XKCA 3J5PA 3ZGQA 4LNGA 4DRXE 3UTMA 4JZYA 4U8VD 1A17A 4KZ0A 3MEKA 1OY3D 2FEZA 3JUIA 4KZCA 3ONKA 1OWLA 2DBAA 3EHNA 4PH4B 2NC9A 4C48B 1JCSA 5FZRA 3Q47B 3QWWA 2H6GA 3BU8A 3AU5A 5B1BE 3UUXA 5AQBA 1HO8A 1TNBA 2R05A 2I6HA 3EHQA 3UPVA 3R7QA 3B7BA 2VGYA 4GTPA 4HI9A 4WWOA 2V5FA 2L6JA 4FJZA 3OAWA 2M63A 2IJGX 3SI5A 4YDWA 5AJDA 2DIWA 2XEHA 4MS6A 1BLXB 3ASOE 5CCLA 3HVEA 5HI7A 4UI9J 4RLYA 3UI2A 3L54A 4NACA 3Q7FA 3PVLA 5AIJA 1HFAA 2LNIA 1MZCA 4PDXA 3QWPA 3V30A 3HIZA 4HVBA 2RKKA 4H7YA 4DX7D 4I43A 4EECA 2JLBA 2GGFA 5EX3A 3JUEA 5KNHD 3FH5A 1FVHA 3DSTA 3TGOA 3CR3A 4FC8A 3VTXA 5JJ6A 4XEIG 3UX4A 1EYHA 3RAUA 5LP0A 4HS2A 1NI1A 2V0PA 5FINA 1Q2ZA 4KT6B 4GMRA 5KJKA 1E7VA 4DI3A 3C3OA 3QB2A 4K5CA 4DUIA 1TR4A 3TWWA 3T9KA 1O1SA 3JYSA 2UY1A 2ONDA 3DWLG 4JHKA 4TXQA 2RFMA 5G2NA 1HF8A 2V4LA 1TJCA 4GZ6A 1IHGA 3LYAA 3ZW3A 2ZGGA 3ML8A 3SD5A 4LSZE 4EZJA 4TXPA 3L22A 3Q7AA 1MYOA 5G55A 2LSUA 3B7TA 4K03A 3TL5A 1SW6A 3FU5A 2R02A 3PEUB 4XI0A 4TRQA 4FLHA 3CSFA 3JXIA 2OEVA 3MZLB 3AG4E 2KXPC 4Q96A 3HDXA 3GZ2A 5HQ8A 5A23A 4GTMA 4TUMA 2X6IA 1LD7A 3X2QE 2R59A 4P29A 3APDA 3KAEA
chains in the Genus database with same CATH topology
3JXJA 2JABA 2XZTG 1MX4A 5KBAA 3EHRA 1IXVA 4OAUC 3UXGA 5ENTD 3W9GA 5EIBE 3C5RA 4O1OA 5KWDA 4HB5A 4G8KA 3V2XA 3V2OA 3ZUVB 5D66A 2L6BA 5ENRD 1N0QA 4F6RD 1BI7B 3V31A 5JMND 4U96D 4DX1A 3J5PA 5EILA 3NOCD 2RFAA 4ATZD 4DRXE 4U95D 5AQ7A 5CEDB 5FINA 1MX6A 3UTMA 1K3ZD 2Y1LE 4U8VD 4Z68A 4QQIA 5CBNA 5JA4D 3V79K 4GMRA 1AWCB 5ENOD 1WG0A 1K1BA 3J5QB 4BERA 1IKND 1OY3D 1MJ0A 1MX2A 3HRAA 2XEEA 4K5CA 5ENSD 3ZKJA 4OAVB 4DX5D 5BXUA 4F1PA 2QC9A 1YMPA 4DUIA 1N0RA 3F6QA 3Q9NC 1WDYA 2FO1E 1TR4A 4HI8A 4UUCA 3T8KA 1DCQA 3TWWA 3T9KA 4JB8P 4C48B 5BXOA 5CERB 3KEAA 4O60A 5EN5D 3IXEA 2BKGA 4HRMB 2RFMA 4ZHBA 1S70B 3TWUA 4HBDA 1DC2A 5AQBA 2KBXA 3Q9UC 4LG6A 4BETA 5HS0A 5ITZF 4DX2A 3NOGD 2DWZA 3EHQA 5EYPF 3TWVA 2ZGDA 2DVWA 5FIOA 5ENPD 3B7BA 3TWTA 5CBOA 2XZDG 5EIDA 2V4HC 4NIKA 3SO8A 4HI9A 5CECB 4J8YA 3ZNGA 2ZGGA 2ETAA 2J8SD 2XENA 3B95A 2F8YA 4K5BA 1IHBA 2Y0BG 3TWXA 1YCSB 4CYMD 2MYOA 2F8XK 1BU9A 5CEAA 1BD8A 1G3NB 4LNUD 4LSZE 5KNGA 1SVXA 4K5AB 5AQ9A 1MYOA 4G8LA 4HQDA 4U8YD 4YDWA 1AP7A 2P2CP 4HRLA 3ZU7B 2XEHA 3TWRA 1K1AA 4A63B 3LJNA 5HKPA 1BLXB 2QYJA 1QYMA 4N5QA 1SW6A 4J7WA 3D9HA 2PNNA 2HE0A 1NFIE 2V5QC 4HLLA 5AN8A 2F37A 3TWSA 1YYHA 1BI8B 2DZOA 4RLYA 1N11A 4HNAD 4YDYA 3UI2A 5AAOA 3JXIA 4BSZB 4O1PA 1UOHA 2NYJA 3DEPA 3AAAC 2AJAA 3AJIA 4GPMA 4CZ2D 4BEPA 2KXPC 2BKKB 3V30A 3TWQA 3NBNB 3EU9A 2A5EA 2ETBA 5ENQD 4DX6D 2DZNA 3DEOA 5EYLA 3HG0D 4TUMA 5AARA 2B0OE 4DX7D 1D9SA 4BESA 1OT8A 4QFVA 2VGEA 4HRNA 1A5EA 5AQAA 5HRYA 2ETCA 4ZFHA 4B93B 3JUEA 5KNHD 3W9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXJ A;  2JAB A;  2XZT G;  1MX4 A;  5KBA A;  3EHR A;  1IXV A;  4OAU C;  3UXG A;  5ENT D;  3W9G A;  5EIB E;  3C5R A;  4O1O A;  5KWD A;  4HB5 A;  4G8K A;  3V2X A;  3V2O A;  3ZUV B;  5D66 A;  2L6B A;  5ENR D;  1N0Q A;  4F6R D;  1BI7 B;  3V31 A;  5JMN D;  4U96 D;  4DX1 A;  3J5P A;  5EIL A;  3NOC D;  2RFA A;  4ATZ D;  4DRX E;  4U95 D;  5AQ7 A;  5CED B;  5FIN A;  1MX6 A;  3UTM A;  1K3Z D;  2Y1L E;  4U8V D;  4Z68 A;  4QQI A;  5CBN A;  5JA4 D;  3V79 K;  4GMR A;  1AWC B;  5ENO D;  1WG0 A;  1K1B A;  3J5Q B;  4BER A;  1IKN D;  1OY3 D;  1MJ0 A;  1MX2 A;  3HRA A;  2XEE A;  4K5C A;  5ENS D;  3ZKJ A;  4OAV B;  4DX5 D;  5BXU A;  4F1P A;  2QC9 A;  1YMP A;  4DUI A;  1N0R A;  3F6Q A;  3Q9N C;  1WDY A;  2FO1 E;  1TR4 A;  4HI8 A;  4UUC A;  3T8K A;  1DCQ A;  3TWW A;  3T9K A;  4JB8 P;  4C48 B;  5BXO A;  5CER B;  3KEA A;  4O60 A;  5EN5 D;  3IXE A;  2BKG A;  4HRM B;  2RFM A;  4ZHB A;  1S70 B;  3TWU A;  4HBD A;  1DC2 A;  5AQB A;  2KBX A;  3Q9U C;  4LG6 A;  4BET A;  5HS0 A;  5ITZ F;  4DX2 A;  3NOG D;  2DWZ A;  3EHQ A;  5EYP F;  3TWV A;  2ZGD A;  2DVW A;  5FIO A;  5ENP D;  3B7B A;  3TWT A;  5CBO A;  2XZD G;  5EID A;  2V4H C;  4NIK A;  3SO8 A;  4HI9 A;  5CEC B;  4J8Y A;  3ZNG A;  2ZGG A;  2ETA A;  2J8S D;  2XEN A;  3B95 A;  2F8Y A;  4K5B A;  1IHB A;  2Y0B G;  3TWX A;  1YCS B;  4CYM D;  2MYO A;  2F8X K;  1BU9 A;  5CEA A;  1BD8 A;  1G3N B;  4LNU D;  4LSZ E;  5KNG A;  1SVX A;  4K5A B;  5AQ9 A;  1MYO A;  4G8L A;  4HQD A;  4U8Y D;  4YDW A;  1AP7 A;  2P2C P;  4HRL A;  3ZU7 B;  2XEH A;  3TWR A;  1K1A A;  4A63 B;  3LJN A;  5HKP A;  1BLX B;  2QYJ A;  1QYM A;  4N5Q A;  1SW6 A;  4J7W A;  3D9H A;  2PNN A;  2HE0 A;  1NFI E;  2V5Q C;  4HLL A;  5AN8 A;  2F37 A;  3TWS A;  1YYH A;  1BI8 B;  2DZO A;  4RLY A;  1N11 A;  4HNA D;  4YDY A;  3UI2 A;  5AAO A;  3JXI A;  4BSZ B;  4O1P A;  1UOH A;  2NYJ A;  3DEP A;  3AAA C;  2AJA A;  3AJI A;  4GPM A;  4CZ2 D;  4BEP A;  2KXP C;  2BKK B;  3V30 A;  3TWQ A;  3NBN B;  3EU9 A;  2A5E A;  2ETB A;  5ENQ D;  4DX6 D;  2DZN A;  3DEO A;  5EYL A;  3HG0 D;  4TUM A;  5AAR A;  2B0O E;  4DX7 D;  1D9S A;  4BES A;  1OT8 A;  4QFV A;  2VGE A;  4HRN A;  1A5E A;  5AQA A;  5HRY A;  2ETC A;  4ZFH A;  4B93 B;  3JUE A;  5KNH D;  3W9F A; 
#chains in the Genus database with same CATH topology
 5KBA A;  3ASD A;  4OAU C;  3AG3 E;  3C5R A;  5KWD A;  4HOS A;  2PM6 A;  5JJT A;  4AY5 A;  3CKC A;  1K3Z D;  2YQ8 A;  3BG1 B;  4Z68 A;  4WNF A;  3DSU A;  4U0Z A;  1WG0 A;  4L1B A;  3ZFW A;  3T8M A;  5BUZ A;  2IY0 C;  4U0U A;  2I9C A;  3FTZ A;  2XEV A;  5BXO A;  1DVP A;  2VSY A;  3EIQ C;  3NZS A;  5G04 C;  3RRU A;  2WXM A;  2KBX A;  4LEU A;  3WG7 E;  2DVW A;  2L0T B;  1U3C A;  5ENP D;  3VTY A;  1EDU A;  2ZIR A;  3TG5 A;  1Z3X A;  3HXC A;  4K5B A;  3IV0 A;  2GRQ B;  3LEW A;  1H0A A;  1X5B A;  3EIJ A;  3CK7 A;  3I5P A;  1INZ A;  5AEN A;  3D9I A;  1FPP A;  2YHE A;  4HOR A;  4DLQ A;  1BI8 B;  4YVQ C;  3ZVV A;  4G1T A;  3BG0 B;  3NBN B;  5D0Q D;  1HS6 A;  4XKB A;  2F0Y A;  3FH7 A;  1D9S A;  1O5M A;  4GTS A;  3FP3 A;  3PZ4 A;  1H6P A;  1IXV A;  3E33 A;  3FTX A;  3EU5 A;  4BX8 A;  2P9K G;  3V2O A;  3RK6 A;  1ZB1 A;  1E8W A;  3PUK A;  5AQ7 A;  3FHE A;  1N94 A;  4YVO A;  5ENO D;  2I1J A;  3EHM A;  5ENS D;  3U9W A;  4OAV B;  3PNL B;  4F1P A;  2QC9 A;  3ENE A;  4FLB A;  4B94 A;  3S2A A;  3GW4 A;  2IO3 C;  4EZL A;  5B1A E;  4O60 A;  3LDZ A;  3LXU X;  2X6F A;  4JL0 A;  4M7C A;  4ANV A;  4UWK A;  3Q9U C;  3IHV A;  4ACK A;  2OEW A;  5FQ8 A;  1OWO A;  3FUI A;  3SO8 A;  2FO7 A;  2FUL A;  3ZNG A;  4GZD A;  2MYO A;  2R17 C;  4OVV A;  2J9Q A;  2P9N G;  4HOT A;  1AP7 A;  1YA0 A;  5FWQ A;  3TJP A;  3CVV A;  2AXU A;  5HKP A;  3QDN A;  3S7B A;  2OCC E;  2MOW A;  5EKQ D;  2PNN A;  3NQP A;  1N11 A;  4GZC A;  4NUR A;  2WQH A;  3MKQ A;  2WXH A;  3NB2 A;  1N4S A;  4DX6 D;  2ETB A;  4WND A;  2B0O E;  4HOU A;  1HU3 A;  3AS4 A;  2XRY A;  5HRY A;  4G11 A;  5J08 A;  4J6I A;  1MX4 A;  5G04 J;  4U8H A;  4GML A;  3SF4 A;  3P1U A;  4A3V A;  2R5S A;  4CT4 A;  4EBA G;  4ATG A;  4V3I A;  2J09 A;  4QQI A;  4KYO B;  4OYS A;  5DIZ A;  4I6E A;  1BPO A;  4I9C A;  4A1G A;  4HI8 A;  3T8K A;  4U7E B;  3PDN A;  3L17 A;  5KJM A;  3FEY A;  4ZHB A;  4O6F A;  1S70 B;  3CVU A;  4BTB A;  2WQ7 A;  1SA4 A;  3CHS A;  4DX2 A;  1D8E A;  2LO6 A;  3ZYM A;  5ENN A;  2R03 A;  1JCQ A;  4BX9 A;  2VGX A;  5M72 A;  2VSN A;  5G05 J;  1BU9 A;  2CHZ A;  2P58 C;  3AU4 A;  4N39 A;  4E85 A;  4HLE A;  5CHE E;  2IF4 A;  2OOE A;  5AQ9 A;  4C9B B;  1HH8 A;  3Q79 A;  4EZK A;  3CVW A;  2XPI A;  3LCA A;  1JUQ A;  2X38 A;  4AJW A;  3PE4 A;  2V5Q C;  1N4Q A;  1NA0 A;  4CGV A;  4FAD A;  4BT8 A;  5CCM A;  3KSQ A;  4N2Q A;  4CZ2 D;  2L9B A;  2BKK B;  5T3R A;  3HHM A;  3HXF A;  3CEQ A;  3VLF A;  5BW8 C;  4GTQ A;  4N3B A;  4UQY A;  4U63 A;  2NSZ A;  2FI7 A;  4H7X A;  2A4Z A;  4URK A;  4I2W A;  4FJY A;  5H7P A;  2WXP A;  1BI7 B;  1LD8 A;  3E4B A;  1ELR A;  1MHQ A;  1IYG A;  2LSV A;  3D9L A;  1MJ0 A;  3C3Q A;  2XCC A;  3ZKJ A;  4YDE A;  3PUJ A;  3G2U A;  4JHR A;  4D10 C;  2X6K A;  1OWM A;  1MQS A;  4I1M A;  3Q5M A;  4WNG A;  4FHJ A;  3MGB A;  1KZO A;  3UIN C;  3LY9 A;  4IYP A;  2IU1 A;  3OXF A;  3ZHE B;  2P9U G;  4EHM A;  2F8Y A;  1YCS B;  5BV1 A;  1IQR A;  1BD8 A;  3R9M A;  3B7U X;  4HQD A;  4MRU A;  4HRL A;  4ABN A;  1TN7 A;  2QYJ A;  4A55 A;  4DJA A;  5A7D B;  2HR2 A;  1YYH A;  3G2S A;  3IBE A;  5CRU A;  3SFY A;  4GAA A;  4GMJ A;  3R7R A;  3EU9 A;  2VTB A;  4FA6 A;  4UQZ A;  3CKB A;  2AXV A;  3FUD A;  3W9F A;  2FF4 A;  4J8D A;  1K8K G;  3T5V A;  1ZU2 A;  5ENT D;  4G23 A;  1JPL A;  5D66 A;  3R9A B;  1N0Q A;  2DYS E;  4DX1 A;  4XX5 A;  4EBA A;  4J8F A;  2EQX A;  1IQU A;  4TUU A;  2ZU6 B;  1AWC B;  3C3R A;  1N95 A;  3FEX A;  2AXZ A;  3FWV A;  4GTT A;  4YDO A;  4YND A;  4XIF A;  1S63 A;  3ZYQ A;  1EPU A;  3U3W A;  4LNB A;  3FTS A;  2J49 A;  2WXK A;  5EDS A;  1L5J A;  1KT0 A;  3AG2 E;  5EN5 D;  4HRM B;  2GRP B;  2CHW A;  2IOL A;  3IKO B;  4B89 A;  5IY5 E;  2VTB B;  4WAF A;  4Y6C A;  3I4G A;  3ULE G;  3SQV A;  4CYM D;  1KLX A;  4AEZ C;  3HVE B;  3PEV B;  5CMY A;  5DBK A;  1UJJ A;  3APC A;  4R7L A;  4C0M A;  1V54 E;  2EIN E;  5AYW D;  2P2C P;  3MV2 B;  3QAQ A;  1E8Z A;  3QJZ A;  4J7W A;  1OWP A;  3RJV A;  5AAO A;  2NYJ A;  1TJF A;  3Q73 A;  3ZYL A;  3QNK A;  2GRO B;  2GW1 A;  2QFC A;  3UT7 A;  5ENQ D;  5AAR A;  4F1S A;  1OT8 A;  1Y8M A;  1ELK A;  2P9P G;  1OCO E;  1HZ4 A;  3JXJ A;  5BT1 A;  1KPS B;  5J90 A;  1PY1 A;  2L6B A;  1OCC E;  3FUL A;  2KCL A;  2EIJ E;  3VLE A;  3CIA A;  2UY1 B;  2BF0 X;  3J5Q B;  4AVX A;  2VQ2 A;  4AOF A;  3BEE A;  1N0R A;  3LKU A;  4GA1 A;  5E75 A;  1RW2 A;  3SBS A;  5CMW A;  3NAW A;  3C72 A;  4CT0 A;  2C0M A;  1H6K A;  4EPZ A;  2PM7 A;  2RG8 A;  1HG2 A;  1Y6I A;  3FDH A;  4MLP A;  4W9R A;  1NA3 A;  2V4H C;  3EUV A;  1N4P A;  4NIK A;  2WXI A;  2J8S D;  2ETA A;  3B95 A;  2F8X K;  3Q49 B;  4LCT A;  5BPP A;  3CHP A;  1OWN A;  2H6I A;  4LNU D;  5KNG A;  5B3S E;  3DSW A;  1N52 A;  4U8Y D;  5JHB A;  5FQ4 A;  2WXL A;  3ZU7 B;  4MBG A;  2EIK E;  1PC2 A;  4JD2 G;  4AXH A;  3PZ3 A;  4J8S A;  4AP2 A;  2XS1 A;  4I9E A;  4TV3 A;  5C1D A;  3D9K A;  3E37 A;  2CG3 A;  1HX8 A;  5LFA A;  2QZA A;  1U3D A;  1UW4 B;  4GTR A;  5E76 A;  3G2V A;  2ION A;  3W9G A;  4HB5 A;  1TNZ A;  4UWL A;  4FUL A;  2GRM A;  1KT1 A;  3Q15 A;  2Y4U A;  3E30 A;  5G05 C;  3V79 K;  4E6H A;  2IEJ A;  2ILR A;  2X3M A;  1WM5 A;  2E0I A;  4GCN A;  2DCP A;  3KD7 A;  1H2U A;  3ZXP A;  1N9A A;  2P9I G;  5FJY A;  3ASN E;  4CEM A;  3DXK G;  4WNE A;  4CGW A;  3G2W A;  1DC2 A;  3GZ1 A;  4BET A;  3RKV A;  3NOG D;  4OVU A;  4B0Z A;  1H2T C;  1LF8 A;  2LXM A;  3E34 A;  4ANU A;  3L6A A;  4XZ4 A;  4B8C B;  3FTU A;  1G3N B;  5ARF A;  2QYU A;  1NP7 A;  3Q75 A;  3MCX A;  3RRN B;  2OVB A;  3AS5 A;  1K1A A;  2FBN A;  4PS8 A;  2Y4T A;  4GZ3 A;  3S7D A;  4AY6 A;  4N5Q A;  2AWI A;  2J08 A;  2F37 A;  5LCW J;  4KVO A;  1VDY A;  4UI9 K;  4RVB A;  2IOS A;  3CHO A;  3LPZ A;  1TNY A;  2BED A;  3DSX A;  4LRZ A;  4HOQ A;  2VJ8 A;  3ZRH A;  2KC7 A;  3JQ1 A;  3OXG A;  3EHR A;  1S0P A;  3DSV A;  1E7U A;  5A6C A;  3FTV A;  5ENR D;  4AIF A;  3KEZ A;  2CFZ A;  3ML9 A;  4K0R A;  2Y1L E;  3TAX A;  5CBN A;  2EIL E;  3D9N A;  2XGM A;  1MX2 A;  1JWF A;  2IQC A;  1S64 A;  3CK8 A;  3KS2 A;  3FUN A;  2V8S E;  2KM4 A;  1YMP A;  2WXN A;  1WDY A;  3UIO C;  1XNF A;  3D9J A;  4JB8 P;  2I2O A;  3EJN A;  1Z3Y A;  2BKG A;  5JHA A;  4LUN U;  4IRU A;  4I17 A;  3TWV A;  1DNP A;  5EYP F;  3TWT A;  5LOZ A;  1FCH A;  2XEN A;  2PZI A;  1N4R A;  4XE0 A;  3UKR G;  4I6G A;  2BUG A;  3CVY A;  4G8L A;  3L16 A;  3LY8 A;  3MKQ B;  2VYI A;  3CK9 A;  4LER A;  4L7T A;  4KMO A;  3UMV A;  4YDY A;  3URZ A;  3CVP A;  3QK0 A;  3AAA C;  3AJI A;  2XGS A;  3FH8 A;  3FTY A;  4HFG A;  3UM2 A;  4BT9 A;  3TWQ A;  3FUJ A;  2DZN A;  5EYL A;  1OUV A;  4BES A;  4BFR A;  1FVF A;  3ESK A;  3LY7 A;  2HM8 A;  5ANR A;  1O1T A;  3HXE A;  3EDT B;  4F7A A;  3APF A;  4U95 D;  4RG9 A;  1UN8 A;  3ASF A;  1HG5 A;  3D9O A;  1IKN D;  2XEE A;  4DX5 D;  2WVI A;  5BXU A;  4UQX A;  2FO1 E;  1DCQ A;  2B6C A;  2VGX B;  3ZPJ A;  3SFX A;  2WPV A;  3FTW A;  3FUE A;  2AVP A;  1E90 A;  1TNU A;  3RRM B;  4A3T A;  3TXM A;  3TWU A;  3LVR E;  2XS8 A;  4F3V A;  2XPZ A;  2DWZ A;  4WWP A;  2MRI A;  2XPY A;  2XZD G;  4EQF A;  1ZBP A;  4MKT A;  2OVF A;  3ONL A;  4CRW A;  4WUY A;  3ZYK A;  2KCV A;  3S7F A;  4G25 A;  3UQ3 A;  3ZXS A;  2JEK A;  5FTP A;  3TWR A;  4JA9 A;  2LUH A;  2HE0 A;  4JXT A;  4BEP A;  1ELW A;  1WAO 1;  1B89 A;  3DEO A;  2GRR B;  3JCK C;  3RIB A;  2LAI A;  3LJ3 A;  3ASH A;  4B93 B;  3SHF A;  4JHJ A;  3FY4 A;  4G8K A;  2L0I A;  4BTA A;  1U2V G;  4GCO A;  5EIL A;  3FU3 A;  4ILG A;  1E96 B;  5JA4 D;  4PUC A;  3CST A;  3CVN A;  5KJL A;  1OXJ A;  3MKR A;  3QC1 A;  1NZN A;  1UJK A;  1TN8 A;  3AG1 E;  5CRV A;  2IO2 C;  5LX8 A;  4TXR A;  2J4D A;  1TYQ G;  2YIN A;  4ILH B;  3SGH A;  1V55 E;  4CCA A;  1E8Y A;  2VSX E;  3DPD A;  3UM1 A;  4L9P A;  3G2T A;  4IUL A;  4IN3 B;  1O1R A;  4JPS A;  1W3B A;  5T4Y A;  3PRE A;  4GA0 A;  1TNO A;  3O4Z A;  3DPY A;  2H6H A;  3U64 A;  3RO2 A;  2WB2 A;  3UM0 A;  1TEZ A;  5FZQ A;  3IHY A;  4WWN A;  3ULY A;  4JEU A;  3PZ1 A;  3LS8 A;  4ME2 A;  2C0L A;  1A5E A;  4GTV A;  3SBT B;  2UWJ G;  2JAB A;  4UWF A;  2KCK A;  5T8I A;  3CVX A;  3C98 A;  3FFL A;  2LXL A;  3PE3 A;  3UKU G;  3L13 A;  3L08 A;  4FP7 A;  5EX0 A;  3ABM E;  3Q4A B;  5CED B;  2KZT A;  4B8A A;  3E32 A;  1SZA A;  4ANX A;  4BER A;  1JWG A;  2VSO E;  3HRA A;  1D8D A;  2XRZ A;  3OTN A;  3F6Q A;  3U66 A;  4JC8 A;  1H19 A;  2HYZ A;  4ILI A;  3MX3 A;  2DYR E;  3KEA A;  2CHX A;  2XHE A;  2WXF A;  5LCW C;  1Z6T A;  5KJN A;  4GTO A;  2J4B A;  1JCR A;  2I1K A;  2ZGD A;  3CLJ A;  4GYW A;  3ZEF A;  3DBS A;  4APF A;  4L2L A;  5CEA A;  3CV0 A;  4BSX A;  4K5A B;  4CDN A;  4L23 A;  1N54 A;  1QYM A;  2KZT B;  4HXI A;  2DZO A;  2X6J A;  3NF1 A;  4N3A A;  4CDR A;  4GYY A;  3ESL A;  1FT1 A;  2Q7F A;  4N5C A;  1QNF A;  2WMO A;  4AV7 A;  4QFV A;  3NZU A;  3FUM A;  5AQA A;  4ZFH A;  1RZ4 A;  2ZXW E;  2XZT G;  5C2Y A;  5BV0 A;  2C2L A;  3JQ0 A;  4GA2 A;  1HE8 A;  4G26 A;  4J8E A;  1QQE A;  3D9M A;  1UG3 A;  3ABK E;  1EF1 C;  2E2E A;  2XGO A;  5KCM A;  3HXB A;  4AM9 A;  3CQC B;  2KAT A;  2R2L A;  4JW1 A;  1K1B A;  3OXL A;  4KVM A;  3S7J A;  2WXG A;  1SZ9 A;  2H6F A;  2WMN A;  3Q9N C;  5FT9 A;  5BNW A;  2ZIS A;  1XGW A;  3CHM A;  1E8X A;  4GPK A;  2CG2 A;  2WXJ A;  4GU5 A;  2OV8 A;  3ISM C;  3FUF A;  5FIO A;  1SQM A;  3HYM B;  2YHC A;  4NRH B;  3FU0 A;  4J8Y A;  3TWX A;  2Y0B G;  2PL2 A;  3T5X A;  1LTX A;  2PQN A;  3PZD A;  3PRZ A;  4A63 B;  2XCB A;  5FQ6 A;  1UN9 A;  3QOU A;  5AN8 A;  2WXO A;  3RSE G;  5D2M C;  2PQR A;  4FU3 A;  2AJA A;  5D0O D;  4ANW A;  2WM9 A;  3PZ2 A;  2GRL A;  3RU0 A;  4XI9 A;  3KSL A;  3TXN A;  4GZ5 A;  5FZS A;  3AS8 A;  3RO3 A;  4J0U A;  4N2S A;  3D9P A;  2BTD A;  5JMN D;  4U96 D;  4ATZ D;  1H2V C;  3VLD A;  2NXP A;  1WY6 A;  4GB9 A;  1OCZ E;  4DLO A;  3ABL E;  2X6H A;  3PH0 C;  3PNT B;  4G2V A;  3CVL A;  5AJL A;  3FUK A;  4RQI A;  3P2B A;  3DRA A;  2GRN B;  4I1A A;  3QWV A;  1PAQ A;  5CER B;  2P9L G;  3IXE A;  4Q69 A;  3TG4 A;  1KZP A;  4L2Y A;  4HBD A;  4FHK A;  4I6J A;  4PS7 A;  3FUH A;  5CBO A;  2P9S G;  3CHR A;  4DI4 A;  3SZ7 A;  4DPR A;  2QY7 A;  3O48 A;  3CHQ A;  3CQG B;  1SVX A;  4BWR A;  3SNX A;  2A5U A;  3WXX A;  2EIM E;  3LJN A;  4JEH A;  4ACL A;  3D9H A;  1Z5S C;  3QAR A;  4BSZ B;  4O1P A;  1UOH A;  4M3O A;  4GPM A;  3UIP C;  2A5E A;  3HG0 D;  3B7S A;  3FU6 A;  4JA7 A;  2J07 A;  2VGE A;  4HRN A;  2Y69 E;  3I4R B;  3CGH A;  2XQ0 A;  3SY2 A;  3ZIM A;  4DK5 A;  3UXG A;  5EIB E;  4O1O A;  3BUA A;  4U04 A;  3PS6 A;  4UWG A;  3ZUV B;  4F6R D;  3V31 A;  3MV3 B;  4I2Z A;  1OCR E;  3NOC D;  2RFA A;  4G24 A;  4Q94 A;  4PS3 A;  4UWH A;  1MX6 A;  1TN6 A;  4UI9 C;  3B7R L;  2CFU A;  1QBQ A;  4JVS A;  2AW6 A;  3ULQ A;  3D3M A;  2Y3A A;  1HXI A;  4UUC A;  3Q78 A;  2LAH A;  5JJ7 A;  4RG6 A;  3UT8 A;  3CVQ A;  3K9I A;  3DSS A;  3MJW A;  2HO1 A;  4LG6 A;  5HS0 A;  5ITZ F;  3L9T A;  3U4T A;  2YNQ A;  1DCE A;  5EID A;  5CEC B;  2IFU A;  3BQO A;  3B13 A;  1P5Q A;  1QZ2 A;  5FQ7 A;  3IEG A;  1IHB A;  3GYZ A;  4BY6 A;  1GW6 A;  3DXM G;  1H6O A;  3GZS A;  4Y6W A;  3MYV A;  3UT4 A;  3ZN3 A;  3ZHE A;  4RSY A;  1FT2 A;  1SA5 A;  3HXD A;  4F53 A;  4GYO A;  3QKY A;  3UM3 A;  3N71 A;  2WXR A;  1NFI E;  3MA5 A;  4X8Q A;  4HLL A;  2WQ6 A;  3TWS A;  4HNA D;  4U0S A;  4N3C A;  2WXQ A;  3I3N A;  3DEP A;  4A1S A;  4NQ0 A;  3L82 A;  4U07 A;  4I1O B;  3LVQ E;  3ASG A;  1X81 A;  2MHK A;  4C0E A;  2ETC A;  4CDM A;  4APO A;  5ANL A;  3SFZ A;  1NL4 A;  5ARG A;  4KBQ A;  3V2X A;  2RD0 A;  4KXK B;  4XKC A;  3J5P A;  3ZGQ A;  4LNG A;  4DRX E;  3UTM A;  4JZY A;  4U8V D;  1A17 A;  4KZ0 A;  3MEK A;  1OY3 D;  2FEZ A;  3JUI A;  4KZC A;  3ONK A;  1OWL A;  2DBA A;  3EHN A;  4PH4 B;  2NC9 A;  4C48 B;  1JCS A;  5FZR A;  3Q47 B;  3QWW A;  2H6G A;  3BU8 A;  3AU5 A;  5B1B E;  3UUX A;  5AQB A;  1HO8 A;  1TNB A;  2R05 A;  2I6H A;  3EHQ A;  3UPV A;  3R7Q A;  3B7B A;  2VGY A;  4GTP A;  4HI9 A;  4WWO A;  2V5F A;  2L6J A;  4FJZ A;  3OAW A;  2M63 A;  2IJG X;  3SI5 A;  4YDW A;  5AJD A;  2DIW A;  2XEH A;  4MS6 A;  1BLX B;  3ASO E;  5CCL A;  3HVE A;  5HI7 A;  4UI9 J;  4RLY A;  3UI2 A;  3L54 A;  4NAC A;  3Q7F A;  3PVL A;  5AIJ A;  1HFA A;  2LNI A;  1MZC A;  4PDX A;  3QWP A;  3V30 A;  3HIZ A;  4HVB A;  2RKK A;  4H7Y A;  4DX7 D;  4I43 A;  4EEC A;  2JLB A;  2GGF A;  5EX3 A;  3JUE A;  5KNH D;  3FH5 A;  1FVH A;  3DST A;  3TGO A;  3CR3 A;  4FC8 A;  3VTX A;  5JJ6 A;  4XEI G;  3UX4 A;  1EYH A;  3RAU A;  5LP0 A;  4HS2 A;  1NI1 A;  2V0P A;  5FIN A;  1Q2Z A;  4KT6 B;  4GMR A;  5KJK A;  1E7V A;  4DI3 A;  3C3O A;  3QB2 A;  4K5C A;  4DUI A;  1TR4 A;  3TWW A;  3T9K A;  1O1S A;  3JYS A;  2UY1 A;  2OND A;  3DWL G;  4JHK A;  4TXQ A;  2RFM A;  5G2N A;  1HF8 A;  2V4L A;  1TJC A;  4GZ6 A;  1IHG A;  3LYA A;  3ZW3 A;  2ZGG A;  3ML8 A;  3SD5 A;  4LSZ E;  4EZJ A;  4TXP A;  3L22 A;  3Q7A A;  1MYO A;  5G55 A;  2LSU A;  3B7T A;  4K03 A;  3TL5 A;  1SW6 A;  3FU5 A;  2R02 A;  3PEU B;  4XI0 A;  4TRQ A;  4FLH A;  3CSF A;  3JXI A;  2OEV A;  3MZL B;  3AG4 E;  2KXP C;  4Q96 A;  3HDX A;  3GZ2 A;  5HQ8 A;  5A23 A;  4GTM A;  4TUM A;  2X6I A;  1LD7 A;  3X2Q E;  2R59 A;  4P29 A;  3APD A;  3KAE A; 
#chains in the Genus database with same CATH homology
 3JXJ A;  2JAB A;  2XZT G;  1MX4 A;  5KBA A;  3EHR A;  1IXV A;  4OAU C;  3UXG A;  5ENT D;  3W9G A;  5EIB E;  3C5R A;  4O1O A;  5KWD A;  4HB5 A;  4G8K A;  3V2X A;  3V2O A;  3ZUV B;  5D66 A;  2L6B A;  5ENR D;  1N0Q A;  4F6R D;  1BI7 B;  3V31 A;  5JMN D;  4U96 D;  4DX1 A;  3J5P A;  5EIL A;  3NOC D;  2RFA A;  4ATZ D;  4DRX E;  4U95 D;  5AQ7 A;  5CED B;  5FIN A;  1MX6 A;  3UTM A;  1K3Z D;  2Y1L E;  4U8V D;  4Z68 A;  4QQI A;  5CBN A;  5JA4 D;  3V79 K;  4GMR A;  1AWC B;  5ENO D;  1WG0 A;  1K1B A;  3J5Q B;  4BER A;  1IKN D;  1OY3 D;  1MJ0 A;  1MX2 A;  3HRA A;  2XEE A;  4K5C A;  5ENS D;  3ZKJ A;  4OAV B;  4DX5 D;  5BXU A;  4F1P A;  2QC9 A;  1YMP A;  4DUI A;  1N0R A;  3F6Q A;  3Q9N C;  1WDY A;  2FO1 E;  1TR4 A;  4HI8 A;  4UUC A;  3T8K A;  1DCQ A;  3TWW A;  3T9K A;  4JB8 P;  4C48 B;  5BXO A;  5CER B;  3KEA A;  4O60 A;  5EN5 D;  3IXE A;  2BKG A;  4HRM B;  2RFM A;  4ZHB A;  1S70 B;  3TWU A;  4HBD A;  1DC2 A;  5AQB A;  2KBX A;  3Q9U C;  4LG6 A;  4BET A;  5HS0 A;  5ITZ F;  4DX2 A;  3NOG D;  2DWZ A;  3EHQ A;  5EYP F;  3TWV A;  2ZGD A;  2DVW A;  5FIO A;  5ENP D;  3B7B A;  3TWT A;  5CBO A;  2XZD G;  5EID A;  2V4H C;  4NIK A;  3SO8 A;  4HI9 A;  5CEC B;  4J8Y A;  3ZNG A;  2ZGG A;  2ETA A;  2J8S D;  2XEN A;  3B95 A;  2F8Y A;  4K5B A;  1IHB A;  2Y0B G;  3TWX A;  1YCS B;  4CYM D;  2MYO A;  2F8X K;  1BU9 A;  5CEA A;  1BD8 A;  1G3N B;  4LNU D;  4LSZ E;  5KNG A;  1SVX A;  4K5A B;  5AQ9 A;  1MYO A;  4G8L A;  4HQD A;  4U8Y D;  4YDW A;  1AP7 A;  2P2C P;  4HRL A;  3ZU7 B;  2XEH A;  3TWR A;  1K1A A;  4A63 B;  3LJN A;  5HKP A;  1BLX B;  2QYJ A;  1QYM A;  4N5Q A;  1SW6 A;  4J7W A;  3D9H A;  2PNN A;  2HE0 A;  1NFI E;  2V5Q C;  4HLL A;  5AN8 A;  2F37 A;  3TWS A;  1YYH A;  1BI8 B;  2DZO A;  4RLY A;  1N11 A;  4HNA D;  4YDY A;  3UI2 A;  5AAO A;  3JXI A;  4BSZ B;  4O1P A;  1UOH A;  2NYJ A;  3DEP A;  3AAA C;  2AJA A;  3AJI A;  4GPM A;  4CZ2 D;  4BEP A;  2KXP C;  2BKK B;  3V30 A;  3TWQ A;  3NBN B;  3EU9 A;  2A5E A;  2ETB A;  5ENQ D;  4DX6 D;  2DZN A;  3DEO A;  5EYL A;  3HG0 D;  4TUM A;  5AAR A;  2B0O E;  4DX7 D;  1D9S A;  4BES A;  1OT8 A;  4QFV A;  2VGE A;  4HRN A;  1A5E A;  5AQA A;  5HRY A;  2ETC A;  4ZFH A;  4B93 B;  3JUE A;  5KNH D;  3W9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...