4U8YD

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB.
pubmed doi rcsb
molecule keywords Multidrug efflux pump subunit AcrB
molecule tags Transport protein
source organism Escherichia coli
total genus 50
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u8yD00
3D9HA 2V4HC 4GPMA 4HI8A 3TWRA 1SVXA 4U95D 3NOCD 3ZNGA 3Q9NC 3TWTA 1MX4A 1K1BA 1MYOA 2V5QC 1DCQA 5ENSD 3W9GA 4NIKA 2ETCA 4JB8P 5EYLA 4A63B 4DX7D 5BXOA 5EIBE 5HS0A 1BD8A 3W9FA 4OAVB 1OT8A 5EYPF 4F6RD 5KNGA 1K3ZD 4O1PA 3F6QA 4K5AB 3TWVA 4CYMD 2ETAA 2FO1E 4BESA 3TWSA 4OAUC 2XEEA 2Y1LE 4HRMB 5ENPD 3UI2A 4HQDA 4RLYA 3TWWA 3V2OA 4HBDA 2DWZA 4HLLA 3V79K 4DX1A 4HNAD 3Q9UC 2L6BA 5FINA 2B0OE 4Z68A 4DX6D 3V30A 3ZU7B 3TWXA 5KWDA 1N0QA 2KXPC 1IXVA 4HRLA 4LSZE 4HB5A 2XENA 5AARA 2ETBA 5ENOD 5ITZF 3V31A 1IKND 1WDYA 2P2CP 3C5RA 5EIDA 1D9SA 1YMPA 5AQAA 3B7BA 1K1AA 4BEPA 1G3NB 3HG0D 2RFMA 3JUEA 1QYMA 3KEAA 4U96D 2XZTG 4G8KA 1N11A 3TWQA 4C48B 1DC2A 4YDYA 1MJ0A 2ZGGA 5CERB 4GMRA 5CBOA 1AP7A 4U8YD 1AWCB 5AQ7A 3EHQA 1BU9A 2PNNA 2DZNA 2F37A 4ZFHA 2J8SD 2AJAA 4DUIA 1IHBA 5BXUA 5JA4D 1TR4A 1A5EA 5CECB 1NFIE 2DVWA 5D66A 4N5QA 5FIOA 1YCSB 5HKPA 3EU9A 5ENTD 4BERA 3AAAC 2BKKB 2QYJA 5HRYA 4QFVA 4B93B 3JXIA 1UOHA 4QQIA 4CZ2D 1N0RA 2VGEA 5KBAA 5CBNA 2DZOA 3J5QB 3J5PA 4K5CA 4DX5D 2XEHA 4YDWA 2QC9A 5EILA 3LJNA 2XZDG 3DEPA 3EHRA 4LG6A 4O1OA 3TWUA 4O60A 3IXEA 3HRAA 4BETA 2F8XK 5EN5D 2Y0BG 3ZKJA 1BI7B 1SW6A 2RFAA 4HRNA 5ENQD 3T8KA 4BSZB 2A5EA 2NYJA 3AJIA 3B95A 2BKGA 4K5BA 4ZHBA 4DRXE 5KNHD 1YYHA 5AAOA 5AN8A 1BI8B 2HE0A 4UUCA 3UTMA 3UXGA 3DEOA 4F1PA 2ZGDA 4U8VD 1OY3D 2JABA 4J7WA 2F8YA 4HI9A 1BLXB 3SO8A 4DX2A 1S70B 4J8YA 1MX6A 3T9KA 3V2XA 4TUMA 5AQ9A 3ZUVB 3NBNB 1MX2A 5JMND 5CEAA 5ENRD 4G8LA 5CEDB 2KBXA 3JXJA 4LNUD 5AQBA 4ATZD 1WG0A 2MYOA 3NOGD
chains in the Genus database with same CATH superfamily
2WB2A 1Y6IA 3B7TA 1UW4B 3ML8A 4A63B 1OCZE 3G2WA 1BPOA 4O1PA 4HORA 5DIZA 2PM6A 1U3DA 4MS6A 4RG6A 3CLJA 2XEEA 1PC2A 3S7DA 3GZ2A 2FO7A 2LSVA 4HLLA 1FVHA 4HVBA 4I9CA 2XGMA 4J8EA 2XENA 2P9NG 3D9OA 2P9PG 3ESLA 1U3CA 3DWLG 3C5RA 1D9SA 5AQAA 3CHQA 2RFMA 3NF1A 4JA9A 3L54A 1KT0A 1OCOE 2J4DA 4HOQA 1AWCB 4H7XA 2F37A 3CR3A 1TR4A 2V5FA 4HFGA 1H2VC 2XCBA 1YCSB 4F53A 3HXEA 4OVUA 3KSQA 3O48A 3ABKE 1FVFA 4CDMA 2P9UG 5T3RA 4DPRA 4C0EA 3LEWA 5AAOA 3ZEFA 3UTMA 2FI7A 2C2LA 1BLXB 3Q7FA 1S70B 3AS4A 5ANRA 4L9PA 3SFYA 2AWIA 2RD0A 2ZU6B 1EYHA 2NXPA 5HS0A 3PZ4A 4B8AA 2J4BA 2A4ZA 3AU4A 3CHRA 3PUJA 4GAAA 1H0AA 1V55E 3SFXA 4DX6D 4GTOA 3FUNA 2CG2A 5CMWA 3QWVA 4MLPA 3KS2A 2X6HA 2I9CA 2PQRA 2HO1A 4AIFA 4BSXA 5T8IA 3CVLA 2L0TB 1S0PA 4U8YD 4AXHA 2NC9A 3FEXA 3UPVA 1E7VA 1OUVA 5JA4D 2L9BA 5A6CA 5D66A 3ONKA 5DBKA 4I17A 2BF0X 1HXIA 2P9IG 3MKRA 2WPVA 3C3OA 3ZXSA 3J5PA 4DX5D 3FUHA 3EHRA 4OVVA 1S63A 2KC7A 1ZB1A 4DI4A 4GMLA 4FP7A 4OYSA 4FLBA 4WWNA 4ACKA 3FTXA 3LJ3A 4DJAA 4DX2A 2VGYA 3ASDA 3Q78A 3NBNB 3MJWA 3QNKA 1B89A 4RVBA 4BT9A 1YA0A 1HH8A 2QY7A 3JQ0A 4YVQC 4LUNU 3S2AA 4EZKA 1MX4A 2FBNA 5ENSD 3W9GA 1E96B 3PREA 1WM5A 1OT8A 1UJKA 4CYMD 3E32A 4AOFA 4U04A 3ZYLA 5LCWC 2DWZA 1HG5A 5ENNA 5FINA 2ONDA 5EX0A 4Z68A 3TWXA 1N0QA 3MX3A 2LO6A 2GRNB 4TXQA 3SI5A 3SGHA 4UWFA 2VGXA 3PZ1A 1G3NB 4YVOA 2R05A 2WQHA 4ILGA 5D2MC 3I4GA 1FCHA 4G8KA 3QJZA 4UWHA 4AVXA 1O5MA 2R17C 4U7EB 4EECA 1H6OA 4F3VA 1HG2A 3DBSA 2J8SD 3B7SA 2P9KG 3AAAC 3CK7A 4KXKB 4CT4A 3UM3A 3RIBA 3ZPJA 3DXKG 1MQSA 3TXNA 3UINC 5FT9A 2WXRA 4AY6A 3ASFA 1TJCA 3CSTA 3SO8A 4YNDA 5JMND 4G8LA 1HF8A 3CGHA 3D9NA 3FHEA 1K1BA 3BEEA 5AJDA 4CEMA 2F0YA 4IULA 4JC8A 4DI3A 4XEIG 2BEDA 5D0OD 3Q9UC 1TNZA 3S7FA 3V30A 4U63A 3L16A 3T5VA 3RJVA 4NACA 3QARA 4B0ZA 2B6CA 3E37A 4JPSA 2Y3AA 3OTNA 4XKBA 4APOA 3E34A 2JLBA 3N71A 4PDXA 4G1TA 1KZPA 2GRRB 4N3CA 2UWJG 2VSYA 5B3SE 4I1AA 3EU9A 5LCWJ 2LXMA 3R7QA 2WXHA 4KZ0A 4BT8A 3ZYQA 4AM9A 4AJWA 5JJ6A 4KT6B 1IHGA 4IN3B 5CBNA 2DZOA 2IO3C 3FUMA 2VTBA 4K5CA 3D9MA 2QZAA 3PNTB 4KBQA 3UIOC 1TEZA 3HRAA 4G24A 4D10C 1PAQA 2A5EA 3NAWA 3ZRHA 5FWQA 3DEOA 1ZBPA 4LRZA 4KVOA 2R59A 4XIFA 1JCQA 2GRPB 1KLXA 3VTXA 2X6KA 1XNFA 1DCEA 1Z3YA 2MYOA 1MHQA 3UUXA 2V4HC 3ONLA 4LNBA 2V4LA 4A55A 4JXTA 2YQ8A 5EIBE 2JEKA 3MV2B 3ABME 3W9FA 4OAVB 4DK5A 5J08A 5ARGA 4GCNA 5AIJA 4K5AB 5FQ4A 2CG3A 3JUIA 1E90A 3CQCB 4CCAA 4P29A 5E76A 1NP7A 3SD5A 3IV0A 2LSUA 3K9IA 4HRLA 2IO2C 4R7LA 5FQ7A 1K1AA 3ZGQA 4WNFA 2YNQA 2AXVA 3FTYA 4GYOA 3QDNA 1N11A 3BU8A 3UX4A 4GU5A 1MZCA 2LXLA 3DSWA 4G2VA 1E8WA 2FEZA 3AU5A 4F7AA 5HRYA 3PZ2A 3JXIA 3RRNB 2YINA 2VGEA 1X81A 2XEHA 5EILA 3DEPA 3AG3E 1Y8MA 3FU6A 4XKCA 2WMNA 4N3BA 5AN8A 2OCCE 3DSUA 3SHFA 3NQPA 3D9JA 5EDSA 4I9EA 1QQEA 3CVQA 3L9TA 3JYSA 4YDOA 2V8SE 4G11A 2XEVA 4WUYA 4JZYA 1SVXA 4M3OA 3ULQA 1MYOA 2V5QC 4DX7D 1Z6TA 5BXOA 3HXBA 4L2YA 4ILIA 4BWRA 2M63A 5KNGA 2FO1E 4HRMB 4HLEA 3CVYA 5CRVA 4KZCA 3APDA 2GW1A 2XPYA 1INZA 4J8DA 5AARA 3CHOA 1NA0A 4LCTA 3VLFA 4BEPA 3JUEA 2V0PA 4GA1A 4URKA 3P1UA 4GZDA 4BTAA 3IBEA 3C3RA 3AG4E 3LPZA 4A1SA 3NZUA 2IEJA 5BXUA 1A5EA 2AJAA 3E4BA 2C0LA 1LD8A 1OWNA 5FQ6A 4QFVA 3Q5MA 4U0ZA 5BNWA 4DLQA 3PZ3A 1JCRA 5FQ8A 4YDWA 4JEHA 3PEUB 4BETA 2WXPA 2WM9A 5EN5D 1N54A 4Q69A 3B95A 3ASGA 2P9LG 4F1PA 2R2LA 3FUJA 1H19A 3B13A 2KCLA 3I4RB 2GGFA 3URZA 2WXMA 2VTBB 3NOGD 5T4YA 4XZ4A 4CT0A 3ZNGA 5FZRA 2WXGA 5EYLA 2ETCA 4A3VA 2BTDA 3DRAA 4PS7A 1DNPA 3RSEG 2XRZA 2ETAA 1O1SA 3ZHEB 3QB2A 4RSYA 2RG8A 4DX1A 5BPPA 3CK9A 2I2OA 2L6BA 4HOUA 4N2SA 5LX8A 3ULEG 4FADA 4ANUA 2OEWA 4TV3A 3UMVA 2IU1A 3CEQA 4FHKA 4C9BB 1UN8A 5ITZF 1HZ4A 1TNYA 3B7BA 1ELKA 4U96D 1P5QA 5KJMA 3TWQA 4EQFA 3E33A 2H6GA 3UKUG 4X8QA 3L13A 3E30A 1H6PA 4BX9A 3SBSA 1DVPA 1SZAA 1V54E 2BKKB 4JHRA 1HE8A 3ZXPA 2CHXA 4O6FA 1N0RA 4B94A 2DYRE 3FTZA 4GTRA 3SZ7A 3C3QA 2PL2A 3TWUA 4E85A 4HRNA 2E2EA 3AJIA 3P2BA 3G2UA 3EU5A 3FU3A 4NRHB 2GROB 2I1JA 4EBAG 4J7WA 2F8YA 4I6GA 1IQUA 1MX6A 5CEAA 5H7PA 5ENRD 5LFAA 4FULA 3L22A 2AXUA 2ZISA 1EPUA 3MA5A 1OWOA 3Q9NC 2XHEA 2EILE 4PUCA 4ATGA 5EYPF 5BV0A 4MKTA 1E8XA 4HBDA 2WXNA 4L2LA 1UN9A 4ANVA 3RK6A 3V31A 1N4PA 3ASOE 3AS5A 2RKKA 3QC1A 4GZ5A 2IF4A 1O1TA 2WXQA 3FFLA 4U07A 3C72A 4M7CA 1KZOA 2ZGGA 4EPZA 3IKOB 5AQ7A 1QZ2A 4DUIA 3IHVA 3SBTB 3Q7AA 2CFZA 3CQGB 4CZ2D 2VQ2A 3J5QB 3FU0A 3D9PA 1VDYA 5ENQD 4ZHBA 5FZQA 5KNHD 4J8FA 4JW1A 3UKRG 2XCCA 4UQXA 3LY9A 3V2XA 2AXZA 4I6JA 5CEDB 5HI7A 4LNUD 5AQBA 3ASNE 4HI8A 3TWRA 4U95D 3PS6A 2WXJA 4AP2A 1K3ZD 3FUFA 3ZVVA 2Y1LE 5ENPD 4NQ0A 3TAXA 3RRMB 1HS6A 4JVSA 3O4ZA 2IQCA 4ILHB 2PQNA 4N39A 3VTYA 4ANWA 2KZTA 5E75A 1SQMA 2R02A 5CCLA 2MHKA 4UWGA 2KCVA 3CIAA 3RO3A 1FPPA 1N52A 1BU9A 2PNNA 2Y69E 4GYYA 2EIKE 2DVWA 5G04J 5JHBA 3RO2A 5HKPA 3Q15A 4CDNA 5ENTD 2X6FA 4BX8A 3MGBA 3ZN3A 2F8XK 5AYWD 3CHSA 4TXPA 3ZKJA 3T5XA 3DXMG 3HVEA 1FT1A 3G2TA 3DSVA 3UM0A 1OWLA 1Z5SC 2MRIA 3UT4A 3IHYA 2XPZA 4XI0A 3SQVA 4GTQA 4FLHA 3JCKC 3KAEA 3R9MA 3R7RA 2WQ7A 4WNDA 3CVPA 5G2NA 4KVMA 4JB8P 4J0UA 4I2ZA 1BD8A 3ZHEA 4N2QA 3CHPA 4GA2A 4FHJA 4GPKA 3PUKA 3V2OA 2XS1A 4J8SA 5CHEE 3HYMB 2XGOA 3X2QE 3NZSA 5J90A 3ZU7B 2GRLA 2OEVA 1HX8A 3OXLA 2WXKA 5C2YA 4WNEA 3KEZA 5EIDA 3TJPA 2AVPA 3MYVA 3Q73A 4APFA 1K8KG 4EHMA 3EIQC 4GTVA 5CBOA 2UY1A 1AP7A 3DSTA 2I1KA 4GTTA 3LY8A 1LD7A 1X5BA 1NFIE 3FH8A 3U66A 5AJLA 4GTPA 3EIJA 3PH0C 4ANXA 4B93B 1ELRA 2EINE 1UOHA 2J09A 4WWOA 3S7JA 4TXRA 1U2VG 2WXIA 5LP0A 1OCCE 4I6EA 4ACLA 2IY0C 4BSZB 4H7YA 4K0RA 3MEKA 4JHJA 3UT8A 4GMJA 2ZGDA 3FY4A 4U8VD 5BUZA 3FTSA 3HHMA 1TN7A 1XGWA 1QBQA 3MCXA 3Q79A 3EHMA 1A17A 3LDZA 3U64A 2HR2A 2NSZA 4GCOA 5IY5E 3PZDA 1HFAA 2H6HA 5A7DB 2WMOA 1SA5A 3V79K 4JD2G 3PDNA 1UG3A 1FT2A 2P9SG 4FJYA 1OCRE 4I2WA 2LAHA 1IXVA 5G55A 1IKND 5B1BE 1D8DA 3KSLA 1PY1A 3BQOA 2PM7A 1NI1A 3LXUX 2ZIRA 4UWLA 5B1AE 2LUHA 3L6AA 3TGOA 3EUVA 1IHBA 3DPYA 4AEZC 4HOSA 2WVIA 3FTWA 2HM8A 4U0UA 5KBAA 2KZTB 5FTPA 1N4RA 3CVXA 3U4TA 4XI9A 1SW6A 3APFA 2NYJA 2BKGA 2IONA 4I1MA 2DBAA 4LERA 3U3WA 3UXGA 3RKVA 3UM2A 1RW2A 3DPDA 2J9QA 2JABA 2AW6A 3S7BA 1H2TC 3HDXA 3B7UX 2KBXA 1TYQG 4GZCA 3T8MA 3NOCD 3CKBA 4RG9A 4UI9C 4W9RA 1N9AA 2FULA 3HVEB 3HXDA 3ML9A 3MKQB 1SA4A 3TWSA 1N4SA 4HQDA 3TXMA 3ZIMA 5C1DA 1JWGA 1H2UA 4FU3A 2DIWA 1TN8A 3AG1E 5CCMA 2ETBA 1KT1A 2OVFA 5EX3A 4DLOA 2I6HA 3HG0D 2R5SA 3G2SA 4Q96A 3U9WA 4G26A 4EZLA 4Q94A 1TNUA 3LVQE 4YDYA 4BTBA 5CERB 4HXIA 3CK8A 2YHEA 3EHQA 1SZ9A 3MV3B 4JA7A 2DZNA 2DYSE 5CECB 3HXCA 5FIOA 4F1SA 3FUKA 1Z3XA 5ARFA 5FJYA 3FWVA 3FEYA 1NA3A 2QC9A 3LJNA 1L5JA 3LS8A 5A23A 1LF8A 5ANLA 4O60A 3D3MA 3T8KA 3TG4A 3NB2A 2UY1B 4DRXE 4EBAA 3TL5A 3CHMA 1YYHA 5BV1A 3Q4AB 2EIJE 5CRUA 3BG1B 3C98A 3ABLE 3D9IA 2IOLA 4TUMA 2Y4UA 2MOWA 4ABNA 3JXJA 2BUGA 2VJ8A 4UQYA 3ESKA 3D9HA 3SFZA 4V3IA 2DCPA 3PVLA 3ASHA 1OWMA 1UJJA 4F6RD 4AV7A 5CMYA 2KM4A 2J49A 4Y6WA 3TWWA 3FTUA 4CGWA 3FH5A 4JEUA 5FZSA 3LKUA 2KXPC 1EDUA 5KJNA 2Q7FA 3DSXA 3ISMC 5G04C 3TG5A 3KEAA 3VLEA 3D9LA 3FU5A 2GRMA 1O1RA 4UI9J 4WNGA 2EIME 2J08A 3QAQA 3PRZA 3OXGA 4BY6A 3QWPA 1IYGA 1N94A 4PH4B 4O1OA 3GYZA 3QKYA 2L6JA 2GRQB 3MZLB 2Y0BG 3QOUA 4K5BA 4NURA 5M72A 3SY2A 2HE0A 2P58C 3B7RL 3ZW3A 2WQ6A 1OY3D 1GW6A 3JQ1A 5AQ9A 2HYZA 1TNBA 4TUUA 1WG0A 3BG0B 4JL0A 4PS3A 4FJZA 2XRYA 4WAFA 3TWTA 2XS8A 1N4QA 1E7UA 1DCQA 4WWPA 2X6JA 2XGSA 2J07A 4XE0A 3F6QA 1D8EA 4OAUC 3AG2E 1ELWA 4FC8A 1JPLA 3UM1A 1HO8A 4GA0A 3ZYKA 5KWDA 2X38A 1NL4A 2PZIA 4LSZE 4CDRA 1IQRA 1WDYA 2P2CP 4AY5A 3IEGA 1OXJA 2QYUA 2VSXE 1QYMA 3PEVB 2FF4A 3PNLB 2XZTG 1EF1C 2R03A 3FUEA 3SF4A 1TN6A 2IJGX 4ZFHA 4RQIA 4N5QA 5D0QD 3RAUA 3UIPC 4A1GA 4L7TA 3Q49B 4QQIA 1LTXA 1JUQA 4GZ3A 3FUIA 4MRUA 4N5CA 2XZDG 4A3TA 4LG6A 4YDEA 4U0SA 2Y4TA 5JJTA 2LNIA 4UI9K 2RFAA 3LYAA 2IFUA 3APCA 3HXFA 3CVWA 4MBGA 2YHCA 3WXXA 3LVRE 4J8YA 4I1OB 3L08A 3ZUVB 3OXFA 1MX2A 1JCSA 3ULYA 3RRUA 2X3MA 4C0MA 4GPMA 3CSFA 3ENEA 5JHAA 4NIKA 3MKQA 3CV0A 3BUAA 4GB9A 3I3NA 4J6IA 3KD7A 2C0MA 3TWVA 2XQ0A 1HU3A 3R9AB 2CFUA 2A5UA 3Q75A 4UQZA 4BESA 4I43A 3LY7A 4N3AA 3QK0A 1N95A 4RLYA 5G05C 2B0OE 4Y6CA 3DSSA 4L1BA 2OVBA 3EJNA 2X6IA 4IYPA 1W3BA 3OAWA 3I5PA 1TNOA 2KATA 3GZSA 4K03A 4U8HA 5BW8C 1DC2A 1Q2ZA 5EKQD 2ILRA 3EHNA 3GZ1A 4GYWA 2OV8A 4GZ6A 5BT1A 2XPIA 3Q47B 3L82A 5JJ7A 2QYJA 4KMOA 4UWKA 4GTSA 2VSOE 4IRUA 1JWFA 4HOTA 3FDHA 2WXOA 2H6FA 4LEUA 3IXEA 5KJKA 1BI7B 3G2VA 3SNXA 2ZXWE 1NZNA 4E6HA 1H6KA 1BI8B 2CHZA 3FULA 1RZ4A 4HI9A 5LOZA 3WG7E 3T9KA 1ZU2A 1WAO1 4CRWA 4LNGA 4FA6A 2H6IA 4CGVA 4PS8A 3UI2A 2LAIA 4EZJA 3FTVA 3D9KA 4HNAD 2EQXA 4GTMA 3CKCA 5KJLA 1OWPA 2QFCA 3EDTB 3CVNA 2E0IA 4HB5A 5ENOD 4JHKA 2KCKA 4HS2A 1YMPA 3UQ3A 1QNFA 2VGXB 1TJFA 3QWWA 4L23A 4C48B 1MJ0A 3HIZA 4GMRA 4ME2A 1KPSB 3CVVA 4G23A 3VLDA 3LCAA 3FP3A 4XX5A 3AS8A 2OOEA 3UT7A 4BERA 5HQ8A 3FUDA 5AENA 2L0IA 4B89A 2CHWA 5G05J 3ZYMA 1S64A 1E8ZA 3PE4A 2WXLA 1E8YA 4KYOB 2WXFA 4B8CB 3CVUA 3L17A 2IOSA 3FH7A 5KCMA 3ZFWA 3PE3A 4UUCA 2VSNA 3RU0A 4BFRA 4TRQA 2VYIA 1WY6A 3GW4A 4ATZD 4G25A
chains in the Genus database with same CATH topology
3D9HA 2V4HC 4GPMA 4HI8A 3TWRA 1SVXA 4U95D 3NOCD 3ZNGA 3Q9NC 3TWTA 1MX4A 1K1BA 1MYOA 2V5QC 1DCQA 5ENSD 3W9GA 4NIKA 2ETCA 4JB8P 5EYLA 4A63B 4DX7D 5BXOA 5EIBE 5HS0A 1BD8A 3W9FA 4OAVB 1OT8A 5EYPF 4F6RD 5KNGA 1K3ZD 4O1PA 3F6QA 4K5AB 3TWVA 4CYMD 2ETAA 2FO1E 4BESA 3TWSA 4OAUC 2XEEA 2Y1LE 4HRMB 5ENPD 3UI2A 4HQDA 4RLYA 3TWWA 3V2OA 4HBDA 2DWZA 4HLLA 3V79K 4DX1A 4HNAD 3Q9UC 2L6BA 5FINA 2B0OE 4Z68A 4DX6D 3V30A 3ZU7B 3TWXA 5KWDA 1N0QA 2KXPC 1IXVA 4HRLA 4LSZE 4HB5A 2XENA 5AARA 2ETBA 5ENOD 5ITZF 3V31A 1IKND 1WDYA 2P2CP 3C5RA 5EIDA 1D9SA 1YMPA 5AQAA 3B7BA 1K1AA 4BEPA 1G3NB 3HG0D 2RFMA 3JUEA 1QYMA 3KEAA 4U96D 2XZTG 4G8KA 1N11A 3TWQA 4C48B 1DC2A 4YDYA 1MJ0A 2ZGGA 5CERB 4GMRA 5CBOA 1AP7A 4U8YD 1AWCB 5AQ7A 3EHQA 1BU9A 2PNNA 2DZNA 2F37A 4ZFHA 2J8SD 2AJAA 4DUIA 1IHBA 5BXUA 5JA4D 1TR4A 1A5EA 5CECB 1NFIE 2DVWA 5D66A 4N5QA 5FIOA 1YCSB 5HKPA 3EU9A 5ENTD 4BERA 3AAAC 2BKKB 2QYJA 5HRYA 4QFVA 4B93B 3JXIA 1UOHA 4QQIA 4CZ2D 1N0RA 2VGEA 5KBAA 5CBNA 2DZOA 3J5QB 3J5PA 4K5CA 4DX5D 2XEHA 4YDWA 2QC9A 5EILA 3LJNA 2XZDG 3DEPA 3EHRA 4LG6A 4O1OA 3TWUA 4O60A 3IXEA 3HRAA 4BETA 2F8XK 5EN5D 2Y0BG 3ZKJA 1BI7B 1SW6A 2RFAA 4HRNA 5ENQD 3T8KA 4BSZB 2A5EA 2NYJA 3AJIA 3B95A 2BKGA 4K5BA 4ZHBA 4DRXE 5KNHD 1YYHA 5AAOA 5AN8A 1BI8B 2HE0A 4UUCA 3UTMA 3UXGA 3DEOA 4F1PA 2ZGDA 4U8VD 1OY3D 2JABA 4J7WA 2F8YA 4HI9A 1BLXB 3SO8A 4DX2A 1S70B 4J8YA 1MX6A 3T9KA 3V2XA 4TUMA 5AQ9A 3ZUVB 3NBNB 1MX2A 5JMND 5CEAA 5ENRD 4G8LA 5CEDB 2KBXA 3JXJA 4LNUD 5AQBA 4ATZD 1WG0A 2MYOA 3NOGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9H A;  2V4H C;  4GPM A;  4HI8 A;  3TWR A;  1SVX A;  4U95 D;  3NOC D;  3ZNG A;  3Q9N C;  3TWT A;  1MX4 A;  1K1B A;  1MYO A;  2V5Q C;  1DCQ A;  5ENS D;  3W9G A;  4NIK A;  2ETC A;  4JB8 P;  5EYL A;  4A63 B;  4DX7 D;  5BXO A;  5EIB E;  5HS0 A;  1BD8 A;  3W9F A;  4OAV B;  1OT8 A;  5EYP F;  4F6R D;  5KNG A;  1K3Z D;  4O1P A;  3F6Q A;  4K5A B;  3TWV A;  4CYM D;  2ETA A;  2FO1 E;  4BES A;  3TWS A;  4OAU C;  2XEE A;  2Y1L E;  4HRM B;  5ENP D;  3UI2 A;  4HQD A;  4RLY A;  3TWW A;  3V2O A;  4HBD A;  2DWZ A;  4HLL A;  3V79 K;  4DX1 A;  4HNA D;  3Q9U C;  2L6B A;  5FIN A;  2B0O E;  4Z68 A;  4DX6 D;  3V30 A;  3ZU7 B;  3TWX A;  5KWD A;  1N0Q A;  2KXP C;  1IXV A;  4HRL A;  4LSZ E;  4HB5 A;  2XEN A;  5AAR A;  2ETB A;  5ENO D;  5ITZ F;  3V31 A;  1IKN D;  1WDY A;  2P2C P;  3C5R A;  5EID A;  1D9S A;  1YMP A;  5AQA A;  3B7B A;  1K1A A;  4BEP A;  1G3N B;  3HG0 D;  2RFM A;  3JUE A;  1QYM A;  3KEA A;  4U96 D;  2XZT G;  4G8K A;  1N11 A;  3TWQ A;  4C48 B;  1DC2 A;  4YDY A;  1MJ0 A;  2ZGG A;  5CER B;  4GMR A;  5CBO A;  1AP7 A;  4U8Y D;  1AWC B;  5AQ7 A;  3EHQ A;  1BU9 A;  2PNN A;  2DZN A;  2F37 A;  4ZFH A;  2J8S D;  2AJA A;  4DUI A;  1IHB A;  5BXU A;  5JA4 D;  1TR4 A;  1A5E A;  5CEC B;  1NFI E;  2DVW A;  5D66 A;  4N5Q A;  5FIO A;  1YCS B;  5HKP A;  3EU9 A;  5ENT D;  4BER A;  3AAA C;  2BKK B;  2QYJ A;  5HRY A;  4QFV A;  4B93 B;  3JXI A;  1UOH A;  4QQI A;  4CZ2 D;  1N0R A;  2VGE A;  5KBA A;  5CBN A;  2DZO A;  3J5Q B;  3J5P A;  4K5C A;  4DX5 D;  2XEH A;  4YDW A;  2QC9 A;  5EIL A;  3LJN A;  2XZD G;  3DEP A;  3EHR A;  4LG6 A;  4O1O A;  3TWU A;  4O60 A;  3IXE A;  3HRA A;  4BET A;  2F8X K;  5EN5 D;  2Y0B G;  3ZKJ A;  1BI7 B;  1SW6 A;  2RFA A;  4HRN A;  5ENQ D;  3T8K A;  4BSZ B;  2A5E A;  2NYJ A;  3AJI A;  3B95 A;  2BKG A;  4K5B A;  4ZHB A;  4DRX E;  5KNH D;  1YYH A;  5AAO A;  5AN8 A;  1BI8 B;  2HE0 A;  4UUC A;  3UTM A;  3UXG A;  3DEO A;  4F1P A;  2ZGD A;  4U8V D;  1OY3 D;  2JAB A;  4J7W A;  2F8Y A;  4HI9 A;  1BLX B;  3SO8 A;  4DX2 A;  1S70 B;  4J8Y A;  1MX6 A;  3T9K A;  3V2X A;  4TUM A;  5AQ9 A;  3ZUV B;  3NBN B;  1MX2 A;  5JMN D;  5CEA A;  5ENR D;  4G8L A;  5CED B;  2KBX A;  3JXJ A;  4LNU D;  5AQB A;  4ATZ D;  1WG0 A;  2MYO A;  3NOG D; 
#chains in the Genus database with same CATH topology
 2WB2 A;  1Y6I A;  3B7T A;  1UW4 B;  3ML8 A;  4A63 B;  1OCZ E;  3G2W A;  1BPO A;  4O1P A;  4HOR A;  5DIZ A;  2PM6 A;  1U3D A;  4MS6 A;  4RG6 A;  3CLJ A;  2XEE A;  1PC2 A;  3S7D A;  3GZ2 A;  2FO7 A;  2LSV A;  4HLL A;  1FVH A;  4HVB A;  4I9C A;  2XGM A;  4J8E A;  2XEN A;  2P9N G;  3D9O A;  2P9P G;  3ESL A;  1U3C A;  3DWL G;  3C5R A;  1D9S A;  5AQA A;  3CHQ A;  2RFM A;  3NF1 A;  4JA9 A;  3L54 A;  1KT0 A;  1OCO E;  2J4D A;  4HOQ A;  1AWC B;  4H7X A;  2F37 A;  3CR3 A;  1TR4 A;  2V5F A;  4HFG A;  1H2V C;  2XCB A;  1YCS B;  4F53 A;  3HXE A;  4OVU A;  3KSQ A;  3O48 A;  3ABK E;  1FVF A;  4CDM A;  2P9U G;  5T3R A;  4DPR A;  4C0E A;  3LEW A;  5AAO A;  3ZEF A;  3UTM A;  2FI7 A;  2C2L A;  1BLX B;  3Q7F A;  1S70 B;  3AS4 A;  5ANR A;  4L9P A;  3SFY A;  2AWI A;  2RD0 A;  2ZU6 B;  1EYH A;  2NXP A;  5HS0 A;  3PZ4 A;  4B8A A;  2J4B A;  2A4Z A;  3AU4 A;  3CHR A;  3PUJ A;  4GAA A;  1H0A A;  1V55 E;  3SFX A;  4DX6 D;  4GTO A;  3FUN A;  2CG2 A;  5CMW A;  3QWV A;  4MLP A;  3KS2 A;  2X6H A;  2I9C A;  2PQR A;  2HO1 A;  4AIF A;  4BSX A;  5T8I A;  3CVL A;  2L0T B;  1S0P A;  4U8Y D;  4AXH A;  2NC9 A;  3FEX A;  3UPV A;  1E7V A;  1OUV A;  5JA4 D;  2L9B A;  5A6C A;  5D66 A;  3ONK A;  5DBK A;  4I17 A;  2BF0 X;  1HXI A;  2P9I G;  3MKR A;  2WPV A;  3C3O A;  3ZXS A;  3J5P A;  4DX5 D;  3FUH A;  3EHR A;  4OVV A;  1S63 A;  2KC7 A;  1ZB1 A;  4DI4 A;  4GML A;  4FP7 A;  4OYS A;  4FLB A;  4WWN A;  4ACK A;  3FTX A;  3LJ3 A;  4DJA A;  4DX2 A;  2VGY A;  3ASD A;  3Q78 A;  3NBN B;  3MJW A;  3QNK A;  1B89 A;  4RVB A;  4BT9 A;  1YA0 A;  1HH8 A;  2QY7 A;  3JQ0 A;  4YVQ C;  4LUN U;  3S2A A;  4EZK A;  1MX4 A;  2FBN A;  5ENS D;  3W9G A;  1E96 B;  3PRE A;  1WM5 A;  1OT8 A;  1UJK A;  4CYM D;  3E32 A;  4AOF A;  4U04 A;  3ZYL A;  5LCW C;  2DWZ A;  1HG5 A;  5ENN A;  5FIN A;  2OND A;  5EX0 A;  4Z68 A;  3TWX A;  1N0Q A;  3MX3 A;  2LO6 A;  2GRN B;  4TXQ A;  3SI5 A;  3SGH A;  4UWF A;  2VGX A;  3PZ1 A;  1G3N B;  4YVO A;  2R05 A;  2WQH A;  4ILG A;  5D2M C;  3I4G A;  1FCH A;  4G8K A;  3QJZ A;  4UWH A;  4AVX A;  1O5M A;  2R17 C;  4U7E B;  4EEC A;  1H6O A;  4F3V A;  1HG2 A;  3DBS A;  2J8S D;  3B7S A;  2P9K G;  3AAA C;  3CK7 A;  4KXK B;  4CT4 A;  3UM3 A;  3RIB A;  3ZPJ A;  3DXK G;  1MQS A;  3TXN A;  3UIN C;  5FT9 A;  2WXR A;  4AY6 A;  3ASF A;  1TJC A;  3CST A;  3SO8 A;  4YND A;  5JMN D;  4G8L A;  1HF8 A;  3CGH A;  3D9N A;  3FHE A;  1K1B A;  3BEE A;  5AJD A;  4CEM A;  2F0Y A;  4IUL A;  4JC8 A;  4DI3 A;  4XEI G;  2BED A;  5D0O D;  3Q9U C;  1TNZ A;  3S7F A;  3V30 A;  4U63 A;  3L16 A;  3T5V A;  3RJV A;  4NAC A;  3QAR A;  4B0Z A;  2B6C A;  3E37 A;  4JPS A;  2Y3A A;  3OTN A;  4XKB A;  4APO A;  3E34 A;  2JLB A;  3N71 A;  4PDX A;  4G1T A;  1KZP A;  2GRR B;  4N3C A;  2UWJ G;  2VSY A;  5B3S E;  4I1A A;  3EU9 A;  5LCW J;  2LXM A;  3R7Q A;  2WXH A;  4KZ0 A;  4BT8 A;  3ZYQ A;  4AM9 A;  4AJW A;  5JJ6 A;  4KT6 B;  1IHG A;  4IN3 B;  5CBN A;  2DZO A;  2IO3 C;  3FUM A;  2VTB A;  4K5C A;  3D9M A;  2QZA A;  3PNT B;  4KBQ A;  3UIO C;  1TEZ A;  3HRA A;  4G24 A;  4D10 C;  1PAQ A;  2A5E A;  3NAW A;  3ZRH A;  5FWQ A;  3DEO A;  1ZBP A;  4LRZ A;  4KVO A;  2R59 A;  4XIF A;  1JCQ A;  2GRP B;  1KLX A;  3VTX A;  2X6K A;  1XNF A;  1DCE A;  1Z3Y A;  2MYO A;  1MHQ A;  3UUX A;  2V4H C;  3ONL A;  4LNB A;  2V4L A;  4A55 A;  4JXT A;  2YQ8 A;  5EIB E;  2JEK A;  3MV2 B;  3ABM E;  3W9F A;  4OAV B;  4DK5 A;  5J08 A;  5ARG A;  4GCN A;  5AIJ A;  4K5A B;  5FQ4 A;  2CG3 A;  3JUI A;  1E90 A;  3CQC B;  4CCA A;  4P29 A;  5E76 A;  1NP7 A;  3SD5 A;  3IV0 A;  2LSU A;  3K9I A;  4HRL A;  2IO2 C;  4R7L A;  5FQ7 A;  1K1A A;  3ZGQ A;  4WNF A;  2YNQ A;  2AXV A;  3FTY A;  4GYO A;  3QDN A;  1N11 A;  3BU8 A;  3UX4 A;  4GU5 A;  1MZC A;  2LXL A;  3DSW A;  4G2V A;  1E8W A;  2FEZ A;  3AU5 A;  4F7A A;  5HRY A;  3PZ2 A;  3JXI A;  3RRN B;  2YIN A;  2VGE A;  1X81 A;  2XEH A;  5EIL A;  3DEP A;  3AG3 E;  1Y8M A;  3FU6 A;  4XKC A;  2WMN A;  4N3B A;  5AN8 A;  2OCC E;  3DSU A;  3SHF A;  3NQP A;  3D9J A;  5EDS A;  4I9E A;  1QQE A;  3CVQ A;  3L9T A;  3JYS A;  4YDO A;  2V8S E;  4G11 A;  2XEV A;  4WUY A;  4JZY A;  1SVX A;  4M3O A;  3ULQ A;  1MYO A;  2V5Q C;  4DX7 D;  1Z6T A;  5BXO A;  3HXB A;  4L2Y A;  4ILI A;  4BWR A;  2M63 A;  5KNG A;  2FO1 E;  4HRM B;  4HLE A;  3CVY A;  5CRV A;  4KZC A;  3APD A;  2GW1 A;  2XPY A;  1INZ A;  4J8D A;  5AAR A;  3CHO A;  1NA0 A;  4LCT A;  3VLF A;  4BEP A;  3JUE A;  2V0P A;  4GA1 A;  4URK A;  3P1U A;  4GZD A;  4BTA A;  3IBE A;  3C3R A;  3AG4 E;  3LPZ A;  4A1S A;  3NZU A;  2IEJ A;  5BXU A;  1A5E A;  2AJA A;  3E4B A;  2C0L A;  1LD8 A;  1OWN A;  5FQ6 A;  4QFV A;  3Q5M A;  4U0Z A;  5BNW A;  4DLQ A;  3PZ3 A;  1JCR A;  5FQ8 A;  4YDW A;  4JEH A;  3PEU B;  4BET A;  2WXP A;  2WM9 A;  5EN5 D;  1N54 A;  4Q69 A;  3B95 A;  3ASG A;  2P9L G;  4F1P A;  2R2L A;  3FUJ A;  1H19 A;  3B13 A;  2KCL A;  3I4R B;  2GGF A;  3URZ A;  2WXM A;  2VTB B;  3NOG D;  5T4Y A;  4XZ4 A;  4CT0 A;  3ZNG A;  5FZR A;  2WXG A;  5EYL A;  2ETC A;  4A3V A;  2BTD A;  3DRA A;  4PS7 A;  1DNP A;  3RSE G;  2XRZ A;  2ETA A;  1O1S A;  3ZHE B;  3QB2 A;  4RSY A;  2RG8 A;  4DX1 A;  5BPP A;  3CK9 A;  2I2O A;  2L6B A;  4HOU A;  4N2S A;  5LX8 A;  3ULE G;  4FAD A;  4ANU A;  2OEW A;  4TV3 A;  3UMV A;  2IU1 A;  3CEQ A;  4FHK A;  4C9B B;  1UN8 A;  5ITZ F;  1HZ4 A;  1TNY A;  3B7B A;  1ELK A;  4U96 D;  1P5Q A;  5KJM A;  3TWQ A;  4EQF A;  3E33 A;  2H6G A;  3UKU G;  4X8Q A;  3L13 A;  3E30 A;  1H6P A;  4BX9 A;  3SBS A;  1DVP A;  1SZA A;  1V54 E;  2BKK B;  4JHR A;  1HE8 A;  3ZXP A;  2CHX A;  4O6F A;  1N0R A;  4B94 A;  2DYR E;  3FTZ A;  4GTR A;  3SZ7 A;  3C3Q A;  2PL2 A;  3TWU A;  4E85 A;  4HRN A;  2E2E A;  3AJI A;  3P2B A;  3G2U A;  3EU5 A;  3FU3 A;  4NRH B;  2GRO B;  2I1J A;  4EBA G;  4J7W A;  2F8Y A;  4I6G A;  1IQU A;  1MX6 A;  5CEA A;  5H7P A;  5ENR D;  5LFA A;  4FUL A;  3L22 A;  2AXU A;  2ZIS A;  1EPU A;  3MA5 A;  1OWO A;  3Q9N C;  2XHE A;  2EIL E;  4PUC A;  4ATG A;  5EYP F;  5BV0 A;  4MKT A;  1E8X A;  4HBD A;  2WXN A;  4L2L A;  1UN9 A;  4ANV A;  3RK6 A;  3V31 A;  1N4P A;  3ASO E;  3AS5 A;  2RKK A;  3QC1 A;  4GZ5 A;  2IF4 A;  1O1T A;  2WXQ A;  3FFL A;  4U07 A;  3C72 A;  4M7C A;  1KZO A;  2ZGG A;  4EPZ A;  3IKO B;  5AQ7 A;  1QZ2 A;  4DUI A;  3IHV A;  3SBT B;  3Q7A A;  2CFZ A;  3CQG B;  4CZ2 D;  2VQ2 A;  3J5Q B;  3FU0 A;  3D9P A;  1VDY A;  5ENQ D;  4ZHB A;  5FZQ A;  5KNH D;  4J8F A;  4JW1 A;  3UKR G;  2XCC A;  4UQX A;  3LY9 A;  3V2X A;  2AXZ A;  4I6J A;  5CED B;  5HI7 A;  4LNU D;  5AQB A;  3ASN E;  4HI8 A;  3TWR A;  4U95 D;  3PS6 A;  2WXJ A;  4AP2 A;  1K3Z D;  3FUF A;  3ZVV A;  2Y1L E;  5ENP D;  4NQ0 A;  3TAX A;  3RRM B;  1HS6 A;  4JVS A;  3O4Z A;  2IQC A;  4ILH B;  2PQN A;  4N39 A;  3VTY A;  4ANW A;  2KZT A;  5E75 A;  1SQM A;  2R02 A;  5CCL A;  2MHK A;  4UWG A;  2KCV A;  3CIA A;  3RO3 A;  1FPP A;  1N52 A;  1BU9 A;  2PNN A;  2Y69 E;  4GYY A;  2EIK E;  2DVW A;  5G04 J;  5JHB A;  3RO2 A;  5HKP A;  3Q15 A;  4CDN A;  5ENT D;  2X6F A;  4BX8 A;  3MGB A;  3ZN3 A;  2F8X K;  5AYW D;  3CHS A;  4TXP A;  3ZKJ A;  3T5X A;  3DXM G;  3HVE A;  1FT1 A;  3G2T A;  3DSV A;  3UM0 A;  1OWL A;  1Z5S C;  2MRI A;  3UT4 A;  3IHY A;  2XPZ A;  4XI0 A;  3SQV A;  4GTQ A;  4FLH A;  3JCK C;  3KAE A;  3R9M A;  3R7R A;  2WQ7 A;  4WND A;  3CVP A;  5G2N A;  4KVM A;  4JB8 P;  4J0U A;  4I2Z A;  1BD8 A;  3ZHE A;  4N2Q A;  3CHP A;  4GA2 A;  4FHJ A;  4GPK A;  3PUK A;  3V2O A;  2XS1 A;  4J8S A;  5CHE E;  3HYM B;  2XGO A;  3X2Q E;  3NZS A;  5J90 A;  3ZU7 B;  2GRL A;  2OEV A;  1HX8 A;  3OXL A;  2WXK A;  5C2Y A;  4WNE A;  3KEZ A;  5EID A;  3TJP A;  2AVP A;  3MYV A;  3Q73 A;  4APF A;  1K8K G;  4EHM A;  3EIQ C;  4GTV A;  5CBO A;  2UY1 A;  1AP7 A;  3DST A;  2I1K A;  4GTT A;  3LY8 A;  1LD7 A;  1X5B A;  1NFI E;  3FH8 A;  3U66 A;  5AJL A;  4GTP A;  3EIJ A;  3PH0 C;  4ANX A;  4B93 B;  1ELR A;  2EIN E;  1UOH A;  2J09 A;  4WWO A;  3S7J A;  4TXR A;  1U2V G;  2WXI A;  5LP0 A;  1OCC E;  4I6E A;  4ACL A;  2IY0 C;  4BSZ B;  4H7Y A;  4K0R A;  3MEK A;  4JHJ A;  3UT8 A;  4GMJ A;  2ZGD A;  3FY4 A;  4U8V D;  5BUZ A;  3FTS A;  3HHM A;  1TN7 A;  1XGW A;  1QBQ A;  3MCX A;  3Q79 A;  3EHM A;  1A17 A;  3LDZ A;  3U64 A;  2HR2 A;  2NSZ A;  4GCO A;  5IY5 E;  3PZD A;  1HFA A;  2H6H A;  5A7D B;  2WMO A;  1SA5 A;  3V79 K;  4JD2 G;  3PDN A;  1UG3 A;  1FT2 A;  2P9S G;  4FJY A;  1OCR E;  4I2W A;  2LAH A;  1IXV A;  5G55 A;  1IKN D;  5B1B E;  1D8D A;  3KSL A;  1PY1 A;  3BQO A;  2PM7 A;  1NI1 A;  3LXU X;  2ZIR A;  4UWL A;  5B1A E;  2LUH A;  3L6A A;  3TGO A;  3EUV A;  1IHB A;  3DPY A;  4AEZ C;  4HOS A;  2WVI A;  3FTW A;  2HM8 A;  4U0U A;  5KBA A;  2KZT B;  5FTP A;  1N4R A;  3CVX A;  3U4T A;  4XI9 A;  1SW6 A;  3APF A;  2NYJ A;  2BKG A;  2ION A;  4I1M A;  2DBA A;  4LER A;  3U3W A;  3UXG A;  3RKV A;  3UM2 A;  1RW2 A;  3DPD A;  2J9Q A;  2JAB A;  2AW6 A;  3S7B A;  1H2T C;  3HDX A;  3B7U X;  2KBX A;  1TYQ G;  4GZC A;  3T8M A;  3NOC D;  3CKB A;  4RG9 A;  4UI9 C;  4W9R A;  1N9A A;  2FUL A;  3HVE B;  3HXD A;  3ML9 A;  3MKQ B;  1SA4 A;  3TWS A;  1N4S A;  4HQD A;  3TXM A;  3ZIM A;  5C1D A;  1JWG A;  1H2U A;  4FU3 A;  2DIW A;  1TN8 A;  3AG1 E;  5CCM A;  2ETB A;  1KT1 A;  2OVF A;  5EX3 A;  4DLO A;  2I6H A;  3HG0 D;  2R5S A;  3G2S A;  4Q96 A;  3U9W A;  4G26 A;  4EZL A;  4Q94 A;  1TNU A;  3LVQ E;  4YDY A;  4BTB A;  5CER B;  4HXI A;  3CK8 A;  2YHE A;  3EHQ A;  1SZ9 A;  3MV3 B;  4JA7 A;  2DZN A;  2DYS E;  5CEC B;  3HXC A;  5FIO A;  4F1S A;  3FUK A;  1Z3X A;  5ARF A;  5FJY A;  3FWV A;  3FEY A;  1NA3 A;  2QC9 A;  3LJN A;  1L5J A;  3LS8 A;  5A23 A;  1LF8 A;  5ANL A;  4O60 A;  3D3M A;  3T8K A;  3TG4 A;  3NB2 A;  2UY1 B;  4DRX E;  4EBA A;  3TL5 A;  3CHM A;  1YYH A;  5BV1 A;  3Q4A B;  2EIJ E;  5CRU A;  3BG1 B;  3C98 A;  3ABL E;  3D9I A;  2IOL A;  4TUM A;  2Y4U A;  2MOW A;  4ABN A;  3JXJ A;  2BUG A;  2VJ8 A;  4UQY A;  3ESK A;  3D9H A;  3SFZ A;  4V3I A;  2DCP A;  3PVL A;  3ASH A;  1OWM A;  1UJJ A;  4F6R D;  4AV7 A;  5CMY A;  2KM4 A;  2J49 A;  4Y6W A;  3TWW A;  3FTU A;  4CGW A;  3FH5 A;  4JEU A;  5FZS A;  3LKU A;  2KXP C;  1EDU A;  5KJN A;  2Q7F A;  3DSX A;  3ISM C;  5G04 C;  3TG5 A;  3KEA A;  3VLE A;  3D9L A;  3FU5 A;  2GRM A;  1O1R A;  4UI9 J;  4WNG A;  2EIM E;  2J08 A;  3QAQ A;  3PRZ A;  3OXG A;  4BY6 A;  3QWP A;  1IYG A;  1N94 A;  4PH4 B;  4O1O A;  3GYZ A;  3QKY A;  2L6J A;  2GRQ B;  3MZL B;  2Y0B G;  3QOU A;  4K5B A;  4NUR A;  5M72 A;  3SY2 A;  2HE0 A;  2P58 C;  3B7R L;  3ZW3 A;  2WQ6 A;  1OY3 D;  1GW6 A;  3JQ1 A;  5AQ9 A;  2HYZ A;  1TNB A;  4TUU A;  1WG0 A;  3BG0 B;  4JL0 A;  4PS3 A;  4FJZ A;  2XRY A;  4WAF A;  3TWT A;  2XS8 A;  1N4Q A;  1E7U A;  1DCQ A;  4WWP A;  2X6J A;  2XGS A;  2J07 A;  4XE0 A;  3F6Q A;  1D8E A;  4OAU C;  3AG2 E;  1ELW A;  4FC8 A;  1JPL A;  3UM1 A;  1HO8 A;  4GA0 A;  3ZYK A;  5KWD A;  2X38 A;  1NL4 A;  2PZI A;  4LSZ E;  4CDR A;  1IQR A;  1WDY A;  2P2C P;  4AY5 A;  3IEG A;  1OXJ A;  2QYU A;  2VSX E;  1QYM A;  3PEV B;  2FF4 A;  3PNL B;  2XZT G;  1EF1 C;  2R03 A;  3FUE A;  3SF4 A;  1TN6 A;  2IJG X;  4ZFH A;  4RQI A;  4N5Q A;  5D0Q D;  3RAU A;  3UIP C;  4A1G A;  4L7T A;  3Q49 B;  4QQI A;  1LTX A;  1JUQ A;  4GZ3 A;  3FUI A;  4MRU A;  4N5C A;  2XZD G;  4A3T A;  4LG6 A;  4YDE A;  4U0S A;  2Y4T A;  5JJT A;  2LNI A;  4UI9 K;  2RFA A;  3LYA A;  2IFU A;  3APC A;  3HXF A;  3CVW A;  4MBG A;  2YHC A;  3WXX A;  3LVR E;  4J8Y A;  4I1O B;  3L08 A;  3ZUV B;  3OXF A;  1MX2 A;  1JCS A;  3ULY A;  3RRU A;  2X3M A;  4C0M A;  4GPM A;  3CSF A;  3ENE A;  5JHA A;  4NIK A;  3MKQ A;  3CV0 A;  3BUA A;  4GB9 A;  3I3N A;  4J6I A;  3KD7 A;  2C0M A;  3TWV A;  2XQ0 A;  1HU3 A;  3R9A B;  2CFU A;  2A5U A;  3Q75 A;  4UQZ A;  4BES A;  4I43 A;  3LY7 A;  4N3A A;  3QK0 A;  1N95 A;  4RLY A;  5G05 C;  2B0O E;  4Y6C A;  3DSS A;  4L1B A;  2OVB A;  3EJN A;  2X6I A;  4IYP A;  1W3B A;  3OAW A;  3I5P A;  1TNO A;  2KAT A;  3GZS A;  4K03 A;  4U8H A;  5BW8 C;  1DC2 A;  1Q2Z A;  5EKQ D;  2ILR A;  3EHN A;  3GZ1 A;  4GYW A;  2OV8 A;  4GZ6 A;  5BT1 A;  2XPI A;  3Q47 B;  3L82 A;  5JJ7 A;  2QYJ A;  4KMO A;  4UWK A;  4GTS A;  2VSO E;  4IRU A;  1JWF A;  4HOT A;  3FDH A;  2WXO A;  2H6F A;  4LEU A;  3IXE A;  5KJK A;  1BI7 B;  3G2V A;  3SNX A;  2ZXW E;  1NZN A;  4E6H A;  1H6K A;  1BI8 B;  2CHZ A;  3FUL A;  1RZ4 A;  4HI9 A;  5LOZ A;  3WG7 E;  3T9K A;  1ZU2 A;  1WAO 1;  4CRW A;  4LNG A;  4FA6 A;  2H6I A;  4CGV A;  4PS8 A;  3UI2 A;  2LAI A;  4EZJ A;  3FTV A;  3D9K A;  4HNA D;  2EQX A;  4GTM A;  3CKC A;  5KJL A;  1OWP A;  2QFC A;  3EDT B;  3CVN A;  2E0I A;  4HB5 A;  5ENO D;  4JHK A;  2KCK A;  4HS2 A;  1YMP A;  3UQ3 A;  1QNF A;  2VGX B;  1TJF A;  3QWW A;  4L23 A;  4C48 B;  1MJ0 A;  3HIZ A;  4GMR A;  4ME2 A;  1KPS B;  3CVV A;  4G23 A;  3VLD A;  3LCA A;  3FP3 A;  4XX5 A;  3AS8 A;  2OOE A;  3UT7 A;  4BER A;  5HQ8 A;  3FUD A;  5AEN A;  2L0I A;  4B89 A;  2CHW A;  5G05 J;  3ZYM A;  1S64 A;  1E8Z A;  3PE4 A;  2WXL A;  1E8Y A;  4KYO B;  2WXF A;  4B8C B;  3CVU A;  3L17 A;  2IOS A;  3FH7 A;  5KCM A;  3ZFW A;  3PE3 A;  4UUC A;  2VSN A;  3RU0 A;  4BFR A;  4TRQ A;  2VYI A;  1WY6 A;  3GW4 A;  4ATZ D;  4G25 A; 
#chains in the Genus database with same CATH homology
 3D9H A;  2V4H C;  4GPM A;  4HI8 A;  3TWR A;  1SVX A;  4U95 D;  3NOC D;  3ZNG A;  3Q9N C;  3TWT A;  1MX4 A;  1K1B A;  1MYO A;  2V5Q C;  1DCQ A;  5ENS D;  3W9G A;  4NIK A;  2ETC A;  4JB8 P;  5EYL A;  4A63 B;  4DX7 D;  5BXO A;  5EIB E;  5HS0 A;  1BD8 A;  3W9F A;  4OAV B;  1OT8 A;  5EYP F;  4F6R D;  5KNG A;  1K3Z D;  4O1P A;  3F6Q A;  4K5A B;  3TWV A;  4CYM D;  2ETA A;  2FO1 E;  4BES A;  3TWS A;  4OAU C;  2XEE A;  2Y1L E;  4HRM B;  5ENP D;  3UI2 A;  4HQD A;  4RLY A;  3TWW A;  3V2O A;  4HBD A;  2DWZ A;  4HLL A;  3V79 K;  4DX1 A;  4HNA D;  3Q9U C;  2L6B A;  5FIN A;  2B0O E;  4Z68 A;  4DX6 D;  3V30 A;  3ZU7 B;  3TWX A;  5KWD A;  1N0Q A;  2KXP C;  1IXV A;  4HRL A;  4LSZ E;  4HB5 A;  2XEN A;  5AAR A;  2ETB A;  5ENO D;  5ITZ F;  3V31 A;  1IKN D;  1WDY A;  2P2C P;  3C5R A;  5EID A;  1D9S A;  1YMP A;  5AQA A;  3B7B A;  1K1A A;  4BEP A;  1G3N B;  3HG0 D;  2RFM A;  3JUE A;  1QYM A;  3KEA A;  4U96 D;  2XZT G;  4G8K A;  1N11 A;  3TWQ A;  4C48 B;  1DC2 A;  4YDY A;  1MJ0 A;  2ZGG A;  5CER B;  4GMR A;  5CBO A;  1AP7 A;  4U8Y D;  1AWC B;  5AQ7 A;  3EHQ A;  1BU9 A;  2PNN A;  2DZN A;  2F37 A;  4ZFH A;  2J8S D;  2AJA A;  4DUI A;  1IHB A;  5BXU A;  5JA4 D;  1TR4 A;  1A5E A;  5CEC B;  1NFI E;  2DVW A;  5D66 A;  4N5Q A;  5FIO A;  1YCS B;  5HKP A;  3EU9 A;  5ENT D;  4BER A;  3AAA C;  2BKK B;  2QYJ A;  5HRY A;  4QFV A;  4B93 B;  3JXI A;  1UOH A;  4QQI A;  4CZ2 D;  1N0R A;  2VGE A;  5KBA A;  5CBN A;  2DZO A;  3J5Q B;  3J5P A;  4K5C A;  4DX5 D;  2XEH A;  4YDW A;  2QC9 A;  5EIL A;  3LJN A;  2XZD G;  3DEP A;  3EHR A;  4LG6 A;  4O1O A;  3TWU A;  4O60 A;  3IXE A;  3HRA A;  4BET A;  2F8X K;  5EN5 D;  2Y0B G;  3ZKJ A;  1BI7 B;  1SW6 A;  2RFA A;  4HRN A;  5ENQ D;  3T8K A;  4BSZ B;  2A5E A;  2NYJ A;  3AJI A;  3B95 A;  2BKG A;  4K5B A;  4ZHB A;  4DRX E;  5KNH D;  1YYH A;  5AAO A;  5AN8 A;  1BI8 B;  2HE0 A;  4UUC A;  3UTM A;  3UXG A;  3DEO A;  4F1P A;  2ZGD A;  4U8V D;  1OY3 D;  2JAB A;  4J7W A;  2F8Y A;  4HI9 A;  1BLX B;  3SO8 A;  4DX2 A;  1S70 B;  4J8Y A;  1MX6 A;  3T9K A;  3V2X A;  4TUM A;  5AQ9 A;  3ZUV B;  3NBN B;  1MX2 A;  5JMN D;  5CEA A;  5ENR D;  4G8L A;  5CED B;  2KBX A;  3JXJ A;  4LNU D;  5AQB A;  4ATZ D;  1WG0 A;  2MYO A;  3NOG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...