4U97A

Crystal structure of asymmetric irak4 dimer
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
293
structure length
272
Chain Sequence
HSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAALKQQFDQEIKVMAKCQHENLVELLGFSLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRNIKSANILLDEAFTAKISDFGLATVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title IRAK4 Dimerization and trans-Autophosphorylation Are Induced by Myddosome Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 272
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u97A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u97A01
3JVSA 4M69B 2B55A 2C6DA 4FNWA 1XBCA 2ETMA 4EH9A 4EZ3A 2OJGA 5DMZA 3KGAA 4F6UA 3TJCA 2PMNX 4FKPA 5BYZA 4EOKA 4CVAA 4XOYA 3EFLA 3C1XA 3FC2A 1JAMA 3NNWA 4IVAA 3FI4A 1PXMA 4YZCA 3NAXA 3E8DA 5IA1A 4DT8A 2XK9A 4BF2A 3TZ9A 4B7TA 3CEKA 3CP9A 3AC5A 3HMNA 3KRXA 4NIFA 4APPA 5HO7A 1OKVA 3C4WA 4L7SA 4GVAA 5AMNA 3DQXA 4CEGA 4EL9A 3H9FA 5DPVA 3RAIA 3FMHA 3G6HA 3G9NA 3PIYA 4YJPA 2RG5A 4CKJA 1Y8YA 3MB7A 4X2JA 5IUIA 1LEZA 4GL9A 3UC3A 3L8VA 2W5BA 4MXZA 3SQQA 5CAOA 1OB3A 4RIOA 5A6NA 4WSQA 5IEVA 2Y0AA 3GU5A 2BMCA 4BCIA 4RIXB 4YLLA 2WELA 4R78A 2BCJA 3R30A 1BYGA 5K0KA 4WIHA 3PWDA 4TN6A 2LGCA 3NEWA 3MH2A 4NFNA 5HGIA 1PYEA 5JGDA 4WA9A 2YLEA 1GIIA 2ZMDA 3L8XA 3K5VA 4QOXA 4S2ZA 3R7IA 5A14A 4ZOGA 1M7QA 3KF7A 2YCSA 4D2VA 2FO0A 2FSLX 1IA9A 3HMIA 2BRHA 4QTEA 2C0IA 4S34A 4I0SA 2BZJA 4D5HA 3CY3A 4QP7A 4RWLA 3FZPA 4C3FA 5BVKA 5AA8A 4ASDA 2C0OA 3SD0A 3VRYA 3BLQA 2F2UA 3QA0A 4GU6A 2C6TA 4JDHA 1YOMA 3PVUA 3MFUA 3LQ5A 4ZXTA 1ZMWA 2B52A 3PFQA 3ZDIA 4AT5A 3JY9A 3NCZA 3CIKA 1XH7A 2PVNA 4RA4A 4RJ7A 1OMWA 1OGUA 3LM5A 3VBTA 2C6EA 1WBOA 4ZLZA 3QZHA 5GINE 3MY1A 3R2YA 3VUKA 3W2RA 4QQTA 5L2QA 5E8VA 4WRSA 5C4LA 3OUKA 2OWBA 4PTCA 4AS0A 3P7AA 1PY5A 4L01A 3SXSA 2VUWA 3DCVA 5AP7A 4K33A 1R78A 4U3YA 4OTQA 1OM1A 4Z9LA 3W8QA 3UVRA 2OKRA 4F70A 4J97A 4NW5A 1CKIA 4FKLA 3NUPA 4EH3A 4BTJA 1ZWSA 5C8MA 3R7EA 2VO3A 3T9TA 3E8EA 4EZ7A 1TQMA 4YC8A 4E4LA 2JFMA 1FMOE 2X6EA 4O0TA 5LVNA 3QC9A 4GMYA 2XF0A 1GIHA 5I9XA 3ODZX 4XBUA 4LGDA 2XIZA 4YJUA 4FZFB 2C5YA 2E9VA 4L7FA 3ZC6A 3LCOA 4NFMA 5DYJA 4RVMA 5AAEA 2UZNA 4CFWA 3PYYA 2QOFA 2C5VA 2IW9A 3ZHPC 4EKLA 3DXQA 4IEBA 5FG8A 3SXFA 5H2UA 2BAKA 1V0PA 2G01A 2HK5A 3UQGA 3EL7A 1OIYA 4BIDA 1J1CA 3UO5A 2ITPA 4MHAA 2IVTA 3F6XA 3OWPA 5LVPA 5E7RA 4FG9A 3QTXA 2JKKA 2R3LA 4YO4A 1GJOA 1PXNA 3QQFA 4BRXA 2WTKB 1U54A 2RGPA 4H3QA 5E1EA 4CFFA 3IQ7A 3QTSA 2OXXA 5C03A 1Q4LA 4XUFA 4AGDA 4EOJA 5FDPA 3D7TA 4A4LA 3FZSA 2B1PA 2I0YA 2P55A 4WG3A 3ZONA 5K0XA 3H4JA 4FL2A 4XP0A 4CMOA 2UZTA 2VTIA 4YTCA 5BVFA 4QNYA 2JIIA 5HTIA 2CKEA 5M53A 4JNWA 5A4LA 2C5OA 3NRMA 3KMWA 4DBXA 3SHEA 3VF8A 3K3JA 4USEA 3UOHA 3VUHA 4P4CA 3FKOA 2R3IA 4O21A 3UYTA 5AM6A 3OOGA 1RDQE 2UZVA 4MD9E 3S1HA 4G3FA 4IWDA 4M69A 5HE0A 4QMNA 1O6KA 3VAPA 5IQEA 2LAVA 4B8MA 4F0FA 3PRIA 4EUTA 2WQOA 3EQFA 1PW2A 2I7QA 2QHNA 3C7QA 4YSMA 3RK7A 2ETKA 4CGAA 2WPAA 4K9YA 1DI9A 3C4FA 3AGMA 1M17A 3OW3A 4AZFA 1DAWA 4ZY6A 5IQAA 5AV3A 2YA9A 3KXHA 4YNOA 3VS6A 3ALNA 3Q3BA 1H4LA 3FPMA 3MN3A 2J7TA 3NW5A 4GK3A 5HE1A 2WTDA 3EFKA 1YWRA 2VWUA 3MFTA 1Z57A 5ANEA 3NLBA 2PTKA 3EFJA 4LGHA 4PRJA 2I0VA 2PE1A 4IHPA 4D2WA 3RALA 3N9XA 3QUEA 4HYIA 5KE0A 3PZEA 2F49A 3DA6A 3PUPA 1FVRA 4RIXA 4M67A 1J3HA 1YXTA 3KN5A 2FH9A 1WCCA 2VTQA 3SDJA 5HX6A 2OJFE 1BLXA 3R7GA 4FYOA 3SRVB 3QTWA 5KMKA 4W4VA 4CRLA 4CRSA 4D5KA 1REKA 4FKSA 3BI6A 2R3JA 3CSVA 4C02A 3LMHA 4JVGA 4L46A 4FKOA 2BVAA 2OJ9A 3BHUA 4CCBA 4BZNA 2GQGA 2P0CA 4UB7A 3UG1A 4ZTMA 2JIUA 3BCEA 5FLFA 3NPCA 3O7LB 4CT2A 3SG9A 2RFEA 3N4VA 1PXOA 2ZMCA 2HZIA 4P2KA 2JDOA 3FHIA 3KY2A 4Y5HA 5HCYA 3NUUA 1M7NA 2QOCA 3FLZA 5IH6A 5KNJA 2PY3A 3BHTA 2XKCA 5J5TA 3EOCA 3I5NA 5D9HA 5J7BA 1GZNA 2BIKB 2R3GA 3CJFA 3DB8A 1OPJA 2UZWE 5HOAA 2QU5A 4NUSA 3UOLA 3OTUA 3TKIA 5IQCA 4F9YA 3ZSGA 5DG5A 3D14A 2WQEA 3UGCA 5CX9A 3EQRA 5M4IA 1MUOA 4FKTA 1WBTA 2GPHA 4FUYA 1M2RA 3OEFX 4ZMEA 2XNPA 4MK0A 5CZIA 4QP2A 2B0QA 3F7ZA 3S4QA 3WZJA 1P4OA 1VYWA 5EQYA 2HZNA 5EQPA 1PXIA 2XIRA 4BL1A 3AG9A 1GZ8A 2CJMA 3KL8A 3QGWA 3QQGA 4TWNA 1JSUA 2PMOX 3S2PA 3HKOA 3FY2A 4N70A 5LMKC 4FKGA 4DEIA 4EHZA 2JDVA 4X2NA 2GFSA 4PMTA 5AA9A 2OH0E 3U51A 2OFUA 3KB7A 4X3FB 2C4GA 2X39A 3KXMA 3W2OA 2XJ1A 5LCKA 2W06A 3OT8A 3QALE 4IB5A 3AMYA 3MGYA 4KBKA 5CSHA 2EU9A 4G16A 3VN9A 4O0XA 4ZTRA 3BU3A 4L42A 3ZEWA 3LMIA 4C59A 4O82A 2Y4IC 3CQUA 2QU6A 4IAZA 5E8ZA 4HVSA 3WZEA 3UBDA 5KMOA 4N4SA 1Q8UA 5KBRA 3VUMA 1Q61A 3PXKA 4CSVA 3IDCA 1CKPA 2XCHA 4UWBA 4D55A 5HZNA 5GNKA 4M66A 3UIBA 1G5SA 3I0OA 3MB6A 4USDA 2IZRA 4FV3A 4QMPA 2HXLA 3BYMA 5D7AA 1OL1A 1KSWA 1YRPA 2XEYA 3PP0A 1W8CA 4OTIA 2ZDUA 4BHZA 2YDIA 4YLJA 4ITIA 4IJPA 1SYKA 2R3PA 1OPKA 5J9LA 1VEBA 1M2QA 3DXNA 4EK5A 5LWNA 2OSCA 5FDXA 3F2AA 3R28A 2BROA 5M09A 3PVWA 1TVOA 5AAGA 3LHJA 5F95A 5EYMA 3U4WA 1T46A 2HZ4A 4YMJA 3LFCA 3P23A 2PZYA 3BYUA 4Y85A 1EH4A 5ACBC 3PPZA 3ZXZA 4LRKA 4IFGA 5J1VA 3NUXA 5EYCA 1NXKA 4X6RA 2UZLA 4MQ1A 4AN2A 3MFRA 3POZA 5HU9A 5AP5A 5BPYA 3KVWA 1WBPA 3KU2A 3LFSA 5K5NA 4FT5A 3FWQA 4TWCA 4C4IA 4R7HA 4AFJA 4JR7A 4ASXA 3KXNA 4EK6A 3D15A 5A4CA 5IQHA 2HWOA 3LCDA 1QPCA 2YM4A 3WIGA 3TM0A 3ZUVA 2VZ6A 3OXTA 1WBNA 4BFMA 4BICA 2Z7QA 4EQCA 5EOBA 4TYHB 4R77A 2QONA 3SRVA 3OFMA 4CYIA 2X81A 4I1ZA 5BUIA 5EYKA 3FZOA 4CFUA 3PSBA 2IZUA 3KCFA 3D5VA 1PMEA 4LUDA 3CPBA 2ZB1A 3JY0A 4O7YA 1OKWA 3FY0A 3SOAA 5JGAA 4FEQA 3W8LA 3DNDA 3MFSA 4I5CA 2O0UA 2BUJA 4QMOA 5AV1A 4KIKB 5A4EA 4E1ZA 5HBHA 5AUTA 3TUCA 4FI1A 2QOHA 4F9CA 1F5QA 4XX9A 3NUAA 5ETCA 1AGWA 3GEQA 1OZ1A 5CEOA 3R8ZA 4DEGA 3VS0A 3NUSA 4JT3A 5EM8A 5GZAA 3L9NA 2XK8A 5AP6A 1URWA 3E3PA 2GCDA 2VTOA 1Z5MA 3OOMA 4FKWA 5BVOA 2OXDA 2ITOA 5EW8A 3ZSIA 5IA4A 2W1CA 4I20A 3WILA 4O83A 3F88A 3R2BA 1Y91A 3F66A 4G3DA 1FBNA 1H26A 3COIA 3F61A 4CT1A 4YZDA 4DFUA 4ANQA 4M13A 1NA7A 2WEIA 4W4WA 3LJ0A 3L8PA 3OT3A 1NVSA 3E93A 3GCQA 2ITXA 2ZB0A 2OXYA 2XK6A 4RX8A 2XYNA 4ANLA 2PMLX 4Z3VA 2CCHA 2P4IA 3JVRA 4DC2A 1GZKA 1Q8YA 2VWZA 3FXWA 1UVRA 4XMOA 3W55A 4J98A 4YZMA 4LI5A 3LFBA 4GV1A 4NCTC 2R9SA 3GT8A 1YXSA 4XCUA 2FGIA 1DI8A 4CKIA 4FZAB 4YUQA 5H8EA 4GIIA 4IVBA 4D0XA 1YXUA 4F7LA 1ZYDA 3TV4A 4CG8A 1SVHA 4YLKA 4CKRA 3GCUA 4FV6A 1H0WA 4GFGA 2BFYA 3CGOA 3FHRA 4O22A 4RQVA 4C4HA 5G1XA 4UMRA 4IADA 1WBWA 4F1TA 4CCUA 4DFYA 4IX3A 1Q8ZA 3QQHA 3VUIA 4G17A 3QKKA 4X3FA 4GFMA 4BDKA 2XRUA 3QBNA 5EFQA 2OI4X 2AC5A 2J50A 3FMNA 1B38A 2VNYA 4MBLA 4WNMA 2ITVA 2J0KA 1PJKA 4YJVA 5BQ0A 4A7CA 3LFAA 3Q04A 3QHWA 3AT4A 3O0GA 2WMSA 4FYNA 5CU6A 2HOGA 2YCRA 4FTQA 4ANSA 1QPJA 4FNZA 1KV1A 4ACDA 3PE1A 4BI1A 4EZ5A 3R63A 3AC1A 5AV4A 3AXWA 4MWHA 4WSYA 3MESA 3F3WA 5I9UA 4FTOA 4O7NA 2CGWA 2QCSA 4AZEA 2ZYBA 3KRJA 3N4UA 4BCOA 3KXXA 3COKA 2OJIA 1Q8TA 2XCKA 2ZOQA 5FP5A 1P4FA 2BAQA 3H9RA 4OT5A 2HIWA 1H25A 4APCA 3BBTB 3BBWA 2XEZA 4IDVA 5T3QA 2BPMA 1WVXA 2IN6A 3LXPA 3NNVA 4XOZA 3ZO2A 4JX7A 3FI2A 5CAPA 4YHFA 2YLFA 2WQMA 4KKHA 2AC3A 3G6GA 3GOPA 3EKNA 4ZIMA 4F4PA 3HA6A 1Q3WA 5BVWA 1CMKE 5A3XA 5I3OA 2QI8A 3PWYA 2GS7A 3PVGA 3MBLA 1WBSA 5CSWA 2B54A 4RX5A 5BUJA 2PZ5A 5KMNA 3DLZA 4AF3A 2EWAA 2YWPA 2VTPA 2EB2A 1R1WA 1ZOHA 3QUPA 4B6LA 3Q5IA 3TV6A 3BYOA 3UIMA 3E7VA 1ND4A 3CTQA 5HCZA 5EHYA 4C3RA 4A07A 4XBRA 2VTJA 2QHMA 4MX9A 5I9YA 4FICA 1CKJA 4BWPA 5IEXA 4M68A 1KOBA 4ALWA 2B9IA 4TYHA 1PMVA 3SA0A 4PP7A 1PHKA 3ACKA 4IZAA 3V8WA 2OZAA 1W0XC 5M44A 3F69A 5HESA 2CHLA 3NX8A 3O51A 4RVTA 4BCPA 1BKXA 2WTWA 3ZMMA 3R22A 3R9HA 5FXRA 5KZIA 4KS7A 4OTPA 1M2PA 2X7OA 3A4PA 3V3VA 3W18A 4E8AA 1A48A 3HMOA 2QLUA 3I4BA 4YURA 4MD7E 4NK9A 1NY3A 4MXCA 1U46A 4GVJA 2BALA 4KIKA 3HRFA 2WFYA 2O5KA 1H00A 3F2NA 4BDDA 1YDSE 3D83A 4L9IA 4Y95A 3NZ0A 3BWJA 2R3MA 4D4YA 2W1FA 4M15A 5ETIA 2WMVA 3GC8A 4V01A 3SW7A 2XKEA 3WF7A 1JPAA 3LFQA 4IC8A 4ID7A 4OTDA 4QP1A 4U42A 3MVMA 2PUNA 1H8FA 3R00A 4WBOA 5LQFA 3PXRA 1NT2A 1UWHA 1WMKA 3I1AA 4HVGA 3IOKA 2ESMA 3HX4A 1JKKA 3K2LA 5LMAA 3TTIA 1W82A 2JEDA 3V5LA 4F65A 1CSNA 4IMYA 4LMUA 1YXVA 3CC6A 4QP8A 4BBEA 4BZOA 4CLIA 4G6LA 2JBOA 3FXZA 5I3RA 4L45A 3WE4A 1JKSA 4I0TA 4TT7A 3T9IA 4F6WA 2W96B 5K9IA 1XJDA 1YKRA 2GU8A 4ZY5A 5AR4A 4L53A 4FR4A 2WTCA 4U80A 3QRUA 3AT3A 5C8NA 3P86A 5IMXA 2EVAA 4CXAA 4C36A 2CGVA 1YDRE 2W1ZA 3CJGA 3IECA 2JDRA 4G3GA 2AUHA 1H1QA 3IKAA 4MWIA 3F5PA 4R8QA 1F3MC 1Y57A 2FYSA 4Y46A 5EDQA 4ZSGA 5EW9A 3O2MA 4IXPA 2J9MA 3TZMA 3TNWA 3QWJA 4IX5A 3A7FA 3RNYA 3UMWA 3V8TA 2ZM1A 2C6OA 4RQKA 3VBXA 4MNEA 3ZZWA 5C9CA 3TEIA 4X6QC 5JKGA 2W1HA 4QPMA 5DLSA 4NT4A 4NM7A 5FRIA 5EM5A 2YCQA 4O7VA 4ACGA 4LRJA 4L44A 4FG8A 5IPJA 4NJ3A 4DTKA 4L67A 5KUPA 2BZIB 5A4TA 4AE9A 2QR8A 4D1SA 4YU2A 3GQIA 4QYYA 5GHVA 3HRBA 3HDNA 5L6WL 4XJ0A 5CU4A 4AX8A 4EYMA 1H08A 4GT4A 3CD3A 4WUNA 3NW7A 5CXZA 4TYEA 1Q99A 2GS6A 4EI4A 3WF9A 1TKIA 4C4GA 2PU8A 4HPTE 2ERKA 2YDJA 4LQMA 5TR6A 4MF0A 2O8YA 1DM2A 4ACHA 3SG8A 2H9VA 4GKHA 3COMA 3UOJA 4BDIA 3O8TA 4AW5A 1PMUA 5EYDA 5KO1A 4XH6A 4UXQA 2KULA 2X1NA 3KK9A 4NWMA 2J6MA 4UZHA 2GDOA 5G6VA 3IS5A 2J0JA 4RZVA 1I09A 1H01A 4NM5A 3O96A 3E8CA 4ERWA 3EQDA 5LMBA 3U87A 4BCHA 3FI8A 4FV0A 3F5GA 4H58A 3V04A 5HG7A 1UU3A 5LCJA 4U81A 2R3HA 4GFOA 2R64A 2JLDA 2ONLC 4GUEA 3M42A 2QOQA 3FC1X 3PPJA 2W9ZB 2PUPA 1UWJA 3KULB 3KMUA 4EOQA 3GU8A 3PY3A 3F5UA 4IQ6A 4B9DA 5DT3A 1SZMA 5CYIA 3R1NA 2WHBA 3FMKA 4J96A 3WIKA 4FKQA 3NCGA 3DK3A 3Q53A 4ONAA 3LE6A 4PL3A 2WMAA 3D5UA 3E63A 4YBJA 4PWNA 5HG8A 1MRUA 5E8UA 5EHOA 5DRDA 3KK8A 4PDYA 5DOSA 1ATPE 4KD1A 3R83A 4FL3A 1OKZA 3CCNA 3DQWA 3RWQA 3CKXA 1SVGA 3PIZA 4DH3A 5JFVA 5I9WA 5IQGA 3KN6A 4WNOA 1MRVA 5H8BA 3OY1A 5DR2A 2ZM3A 2YWVA 4HNFA 3FMMA 3UNJA 2PPQA 5M08A 3R7OA 2JFLA 3E8NA 5FXSA 3TV7A 4BGHA 3R9RA 2F7ZE 4HPUE 4EC8A 2YDKA 4ZAUA 2P2HA 4YR8A 1J7UA 4L6QA 5ETAA 2J0IA 4RJ4A 4I5MA 2CKPA 3PTGA 4MXYA 4ENXA 4MYGA 4RJ6A 4IX6A 5CXHA 1RQQA 3IOPA 4PTEA 2XZSA 4O0WA 3ZLYA 4C33A 2P33A 3BV2A 4QTAA 4F99A 3QRIA 2Z60A 3VS7A 3ZM9A 1RJBA 5IA5A 3ATSA 3H0ZA 5DH3A 2ITWA 5AR3A 5CU0A 2O63A 5IH4A 4L68A 4HCTA 5BVEA 1REJA 4AGWA 3MDYA 3DV3A 5IA0A 2OIBA 4YJNA 2E9UA 3R01A 3OCBA 5IMEA 5K3YA 2C5XA 3DOGA 5CI6A 5J7HA 4GJ2A 1KE6A 3MH0A 4J7BA 4K11A 4RLLA 4V0GB 4DH7A 1P2AA 3KKVA 1G8AA 3RTPA 4AOIA 2VO6A 4G5JA 5E90A 2FA2A 3OY3A 4KBCA 4YTIA 1IG1A 1JVPP 4FK3A 3DAJA 2V7AA 3QAME 2CKOA 5FP6A 4YZNA 1FVVA 4E5AX 2Y4IB 2W9FB 2O65A 3LXKA 4GYGA 5CS6A 3FLQA 3SXRA 4ACCA 4CG9A 3EKKA 2WNTA 2VX3A 2J5FA 3ULIA 4UMQA 5CAVA 1XBAA 4S31A 4L3JA 5E8WA 2QURA 1BL7A 2X2MA 4JI9A 4O1OA 5EI6A 1H27A 3EZRA 4MQ2A 2V7OA 2WMUA 4LG4A 3DFCB 3DDPA 3I6UA 3RHKA 5B0XA 4BI0A 2Z7SA 2C0TA 3FLYA 3HA8A 4AW2A 5AV0A 3NS9A 3QQUA 3HZTA 4IAFA 5H9BA 3O23A 4E93A 4D4SA 3Q5ZA 5EKNA 3UO4A 3LCKA 2BRNA 4WBBB 3A7JA 4O0YA 5GZ9A 4XV3A 3AOXA 1J1BA 3TXOA 2C5NA 2Z2WA 4XYFA 3E3BX 3UG2A 4KKGA 4FSQA 4KIOA 3GCVA 1VR2A 3P7CA 5DE2A 4ZZMA 4EH7A 3DAKA 1IEPA 4KB8A 4L3LA 1YI4A 1BI8A 2XM9A 3LM0A 4DFZE 1ZZLA 4JX3A 3ZO3A 5IA2A 2GHGA 2R3QA 2V62A 4YC3A 3DK7A 5AFVA 3OWLA 4PMSA 4EWQA 4RVKA 5DR9A 3ZC5A 4MF1A 4FTCA 3QQLA 3HRCA 2J4ZA 1ZRZA 3DKFA 3M1SA 3VC4A 4UWYA 4R3CA 1U4DA 2JIVA 3VUTA 5BVDA 1IAHA 2GQSA 4MNFA 2J5EA 3LQ8A 5LVOA 4ASEA 2IW6A 2BFXA 5IQBA 3EN5A 4D28A 3NVMB 1XO2B 3D7ZA 3QTIA 3MY5A 1SVEA 4TKSA 3C50A 2RG6A 4I6FA 2WD1A 3AD6A 2G1TA 5T6KA 3S95A 4CTBA 4PL4A 3AMBA 3PJ2A 3V5JA 5CF6A 3CD8A 4I6QA 3EYGA 4BCQA 4IB3A 2GNHA 5HTBA 4LOPA 4M3QA 4Z55A 3FAAA 4LV5A 2VTLA 3FL4A 4ACMA 4QMYA 3MW1A 2XP2A 4RLKA 5AIRA 1IRKA 4IAAA 3EH9A 3OXIA 3BGZA 3QYZA 4FIJA 1V1KA 3KULA 3UNZA 5DI1A 4A9SA 4DYMA 1J7LA 4RMZA 1GOLA 4OW8A 5TKDA 5IUHA 4FEWA 2FSTX 3MYGA 5M51A 2YM6A 4C4EA 2CKQA 4NU1A 5HE3A 1R39A 2PZRA 3RPRA 2E9PA 3ROCA 4C37A 4BY9E 3G15A 4ITHA 2R2PA 5HHWA 4FA2A 5M4FA 1Y6BA 4E6QA 3UE4A 5TOZA 3ZH8A 5GZ8A 5EOLA 3UJGA 2IPXA 4YJOA 5L2SA 1UNGA 2PMIA 2YZLA 3BHVA 4QNAA 2C6KA 3DJ6A 4C8BA 4GU9A 4TNDA 2UUEA 4ANMA 4CZYB 5CY3A 2X4FA 2VRXA 4O0SA 1K9AA 4DCAA 4PDSA 3DAEA 3O71A 4R3PA 2BTSA 3UYSA 1ZYCA 3QKLA 3RNIA 3O7LD 4O0RA 3U9NA 3DZOA 3W32A 4FKRA 3DU8A 1ZYJA 3ORZA 2OBJA 1JBPE 3MH1A 5A6OA 2VWYA 5IA3A 4GEOA 4TYGA 4CQEA 2H34A 3DBCA 4I0RA 3G5DA 4M84A 3SX9A 2IJMA 2JGZA 3FBVA 5BYYA 4J99A 2X7GA 3BGQA 2BHHA 4XRJA 3MH3A 4FZ7A 2BZHB 3GU6A 5I9ZA 3Q4CA 4HGSA 3ZXTA 3OEZA 3P7BA 5LMKA 4LOQA 3SC1A 4W9WA 3GU4A 5AJQA 5HO6A 1IR3A 5E92A 3CPCA 5BNJA 4ALUA 1K2PA 4H1JA 4IW0A 5LJJA 5JN2A 2YIRA 3ENHA 4S33A 4YPSA 4V0GA 3F3TA 3KA0A 3TUBA 4ALVA 5FBNC 4QMSA 1JSTA 4WUAA 4FNYA 4IAKA 4ITJA 5AP2A 1OBGA 3BU6A 4D1XA 3G0EA 4KWPA 3EL8A 3LIJA 3VJNA 4WKQA 5DA3A 2QC6A 4FVQA 2C6IA 3U54A 3ORNA 4C57A 4IBMA 2C1BA 4M97A 3ENMA 4EK4A 5CVGA 5IF1A 3RZFA 3R71A 2HW7A 4YSJA 3QTZA 2PSQA 2WO6A 1ZMVA 4ENYA 5FGKA 4DGGA 3A4OX 1UKIA 3FPQA 1PKDA 2QOLA 2VTAA 2OFVA 3Q96A 4AOTA 2W4JA 3FZRA 1PRYA 3QL8A 4J52A 3VW8A 2B53A 3FUPA 5F1ZA 4CFNA 4YJSA 5KMLA 4B4LA 2NPQA 1H1WA 3QD3A 2X7FA 4O38A 4TXCA 4FVPA 4XV1A 5FWKK 2JAVA 4BBMA 4BHNA 2QR7A 4E4XA 5DGZA 4BI2A 5CEPA 4FSUA 3TNPC 2VTMA 4BCJA 3EN6A 3A61A 4ORKA 4OTGA 4PUZA 3VRZA 3QX2A 4RBLA 3R0TA 3KRLA 3DNEA 1S9JA 1SMHA 3W10A 4O6EA 4E4MA 2OU7A 3BLHA 4XG7A 4BGQA 2CMWA 5CEIA 2VWIA 2WKMA 3I79A 2BRMA 3I0QA 4YJRA 2ITQA 3Q9YA 2XUUA 2IG7A 1UA2A 2A2AA 3ODYX 4JRNA 3F9NA 4F09A 5HLNA 1P5EA 2YFXA 2QVSE 4ZS0A 1QCFA 2A27A 2X2KA 5AR7A 2UZOA 1WVWA 4QO9A 5KMIA 2UZUE 3DKCA 4W8EA 4RVLA 1L3RE 1OUYA 3DPKA 4M14A 1GZOA 3VBQA 2QG7A 5HLPA 4FIHA 3NYNA 3BZ3A 2QLQA 4YHTA 4CZTA 4TNBA 3TT0A 4FZDB 3DS6A 4I92A 5DEWA 3R8VA 4BB4A 2OJJA 4YZBA 5AP0A 3DKOA 5K4JA 4HVDA 4FT0A 5E8TA 5I5ZA 4FKJA 3UZTA 4G1WA 4DEDA 1KE7A 4I5HA 3W33A 4WRGA 4FV5A 4TY1A 3IW8A 1O6YA 3GI3A 3TNQB 3EHAA 4FK6A 5HNGA 2XNMA 4AXAA 4DF3A 4IVDA 4X0MA 4FG7A 3UOKA 2XB7A 4IH8A 2PVYA 3HMMA 5K4IA 5JQ5A 3I5ZA 3NWWA 4FKIA 3OMVA 3A2CA 2XKDA 2C47A 5CT7A 2X9EA 5L8LA 3C0IA 5HG9A 4B8LA 4TTHB 4BDHA 4JG8A 4DE4A 4ASZA 3TKUA 5CLPA 3V5TA 3GQLA 3OWJA 3PE2A 3E7OA 2A4LA 4FEVA 3GFWA 2R0UA 3LW0A 4LOOA 3HL7A 4FTKA 4FBXA 1H1PA 4OT6A 1W98A 3HVCA 2YM3A 5A4QA 5KKRB 4Y5QA 5CEKA 3NYVA 1MQ4A 3ZFXA 4AT3A 3RPSA 3ANQA 4NCTA 4DEAA 4BDGA 3AC3A 5EI2A 2VD5A 3L9LA 4G3CA 4HGTA 1PKGA 2I40A 3FLWA 4FOBA 4O91A 5B7VA 2G9XA 4JS8A 4XLIA 3VW6A 4D4VA 1UNHA 2BHEA 4RG0A 3RVGA 4H39A 4DG2E 2W05A 3R8LA 4WT6A 5CT0A 3MTFA 5AR5A 4EWHA 1LR4A 1OVEA 3G0FA 4MXXA 3Q4TA 1JQHA 4ARKA 1Z9XA 2C69A 3Q4UA 4KINA 3RKBA 4ZLYA 4FV2A 4TL0A 1M52A 2B4SB 4JBPA 4U97A 3QZIA 4OTFA 4DA5A 4EORA 2O64A 2C3IB 5T68A 2ETRA 4L43A 3ZTXA 3FQHA 4PF4A 4QRCA 1MP8A 2GMXA 2ITZA 2W17A 2WXVA 2BDFA 2PE2A 2W5AA 3KEXA 4H1MA 4BR3A 4I5PA 1VZOA 4KIPA 4E5BA 4QQJA 4N57A 4RRVA 4WG4A 3MVLA 4FSTA 5I9VA 4Q9ZA 3PRFA 1QMZA 4CV9A 5HD4A 4DLIA 1G8SA 4MVFA 2WOUA 3JS2A 2VWBA 5HCXA 3QZGA 2R3OA 3PLSA 3OD6X 3RMFA 4PPAA 3KF4A 5CVFA 2PVFA 4FIFA 4Q9SA 4E6CA 2CCIA 5GIOE 5AR8A 4USFA 3I60A 4F08A 3KREA 3BPRA 4QP4A 4YNEA 3Q6UA 4EJ7A 3RZBA 4QYGA 4KNBA 4F1MA 1KE8A 1ZY5A 3LOKA 2GS2A 5C27A 1XH5A 2IZTA 2WTJA 3AC2A 3GC9A 4NH1A 3RJCA 4F63A 3HYHA 5DEYA 2W7XA 2WMXA 1XBBA 3R21A 2C6MA 2F7XE 3PY1A 4BKJA 3FV8A 4F6SA 4DEEA 3FYJX 4PNKA 4X7QA 3EQCA 4R5SA 3O8PA 4H3PA 5JZNA 5E91A 4TWOA 3BU5A 4HCVA 3TZ7A 4XG2A 3C9WA 4RJ3A 4FTAA 4C62A 5BVNA 2XH5A 4L00A 5AX9A 3QTRA 1ERKA 5EI8A 4G6OA 2WTVA 3DJ7A 4ZJVA 4ZJIA 3AGLA 4GUBA 2RIOA 3VS1A 3R73A 4A9RA 5CSVA 2NNWB 1PXJA 3D5XA 3ITZA 4IWPA 2VWWA 3E5AA 5IDPA 2Q0BA 3UMXA 4DHFA 4NSTA 1BI7A 3TIZA 2J51A 2PVKA 3PA4A 1VYZA 3HEGA 4JOAA 2XNGA 5EW3A 1KV2A 5ICPA 4HNIA 3FLNC 3FQEA 4ANBA 4F0IA 2YEXA 3EIDA 5ITAA 2BKZA 1Q62A 2JKMA 3JYAA 3RK9A 4RGJA 3DKGA 3SAYA 4G3EA 4P5ZA 5HKMA 4D58A 3RINA 4BBFA 4GT3A 4QTDA 2E2BA 3TWJA 5I0BA 4IWQA 3PA3A 3QD2B 2I1MA 3CQWA 4OBPA 2XBAA 2PE0A 3EB0A 4ZS4A 4OAUC 2RF9A 3IONA 4K77A 3R1YA 4LL5A 3GC0A 3V5WA 3ZZEA 4OAVB 4ZZOA 2YABA 2B9JA 3D9VA 4PV0A 2X6DA 1YHVA 5EK7A 5HE2A 1AD5A 3HNGA 3VJOA 2XK4A 4C34A 3IW6A 4F7JA 3EQGA 2O3PA 3OZ6A 4D2SA 1JSVA 5EKOA 3RAKA 3RBWA 3ZDUA 5BX0A 3BIZA 2WIHA 3WOWA 4GIHA 3E87A 4HGEA 2HCKA 1UV5A 3CS9A 5HIDA 5C01A 2WAJA 4O2PA 4Z16A 5DHJA 4PL5A 3ORKA 3CQEA 1ZOGA 5B2LA 3NAYA 3EFWA 3V6RA 3IW4A 4A06A 5JZJA 5HI2A 4C61A 5LXMA 2AYPA 3G2FA 5AUVA 4JG7A 5LOHA 2DWBA 3P9JA 4BDJA 5HBJA 2GNFA 3P0MA 2QODA 2QO2A 4J8MA 3TL8A 3ZO4A 3H9OA 3KQ7A 2V0DA 4QD6A 5TO8A 3UO6A 4WHZA 4EONA 2OIQA 4EYJA 3MI9A 3THBA 4QMTA 2UW7A 3KRRA 4LUEA 3A62A 5D7VA 4EBVA 4U41A 4FEXA 4KA3A 1HCLA 4O81A 3LFFA 4W4XA 3DZQA 1W84A 2UW0A 3K3IA 3ZUUA 2QOKA 4KBAA 1V0OA 2RFNA 2HAKA 4F9AA 5EH0A 4PDPA 4ZTSA 3QLGA 4ZJJA 3KFAA 4E26A 3VS4A 2YN8A 3VVHA 5CF8A 4ZZNA 3ORLA 2WGJA 3WYYA 2ZV7A 3ZFYA 4PMMA 3DXPA 5C1QB 3Q4ZA 4F7SA 3EN4A 3BYVA 3GP0A 4YTHA 3IW5A 4QQCA 5ANGA 3I6WA 3ZSHA 3OROA 4AA4A 5C26A 2HY0A 2ZM4A 1O6LA 2OW3A 4GSBA 4FMQA 3LJ2A 4DH8A 2BIYA 4R1VA 3OP5A 3I7CA 4OR5A 1PYXA 4FV9A 3BQCA 4YO6A 5JFXA 3KMMA 4CTCA 5FXQA 2QD9A 1U5QA 3GFEA 1JNKA 4K8AA 3F3VA 4R1YA 1XWSA 5CQUA 4JIAA 5ANDA 3DBQA 3OVVA 4AGUA 5LVMA 3CE3A 4IVCA 2XYUA 3MTLA 4I41A 3T3UA 1A06A 3OS3A 1KOAA 5JEBA 1B6CB 4I6BA 1Q24A 3VULA 4HW7A 4A9UA 2XK3A 5TF9A 4G6NA 4JDIA 2CGUA 3QF9A 3R02A 4AU8A 4EOIA 5J9ZA 5A54A 4CNHA 4AZTA 2UW3A 2VTTA 4KSPA 3BGPA 2W4OA 3B2WA 4JDKA 3VNTA 4IWOA 4EUUA 4DINA 5FUTA 2WMBA 3E64A 3MY0A 3R6XA 2GTMA 4QYEA 3M2WA 3PG1A 1A9UA 4PQNA 3CTJA 4EEVA 4WOVA 4RX7A 5KBQA 3E92A 2CN8A 4JDJA 3VBYA 4EBWA 2YAKA 1UKHA 3KVXA 1UU7A 3NW6A 4RWJA 4Y83A 4EH6A 3U6IA 1W7HA 3QLFA 4OTHA 4RFZA 3DBDA 3L9PA 3C4XA 1E9HA 4PP9A 5IQDA 2G2HA 3LZBA 3NNUA 3LJ1A 4JAIA 4AZWA 4YPDA 1KUTA 3PXYA 3LAUA 3R9NA 4I23A 1RE8A 3FKNA 3LLAA 3R9DA 4E20A 4FSRA 2XS0A 3PDTA 3OG7A 1ZARA 2RSVA 4IAIA 1XH8A 3ZO1A 2DUVA 2QOIA 3A99A 4A4OA 1H28A 4XRLA 4O7WA 5DT0A 1OPLA 3EMGA 4K6ZA 2QQ7A 4QMZA 4G9RA 5HBEA 4XHKB 4AZSA 3AMAA 5L2WA 5AUYA 4JR3A 4QMXA 1Q97A 2ITNA 3U55A 4FV7A 4PY1A 3GU7A 3HDMA 4BC6A 2RFSA 4FSNA 3S0OA 2Q0NA 4JJRA 5C4KA 2H96A 3EQBA 3FZ1A 3GENA 3QCSA 4XNEA 3MS9A 2QNJA 2WU7A 5E8YA 2YM7A 4BDFA 4BWKA 3CXWA 5EDPA 5AAFA 4DEHA 5L6PA 3A7IA 4UMPA 4J95A 2HELA 5KX8A 3IW7A 3B2TA 4R5YA 2CLXA 3Q6WA 3DTCA 3FXXA 4ANNA 1PXLA 2ZV8A 4BN1A 2UW6A 1LUFA 2OZOA 3AD5A 5M56A 3PVBA 4PTGA 5BMSA 4KUJA 1PXKA 2JDSA 3VHEA 5LWMA 4AOJA 3HAVA 4XP2A 5CASA 2PL0A 4GCJA 3UDBA 3Q9XA 3ZRMA 3Q9ZA 4KIQA 5FM3A 4RJ8A 3ZLXA 3UQCA 3MA6A 4UV0A 2X2LA 4OGRA 3P08A 4N6ZA 3PIXA 4RWIA 2C3KA 4IFCA 3LQ3A 1YWNA 4FKUA 3F82A 5CU3A 3PSDA 3VIDA 4DH1A 3A60A 4Y8DA 3HP2A 4N0SA 4ZTQA 3QZFA 4WD5A 3C5UA 3UP7A 4FT7A 1KE9A 1ZXEA 1OIQA 5CEQA 2ITUA 4NM0A 1O9UA 4UN0C 4NL0A 3OBGA 4OTWA 4W8DA 3MIAA 4ZY4A 2EUFB 2XMYA 3G51A 3WZDA 3RCDA 4O0VA 3LFDA 1FMKA 5J1WA 4YJTA 4XLVA 5BUEA 4BDCA 3JUHA 3OF0A 1FPUA 4ZTNA 5CNOA 4FOCA 5HU3A 2WQNA 2XJ0A 2JD5A 1IA8A 3QKMA 3DB6A 3R04A 4UY9A 3UVPA 5JQ8A 4QP6A 4RC2A 4YZ9A 5E8XA 4ZMFA 4BVUA 2QOBA 3F5XA 2QOOA 5ANOA 3W16A 2W4KA 3DFAA 3IDPA 2B9FA 1JOWB 2VTHA 1L8TA 4V05A 4CFVA 3K54A 4IX4A 2OLCA 5JFSA 3F3UA 5ETFA 3KXZA 3G9LX 5HQ0A 2R3NA 3EQPA 3FYKX 3PA5A 2F9GA 2NRUA 2PVHA 3TJDA 3U6HA 4ZK5A 2YERA 3PJ1A 3DLSA 3ZUTA 4MEDA 1GAGA 4QMUA 4DLJA 4Q2AA 1JKLA 4FEUA 3OW4A 4BCNA 3QRKA 4B0GA 3C0GA 4FTMA 3OBJA 1ZOEA 4O7SA 2XBJA 2FSOX 4DEBA 1WZYA 4UALA 2KTYA 4FV1A 4UYAA 2VX1A 3R1QA 4QP3A 4O0UA 3F7WA 3OWKA 4D2RA 3GUBA 3LPBA 5FTQA 4UXLA 4E6AA 1UU9A 4UMUA 2IO6A 5FEQA 1ZY4A 5HORA 2QKRA 5F4NA 2PVRA 4JQ7A 4MCVA 4TW9A 1S9IA 2R5TA 4E6DA 2C6LA 5J8IA 3AQVA 3UC4A 1H1RA 4BZDA 3UIXA 3Q2JA 2F4JA 3GCPA 1PMNA 4QYFA 4ZTLA 1MRYA 3O50A 3LLTA 4TPTA 3GGFA 3V5PA 2BAJA 3C4CA 3Q60A 2IVVA 4KRCA 4UZDA 4WNPA 4G31A 2PZIA 5M06A 3WARA 4ZP5A 3W2SA 4IIRA 2Y7JA 5J87A 4DAWA 5E4HA 2WMTA 3QRTA 5HICA 3P1AA 5EM6A 3NUYA 3II5A 3MVJA 3SOCA 4FTNA 2GSFA 4UEUA 4F9WA 3OTVA 4EH8A 3GC7A 4PPBA 4CV8A 4E7WA 5IH5A 3IG7A 3Q52A 2YM5A 4NTTA 3UQFA 5I4NA 5EQEA 4RFYA 2WB8A 2FUMA 4U0IA 3QWKA 3H30A 1OUKA 1TQIA 3P79A 4AA5A 4EK8A 1U59A 2VGPA 4WO5A 4XV2A 2F7EE 5AIKA 2OO8X 3CY2A 2C3LA 2VTSA 2CLQA 2RL5A 2WMQA 3QCXA 3BRBA 3LMGA 5DVRA 4EQMA 5CF4A 4KRDA 5M57A 4H36A 4IB1A 4NKSA 4X21A 4PMPA 5AM7A 2CSNA 2XNEA 4LV8A 5FEDA 2P2IA 3QXPA 4AT4A 4EK3A 4GYIA 4IAYA 5EG3A 2PUUA 1JWHA 2YJRA 4AACA 3NMUF 2CDZA 4RIYB 5CZHA 5KMJA 2Z8CA 2JITA 3R9OA 4QMLA 5KHXA 1IASA 3RK5A 2J2IB 5L8KA 3BE9A 4EH4A 4XG6A 3EYHA 1NW1A 4J8NA 5HNBA 5AEPA 2YIXA 4NJDA 1Q41A 3OC1A 3RPVA 4I4FA 3RPOA 4O7ZA 4DFBA 3FMEA 5CALA 4DFNA 4BYJA 4I93A 4IB0A 3UVQA 4AN9A 1K3AA 2VGOA 4II5A 4O7RA 5FTOA 2UZEA 3QD0A 4BIEA 5AP4A 2JC6A 3DTWA 3DJ5A 4EC9A 2HXQA 2C3JA 3MJ1A 3D2KA 2B9HA 5D1JA 2UVYA 2YAAA 4Z7HA 5L2TA 4FKVA 2R3RA 3PXQA 2UV2A 1ZLTA 2ZV9A 3WF8A 4EHGA 4EOLA 4TWPA 3VF9A 4NTSA 5IEYA 4CFMA 3FSFA 2GTNA 2VN9A 3WBLA 4FTTA 3KRWA 3G90X 3ZFMA 5HIEA 5GJDA 4I6HA 4I94A 2UVXA 2UZBA 1BL6A 2O2UA 2XIXA 4EH5A 3ULZA 2E9OA 5M07A 2XA4A 2Z7RA 4YTFA 1MQBA 1URCA 3IO7A 2XKFA 2F2CB 2W1GA 2OG8A 2W5HA 4Q5HA 4CQGA 4RFMA 5H3QA 4DH5A 1ZYLA 4U40A 4F7NA 4U5JA 4D0WA 3VS5A 2GHMA 3GB2A 1YWVA 3ZRLA 2QG5A 2SRCA 1XHAA 2YACA 3TN8A 4AN3A 5AADA 2YISA 4R7IA 3REPA 3UTOA 1XH4A 3DK6A 4ERKA 5M4UA 5CTPA 5D41A 1OL6A 2WTIA 3FDNA 3EN9A 3ETAA 4BYIA 4FNXA 4GG5A 4DTAA 4DTBA 3PJ3A 3QXOA 5FM2A 5BMMA 4D9TA 5HG5A 1SNUA 4OUCA 5J79A 1YW2A 3FMLA 4EOMA 4FUXA 1E1XA 2YIWA 1OBDA 1YQJA 1CDKA 5IG1A 1YHSA 1FGKA 1TQPA 2X8EA 3FJQE 4HZRA 4BTFA 4B99A 3TDWA 3VQUA 4DN5A 3PP1A 4BCGA 3CTHA 3HUBA 3JPVA 4RWKA 3TZ8A 3C13A 4YHJA 3CLYA 3W1FA 4QTBA 4BTKA 4AP7A 4FE2A 3BE2A 1U5RA 3BEGA 3SGCA 3C5IA 1OIRA 5A9UA 3F2RA 4DGMA 4GKIA 4HGLA 4CYJA 3UNKA 2V55A 4ZSAA 3KXGA 3ZBFA 4K0YA 4WG5A 5HTCA 2BKKA 1IAJA 4MBJA 2DS1A 1RW8A 2XNBA 4FVRA 4YP8A 3QX4A 5CVHA 2X9FA 4CZUA 1HCKA 3ANRA 1H07A 1YVJA 1ZAOA 2BRGA 2R4BA 3O8UA 4QTCA 4AGCA 5ANKA 4MTAA 3ATTA 1Q5KA 1YHWA 4LGGA 5FBOA 3MA3A 3SLSA 2RFDA 4XEYA 4FSWA 1CM8A 4C4JA 2R7IA 3P4KA 5DFPA 5J9YA 3FQSA 3NVKI 2J0MB 4NW6A 2CNQA 5GIPE 4UBAA 4I24A 1OECA 3RCJA 4TYIA 2ZDTA 3U4UA 1QPDA 2OK1A 5CAQA 4QMWA 4OBQA 2UZDA 4U7ZA 4AWIA 5J95A 4X2FA 3LVPA 3R1SA 1J91A 5H8GA 1GIJA 4FTRA 3L8SA 1OKYA 4R3RA 3VUDA 2ITYA 4RX9A 1YXXA 4U9AA 3R7YA 3ZRKA 4NYEA 3D2IA 4IM0A 5D11A 3R7VA 3T3VA 5GJFA 4U3ZA 4DGOA 1Y6AA 1FGIA 4LM5A 3V5QA 4AW1A 5DBXA 2JKQA 5KZ0A 1ZZ2A 3HV3A 5D10A 3AC8A 2XM8A 3OHTA 1R0EA 3MPTA 4IANA 4IM3A 4XP3A 5ANJA 4AUAA 4E73A 2Z02A 4HVHA 2FB8A 3UIUA 3NIZA 3IPHA 3BX5A 4G9CA 4HZSA 4NEUA 1FQ1B 1FVTA 5FD2A 4G34A 3NYXA 4L8MA 4OTRA 4DITA 5IDNA 2QO9A 1OITA 2WMRA 3A7HA 5JRSA 4XS2A 1GNGA 5EM7A 3HAMA 5D12A 4TRLA 3BHHA 3PZHA 5JK3A 2W1IA 3EJ1A 4RIYA 3WYXA 4S32A 4EH2A 5IQIA 4UX9A 4CD0A 3NDMA 4HOKA 5L4QA 2JKOA 5HVKA 2G2IA 4M0YA 3MPMA 2Y9QA 4OBOA 1M14A 4JL9A 4M7IA 4K1BA 3MPAA 1AQ1A 2VTRA 3ORMA 5LARA 3EN7A 4NZWB 4FZ6A 3IGOA 1WBVA 3RGFA 3WF6A 5B2KA 2JDTA 3VQHA 1YOJA 5AWMA 3QYWA 1JKTA 1XKKA 2V5QA 4KABA 3W2QA 2OGVA 2XRWA 3OCGA 4QMVA 3HV4A 4BDBA 4EOPA 3D0EA 2I0EA 5AP1A 4QP9A 3AT2A 5DNRA 5DT4A 5HLWA 2IVUA 2VAGA 3F3ZA 4IZ5A 4G5PA 1R0PA 2UVZA 2WZJA 1W83A 2A0CX 3PY0A 5KHWA 1H1SA 4FSMA 2EXCX 3HV5A 4CMTA 4IACA 5BYLA 4DGNA 4XG8A 1F0QA 5JSMA 3AD4A 3HLLA 1ZMUA 4ZSJA 3UZPA 3GCSA 2R0IA 2W0JA 2PHKA 2YIQA 5HO8A 1APME 2OF4A 4AE6A 1PXPA 4FX3A 4OLIA 3SV0A 3BELA 3A8WA 3ZEPA 5DR6A 4DG0E 4HCUA 2HYYA 3L1SA 2DQ7X 3NGAA 4WNKA 2JBPA 3MV5A 3PLAE 2WQBA 2X8DA 5IKWA 3TNIA 4NKAA 3Q2MA 3RP9A 3FLSA 3CR0A 4MXOA 3V6SA 3H0YA 3TKHA 4C4FA 2YHVA 4IC7A 2OF2A 3QRJA 4LMNA 4BKYA 3C4ZA 3POOA 4DFLA 3QC4A 3H10A 2RKUA 5DWRA 3ZU7A 2CNUA 2FSMX 4JIKA 4QQ5A 1XH9A 2G15A 5HIBA 3VWAA 4AW0A 1FOTA 5AR2A 2XNOA 4IE9A 4ZSLA 3PJ8A 2WTKC 3IDBA 2A1AB 3RWPA 3D4QA 4I22A 4MBIA 3GOKA 5KCVA 5AV2A 2Y4PA 4AZVA 4EHVA 2QKWB 1VJYA 5AUZA 3QCQA 3PXFA 4GK4A 1SNXA 4GRBA 2YZAA 2OZAB 3K5UA 3PJCA 2GQRA 2H8HA 2OICA 2WU6A 4IZYA 3FZTA 4Y73A 4CFXA 5CU2A 4QPSA 2W99B 2G2FA 5HD7A 3U8WA 4S30A 5IQFA 4P7EA 4AA0A 4HYSA 3FEGA 2V22A 4C0TA 5JRQA 3NIEA 2W1EA 5F94A 4GH2A 2R7BA 2BDWA 4FSYA 3ZS5A 3ET7A 2PVLA 3C4EA 4RIWB 2GNIA 1YDTE 2YJSA 3A8XA 3UPXA 2X4ZA 4Z7GA 2UW8A 4FIGA 4MAOA 4FSZA 3C0HA 4E3CA 4JBOA 5L6OA 3ZLWA 2EXEA 4L3PA 3PSCA 2CNVA 3SW4A 3O17A 4Q5EA 4ZSEA 1G3NA 3HUCA 3QTUA 3T8OA 2ZJWA 5B2MA 2GNLA 4FF8A 5JT2A 4D2PA 4O2ZA 5ACKA 1Q3DA 2XNNA 4XG3A 2PVMA 3D5WA 4M8TA 3DBFA 4XG9A 4C38A 4C7TA 5IZFA 4LYNA 3IGGA 3E62A 5LVLA 2H6DA 3MSSA 3N51A 5HX8A 3TDVA 2IZSA 3PG3A 4A9YA 1LP4A 5CANA 4M12A 4O96A 2Q83A 2WEVA 4MXAA 4BIBA 5GJGA 3CGFA 3DY7A 4J53A 4X2KA 4ZEGA 4JQ8A 5TE0A 4DFXE 1STCE 2ZV2A 3CKWA 4FIIA 4J1RA 1QPEA 4FL1A 4JAJA 4TZRA 4K2RA 3FE3A 3ELJA 4FTJA 3QQJA 2R3KA 4I4EA 3Q32A 1P14A 4YBKA 4O84A 4U43A 3V51A 2XJ2A 3TG1A 2YIYA 5ANIA 5IU2A 1R3CA 3H3CA 3LCSA 2Y8OA 4EJNA 3DBEA 4RZWA 4O6LA 3RHXA 3ORIA 2DYLA 4QT1A 4MNEB 5CNNA 2XIYA 4A4XA 2PK9A 4BDAA 3ROYA 5L3AA 4CMUA 3LXLA 1KWPA 4EHEA 2UW9A 3BHYA 4U6RA 5CEMA 2BTRA 4FODA 3HV6A 3Q9WA 1I44A 5CAUA 4ZLOA 4M0ZA 4EOSA 3WI6A 4W9XA 3WZUA 2XK7A 2VO7A 5M4CA 3C51A 2EXMA 3COHA 5K5XA 2GNGA 4FTUA 4EQUA 3OCSA 2NP8A 4F1OA 3OCTA 4G2FA 3WZKA 3NNXA 3R7UA 4FT9A 1PF8A 4LRMA 2F57A 2J90A 1LEWA 4RJ5A 1YI6A 2OH4A 4QMMA 3TUDA 2IVSA 3D94A 4PDOA 4TYJA 1J7IA 4R7BA 5CF5A 3QCYA 4GJ3A 2ZVAA 2X8IA 4W4YA 4J71A 3RPYA 3HMPA 1QL6A 5J5SA 3FI3A 4FTIA 1OL5A 4XV9A 3ZOSA 4U8ZA 4U44A 1DS5A 2C68A 3LFEA 1NVQA 1LPUA 4IJ9A 2PUIA 4C35A 1X8BA 5C8KA 3BQRA 3ALOA 1BMKA 3ZM4A 3UZRA 4V04A 3I81A 2CPKE 4AG8A 1XH6A 1E1VA 5HVYA 2VU3A 4AFEA 4MD8E 4MH7A 5CQWA 2YM8A 3GVUA 2B7AA 3FKLA 2CGXA 3EQIA 4XG4A 5A46A 4JRVA 4RA5A 3DT1A 4IDTA 4X3FC 2WMWA 1FINA 3QUDA 2GNJA 4RPVA 3VUGA 5F9EA 5IUGA 4AAAA 5E1SA 3VS3A 2E9NA 3V8SA 2J0LA 2UW5A 2W1DA 3VHKA 4PX6A 4O1PA 4EKKA 4YC6A 4O7LA 3HGKA 2Y6MA 4U45A 4UYNA 3BWFA 2BDJA 3ERKA 4FV8A 1HOWA 4PNIA 3B8RA 1KE5A 2IWIA 3BKBA 4DGLC 5IISA 3EWHA 4C3PA 2ERZE 2BILB 3I7BA 4RT7A 3TI1A 3LFNA 3R8MA 2PVJA 4NIFB 2PZPA 3CBLA 4KS8A 2VNWA 2XIKA 2HENA 3NYOA 3QD4A 3ORTA 3QHRA 4D2TA 2VX0A 3MVHA 3TACA 1WVYA 3RM6A 3FMJA 1WAKA 4GK2A 1WFCA 1OIUA 4BCKA 2VWVA 4ANOA 4K18A 1DAYA 2NRYA 3NUNA 3TNHA 4R6VA 4LFIA 3ID6C 4FV4A 3ACJA 1Y8GA 2OIDA 5EDRA 3SKCA 4C2WA 4RIWA 2CN5A 2QO7A 4RC3A 3WF5A 5JGBA 3QU0A 3KCKA 3ZCLA 4DCEA 4Y72A 4FGBA 4RSSA 3JXWA 5DRBA 2P3GX 4C2VA 5JFWA 4PPCA 3BEAA 2C30A 1OI9A 2ITTA 3FSKA 3QA8A 3S00A 5DIAA 4DBNA 4D9UA 1V0BA 1Q8WA 1XR1A 2NO3A 3B8QA 3UPZA 3PXZA 3GXLA 4BCFA 1CTPE 3GNIB 4CLJA 4HJOA 4QMQA 3QFVA 2ONLA 4FC0A 2JAMA 2PULA 4EOOA 3M11A 3RAWA 3P78A 3ORPA 5FEEA 3QQKA 4F9BA 3SVVA 3BV3A 3PPKA 2Y6OA 2XVDA 4FT3A 2BR1A 3UODA 4KKEA 5KKRC 1SM2A 2Z7LA 4JBQA 4QYHA 2GFCA 3AC4A 2GHLA 3ZYAA 2PYWA 2HY81 2VTNA 3IK3A 3ZBXA 2REIA 4HYHA 4MKCA 5CI7A 1BX6A 2ZAZA 3EZVA 3RAHA 5E8SA 3FL5A 2VO0A 2HW6A 4P5QA 4F0GA 3UP2A 4NM3A 5KMMA 2HWPA 3TTJA 5M55A 4BGGA 1UNLA 4HVIA 1H0VA 5AUUA 4JXFA 3V01A 1OL2A 1T45A 3L9MA 4O27B 4D4RA 4FGRA 3BLRA 3VO3A 3A7GA 4F64A 4KAOA 5HEZA 2BRBA 4H3BA 2UW4A 5AP3A 4E5WA 2PWLA 3LKMA 2YITA 3S3IA 1H24A 3FMDA 3MIYA 1NVRA 3VBWA 4C58A 5CSPA 5HVJA 4QPAA 4IM2A 3W2CA 4JBVA 1JLUE 1UU8A 2HZ0A 3DGKA 3BYSA 3QTQA 3VS2A 3MJ2A 3VBVA 4DT9A 5JH6A 4YJQA 4DG3E 3N4TA 3LXNA 1OL7A 5F20A 3DDQA 5AUWA 2WOTA 4I3ZA 3ORXA 3HV7A 1B39A 4LL0A 4O86A 5CENA 4BDEA 4HYUA 3LCTA 4FTLA 3QGYA 4JG6A 4L52A 5EHLA 5DN3A 3JR1A 4U79A 2IW8A 4E4NA 2EB3A 5E9EA 4JLCA 4GG7A 4P90A 3U9CA 2C1AA 4YGAA 3GBZA 4AQCA 3E88A 5TT7A 2VV9A 4JQEA 3TCPA 3RI1A 3U6JA 3G33A 3MWUA 3NR9A 4N6YA 5L8JA 1XQZA 3ZLSA 3RM7A 3R8UA 1U54B 4D1ZA 4GS6A 2WIPA 3EQHA 3R8PA 5AUXA 3HP5A 4I21A 2BZKB 4UWCA 3W2PA 5CWZA 4BCMA 4H05A 2A19B 3WE8A 4BWXA 4X2GA 4BKZA 3HECA 2ACXA 3KC3A 4GT5A 1YI3A 3D7TB 5L2IA 3NSZA 4O7TA 4X3JA 3TIYA 1YOLA 2YCFA 5JMSA 1GY3A 5FTGA 3P5KA 4A9TA 1BUHA 5FQDC 4RC4A 2I6LA 2FVDA 2VWXA 2X0GA 3OUNB 4ZTHA 5HNIX 1ZYSA 4IZ7A 4BTMA 4UMTA 2I0HA 3OXZA 4KSQA 4GW8A 5AX3A 2R3FA 5CSXA 4FIEA
chains in the Genus database with same CATH superfamily
3JVSA 4M69B 2B55A 2C6DA 4FNWA 1XBCA 2ETMA 4EH9A 4EZ3A 2OJGA 5DMZA 3KGAA 4F6UA 3TJCA 2PMNX 4FKPA 5BYZA 4EOKA 4CVAA 4XOYA 3EFLA 3C1XA 3FC2A 1JAMA 3NNWA 4IVAA 3FI4A 1PXMA 4YZCA 3NAXA 3E8DA 5IA1A 4DT8A 2XK9A 4BF2A 3TZ9A 4B7TA 3CEKA 3CP9A 3AC5A 3HMNA 3KRXA 4NIFA 4APPA 5HO7A 1OKVA 3C4WA 4L7SA 4GVAA 5AMNA 3DQXA 4CEGA 4EL9A 3H9FA 5DPVA 3RAIA 3FMHA 3G6HA 3G9NA 3PIYA 4YJPA 2RG5A 4CKJA 1Y8YA 3MB7A 4X2JA 5IUIA 3UDZA 1LEZA 4GL9A 3UC3A 3L8VA 2W5BA 4MXZA 3SQQA 5CAOA 1OB3A 4RIOA 5A6NA 4WSQA 5IEVA 2Y0AA 3GU5A 2BMCA 4BCIA 4RIXB 4YLLA 2WELA 4R78A 2BCJA 3R30A 1BYGA 5K0KA 4WIHA 3PWDA 4TN6A 2LGCA 3NEWA 3MH2A 4NFNA 5HGIA 1PYEA 5JGDA 4WA9A 2YLEA 1GIIA 2ZMDA 3L8XA 3K5VA 4QOXA 4S2ZA 3R7IA 5A14A 4ZOGA 1M7QA 3KF7A 2YCSA 4D2VA 2FO0A 2FSLX 1IA9A 3HMIA 2BRHA 4QTEA 2C0IA 4S34A 4I0SA 2BZJA 4D5HA 3CY3A 4QP7A 4RWLA 3FZPA 4C3FA 5BVKA 5AA8A 4ASDA 4O4DA 2C0OA 3SD0A 3VRYA 3BLQA 2F2UA 3QA0A 4GU6A 2C6TA 4JDHA 1YOMA 3PVUA 3MFUA 3LQ5A 4ZXTA 1ZMWA 2B52A 3PFQA 3ZDIA 4AT5A 3JY9A 3NCZA 3CIKA 1XH7A 2PVNA 4RA4A 4RJ7A 1OMWA 1OGUA 3LM5A 3VBTA 2C6EA 1WBOA 4ZLZA 3QZHA 5GINE 3MY1A 3R2YA 3VUKA 3W2RA 4QQTA 5L2QA 5E8VA 4WRSA 5C4LA 3OUKA 2OWBA 4PTCA 4AS0A 3P7AA 1PY5A 4L01A 3SXSA 2VUWA 3DCVA 5AP7A 4K33A 1R78A 4U3YA 4OTQA 1OM1A 4Z9LA 3W8QA 3UVRA 2OKRA 4F70A 4J97A 4NW5A 1CKIA 4FKLA 3NUPA 4EH3A 4BTJA 1ZWSA 5C8MA 3R7EA 2VO3A 3T9TA 3E8EA 4EZ7A 1TQMA 4YC8A 4E4LA 2JFMA 1FMOE 2X6EA 4O0TA 5LVNA 3QC9A 4GMYA 2XF0A 1GIHA 5I9XA 3ODZX 4XBUA 4LGDA 2XIZA 4YJUA 1ST0A 4FZFB 2C5YA 2E9VA 4L7FA 3ZC6A 3LCOA 4NFMA 5DYJA 4RVMA 5AAEA 2UZNA 4CFWA 3PYYA 2QOFA 2C5VA 2IW9A 3ZHPC 4EKLA 3DXQA 4IEBA 5FG8A 3SXFA 5H2UA 2BAKA 1V0PA 2G01A 2HK5A 3UQGA 3EL7A 1OIYA 4BIDA 1J1CA 3UO5A 2ITPA 4MHAA 2IVTA 3F6XA 3OWPA 5LVPA 5E7RA 4FG9A 3QTXA 2JKKA 2R3LA 4YO4A 1GJOA 1PXNA 2IF8A 3QQFA 2WTKB 1U54A 2RGPA 4H3QA 5E1EA 4BRXA 4CFFA 3IQ7A 3QTSA 2OXXA 5C03A 1Q4LA 4XUFA 4AGDA 4EOJA 5FDPA 3D7TA 4A4LA 3FZSA 2B1PA 2I0YA 2P55A 4WG3A 3ZONA 5K0XA 3H4JA 4FL2A 4XP0A 4CMOA 2UZTA 2VTIA 4YTCA 5BVFA 4QNYA 2JIIA 5HTIA 2CKEA 5M53A 4JNWA 5A4LA 2C5OA 3NRMA 4QDEA 3KMWA 4DBXA 3SHEA 3VF8A 3K3JA 4USEA 3UOHA 3VUHA 4P4CA 3FKOA 2R3IA 4O21A 3UYTA 5AM6A 3OOGA 1RDQE 2UZVA 4MD9E 3S1HA 4G3FA 4IWDA 4M69A 5HE0A 4QMNA 1O6KA 3VAPA 5IQEA 2LAVA 4B8MA 4F0FA 3PRIA 4EUTA 2WQOA 3EQFA 1PW2A 2I7QA 2QHNA 3C7QA 4YSMA 3RK7A 2ETKA 4CGAA 2WPAA 4K9YA 1DI9A 3C4FA 3AGMA 1M17A 3OW3A 4AZFA 1DAWA 4ZY6A 5IQAA 5AV3A 2X0QA 2YA9A 3KXHA 4YNOA 3VS6A 3ALNA 3Q3BA 1H4LA 3FPMA 3MN3A 2J7TA 3NW5A 4GK3A 5HE1A 2WTDA 3EFKA 1YWRA 2VWUA 3MFTA 1Z57A 5ANEA 3NLBA 2PTKA 3EFJA 4LGHA 4PRJA 2I0VA 2PE1A 4IHPA 4D2WA 3RALA 3N9XA 3QUEA 4HYIA 5KE0A 1XMLA 3PZEA 2F49A 3DA6A 3PUPA 1FVRA 4RIXA 4M67A 1J3HA 1YXTA 3KN5A 2FH9A 1WCCA 2VTQA 3SDJA 5HX6A 2OJFE 1BLXA 3R7GA 4FYOA 3SRVB 3QTWA 5KMKA 4W4VA 4CRLA 4CRSA 4D5KA 1REKA 4FKSA 3BI6A 2R3JA 3CSVA 4C02A 3LMHA 4JVGA 4L46A 4FKOA 2BVAA 2OJ9A 3BHUA 4CCBA 4BZNA 2GQGA 2P0CA 4UB7A 3UG1A 4ZTMA 2JIUA 3BCEA 5FLFA 3NPCA 3O7LB 4CT2A 3SG9A 2RFEA 3N4VA 1PXOA 2ZMCA 2HZIA 4P2KA 3W0SA 2JDOA 3FHIA 3KY2A 4Y5HA 5HCYA 3NUUA 1M7NA 2QOCA 3FLZA 5IH6A 5KNJA 2PY3A 3BHTA 2XKCA 5J5TA 3EOCA 3I5NA 5D9HA 5J7BA 1GZNA 2BIKB 2R3GA 3CJFA 3DB8A 1OPJA 2UZWE 5HOAA 2QU5A 4NUSA 3UOLA 3OTUA 3TKIA 5IQCA 4F9YA 3ZSGA 5DG5A 3D14A 2WQEA 3UGCA 5CX9A 3EQRA 5M4IA 1MUOA 4FKTA 1WBTA 2GPHA 4FUYA 1M2RA 3OEFX 4ZMEA 2XNPA 4MK0A 5CZIA 4QP2A 2B0QA 3F7ZA 3S4QA 3WZJA 1P4OA 1VYWA 5EQYA 2HZNA 5EQPA 1PXIA 2XIRA 4BL1A 3AG9A 1GZ8A 2CJMA 3KL8A 3QGWA 3QQGA 4TWNA 2NYAA 1JSUA 2PMOX 3S2PA 3HKOA 3FY2A 4N70A 5LMKC 4FKGA 4DEIA 4EHZA 2JDVA 4X2NA 2GFSA 4PMTA 5AA9A 2OH0E 3U51A 2OFUA 3KB7A 4X3FB 2C4GA 2X39A 3KXMA 3W2OA 2XJ1A 5LCKA 2W06A 3OT8A 3QALE 4IB5A 3AMYA 3MGYA 4KBKA 5CSHA 2EU9A 1VLRA 4G16A 3VN9A 4O0XA 4ZTRA 3BU3A 4L42A 3ZEWA 3LMIA 4C59A 1TFFA 4O82A 2Y4IC 3CQUA 2QU6A 4IAZA 5E8ZA 4HVSA 3WZEA 3UBDA 5KMOA 4N4SA 1Q8UA 5KBRA 3VUMA 1Q61A 3PXKA 4CSVA 3IDCA 1CKPA 2XCHA 4UWBA 4D55A 5HZNA 5GNKA 4M66A 3UIBA 1G5SA 3I0OA 3MB6A 4USDA 2IZRA 4FV3A 4QMPA 2HXLA 3BYMA 5D7AA 1OL1A 1KSWA 1YRPA 2XEYA 3PP0A 1W8CA 4OTIA 2ZDUA 4BHZA 2YDIA 4YLJA 4ITIA 4IJPA 1SYKA 2R3PA 1OPKA 5J9LA 1VEBA 1M2QA 3DXNA 4EK5A 5LWNA 2OSCA 5FDXA 3F2AA 3R28A 2BROA 5M09A 3PVWA 1TVOA 5AAGA 3LHJA 5F95A 5EYMA 3U4WA 1T46A 2HZ4A 1G8JA 4YMJA 3LFCA 3P23A 2PZYA 3BYUA 4Y85A 1EH4A 5ACBC 3PPZA 3ZXZA 4LRKA 4DHJA 4IFGA 5J1VA 3NUXA 5EYCA 1NXKA 4X6RA 2UZLA 4MQ1A 4AN2A 3MFRA 3POZA 5HU9A 5AP5A 5BPYA 3KVWA 1WBPA 3KU2A 3LFSA 5K5NA 4FT5A 3FWQA 4TWCA 4C4IA 4R7HA 4AFJA 4JR7A 4ASXA 3KXNA 4EK6A 4JMQA 3D15A 5A4CA 5IQHA 2HWOA 3LCDA 1QPCA 2YM4A 3WIGA 3TM0A 3ZUVA 2VZ6A 3OXTA 1WBNA 4BFMA 4BICA 2Z7QA 1ST4A 4EQCA 5EOBA 4TYHB 4R77A 2QONA 3SRVA 3OFMA 4CYIA 2X81A 4I1ZA 5BUIA 5EYKA 3FZOA 4CFUA 3PSBA 2IZUA 3KCFA 3D5VA 1PMEA 4LUDA 3CPBA 2ZB1A 3JY0A 4O7YA 1OKWA 3FY0A 3SOAA 5JGAA 4FEQA 3W8LA 3DNDA 3MFSA 4I5CA 2O0UA 2BUJA 4QMOA 5AV1A 4KIKB 5A4EA 4E1ZA 5HBHA 5AUTA 3TUCA 4FI1A 2QOHA 4F9CA 1F5QA 4XX9A 3NUAA 5ETCA 1AGWA 3GEQA 1OZ1A 5CEOA 3R8ZA 4DEGA 3VS0A 3NUSA 4JT3A 5EM8A 5GZAA 3L9NA 2XK8A 5AP6A 1URWA 3E3PA 2GCDA 2VTOA 1Z5MA 3OOMA 4FKWA 5BVOA 2OXDA 2ITOA 5EW8A 3ZSIA 5IA4A 2W1CA 4I20A 3WILA 4O83A 3F88A 3R2BA 1Y91A 3F66A 4G3DA 1FBNA 1H26A 3COIA 3F61A 4CT1A 4YZDA 4DFUA 4ANQA 4M13A 1NA7A 2WEIA 4W4WA 3LJ0A 3L8PA 3OT3A 1NVSA 3E93A 3GCQA 2ITXA 2ZB0A 2OXYA 2XK6A 4RX8A 2XYNA 4ANLA 2PMLX 4Z3VA 2CCHA 2P4IA 3JVRA 4DC2A 1GZKA 1Q8YA 2VWZA 3FXWA 1UVRA 4XMOA 3W55A 4J98A 4YZMA 4LI5A 3LFBA 4GV1A 4NCTC 2R9SA 3GT8A 1YXSA 4XCUA 2FGIA 1DI8A 4CKIA 4FZAB 4YUQA 5H8EA 4GIIA 4IVBA 4D0XA 1YXUA 4F7LA 1ZYDA 3TV4A 4CG8A 1SVHA 4YLKA 4CKRA 3GCUA 4FV6A 1H0WA 4GFGA 2BFYA 3CGOA 3FHRA 4O22A 4RQVA 4C4HA 5G1XA 4UMRA 4IADA 1WBWA 4F1TA 4CCUA 4DFYA 4IX3A 1Q8ZA 3QQHA 3VUIA 4G17A 3QKKA 4X3FA 4GFMA 4BDKA 2XRUA 3QBNA 5EFQA 2OI4X 2AC5A 2J50A 3FMNA 1B38A 2VNYA 4MBLA 4WNMA 2ITVA 2J0KA 1PJKA 4YJVA 5BQ0A 4A7CA 3LFAA 3Q04A 3QHWA 3AT4A 3O0GA 2WMSA 4FYNA 5CU6A 2HOGA 2YCRA 4FTQA 4ANSA 1QPJA 4FNZA 1KV1A 4ACDA 3PE1A 4BI1A 4EZ5A 3R63A 3AC1A 5AV4A 3AXWA 4MWHA 4WSYA 3MESA 3F3WA 5I9UA 4FTOA 4O7NA 2CGWA 2QCSA 4AZEA 2ZYBA 3KRJA 3N4UA 4BCOA 3KXXA 3COKA 2OJIA 1Q8TA 2XCKA 2ZOQA 5FP5A 1P4FA 2BAQA 3H9RA 4OT5A 2HIWA 1H25A 4APCA 3BBTB 3BBWA 2XEZA 4IDVA 5T3QA 2BPMA 1WVXA 2IN6A 3LXPA 3NNVA 4XOZA 3ZO2A 4JX7A 3FI2A 5CAPA 4YHFA 2YLFA 2WQMA 4KKHA 2AC3A 3G6GA 3GOPA 3EKNA 4ZIMA 4F4PA 3HA6A 1Q3WA 5BVWA 1CMKE 5A3XA 5I3OA 2QI8A 3PWYA 2GS7A 3PVGA 3MBLA 1WBSA 5CSWA 2B54A 4RX5A 5BUJA 2PZ5A 5KMNA 3DLZA 4AF3A 2EWAA 2YWPA 2VTPA 2EB2A 1R1WA 1ZOHA 3QUPA 4B6LA 3Q5IA 3TV6A 3BYOA 3UIMA 3E7VA 1ND4A 3CTQA 5HCZA 5EHYA 4C3RA 4A07A 4XBRA 2VTJA 2QHMA 4MX9A 5I9YA 4FICA 1CKJA 4BWPA 5IEXA 4M68A 1KOBA 4ALWA 2B9IA 4TYHA 1PMVA 3SA0A 4PP7A 1PHKA 3ACKA 4IZAA 3V8WA 3VONA 2OZAA 1W0XC 5M44A 3F69A 5HESA 2CHLA 3NX8A 3O51A 4RVTA 4BCPA 1BKXA 2WTWA 3ZMMA 3R22A 3R9HA 5FXRA 5KZIA 4KS7A 4OTPA 1M2PA 2X7OA 3A4PA 3V3VA 3W18A 4E8AA 1A48A 3HMOA 2QLUA 3I4BA 4YURA 4MD7E 4NK9A 1NY3A 4MXCA 1U46A 4GVJA 2BALA 4KIKA 3HRFA 2WFYA 2O5KA 1H00A 3F2NA 4BDDA 1YDSE 3D83A 4L9IA 4Y95A 3NZ0A 3BWJA 2R3MA 4D4YA 2W1FA 4M15A 5ETIA 2WMVA 3GC8A 4V01A 3SW7A 2XKEA 3WF7A 1JPAA 3LFQA 4IC8A 4ID7A 4OTDA 4QP1A 4U42A 3MVMA 2PUNA 1H8FA 3R00A 4WBOA 5LQFA 3PXRA 1NT2A 1UWHA 1WMKA 3I1AA 4HVGA 3IOKA 2ESMA 3HX4A 1JKKA 3K2LA 5LMAA 3TTIA 1W82A 2JEDA 3V5LA 4F65A 1CSNA 4IMYA 4LMUA 1YXVA 3CC6A 4QP8A 4BBEA 4BZOA 4CLIA 4G6LA 2JBOA 3FXZA 5I3RA 4L45A 3WE4A 1JKSA 4I0TA 4TT7A 3T9IA 4F6WA 2W96B 5K9IA 1XJDA 1YKRA 2GU8A 4ZY5A 5AR4A 4L53A 4FR4A 2WTCA 4U80A 4MUQA 3QRUA 3AT3A 5C8NA 3P86A 5IMXA 2EVAA 4CXAA 4C36A 2CGVA 1YDRE 2W1ZA 3CJGA 3IECA 2JDRA 4G3GA 2AUHA 1H1QA 3IKAA 4MWIA 3F5PA 4R8QA 1F3MC 1Y57A 2FYSA 4Y46A 5EDQA 4ZSGA 5EW9A 3O2MA 4IXPA 2J9MA 3TZMA 3TNWA 3QWJA 4IX5A 3A7FA 3RNYA 3UMWA 3P5JC 3V8TA 2ZM1A 2C6OA 4RQKA 3VBXA 4MNEA 3ZZWA 5C9CA 3TEIA 4X6QC 5JKGA 2W1HA 4QPMA 5DLSA 4NT4A 4NM7A 5FRIA 5EM5A 2YCQA 4O7VA 4ACGA 4LRJA 4L44A 4FG8A 5IPJA 4NJ3A 4DTKA 4L67A 5KUPA 2BZIB 5A4TA 4AE9A 2QR8A 4D1SA 4YU2A 3GQIA 4QYYA 5GHVA 3HRBA 3HDNA 5L6WL 4XJ0A 5CU4A 4AX8A 4EYMA 1H08A 4GT4A 3CD3A 4WUNA 3NW7A 5CXZA 4TYEA 1Q99A 2GS6A 4EI4A 3WF9A 1TKIA 4C4GA 2PU8A 4HPTE 2ERKA 2YDJA 4LQMA 5TR6A 4MF0A 2O8YA 1DM2A 4ACHA 3SG8A 2H9VA 4GKHA 3COMA 3UOJA 4BDIA 3O8TA 4AW5A 1PMUA 5EYDA 5KO1A 4XH6A 4UXQA 4AXEA 2KULA 2X1NA 3KK9A 4NWMA 2J6MA 4UZHA 2GDOA 5G6VA 3IS5A 2J0JA 4RZVA 1I09A 1H01A 4NM5A 3O96A 1XMMA 3E8CA 4ERWA 3EQDA 5LMBA 3U87A 4BCHA 3FI8A 4FV0A 3F5GA 4H58A 3V04A 5HG7A 1UU3A 5LCJA 4U81A 2R3HA 4GFOA 2R64A 2JLDA 2ONLC 4GUEA 3M42A 2QOQA 3FC1X 3PPJA 2W9ZB 2PUPA 1UWJA 3KULB 3KMUA 4EOQA 3GU8A 3PY3A 3F5UA 4IQ6A 4B9DA 5DT3A 1SZMA 5CYIA 3R1NA 2WHBA 3FMKA 4J96A 3WIKA 4FKQA 3NCGA 3DK3A 3Q53A 4ONAA 3LE6A 4PL3A 2WMAA 3D5UA 3E63A 4YBJA 4PWNA 5HG8A 3AKLA 1MRUA 5E8UA 5EHOA 5DRDA 3KK8A 4PDYA 5DOSA 1ATPE 4KD1A 3R83A 4FL3A 1OKZA 3CCNA 3DQWA 3RWQA 3CKXA 1SVGA 3PIZA 4DH3A 5JFVA 5I9WA 5IQGA 3KN6A 4WNOA 1MRVA 5H8BA 3OY1A 5DR2A 2ZM3A 2YWVA 4HNFA 3FMMA 3UNJA 2PPQA 5M08A 3R7OA 2JFLA 3E8NA 5FXSA 3TV7A 4BGHA 3R9RA 2F7ZE 4HPUE 4EC8A 2YDKA 4ZAUA 2P2HA 4YR8A 1J7UA 4L6QA 5ETAA 2J0IA 4RJ4A 4I5MA 2CKPA 3PTGA 4MXYA 4ENXA 4MYGA 4RJ6A 4IX6A 5CXHA 1RQQA 3IOPA 4PTEA 2XZSA 4O0WA 3ZLYA 4C33A 2P33A 3BV2A 4QTAA 4F99A 3QRIA 2Z60A 3VS7A 3ZM9A 1RJBA 5IA5A 3ATSA 3H0ZA 5DH3A 2ITWA 5AR3A 5CU0A 2O63A 5IH4A 4L68A 4HCTA 5BVEA 1REJA 4AGWA 3MDYA 3DV3A 5IA0A 2OIBA 4YJNA 2E9UA 3R01A 3OCBA 5IMEA 5K3YA 2C5XA 3DOGA 5CI6A 5J7HA 4GJ2A 1KE6A 3MH0A 4J7BA 4K11A 4RLLA 4V0GB 4O4FA 4DH7A 1P2AA 3KKVA 1G8AA 3RTPA 4AOIA 2VO6A 4G5JA 5E90A 2FA2A 3OY3A 4KBCA 2XAOA 4YTIA 1IG1A 1JVPP 4FK3A 3DAJA 2V7AA 3QAME 2CKOA 5FP6A 4YZNA 1FVVA 4E5AX 2Y4IB 2W9FB 2O65A 3LXKA 4GYGA 5CS6A 3FLQA 3SXRA 4ACCA 4CG9A 3EKKA 2WNTA 2IEWA 2J5FA 2VX3A 3ULIA 4UMQA 5CAVA 1XBAA 4S31A 4L3JA 5E8WA 2QURA 1BL7A 2X2MA 4JI9A 4O1OA 5EI6A 1H27A 3EZRA 4MQ2A 2V7OA 2WMUA 4LG4A 3DFCB 3DDPA 3I6UA 3RHKA 5B0XA 4BI0A 2Z7SA 2C0TA 3FLYA 3HA8A 4AW2A 5AV0A 3NS9A 3QQUA 3HZTA 4IAFA 5H9BA 3O23A 4E93A 4D4SA 3Q5ZA 5EKNA 3UO4A 3LCKA 2BRNA 4WBBB 3A7JA 4O0YA 5GZ9A 4XV3A 3AOXA 1J1BA 3TXOA 2C5NA 2Z2WA 4XYFA 3E3BX 3UG2A 4KKGA 4FSQA 4KIOA 3GCVA 1VR2A 3P7CA 5DE2A 4ZZMA 4EH7A 3DAKA 1IEPA 4KB8A 4L3LA 1YI4A 1BI8A 2XM9A 3LM0A 4DFZE 1ZZLA 4JX3A 3ZO3A 5IA2A 2GHGA 2R3QA 4DDIA 2V62A 4YC3A 3DK7A 5AFVA 3OWLA 4PMSA 4EWQA 4RVKA 5DR9A 3ZC5A 4MF1A 4FTCA 3QQLA 3HRCA 2J4ZA 1ZRZA 3DKFA 3M1SA 3VC4A 4UWYA 4R3CA 1U4DA 2JIVA 3VUTA 5BVDA 1IAHA 2GQSA 4MNFA 2J5EA 3LQ8A 5LVOA 4ASEA 2IW6A 2BFXA 5IQBA 3EN5A 4D28A 3NVMB 1XO2B 3D7ZA 3QTIA 3MY5A 1SVEA 4TKSA 1G8KA 3C50A 2RG6A 4I6FA 2WD1A 3AD6A 2G1TA 5T6KA 3S95A 4FRFA 4PL4A 4CTBA 3AMBA 3PJ2A 3V5JA 5CF6A 3CD8A 4I6QA 3EYGA 4BCQA 4IB3A 4FJVA 2GNHA 5HTBA 4LOPA 4M3QA 4Z55A 3FAAA 4LV5A 2VTLA 3FL4A 4ACMA 4QMYA 3MW1A 2XP2A 4RLKA 5AIRA 1IRKA 4IAAA 3EH9A 3OXIA 3BGZA 3QYZA 4FIJA 1V1KA 3KULA 3UNZA 5DI1A 4A9SA 4DYMA 1J7LA 4RMZA 1GOLA 4OW8A 5TKDA 5IUHA 4FEWA 2FSTX 3MYGA 5M51A 2YM6A 4C4EA 2CKQA 4NU1A 5HE3A 1R39A 2PZRA 3RPRA 2E9PA 3ROCA 4C37A 4BY9E 3G15A 4ITHA 2R2PA 5HHWA 4FA2A 5M4FA 1Y6BA 4E6QA 3UE4A 3NFGB 5TOZA 3ZH8A 5GZ8A 5EOLA 3UJGA 2IPXA 4YJOA 5L2SA 1UNGA 2PMIA 2YZLA 3BHVA 4QNAA 2C6KA 3DJ6A 4C8BA 4GU9A 4TNDA 2UUEA 4ANMA 4CZYB 5CY3A 2X4FA 2VRXA 4O0SA 1K9AA 4DCAA 4PDSA 3DAEA 3O71A 4R3PA 2BTSA 3UYSA 1ZYCA 3QKLA 3RNIA 3O7LD 4O0RA 3U9NA 3DZOA 3W32A 4FKRA 3DU8A 1ZYJA 3ORZA 2OBJA 1JBPE 3MH1A 5A6OA 2VWYA 5IA3A 4GEOA 4TYGA 4CQEA 2H34A 3DBCA 4I0RA 3G5DA 4M84A 3SX9A 2IJMA 2JGZA 3FBVA 5BYYA 4J99A 2X7GA 3BGQA 2BHHA 4XRJA 3MH3A 4FZ7A 2BZHB 3GU6A 5I9ZA 3Q4CA 4HGSA 3ZXTA 3OEZA 3P7BA 5LMKA 3BLAA 4LOQA 3SC1A 4W9WA 3GU4A 5AJQA 5HO6A 1IR3A 5E92A 3CPCA 5BNJA 4ALUA 1K2PA 4H1JA 4IW0A 5LJJA 5JN2A 2YIRA 3ENHA 4S33A 4YPSA 4V0GA 3F3TA 3KA0A 3TUBA 4ALVA 3W0MA 5FBNC 4QMSA 1JSTA 4WUAA 4FNYA 4IAKA 4ITJA 5AP2A 1OBGA 3BU6A 4D1XA 3G0EA 4KWPA 3EL8A 3LIJA 3VJNA 4WKQA 5DA3A 2QC6A 4FVQA 2C6IA 3U54A 3ORNA 4C57A 4IBMA 2C1BA 4M97A 3ENMA 4EK4A 5CVGA 5IF1A 4LDTA 3RZFA 3R71A 2HW7A 4YSJA 3QTZA 2PSQA 2WO6A 1ZMVA 4ENYA 4BJJB 5FGKA 4DGGA 3A4OX 1UKIA 3FPQA 1PKDA 2QOLA 2VTAA 2OFVA 3Q96A 4AOTA 2W4JA 3FZRA 1PRYA 3QL8A 4J52A 3VW8A 2B53A 3FUPA 5F1ZA 4CFNA 4YJSA 5KMLA 4B4LA 2NPQA 1H1WA 3QD3A 2X7FA 4O38A 4TXCA 4FVPA 4XV1A 5FWKK 2JAVA 4BBMA 4BHNA 2QR7A 4E4XA 2AQXA 5DGZA 4BI2A 5CEPA 4FSUA 3TNPC 2VTMA 4BCJA 3EN6A 3A61A 4ORKA 4OTGA 4PUZA 3VRZA 3QX2A 4RBLA 3R0TA 3KRLA 3DNEA 1S9JA 1SMHA 3W10A 4O6EA 4E4MA 2OU7A 3BLHA 4XG7A 4BGQA 2CMWA 5CEIA 2VWIA 2WKMA 3I79A 2BRMA 3I0QA 4YJRA 2ITQA 3Q9YA 2XUUA 2IG7A 1UA2A 2A2AA 3ODYX 4JRNA 3F9NA 4F09A 5HLNA 1P5EA 2YFXA 2QVSE 4ZS0A 1QCFA 2A27A 2X2KA 5AR7A 2UZOA 1WVWA 4QO9A 5KMIA 2UZUE 3DKCA 4W8EA 4RVLA 1L3RE 1OUYA 3DPKA 4M14A 1GZOA 3VBQA 2QG7A 5HLPA 2XARA 4FIHA 3NYNA 3BZ3A 2QLQA 4YHTA 4CZTA 4TNBA 3TT0A 4FZDB 3DS6A 4I92A 5DEWA 3R8VA 4BB4A 2OJJA 4YZBA 5AP0A 3DKOA 5K4JA 3AKJA 4HVDA 4FT0A 5E8TA 5I5ZA 4FKJA 3UZTA 4G1WA 4DEDA 1KE7A 4I5HA 3W33A 4WRGA 4FV5A 4TY1A 3IW8A 1O6YA 3GI3A 3TNQB 3EHAA 4FK6A 5HNGA 2XNMA 4AXAA 4DF3A 4IVDA 4X0MA 4FG7A 3UOKA 2XB7A 4IH8A 2PVYA 3HMMA 5K4IA 5JQ5A 3I5ZA 3NWWA 4FKIA 3OMVA 3A2CA 2XKDA 2C47A 5CT7A 2X9EA 5L8LA 3C0IA 5HG9A 4B8LA 4TTHB 4BDHA 4JG8A 4DE4A 4ASZA 3TKUA 5CLPA 3V5TA 3GQLA 3OWJA 3PE2A 4O4EA 3E7OA 2A4LA 4FEVA 3GFWA 2R0UA 3LW0A 4LOOA 3HL7A 4FTKA 4FBXA 1H1PA 4OT6A 1W98A 3HVCA 2YM3A 5A4QA 5KKRB 4Y5QA 5CEKA 3NYVA 1MQ4A 3ZFXA 4AT3A 3RPSA 3ANQA 4NCTA 4DEAA 4BDGA 3AC3A 5EI2A 2VD5A 3L9LA 4G3CA 4HGTA 1PKGA 2I40A 3FLWA 4FOBA 4O91A 5B7VA 2G9XA 4JS8A 4XLIA 3VW6A 4D4VA 1UNHA 2BHEA 4RG0A 3RVGA 4H39A 4DG2E 2W05A 3R8LA 4WT6A 5CT0A 3MTFA 5AR5A 4EWHA 1LR4A 1OVEA 3G0FA 4MXXA 3Q4TA 3PUFC 1JQHA 4ARKA 1Z9XA 2C69A 3Q4UA 4KINA 3RKBA 4ZLYA 4FV2A 4TL0A 1M52A 2B4SB