4U97A

Crystal structure of asymmetric irak4 dimer
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
293
structure length
272
Chain Sequence
HSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAALKQQFDQEIKVMAKCQHENLVELLGFSLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRNIKSANILLDEAFTAKISDFGLATVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title IRAK4 Dimerization and trans-Autophosphorylation Are Induced by Myddosome Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Interleukin-1 receptor-associated kinase 4
total genus 97
structure length 272
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u97A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u97A01
1K2PA 3VF9A 5BVFA 4F0GA 1MQ4A 4FE2A 2ZDUA 1WZYA 3I81A 4GRBA 4L00A 1AGWA 2AUHA 4KIKB 1XHAA 1Q62A 3R28A 4BCMA 2ESMA 3HMMA 4XCUA 3VUGA 4CFVA 3BYSA 2JAVA 2PZIA 4GUBA 4ZMFA 4N70A 2OGVA 3BV3A 4KUJA 5KMIA 3QZHA 1ZZLA 4ALVA 3NPCA 3QHWA 4YHTA 4GV1A 3SRVA 4ZP5A 4BI1A 3UNZA 3AC1A 5CF4A 4ZTNA 4CV9A 3LFSA 4AW2A 2IZSA 5DN3A 4YNOA 3A7HA 4DC2A 3GI3A 4IH8A 4RJ3A 4ZTLA 3TL8A 2BTSA 3H9OA 3OBJA 3AGLA 4QMOA 1ZARA 3NYVA 3UYSA 4E20A 4P5QA 4RSSA 5ANDA 3LXKA 5DT3A 5IZFA 4R7BA 3OY3A 2G9XA 4CYJA 4APCA 2Y9QA 5L8LA 3FQEA 3OEFX 3E92A 3QZIA 4FTCA 1WBWA 3L9PA 4ANQA 5EM5A 4ZJVA 2Z7RA 4M68A 1OL1A 3QA0A 2F2CB 1U4DA 5M4UA 3RP9A 1JPAA 3NW7A 4UMUA 4LV8A 4GJ2A 4A4OA 4XG2A 4S32A 3KKVA 4FSWA 4PWNA 5GIPE 3DFCB 4EH3A 4I4EA 2YHVA 5AP5A 1ATPE 3TZ8A 3UVPA 1L8TA 3H10A 2R3GA 4O7LA 2GDOA 5CQWA 3R02A 4E93A 4KIQA 4F9AA 1ND4A 5EK7A 2WTIA 3SX9A 1Q99A 5CAQA 3QZFA 2QD9A 1YRPA 4FV7A 5AMNA 3CE3A 1M2RA 4IMYA 1XO2B 5EM7A 3UO6A 4MBLA 2YM8A 3FZSA 2IVTA 4JDKA 3MFRA 4YJTA 5FG8A 5EM6A 3C4ZA 4F70A 4HYIA 5HU9A 5EHYA 4FEUA 5L6WL 1TQIA 4FZ7A 4OGRA 3R8MA 4KIPA 1YXTA 4IB5A 3ACKA 4BDCA 4P4CA 5M57A 4I3ZA 2BRHA 2OBJA 2PMOX 3OCBA 4QNYA 4R8QA 2BZJA 3QD0A 4U45A 4C62A 3E64A 1I44A 2FA2A 2RIOA 4FICA 3DJ5A 3FUPA 3HV4A 2XM8A 4RZVA 4X7QA 3TUDA 4W9XA 4LOQA 5LMKC 2SRCA 3RWQA 4IAIA 3RAKA 3FYKX 4BDFA 5K5XA 3C0GA 2WFYA 3ZOSA 4RRVA 4XG9A 3FI2A 2QI8A 4X3FB 4K77A 5TOZA 5AP0A 4FL2A 3RAHA 3V5PA 4ZSAA 4C4EA 2YN8A 2E9UA 3GBZA 3MH1A 1NT2A 2RSVA 2W1GA 5CNOA 4HCVA 4C4IA 4AGDA 5LVOA 1R1WA 3K3IA 2QOQA 2UW6A 2FVDA 4FX3A 3D7ZA 4E7WA 2FYSA 1OBGA 1PYXA 1OUYA 4NM0A 5BYLA 1GJOA 2X2MA 5EDQA 3TACA 4BHZA 2VV9A 3PRIA 4YGAA 2C0OA 1YDSE 2JIVA 1JKSA 1WMKA 2B7AA 5EYCA 3ZZWA 4LRJA 2E9VA 3WF6A 5E7RA 4HZRA 3D94A 2PZRA 5CF8A 4GKHA 4WUNA 4W8EA 2BILB 4ZJJA 1M7QA 4YMJA 4F63A 4IC7A 3O7LB 3F66A 4FSUA 3AC4A 4J53A 5D1JA 3GEQA 4EOJA 4M0YA 5L2IA 4DF3A 2R3FA 2UZTA 4XOZA 3TCPA 5CAPA 5KMMA 4I21A 3ZXZA 2FH9A 3NS9A 2X7OA 3SXSA 2YCFA 5M56A 2WTVA 4S30A 3AG9A 4X21A 1M14A 3HZTA 5J8IA 5AEPA 3OMVA 3NAYA 1YWVA 3DPKA 2XYNA 2H34A 2O64A 2C3JA 4L52A 2JITA 4LRKA 5IDNA 5JQ5A 4GL9A 1IRKA 4R3RA 3RNYA 3ZBFA 3ZM4A 2YISA 4PPBA 4QMZA 3QA8A 5IH5A 5ETCA 2PULA 3GNIB 1Q24A 4V01A 4PPCA 4E5WA 4QP7A 3WARA 2A1AB 1XH6A 3MGYA 4LQMA 4YJNA 3QTQA 3QWKA 1MQBA 3IS5A 3S95A 2XJ1A 4U3YA 4ANMA 3DBEA 2BMCA 3GUBA 4H3BA 5HZNA 5CASA 4YJOA 4C2VA 1ZWSA 4FNYA 2J2IB 2Y4IC 4NM3A 3D4QA 5FLFA 3F3WA 3NYNA 3QAME 4AW1A 4B0GA 4M97A 3OXZA 2OW3A 2YIWA 3ROYA 5M06A 2VWBA 3R83A 4J52A 5KCVA 1FBNA 2W4KA 4L9IA 4X6QC 1B39A 3JY9A 3HAVA 4F7NA 4C33A 4BIDA 4UBAA 4ZY6A 3V6RA 4LMNA 3MVMA 1DAYA 3BGPA 4I24A 3ZC5A 4LGGA 5AV0A 4G17A 1SMHA 2FGIA 2Z02A 1Z5MA 4IJPA 2PPQA 3ORXA 2GNGA 4QMXA 2PUUA 3DXNA 3O8UA 4YJQA 2VTLA 3RHKA 4AGCA 4B4LA 3ORKA 3GCUA 2XK3A 5AAGA 1YXVA 4BCPA 3OP5A 5LMAA 4O38A 4BKZA 3FMKA 5AAEA 4OTPA 3DOGA 4K11A 5IQHA 3JR1A 5HESA 3KVWA 3EN7A 4QQTA 2X8DA 2HZNA 5J7HA 1NA7A 2UW0A 2W0JA 4IAZA 2CLXA 2UZLA 3EYGA 4XHKB 2XVDA 4D1ZA 3DZQA 5KNJA 4I5PA 3PDTA 4U41A 2HOGA 5L4QA 1Y6BA 4IJ9A 4XV2A 5J5SA 1CKJA 4EWQA 4YPDA 4BDEA 3EN9A 2UVYA 4RWKA 3FPMA 2P3GX 1P2AA 3CTHA 3PIXA 3BKBA 3R71A 4C59A 1KSWA 2BZKB 3IO7A 4IBMA 4NJ3A 1P4FA 4QT1A 2VWWA 3SGCA 3IDCA 2B55A 1ZZ2A 3C51A 3H4JA 1G3NA 1H01A 3AT2A 2Z60A 2YLEA 2O8YA 4NIFB 3MI9A 5KO1A 4EJ7A 3PXRA 2X7FA 3VS4A 1HCLA 1W98A 1YQJA 2HY0A 4DFNA 1UNHA 3GU7A 2W1ZA 5CEIA 2OXXA 3IKAA 3QCXA 2XRUA 2E9NA 4YHJA 4M15A 3HUBA 3SOCA 3AXWA 4AOJA 5I3RA 2OK1A 4QP4A 4AZWA 4DA5A 1Z9XA 3QRJA 2C30A 2QKWB 3CPBA 3VS3A 4H36A 2C47A 3MJ1A 1NVSA 2ITWA 4FBXA 5CX9A 5AUXA 4EH7A 3UOJA 5DYJA 4E26A 2Y6MA 1JKTA 2XEZA 4BGGA 2NNWB 2WZJA 3R9HA 3FL5A 1PXIA 3VUDA 1B38A 3EMGA 4IVDA 1H4LA 4NEUA 3EFKA 5ETIA 3TXOA 3KF7A 5H3QA 3R7UA 5HCYA 3ZFYA 3MH0A 4QMWA 3VS2A 4FSQA 2R3NA 3U4UA 4AA0A 1PXKA 3ZYAA 5FXRA 3KQ7A 3GU4A 4M7IA 3DA6A 5EYMA 3Q2MA 4YBKA 2X6DA 3MB6A 4LV5A 5BYZA 4KBCA 1DS5A 4BCQA 4LOOA 5A14A 1ERKA 1JWHA 2R5TA 4D58A 4DTBA 3W16A 3WZUA 5CQUA 4AOIA 1LEWA 2XA4A 5HKMA 2XCKA 3CKXA 4AGWA 4TTHB 3LZBA 2XKFA 1K9AA 4KB8A 4TNBA 2VX0A 5DLSA 4X2FA 5AP1A 2UW8A 5FUTA 5AUWA 3W2PA 1BI8A 2UW4A 4CKJA 2BHHA 3A4OX 3L8SA 2PMLX 2O65A 2XNPA 4JG8A 5JZNA 4EQMA 5CXHA 1ZYSA 3ORPA 3VJOA 4RJ4A 5IKWA 1O9UA 3U55A 4IW0A 4BR3A 3F7ZA 3MA3A 1TQPA 2YCRA 3I5NA 5AR3A 2FUMA 3VS7A 3GU8A 4QMLA 3QQKA 1FPUA 4CKRA 2QOCA 4J95A 4KWPA 3UIBA 2CJMA 4DINA 5KKRC 2XJ2A 3FY2A 1H1SA 1R3CA 3I7BA 3L1SA 3ORLA 4ZLZA 5EM8A 4RLLA 3F3UA 2ITVA 1PMUA 4RC4A 4BCGA 2VUWA 4XP2A 5KKRB 4ZAUA 2C6KA 3BIZA 4WKQA 3CQWA 3GQIA 3NUXA 3U9CA 2NP8A 4H3PA 3NCGA 2JD5A 5CZIA 3FKLA 3D2IA 4AGUA 4YR8A 3D5WA 3CQUA 1W82A 3GCVA 4TYIA 5DGZA 3NZ0A 2VWVA 3W1FA 1YDRE 4L44A 4IZ5A 2JFLA 2DWBA 2RL5A 1OMWA 3FXWA 3EL7A 3QGWA 3ROCA 1IEPA 2QOIA 4BKJA 3LAUA 4P5ZA 4GG7A 5BVEA 2CKEA 4C8BA 4O0RA 4EYJA 4J98A 4MTAA 4HCTA 5CYIA 2QG7A 4EH2A 3EHAA 5J9YA 4K0YA 4M67A 2X9FA 1PKGA 3OCGA 4RG0A 3OFMA 3RI1A 5H2UA 2UZDA 3WZJA 5AP6A 2GNLA 3G33A 3A2CA 3LFFA 3UP2A 3T3UA 4WRGA 4PP7A 2O2UA 3A8XA 3PSDA 4MXCA 2OJFE 4L3PA 4HPTE 3MVLA 3C0IA 2WTWA 3L8VA 3PA4A 4YTHA 2F7EE 4AN3A 5IEXA 1WBNA 1P14A 3H30A 4ITHA 4KNBA 5AP3A 1YHVA 1MP8A 3CY2A 5CLPA 3VAPA 1OKWA 4IB0A 4IQ6A 3F3ZA 4Y46A 1QL6A 4Q9SA 2JIIA 3EL8A 4FTUA 3R2BA 3R8ZA 3RVGA 3V01A 5IQGA 3IOKA 3VBYA 3QLGA 3LLTA 5IA1A 2YERA 4RA5A 3NUAA 2V62A 2RG6A 3D9VA 5L2SA 3R21A 1CTPE 2J5FA 4WG5A 4CZTA 4RQKA 3PWYA 3VUMA 3HNGA 3PVGA 4LL0A 4GU9A 3E8NA 4UMQA 5M55A 5CI7A 4P7EA 1JVPP 4GK2A 5IDPA 2PZPA 4TPTA 4XBUA 4ANSA 3O51A 4BRXA 1SVEA 2QU5A 2WMVA 4II5A 3PXKA 2PWLA 3MA6A 3ET7A 3UGCA 2B9JA 2QONA 2YDIA 5ANEA 3VUIA 5CVGA 4BTKA 4EC8A 5LVNA 5HG5A 2PL0A 2JFMA 3U6IA 2BZIB 3PZEA 4EK8A 4FV2A 4D2VA 4U81A 4BN1A 3N4TA 4O2ZA 5CT7A 3NIZA 4NT4A 4DG3E 4E6CA 3PZHA 2JKQA 1OBDA 2X7GA 2XYUA 4O0VA 3E62A 4FV0A 4RZWA 2QLQA 4Z7HA 1V0OA 3EYHA 4FEQA 4BI0A 4CCUA 4FKVA 4GK3A 4O96A 3FJQE 2BTRA 4FMQA 5HTIA 3AC5A 2FB8A 3RM6A 4HVHA 2CGVA 4GS6A 4QYFA 5LMBA 2WMWA 4OTRA 3AD6A 3DKGA 4GK4A 4NTSA 4BCNA 4PUZA 3TDVA 3IG7A 3FC1X 4EONA 1OUKA 4HZSA 3DK6A 2WQNA 2EXCX 3IECA 4QRCA 5DHJA 5B0XA 2ITXA 3CR0A 4IDVA 3LXLA 4FV5A 4O7TA 1XWSA 4ACHA 4HJOA 2YLFA 5BVDA 1QMZA 2IW6A 5FBOA 3DB8A 4IB3A 4Y85A 4HVGA 4Y73A 3DLZA 4YTCA 4FTNA 4C3RA 2BFYA 3DAKA 3KMUA 2YM3A 3QZGA 3P79A 3JUHA 5DH3A 3KXHA 4USDA 4AZFA 3AOXA 4JAIA 3ACJA 3Q9XA 4XG7A 4EOQA 5HLNA 5EQYA 3ETAA 2VTHA 4IFCA 1KV1A 2Q0NA 4I6QA 4JAJA 5EFQA 4MF1A 4NFMA 5HE3A 4GVAA 3QCSA 3QWJA 1SYKA 4OTFA 4RIWB 3CD3A 4NCTA 4Z7GA 5DRBA 2OFVA 5IMXA 1W8CA 4KRCA 2H96A 2HELA 4WBOA 5FTOA 5JRSA 5IEVA 3EB0A 4OT6A 3W55A 4C7TA 1BUHA 3DXQA 4JS8A 2XNEA 4MD8E 4YZDA 4A9UA 5AJQA 5A3XA 3MH2A 3Q6UA 3GOPA 3QUPA 2ZAZA 1VYZA 5CEPA 1RE8A 4BCJA 2QO2A 2GU8A 3HV6A 5ANIA 2XNMA 4BCKA 1PF8A 4JBVA 4R5SA 5AP2A 4C02A 4E4XA 2QCSA 1OVEA 4M66A 3Q4CA 3ZSIA 3FY0A 4UWCA 1P5EA 3G15A 3QL8A 3SC1A 3ORTA 4PDYA 4BZOA 5G1XA 5JFXA 2HZ4A 3KU2A 5CAUA 4BCIA 1YXSA 2XNBA 4FTTA 4RFMA 4XG3A 5HHWA 5GZ8A 5TR6A 3AGMA 5HORA 3UTOA 5HX6A 4RT7A 4FGRA 4FTOA 2DQ7X 5L8KA 4HNFA 4FKQA 2W99B 3QQJA 4ACDA 1JLUE 3EN6A 4JOAA 3HDNA 4D1SA 4A06A 1AD5A 2GSFA 4IZYA 2R3MA 4UZHA 3DXPA 3COHA 4IAYA 4BDHA 4BTFA 4ITJA 4C35A 4ZSJA 3LFBA 2Y4PA 5M4CA 4MBJA 3KRLA 2HY81 3ZMMA 5EYKA 1M2QA 4BTMA 3RBWA 3BGQA 1ZYLA 2J5EA 4TWPA 5DE2A 4FKPA 1FQ1B 4QPMA 5HBEA 2PU8A 3UJGA 1VZOA 1FVVA 3NUPA 3R9NA 3ZO1A 3VO3A 3ZONA 2OXDA 3O23A 3FZRA 1RW8A 2VNYA 5L6OA 3ZC6A 2YIRA 3EQHA 5F9EA 4IWOA 5HO8A 2UW3A 4GFGA 5HVKA 3LE6A 4U8ZA 3Q96A 4GH2A 4PY1A 4G3EA 1BYGA 4QYGA 4WNOA 3ZO3A 5AWMA 3HUCA 4G1WA 5DRDA 4BDJA 2E9PA 5HCXA 4JG6A 3FSFA 1YOMA 5DR9A 4PDOA 4RX7A 3PXZA 4QQJA 4F9WA 3MS9A 4XG6A 4CMOA 2C5VA 2W1FA 4MX9A 4DEEA 3G6GA 4I94A 2W4OA 3UYTA 3PRFA 5AA8A 4RWJA 4I92A 3PY3A 5CU3A 3UP7A 4AT4A 4B99A 4CTBA 3ZBXA 3SG9A 4MNEB 4TXCA 3R7IA 3ZUVA 4TWCA 2OI4X 5FD2A 4NCTC 5AA9A 4JT3A 4L46A 2UZEA 2H8HA 2OSCA 4PNKA 5A9UA 1FMOE 3D5VA 3P7AA 4EL9A 3BHTA 4JVGA 4EKLA 4A9YA 5LXMA 5CU6A 4QYYA 2X1NA 1APME 5DNRA 3W33A 4DFLA 2XRWA 5AUUA 5I5ZA 3R1NA 2G15A 1XH9A 3QTIA 4UX9A 5GJFA 2YWPA 4NM7A 2GFSA 2WMXA 1U59A 4FTRA 4EHGA 4BWKA 4N0SA 4TN6A 2IPXA 3R30A 1GZNA 4TYHA 5EDPA 2P33A 3SW4A 3ZH8A 1VYWA 2F7ZE 5I9YA 3F3TA 4AWIA 5KBRA 3TKIA 2OWBA 2PVKA 2VU3A 5DIAA 3GCSA 1WBSA 2VO3A 1W83A 3DTCA 5HI2A 4RFYA 4AQCA 5C8KA 2ZMDA 4ACMA 3KEXA 3ZEWA 1H07A 4DH8A 1ZOGA 3MH3A 3DLSA 4RVLA 2NRUA 3DK7A 3VRZA 4CSVA 3R00A 3FLZA 2YWVA 4F09A 5TE0A 2VX3A 1UNGA 3HKOA 3VC4A 5BMMA 4HW7A 5L2TA 4DLJA 1FGKA 5FXQA 4ACCA 3D14A 1MUOA 3QXOA 3EQFA 4CT1A 5D7VA 3FI4A 4DITA 4UY9A 4CLIA 1XKKA 5CY3A 3PIZA 3QD2B 3KXMA 4AW5A 4R77A 3QBNA 2HK5A 2QOFA 5C27A 4ZSGA 4IANA 2GNIA 2QNJA 4XRLA 5CEOA 3KCFA 3S4QA 3VS6A 3ID6C 4FVPA 4G9RA 3R73A 3OWJA 4MXOA 5KHWA 3PSBA 4LI5A 4XBRA 3RAIA 4PMPA 4GKIA 3QGYA 1K3AA 2ITUA 3HVCA 4M12A 3QHRA 3FC2A 4DE4A 4YJSA 5M44A 3BHVA 5CAVA 4W4XA 3CPCA 3GC9A 3U51A 4E8AA 2W1HA 3HRBA 4HVIA 3F9NA 3LFEA 1Q4LA 3HX4A 4MEDA 2V7AA 5JGAA 5JEBA 5KUPA 1OGUA 3LCSA 5FDPA 4MD7E 2XEYA 5EYDA 3NW6A 4AU8A 3UZTA 2R3IA 3O8PA 2F49A 2J51A 1BL7A 3OBGA 5LOHA 3TM0A 1Q8TA 5F4NA 5IUIA 3MDYA 2WXVA 3LCDA 4AZTA 2YIYA 2YM4A 3CBLA 1XH4A 4QMTA 5I9XA 4OLIA 3RINA 3C7QA 2IVSA 1BMKA 1ZAOA 2CMWA 3KRXA 5FBNC 3ZDUA 3LFQA 2ZOQA 3RK5A 3U8WA 3QUEA 5IMEA 2YZLA 2CNQA 4CCBA 1PXLA 3HECA 3OT8A 3BGZA 2B9HA 5ANKA 4ZTHA 5M53A 1YXUA 2C6MA 3O8TA 3S0OA 5F20A 1YI4A 2WTDA 2W17A 3QTRA 3MTFA 3QTUA 5IG1A 4Z3VA 1PMVA 2XH5A 3AC8A 3P7BA 3U6JA 2EXEA 2XK8A 3P9JA 3TV4A 4AN2A 3FEGA 2O63A 3MJ2A 4RWLA 4CFMA 4KIOA 5C03A 1PXNA 2WKMA 3HA6A 5M08A 4K8AA 2WGJA 2IVVA 4CFWA 4U7ZA 1PXMA 2OFUA 3SLSA 2RG5A 2ZB0A 1RJBA 2ONLC 4JJRA 2UZOA 4UMTA 2ETRA 2PVMA 4GCJA 2XJ0A 2X39A 2IW9A 4GJ3A 4MH7A 5IISA 3NUUA 4U6RA 4NW5A 3DV3A 3KL8A 4JI9A 3ZRLA 4AG8A 4MQ1A 5AIKA 2WELA 3CTJA 5H8BA 5BPYA 3I5ZA 3NNXA 1OECA 2WHBA 5DVRA 4V04A 5GINE 2OZOA 4KBKA 4XH6A 5EOBA 2YM5A 2YIQA 5CAOA 4FIIA 2YM6A 4U43A 1R39A 4EKKA 3D83A 2W5BA 5HLWA 4IX4A 3LPBA 1OKVA 2OJJA 4G6OA 4XP3A 4ZS0A 4YP8A 1JSTA 1XBAA 3C4XA 4FVQA 3MPMA 3WIKA 4PF4A 3PJ8A 4M13A 4QPAA 4WA9A 3SV0A 4AZVA 4YLKA 5LCKA 3F88A 4AE9A 3CXWA 4IAKA 5A4EA 2GQSA 3SD0A 4U5JA 3C4CA 2UZVA 3PUPA 5J79A 4C2WA 2JDSA 3LVPA 3R9OA 4F7SA 3F5UA 5CSVA 4LRMA 1YOLA 2WMBA 3ERKA 4IE9A 2F7XE 1U5RA 2PY3A 5KZ0A 3HMPA 4FODA 3H9RA 2QURA 5HG9A 5B2KA 3KN5A 2BAQA 5HD4A 2RFNA 5CENA 5J7BA 2JBOA 3KA0A 5CALA 4RX9A 3T9IA 4P2KA 3AT3A 4J7BA 3PPZA 3CGOA 5IQBA 4W4YA 1VR2A 2YDKA 4FL3A 3VVHA 1QPJA 3PFQA 2OIBA 5BUEA 4G3DA 4JDJA 3VHKA 3Q5ZA 1H0WA 2QU6A 3FMLA 1G8AA 1XQZA 3LMIA 2CGWA 4ASDA 2RKUA 1F5QA 3ATTA 3NIEA 4BI2A 4R7IA 5FDXA 3V5QA 3O17A 4O1OA 4DTAA 3EWHA 3MSSA 3EQBA 3KXNA 4NZWB 1OI9A 2NRYA 3DB6A 3MBLA 4DEIA 3MFSA 4FSRA 1XBCA 4WIHA 3NVMB 3TJDA 3DCVA 4O81A 2WQMA 2PE0A 3PP0A 3QRKA 3BI6A 1OPKA 2PMNX 1R78A 4DH7A 2IZUA 3KULA 4ZSEA 3L8PA 3LCTA 1VJYA 5I0BA 1JKLA 3P7CA 2R0IA 3DDQA 3E7VA 4FTMA 1UNLA 4YHFA 5E8UA 2EU9A 3BZ3A 4H39A 3C50A 3AT4A 2QO7A 3PTGA 4XNEA 2VWUA 5I9UA 4FTLA 3DNDA 3W18A 5E1SA 1QPEA 4FKTA 4Y83A 5LVPA 4ORKA 4LGHA 1EH4A 3F6XA 5LWNA 4UMRA 4KD1A 4NW6A 1BKXA 4U0IA 5DT4A 4ZTSA 3F3VA 5HU3A 5EOLA 5GHVA 4FZFB 5BQ0A 2PVHA 5DR6A 3V8SA 4AT3A 3TIZA 4JBQA 4D9UA 2GMXA 4O0XA 3S2PA 4YZCA 3V6SA 3P5KA 4YTFA 1SNUA 4TKSA 1R0EA 2UW9A 1UU9A 3LCKA 5ANJA 4YSMA 4FTIA 4M3QA 3BHYA 4YNEA 2JEDA 2PUNA 1NW1A 5J1VA 3RZBA 4D2WA 2OG8A 3OTUA 3L9LA 5E8XA 3W2SA 1NVRA 4C36A 5B2MA 3GCQA 4M69A 4DEGA 2XKDA 2IG7A 4XP0A 4J8MA 3TI1A 2X81A 2FSTX 2C6EA 3B8QA 2YFXA 3CLYA 3G6HA 3R7GA 4RJ8A 4WRSA 2Y4IB 2WMAA 3OUKA 4YLLA 4FIEA 3D5UA 3TUCA 4R3CA 2YJRA 3M42A 4BIBA 3PY0A 5DR2A 2VD5A 3Q4ZA 2ZM4A 2WMTA 5D41A 4JL9A 3THBA 4EHEA 4BBEA 4ERKA 4FV6A 4KINA 1Q8UA 4IM0A 2EB2A 2W5AA 4W4WA 2W05A 3SVVA 3VWAA 1A9UA 3R7EA 2VTRA 3I0OA 2B9FA 4W9WA 4ZEGA 4L53A 3D15A 3H9FA 5HIBA 3NYOA 2REIA 2WU7A 1IG1A 5IQDA 2YABA 3VS5A 5BUJA 5KMJA 2W7XA 3VN9A 5M51A 3GOKA 3CSVA 4EH9A 4FKSA 1WBTA 3LIJA 3UIMA 3UIUA 3G9LX 3R04A 2VZ6A 2W1IA 3R2YA 4I41A 2R3QA 4IWPA 3R8PA 4CGAA 4GG5A 4N4SA 3LXNA 1Q97A 3V04A 1ZYDA 3FLYA 1M17A 3ZSHA 3PJ1A 1GIJA 3Q4TA 1J1CA 3TNQB 4BYJA 4EOIA 2O5KA 4FI1A 4BVUA 4ERWA 3OOMA 2R4BA 3ZDIA 5AR5A 4PDPA 2OJGA 2BKZA 4JDHA 2PTKA 4BZNA 2IO6A 3WZDA 3UQCA 5IEYA 3DAJA 2BCJA 3W8LA 4BC6A 5EDRA 5CSXA 1Y91A 3CTQA 1XH5A 3HMIA 4WNKA 1KE9A 3SQQA 4BL1A 1PRYA 4D5HA 3R9DA 4L67A 2QOBA 2XK6A 3DKFA 3FWQA 4L7FA 4XG8A 2IN6A 3PG1A 2Z7QA 4M14A 4FT9A 3OCSA 1V0PA 1LPUA 2X4FA 3DDPA 4QD6A 2EXMA 5IPJA 2G2IA 2VWYA 2F4JA 3PJ3A 1J1BA 4EJNA 5LARA 4D4YA 2ACXA 3KVXA 3A7GA 4MNFA 2WOTA 5D10A 1DM2A 1PKDA 2GHMA 4RIWA 2BR1A 4AX8A 2JC6A 2JDVA 2BUJA 2WQBA 3A61A 3OD6X 4LGDA 2EVAA 4UYAA 4WOVA 2UZBA 3JVSA 4U40A 2VTQA 1YVJA 5EQEA 3TZ7A 2HZ0A 2R9SA 2ZDTA 3GU6A 2ITNA 4FT5A 3TG1A 4EH4A 2BKKA 2BIKB 1IR3A 4OTWA 2C3KA 3FMDA 2X2KA 3EQCA 3FMNA 2YIXA 3KMMA 3BLQA 3WI6A 3FZ1A 2Y6OA 3WZEA 2PZYA 4F9YA 5IUGA 3DJ7A 5KBQA 3BU6A 2ZV8A 2P55A 3VIDA 3HA8A 2ZV9A 2VTMA 4BCOA 3B2WA 3JS2A 4NJDA 4WNMA 1I09A 3C1XA 5J1WA 3SKCA 2CNVA 1H28A 4WG4A 4XLIA 4FOCA 3W10A 4WD5A 4LMUA 2QR7A 2PVRA 3ZM9A 2VO0A 3UZRA 1H08A 4DH5A 2KTYA 2ZM1A 4FSTA 4PX6A 5AIRA 1GNGA 4FNZA 3QTXA 4G2FA 2RF9A 3CS9A 4WHZA 1H25A 5BVNA 4DBXA 3OT3A 1Q3DA 2I0HA 4RVKA 3O96A 3VHEA 4CZUA 3BEGA 1NXKA 2B53A 2ITQA 4W8DA 3LFCA 1H27A 4WNPA 4QMMA 4Y5QA 4ZY4A 3OS3A 4DFUA 3CJGA 2ETMA 2VTTA 2A2AA 2X9EA 3IW8A 2BIYA 2C0TA 3JYAA 3R1SA 4NKSA 4QP1A 4TNDA 3ZLXA 4DGGA 1OZ1A 2C5XA 5EW3A 4EH8A 2I7QA 1IAJA 3VUHA 2WO6A 1H0VA 4QPSA 4BWXA 1PYEA 1URCA 3HRFA 4PMMA 3QALE 2XIXA 4LFIA 3TV7A 3CY3A 2FSMX 4E5BA 4MXYA 3C5UA 1Q8YA 1CDKA 2A27A 5TT7A 3LXPA 4FSNA 5EHOA 4F65A 4A4LA 1MRVA 1ZYJA 5F95A 5AX3A 4ANNA 3A7FA 2HZIA 5AV1A 2V5QA 2VWXA 4ZZOA 5AR4A 3RK7A 4QP8A 1Y6AA 1YW2A 3PVWA 4QMQA 1FVRA 3E7OA 3QKMA 1OL2A 2ZJWA 2ITPA 4X6RA 2C5NA 3H0ZA 4FEXA 3Q53A 2PVLA 1LR4A 2W5HA 4ZZMA 1KE8A 2DYLA 3V5WA 2A19B 3WF7A 3LLAA 3Q6WA 1PMNA 3R7YA 5E9EA 1WBVA 4UWYA 3ANRA 4H1JA 3NNWA 2CN8A 4EZ3A 3FLNC 2QR8A 4RLKA 5BVWA 3VQUA 3P4KA 4IFGA 3VUKA 3GGFA 3BLRA 5JFWA 1AQ1A 5IA0A 4MQ2A 5EI6A 5M07A 3L9NA 2HIWA 3VQHA 4G31A 3WZKA 3JPVA 4ITIA 4ARKA 1Q3WA 2W96B 3I7CA 4FT0A 3RK9A 4HGEA 2EB3A 4PMSA 4TRLA 4FL1A 3UG1A 3AD5A 4GFOA 4ZZNA 5H8GA 3PXYA 4FYOA 3BYMA 3F7WA 4EK3A 3MY1A 4GT5A 2IWIA 1KWPA 4OTHA 2HXQA 3RGFA 4BTJA 5EKNA 4BCFA 5BNJA 5IQAA 4AW0A 4FC0A 1ZOHA 4C58A 4X2NA 1G8SA 4A7CA 4JQ8A 4YTIA 3K3JA 4ZS4A 3NR9A 2PE2A 2WTJA 3FAAA 4YPSA 4BKYA 2Y0AA 4FV1A 3QFVA 3QRUA 4XEYA 5HO7A 3G0FA 3KMWA 2XBAA 4EBWA 5BX0A 3KCKA 4CEGA 3S00A 3FQHA 2PK9A 2QG5A 4CQEA 3JVRA 4OR5A 3FPQA 3LQ8A 4FKLA 2WQOA 3WYXA 5DOSA 3EOCA 4FZDB 5T3QA 3TV6A 4B6LA 5LQFA 1QPDA 1JAMA 4G5JA 4O7RA 2VTPA 4RC2A 2JDOA 3P0MA 2UZWE 4NH1A 3B8RA 4TYHB 3F5PA 3TNPC 1S9IA 5I3OA 1OM1A 4EUTA 2VWZA 2B0QA 4S34A 4AACA 5F94A 3NYXA 3ZO4A 4DH3A 1GZKA 3JXWA 3TWJA 4CFNA 4V05A 3NLBA 4YC8A 3A4PA 5C8NA 4JIKA 4ANOA 3EQGA 1UU7A 5IH4A 1UA2A 4O0WA 2RFDA 1ZMVA 2OH4A 4RFZA 4MVFA 4XX9A 3SHEA 3I6WA 2HCKA 4EUUA 4O83A 3I1AA 2LGCA 1UKHA 3IW6A 2GFCA 3ZEPA 3MVJA 4JR7A 1YHSA 4JBOA 2HXLA 1KV2A 4LOPA 5CF6A 2VN9A 2PVFA 4J96A 4U44A 5IUHA 3QKLA 1STCE 4QP3A 4NUSA 3FZTA 4IWQA 4EWHA 2IZRA 3IQ7A 4YZMA 5M4IA 4XRJA 5TF9A 4BIEA 4DGOA 3MPTA 5FXSA 3A99A 2OXYA 2G2FA 4GIHA 4QMYA 3UPZA 2JBPA 5HEZA 3AMAA 4GW8A 2GHGA 3KN6A 3TKUA 2PUIA 5HE1A 1JSUA 2QO9A 4QMNA 3R0TA 3AMBA 4ZJIA 4F4PA 2CSNA 2Z7LA 5IU2A 4IXPA 3FKNA 5IQIA 3VUTA 4EI4A 3BEAA 3OC1A 4QTBA 4OBOA 4QP2A 3GC0A 1OKZA 2XK9A 3ORZA 3QYWA 5HICA 5ACKA 1UU8A 3QRIA 1ZYCA 2J0LA 4AFEA 2JDRA 4NK9A 4FIGA 3F5GA 2ETKA 5KMLA 3CGFA 3UMXA 2B9IA 2CHLA 5A4CA 2XNGA 2O3PA 1DI8A 2AC3A 1PMEA 2ZV2A 4FEWA 1J7IA 4HYUA 4O0UA 4ZMEA 3ZU7A 2DS1A 3WF5A 5I9ZA 3PPJA 1RQQA 4I22A 4Y95A 3DKCA 4YC3A 3RPVA 4NFNA 4JQEA 4E6AA 4Z16A 5JKGA 3BYVA 1KOBA 3F61A 5AUYA 4DFYA 4JG7A 3UO4A 3VBQA 3N9XA 4WG3A 3SW7A 1U54B 3RTPA 4ACGA 5JQ8A 2AYPA 4AZEA 5EKOA 3ATSA 1BX6A 4C61A 4HPUE 3I0QA 5K0KA 4CMTA 5GIOE 1JBPE 1CM8A 2QOHA 2R3HA 3RZFA 3GU5A 4GT3A 3DGKA 4PV0A 4X2JA 4Q2AA 4F6WA 2QHMA 3IOPA 3P1AA 3ZS5A 3E88A 1Q8ZA 3LHJA 4RVTA 2C6OA 4CYIA 4L68A 3V5TA 1M2PA 3MYGA 4FKRA 2XIRA 3GENA 4FIJA 4Y5HA 1NY3A 4IX5A 3GT8A 4QTCA 3PVBA 4OAUC 3NW5A 4L6QA 2P4IA 3EJ1A 3SG8A 3RCDA 3TJCA 2ERKA 2XIKA 1ZXEA 3RMFA 1JKKA 3AD4A 4FV4A 4QMUA 2I0EA 3A7JA 2JAMA 3TUBA 2UZUE 4ANLA 4IVBA 4OUCA 2GNHA 5ITAA 5IA4A 2RGPA 5K5NA 4D4SA 2WIHA 4ALWA 2XNOA 3A8WA 3HMNA 3W2CA 3Q3BA 3FMMA 1YOJA 2VGPA 3DY7A 3HYHA 3CC6A 3KXXA 4NTTA 5AUZA 5HLPA 2J0IA 4G9CA 3UMWA 2HENA 4DFZE 3BE2A 2WEVA 2UV2A 3E5AA 3KC3A 4YO6A 4ENYA 4L45A 4EOKA 5KMOA 2R3PA 3RCJA 1JSVA 1Z57A 2C3IB 2PE1A 5FWKK 4FOBA 3ITZA 4C4HA 4O0YA 3FI3A 4BB4A 3BLHA 4TW9A 3W2RA 3SRVB 3UG2A 4BDDA 3JY0A 1DAWA 1Q8WA 3EN5A 4YLJA 1IA8A 4L3JA 1FVTA 3UNKA 4O0TA 4EORA 2PUPA 3GP0A 4CFXA 2WU6A 4BF2A 4FV8A 2GNFA 1FGIA 4HVSA 1XJDA 3ZO2A 3VW8A 3EQPA 3ORMA 3QTSA 1YWNA 2CGXA 3FMHA 3GC7A 4QTAA 2QHNA 1YKRA 2B1PA 4LG4A 3R8LA 3R8UA 2XM9A 4DG2E 3UVQA 4H05A 2XS0A 3WILA 4DGLC 3O0GA 4JX7A 3TZMA 1KE7A 4JIAA 3E63A 4IX6A 5CXZA 1OPLA 1U54A 4QMVA 4FSYA 4IAAA 2J0MB 4U97A 5HVJA 4A4XA 3G0EA 4ID7A 2YZAA 4FTAA 4FZAB 4JDIA 5HIDA 1FOTA 4ASEA 3EQRA 4Z9LA 3R7OA 4UN0C 3PLAE 4R1YA 4KSPA 4O7NA 4F7LA 3UO5A 2ZV7A 3TDWA 1B6CB 3QUDA 4H58A 5K9IA 4G34A 2XBJA 4KRDA 3OXTA 4NKAA 3GFEA 4DH1A 4J97A 4MXZA 3R8VA 3MFTA 3QD4A 2BFXA 5AV2A 2HYYA 2R3OA 4IM3A 3OOGA 2PMIA 4TWOA 5K4JA 5LVLA 4CRSA 5FEQA 3H3CA 4YU2A 3QD3A 4F0IA 4MBIA 4U3ZA 3DAEA 3TTIA 2PSQA 2V22A 3G2FA 4B7TA 1GIIA 2GS2A 4I0RA 3HV3A 3PXQA 4X0MA 5AAFA 2CCHA 3RWPA 3VBTA 1OKYA 3OVVA 4FVRA 4MAOA 2PVNA 4L8MA 2J6MA 4FUYA 5IA2A 4BBFA 4LL5A 3P78A 4QMSA 4CRLA 3Q4UA 1XBBA 1WCCA 4IX3A 5I9VA 4PRJA 2AC5A 1A06A 3FKOA 4EZ7A 4C37A 4O7VA 4DGNA 4ENXA 5AFVA 3OWLA 3QQUA 4JLCA 3ZLSA 5HVYA 1JOWB 1CSNA 3DU8A 4KKHA 2I40A 2R64A 3DBDA 4L01A 2OO8X 4USEA 5FM3A 3R6XA 2OF4A 4CFUA 3HDMA 2XB7A 4BHNA 1GY3A 2HW6A 1IASA 4F9CA 4OAVB 5HQ0A 3KK9A 4FUXA 4EHZA 3F69A 2W9ZB 3PVUA 1J7LA 2NPQA 2YCQA 3VBXA 3VJNA 4GU6A 1HCKA 4QYEA 4I6FA 4DEAA 3QX4A 4QNAA 2WMSA 3TEIA 4MWHA 3ZTXA 3ANQA 4K33A 5B2LA 2GQRA 3KK8A 5I9WA 2GTNA 4GMYA 3TTJA 4AZSA 3C13A 4IM2A 4XUFA 4ZLOA 3VF8A 3QTWA 2XMYA 4TYJA 1HOWA 2YCSA 4ZSLA 5JRQA 5L6PA 4PP9A 3AQVA 3CJFA 3HP5A 5FEDA 4V0GA 5K0XA 3KREA 5E1EA 5DPVA 4BDIA 3WF8A 4HGTA 5ACBC 3FZPA 2YJSA 3FV8A 2B54A 4ALUA 2R7IA 4EOLA 2I1MA 3UC4A 2JGZA 3M1SA 4H1MA 4L3LA 5CEMA 4AOTA 5JMSA 3TNIA 3EZRA 4WSYA 4F6UA 3BU3A 3ZFMA 5IA3A 1OIQA 3OHTA 1M52A 5HNBA 1KUTA 4AF3A 3WE8A 5A6OA 3OZ6A 5F1ZA 4MKCA 5L8JA 4D2TA 3RNIA 2J4ZA 5HE2A 1GAGA 5EW8A 4CT2A 4O7WA 4K18A 3QXPA 2R0UA 5HE0A 4K9YA 1W84A 2I6LA 4C4JA 2C6LA 3HEGA 3DZOA 4IB1A 5J87A 4USFA 3KULB 3ZRMA 4F0FA 2YM7A 3QC4A 4AS0A 4F08A 2JKMA 2DUVA 4FGBA 3D0EA 4G3CA 2QOLA 4CV8A 3MY5A 2GS6A 1H26A 3QX2A 4BDGA 5AADA 1URWA 3V5LA 3L9MA 1RDQE 5HD7A 4F7JA 5ETFA 3FXXA 4G5PA 4C3FA 3N4UA 3BX5A 3I4BA 1A48A 4FT7A 2P2IA 4PL4A 5IQCA 4FYNA 4DT8A 4DEBA 1QCFA 2BAKA 2P2HA 3MV5A 3KF4A 1FMKA 4BDAA 5E4HA 4I5MA 1UKIA 5AP7A 3GXLA 2YAKA 1ZMWA 2YAAA 4AAAA 2XF0A 4PQNA 1VEBA 1UWHA 1H1RA 3FYJX 1SNXA 2W06A 3A62A 4EK4A 4J1RA 1REKA 3FLQA 4QMPA 4U9AA 5C4KA 1GIHA 3DQWA 3F2NA 5JZJA 3R9RA 2FO0A 4RIYB 3C5IA 2OIQA 4N6YA 4WUAA 2CKPA 3NX8A 5IQFA 5HG7A 3QRTA 2V7OA 5LWMA 3D7TB 3WOWA 5A4QA 4UZDA 5GZAA 2G1TA 4FNWA 4GIIA 3G90X 1WBOA 2OJ9A 4IWDA 2OIDA 4FNXA 3LFAA 4LUDA 2R3KA 4ANBA 3QKKA 4UB7A 2BDWA 3LCOA 3K5VA 5K4IA 4IZAA 5A46A 2VAGA 4I1ZA 3BE9A 5KX8A 4R78A 1SZMA 4AT5A 4LM5A 2B4SB 3BU5A 4YZ9A 2VTSA 3Q9WA 3PJ2A 5BVKA 4RIYA 3P08A 3E87A 3PWDA 4DAWA 3R1YA 2OICA 3P86A 5DI1A 3UZPA 2XP2A 3ALNA 3HL7A 4O2PA 4DFXE 4ZTMA 5D11A 4I20A 1UV5A 5EG3A 3LJ2A 3GVUA 4AXAA 3PYYA 3MTLA 1IAHA 3TNWA 2BRNA 2BHEA 3PSCA 3BWJA 4JNWA 2A4LA 1Y8GA 3K5UA 4KSQA 2CKOA 2F9GA 3BBTB 4DN5A 3QQLA 3LJ1A 4FKGA 5KMNA 3OROA 3U87A 4OTIA 4O86A 2X6EA 4RQVA 3ZLYA 4FG9A 4CKIA 4EQUA 5L2WA 4MF0A 3A60A 4PTCA 4U42A 2Z8CA 1TVOA 1KOAA 1F3MC 4HGSA 2XK7A 1TKIA 2C1AA 4EH5A 3EQDA 1R0PA 5DBXA 1GZOA 5DA3A 4BYIA 2CLQA 5CU2A 2VX1A 4NU1A 4GSBA 4AUAA 2VTJA 4O6EA 3T8OA 2R2PA 3VRYA 3KRJA 3DFAA 5C01A 3T3VA 4BCHA 4L7SA 1PW2A 2BRBA 3E8DA 3IW7A 4W4VA 3G5DA 3FMJA 3I79A 4B8MA 3RPSA 4C4GA 3TZ9A 5C4LA 4Y72A 3PP1A 2C1BA 4X3FC 5CWZA 3UOKA 3W32A 4JQ7A 3FI8A 3DS6A 3R22A 4L43A 4JXFA 3RJCA 1GOLA 4U79A 4DG0E 5FQDC 4TYEA 3VS1A 4HYHA 2WMQA 4KKEA 3MWUA 4WBBB 5HG8A 3KRWA 4PL5A 4B8LA 4X2KA 4X2GA 4YJUA 2IZTA 4EOOA 2WMUA 4FZ6A 2C4GA 4TT7A 2C69A 2E2BA 5HGIA 3RKBA 3UPXA 5IQEA 5B7VA 4EOMA 2C68A 3MIYA 4O7SA 3II5A 4DHFA 4CG9A 3F82A 3MVHA 4CMUA 4O7YA 3CIKA 4WT6A 1CKIA 4CLJA 5ANOA 5GJGA 3F5XA 2GNJA 1O6KA 4PNIA 5JN2A 4D2SA 5FRIA 3POOA 1YXXA 3FSKA 3FL4A 5HO6A 2Z7SA 4BDBA 4XYFA 5D7AA 1U5QA 4ZOGA 3FXZA 4FK3A 4HCUA 3T9TA 3UNJA 4NM5A 5JSMA 3LQ3A 3QF9A 1P4OA 5A4LA 4C34A 3F2AA 5CZHA 3CQEA 3NMUF 1H8FA 5FP5A 3OW4A 2ITZA 4DTKA 5BYYA 4XJ0A 4AE6A 4S33A 5CS6A 4CG8A 2XIYA 2XIZA 4WSQA 4FR4A 2JKOA 5AR8A 3RALA 4FG7A 4YZBA 4FV9A 5KE0A 3AC2A 3QQHA 3KXGA 2QVSE 3BQRA 2O0UA 3QCYA 5HOAA 3UQGA 3P23A 5J95A 3ZSGA 2NO3A 3O7LD 2V0DA 5CVFA 4D55A 4NSTA 4XOYA 4D2PA 4ZY5A 4F6SA 3S1HA 3PJCA 4C38A 2CGUA 4QTEA 4FT3A 5D12A 3VULA 3CEKA 4I5HA 5FEEA 1OIRA 2R7BA 4A07A 1WBPA 4RJ7A 4BDKA 4FG8A 5E8ZA 4RWIA 4C57A 4YO4A 4M69B 4R7HA 3LMGA 1F0QA 3WBLA 1DI9A 4EHVA 4QP6A 3PE1A 4NWMA 2VTNA 2WOUA 2OH0E 4O6LA 1X8BA 4DGMA 4GYIA 3OUNB 4PTEA 4CVAA 3DQXA 3E8EA 4TL0A 4IDTA 2JKKA 1ZLTA 5E8SA 4DLIA 3E8CA 3AC3A 3AMYA 3VBWA 4YUQA 1SM2A 1UVRA 2GTMA 3EH9A 3OWKA 4RX8A 4XV9A 3RAWA 4RX5A 3ULIA 5GZ9A 3CP9A 4I0TA 3FDNA 4FEVA 2WD1A 1BLXA 3PE2A 4E1ZA 5EI2A 5DEYA 2YDJA 3W8QA 1LP4A 3RPOA 4OTQA 5I4NA 3D2KA 5JGBA 3NGAA 4APPA 3IONA 4DCAA 4I93A 4EOPA 1JNKA 5BVOA 1WAKA 5JGDA 1GZ8A 4MHAA 5E8VA 3V3VA 5L3AA 2WNTA 3MIAA 1JQHA 3F2RA 2X0GA 1T46A 4CQGA 4FTKA 2JDTA 3MPAA 4FA2A 2VRXA 4JBPA 1OB3A 5AR7A 4ZIMA 1J3HA 4JR3A 4JX3A 4UV0A 4OW8A 1FINA 4IACA 3V51A 5EH0A 3FBVA 4GYGA 2LAVA 1Q61A 1PXPA 4KKGA 3HV5A 3KFAA 3K54A 3R01A 5E8TA 3HV7A 4HYSA 1TQMA 2PVYA 2VTOA 5E90A 2BROA 4O27B 1QPCA 5DMZA 2YACA 5GNKA 4EH6A 2ITOA 4EEVA 4KABA 3SXFA 4EYMA 5DWRA 4N57A 3COMA 4E4MA 3V5JA 4O1PA 3COKA 3ZLWA 1PJKA 2WAJA 2G01A 4IVCA 4A9SA 4I6HA 4GVJA 3TT0A 3E3PA 2ITYA 4CNHA 4R5YA 1E1XA 3ODZX 3R63A 2W4JA 1E9HA 2PZ5A 3EZVA 4CD0A 4ZXTA 5A6NA 2XKEA 3DKOA 3PXFA 4GEOA 1BI7A 3BCEA 3FLSA 3EQIA 4MNEA 2XCHA 5D9HA 1M7NA 3RM7A 3TIYA 3ZRKA 5TKDA 4BZDA 3SA0A 4BY9E 5HBJA 3UOHA 3LOKA 2CPKE 4YZNA 3L8XA 5AV4A 5J9LA 3FQSA 4QQ5A 3IK3A 4KA3A 3Q9ZA 2OZAA 4FSMA 3OCTA 1H1QA 4K6ZA 4YJRA 4OTGA 3M11A 4J8NA 3RHXA 3DT1A 3UDBA 4S31A 2WEIA 3ENHA 2PYWA 1PXOA 4M8TA 4GT4A 3IDPA 5FTGA 4IHPA 4UWBA 4FKWA 3QQFA 1U46A 4RIXA 4Y8DA 4XMOA 2GHLA 4RVMA 4RC3A 4RMZA 1H1WA 3NEWA 3NUNA 2ERZE 2Y7JA 3D7TA 4D0XA 4MCVA 1KE6A 4ZLYA 4XG4A 2WMRA 5G6VA 3UBDA 5CVHA 1OIYA 2X2LA 5J5TA 1MRYA 4FF8A 4PPAA 2CN5A 2C5OA 3MFUA 4IZ7A 2ITTA 4CTCA 5IF1A 3U54A 1Y57A 3U6HA 4R6VA 4BICA 4GUEA 4QP9A 5A4TA 1YHWA 3UVRA 5EI8A 3KXZA 2KULA 4GFMA 4DBNA 5LJJA 5CF5A 2X8IA 5BMSA 4E3CA 3O71A 4BGHA 1NVQA 2C6IA 4X3JA 4E5AX 2VTIA 2ZM3A 5CSWA 2UW5A 3OEZA 5FM2A 3WYYA 4G3FA 4E4LA 3NNVA 5K3YA 2QLUA 4KIKA 3O2MA 3QU0A 2IW8A 4IAFA 4ASXA 2GQGA 3ORNA 3Q52A 3IW4A 2IVUA 2VTAA 2J9MA 3QCQA 2QODA 5AV3A 2J0KA 1YWRA 3PA5A 4M0ZA 4EK6A 3E3BX 4AA5A 4AFJA 3H0YA 4DYMA 4Z55A 2QQ7A 4BGQA 4RBLA 5E92A 4RIXB 3ZFXA 5AUVA 2HWPA 2WTCA 4XS2A 2UVZA 4PTGA 3UQFA 2BDFA 3A7IA 3BYUA 4S2ZA 4O91A 2PVJA 2ZYBA 3BBWA 3NDMA 4FTJA 3OF0A 5ICPA 4KS8A 5FP6A 1Q41A 2W1EA 2W1DA 2C6DA 4CFFA 5JT2A 2H6DA 3UOLA 4G6NA 3NUSA 3N4VA 4RIOA 3PLSA 3FHRA 4D1XA 1XR1A 1CKPA 3IPHA 2R3JA 3V8WA 2QOKA 1Y8YA 3ZZEA 1G5SA 3M2WA 3BRBA 2P0CA 4LUEA 3NSZA 4E6DA 4MK0A 1OPJA 5C26A 3GB2A 3QLFA 3EFWA 2UUEA 1YI6A 3NRMA 4D4VA 2GPHA 3V8TA 4UMPA 3C9WA 3DTWA 1MRUA 4KS7A 2BALA 3Q32A 5HBHA 2OJIA 5C8MA 3BWFA 1V0BA 5AUTA 3CD8A 3GQLA 1IA9A 5LMKA 5HNGA 3LM0A 4F1TA 3EKKA 4NIFA 3ZHPC 4Q5HA 2BAJA 3BHHA 2X4ZA 4WO5A 4F1OA 4D2RA 5IH6A 3I6UA 4O82A 3D5XA 1OL6A 3IGGA 2OZAB 2FSLX 4FV3A 4M84A 4QOXA 1W7HA 5EQPA 4QTDA 4ONAA 2E9OA 2YEXA 5E8YA 3KGAA 4J71A 4F1MA 2J50A 2BDJA 3G9NA 4F99A 4MD9E 5KHXA 4AN9A 2OU7A 3W2QA 4BFMA 4EQCA 5IA5A 3ZUUA 2XUUA 3LFNA 5AR2A 2UVXA 4EC9A 3MY0A 3OY1A 5FGKA 4HGLA 4K1BA 3LJ0A 5AX9A 3REPA 4QYHA 3NVKI 3HMOA 4NYEA 4I4FA 4N6ZA 4O0SA 1YDTE 2I0VA 3DNEA 4Q5EA 2CDZA 4HOKA 5TO8A 5M4FA 3WE4A 3HAMA 4MYGA 4EBVA 1KE5A 3S3IA 1UWJA 1ZY4A 2VGOA 2VO7A 3NAXA 2YITA 4TZRA 5CANA 3C4EA 5EW9A 5LVMA 5CSHA 3HP2A 3VNTA 1ZOEA 5JFVA 3BQCA 3QTZA 4IC8A 1LUFA 1W0XC 3HRCA 4O22A 2G2HA 4IADA 4ZK5A 4OTDA 5A54A 2R3LA 5CTPA 3QC9A 3R7VA 4AA4A 5BUIA 1ZMUA 3B2TA 2J0JA 4OT5A 4PMTA 4PL3A 1OIUA 2C0IA 2ONLA 3VS0A 4FKOA 4D5KA 1H1PA 3IDBA 4FTQA 4C3PA 1UU3A 3ENMA 5ANGA 4Q9ZA 2WB8A 3BELA 3GCPA 5C1QB 3EN4A 1J7UA 4E73A 3UODA 3LM5A 1REJA 3MB7A 2A0CX 2RFEA 5AM7A 4ZTQA 3SXRA 4I5CA 2R3RA 2GS7A 3ALOA 2WPAA 3QYZA 3U9NA 3PY1A 1J91A 3R1QA 4X3FA 4P90A 4BWPA 4F9BA 5T6KA 2Z2WA 3CKWA 3ULZA 2W9FB 4D9TA 3ODYX 3IGOA 3EIDA 2HW7A 3OW3A 4U80A 2ZB1A 4I23A 4FKUA 5H8EA 4YJVA 3BHUA 1T45A 4UXQA 5CT0A 5CU0A 2VNWA 5CU4A 4DEDA 3TNHA 1L3RE 4FKIA 4UALA 3GC8A 4JRNA 5DFPA 3DK3A 1BL6A 2WIPA 1O6YA 3POZA 1WFCA 3DBCA 1ZY5A 2BRGA 3OG7A 2J7TA 3C0HA 4IEBA 3N51A 2OKRA 4D0WA 5AM6A 3K2LA 4XLVA 4I6BA 4MXXA 5H9BA 3LFDA 3NWWA 4I0SA 1V1KA 1PY5A 3PPKA 5KZIA 3FZOA 3KY2A 5JK3A 5DT0A 3UE4A 4BBMA 1WVXA 2JIUA 4FIHA 4KAOA 2XK4A 4D28A 1WVWA 2XKCA 4NL0A 2Y8OA 1ZRZA 3Q60A 4V0GB 2B52A 3WIGA 4CXAA 3OTVA 3EFJA 4G6LA 4A9RA 4RA4A 4O84A 2HAKA 3HLLA 4OBQA 4B9DA 1XH8A 4EZ5A 3RPRA 4CZYB 2OF2A 1PXJA 4TYGA 4LYNA 3ZUTA 4MXAA 2W1CA 4DEHA 2QKRA 2WTKC 1H24A 4ZTRA 2CKQA 3DBFA 5CI6A 3VW6A 4DCEA 1SVHA 4UEUA 5HIEA 4OBPA 3W2OA 5C9CA 3Q2JA 4G16A 3O50A 1O6LA 2C5YA 4HNIA 4YBJA 4C0TA 3PIYA 4E4NA 2WTKB 4K2RA 2ZVAA 3LW0A 2XZSA 4L42A 3BYOA 3KRRA 3MN3A 3WF9A 3FMEA 2HWOA 2CNUA 4XV3A 4E6QA 4O7ZA 5HNIX 2X8EA 3RPYA 2H9VA 1SVGA 3Q04A 4TY1A 5CSPA 2F2UA 4R1VA 2C6TA 4XV1A 4H3QA 4JRVA 3KB7A 4YC6A 4C4FA 3OXIA 4YURA 1OITA 5HTCA 5JH6A 1OL7A 3PG3A 2BZHB 4A9TA 4RGJA 2C3LA 3QQGA 4TWNA 3CCNA 1PHKA 5JFSA 5KMKA 2IJMA 3ELJA 4J99A 5ETAA 3U4WA 4FSZA 2PHKA 4EOSA 4UXLA 3Q9YA 3VBVA 3BPRA 2VO6A 4F64A 4RPVA 2YA9A 4MWIA 4DT9A 3GFWA 3EFLA 3C4WA 1WVYA 2JLDA 2QC6A 3NUYA 2CCIA 5DG5A 5T68A 5HX8A 4AP7A 3E93A 3SOAA 2OLCA 3FLWA 3LKMA 4IVAA 5M09A 1S9JA 1LEZA 3NNUA 4IIRA 4PDSA 4YSJA 2UZNA 3MW1A 2I0YA 3OWPA 4D4RA 4QO9A 5CEQA 3UC3A 3FE3A 1H00A 5EHLA 3PA3A 4ASZA 4UYNA 2GCDA 3MESA 3SDJA 3BV2A 5E91A 2EWAA 3HGKA 5L2QA 4QQCA 1YI3A 4O21A 1Q5KA 2J90A 4RJ6A 5E8WA 5LCJA 3C4FA 2Q0BA 3DJ6A 3SAYA 4DFBA 2F57A 5DEWA 3EKNA 5J9ZA 4FIFA 1OL5A 4RJ5A 5CNNA 2Q83A 3TKHA 3ZCLA 3LMHA 1E1VA 2RFSA 5AP4A 2ZMCA 1CMKE 2V55A 3TN8A 4FK6A 2VWIA 5CEKA 4YJPA 2UW7A 3FHIA 3LQ5A 2BPMA 2QOOA 4HVDA 2XNNA 3I60A 3IW5A 3DBQA 3ORIA 3Q5IA 3NCZA 3ZXTA 2BVAA 4FKJA 5FTQA 3COIA 2EUFB 2BRMA 4EK5A 5HTBA 2WQEA 1XH7A 2FSOX 3G51A 4G3GA 4R3PA 5GJDA 3UIXA 5HCZA 4KBAA
chains in the Genus database with same CATH superfamily
1K2PA 3VF9A 5BVFA 4F0GA 1MQ4A 4FE2A 2ZDUA 1WZYA 3I81A 4GRBA 4L00A 1AGWA 2AUHA 4KIKB 1XHAA 1Q62A 3R28A 4BCMA 2ESMA 3HMMA 4XCUA 3VUGA 4CFVA 3BYSA 2JAVA 2PZIA 4GUBA 4ZMFA 4N70A 2OGVA 3BV3A 4KUJA 5KMIA 3QZHA 1ZZLA 4ALVA 3NPCA 3QHWA 4YHTA 4GV1A 3SRVA 4ZP5A 4BI1A 3UNZA 3AC1A 5CF4A 4ZTNA 4CV9A 3LFSA 4AW2A 2IZSA 5DN3A 4YNOA 3A7HA 4DC2A 3GI3A 4IH8A 4RJ3A 4ZTLA 3TL8A 2BTSA 3H9OA 3OBJA 3AGLA 4QMOA 1ZARA 3NYVA 3UYSA 4E20A 4P5QA 4RSSA 5ANDA 3LXKA 5DT3A 5IZFA 4R7BA 3OY3A 2G9XA 4CYJA 4APCA 1VLRA 2Y9QA 5L8LA 3FQEA 3OEFX 3E92A 3QZIA 4FTCA 1WBWA 3L9PA 4ANQA 5EM5A 4ZJVA 2Z7RA 4M68A 1OL1A 3QA0A 2F2CB 1U4DA 5M4UA 3RP9A 1JPAA 3NW7A 4UMUA 4LV8A 4GJ2A 4A4OA 4XG2A 4S32A 3KKVA 4FSWA 4PWNA 5GIPE 3DFCB 4EH3A 4I4EA 2YHVA 5AP5A 1ATPE 3TZ8A 3UVPA 1L8TA 3H10A 2R3GA 4O7LA 2GDOA 5CQWA 3R02A 4E93A 4KIQA 4F9AA 1ND4A 5EK7A 2WTIA 3SX9A 1Q99A 5CAQA 3QZFA 2QD9A 1YRPA 4FV7A 5AMNA 3CE3A 1M2RA 4IMYA 1XO2B 5EM7A 3UO6A 4MBLA 2YM8A 3FZSA 2IVTA 4JDKA 3MFRA 4YJTA 5FG8A 5EM6A 3C4ZA 4F70A 4HYIA 5HU9A 5EHYA 4FEUA 5L6WL 1TQIA 4FZ7A 4OGRA 3R8MA 4KIPA 1YXTA 4IB5A 3ACKA 4BDCA 4DDIA 4P4CA 5M57A 4I3ZA 2BRHA 2OBJA 2PMOX 3OCBA 4O4DA 4QNYA 4R8QA 2BZJA 3QD0A 4U45A 4C62A 3E64A 1I44A 2FA2A 2RIOA 4FICA 3DJ5A 3FUPA 3HV4A 2XM8A 4RZVA 4X7QA 3TUDA 1TFFA 4W9XA 4LOQA 5LMKC 2SRCA 3RWQA 4IAIA 3RAKA 3FYKX 4BDFA 5K5XA 3C0GA 2WFYA 3ZOSA 4RRVA 4XG9A 3FI2A 5BV3A 2QI8A 4X3FB 4K77A 5TOZA 5AP0A 4FL2A 3RAHA 3V5PA 4ZSAA 4C4EA 2YN8A 2E9UA 3GBZA 3MH1A 1NT2A 2RSVA 2W1GA 5CNOA 4HCVA 4C4IA 4AGDA 5LVOA 1R1WA 3K3IA 2QOQA 2UW6A 2FVDA 4FX3A 3D7ZA 4E7WA 2FYSA 1OBGA 1PYXA 1OUYA 4NM0A 5BYLA 1GJOA 2X2MA 5EDQA 3TACA 4BHZA 2VV9A 3PRIA 4YGAA 2C0OA 1YDSE 2JIVA 1JKSA 1WMKA 2B7AA 5EYCA 3ZZWA 4LRJA 2E9VA 3WF6A 3BL9A 5E7RA 4HZRA 3D94A 2PZRA 5CF8A 4GKHA 4WUNA 4W8EA 2BILB 4ZJJA 1M7QA 4YMJA 4F63A 4IC7A 3O7LB 3F66A 4FSUA 3AC4A 4J53A 5D1JA 3GEQA 4EOJA 4M0YA 5L2IA 4DF3A 2R3FA 2UZTA 4XOZA 3TCPA 5CAPA 5KMMA 4I21A 3ZXZA 2FH9A 3NS9A 2X7OA 3SXSA 2YCFA 5M56A 2WTVA 4S30A 3W0OA 3AG9A 4X21A 1M14A 3HZTA 5J8IA 5AEPA 3OMVA 3NAYA 1YWVA 3DPKA 2XYNA 2H34A 2O64A 2C3JA 4L52A 2JITA 4LRKA 5IDNA 5JQ5A 4GL9A 1IRKA 4R3RA 3RNYA 3ZBFA 3ZM4A 2YISA 4PPBA 4QMZA 3QA8A 5IH5A 5ETCA 2PULA 3GNIB 1Q24A 4V01A 4PPCA 4E5WA 4QP7A 3WARA 2A1AB 1XH6A 3MGYA 4LQMA 4YJNA 3QTQA 3QWKA 1MQBA 3IS5A 3S95A 2XJ1A 4U3YA 4ANMA 3DBEA 2BMCA 3GUBA 4H3BA 5HZNA 5CASA 4YJOA 4C2VA 1ZWSA 4FNYA 2J2IB 2Y4IC 4NM3A 3D4QA 5FLFA 3F3WA 3NYNA 3QAME 4AW1A 4B0GA 4M97A 3OXZA 2OW3A 2YIWA 3ROYA 5M06A 2VWBA 3R83A 3W0MA 4J52A 5KCVA 1FBNA 2W4KA 4L9IA 4X6QC 1B39A 3JY9A 3HAVA 4F7NA 4C33A 4BIDA 4UBAA 4ZY6A 3V6RA 4LMNA 3MVMA 1DAYA 3BGPA 4I24A 3ZC5A 4LGGA 5AV0A 4G17A 1SMHA 2FGIA 2Z02A 1Z5MA 4IJPA 2PPQA 3ORXA 2GNGA 4QMXA 2PUUA 3DXNA 3O8UA 4YJQA 2VTLA 3RHKA 4AGCA 4B4LA 3ORKA 3GCUA 2XK3A 5AAGA 1YXVA 4BCPA 3OP5A 5LMAA 4O38A 4BKZA 3FMKA 5AAEA 4OTPA 3DOGA 4K11A 5IQHA 3JR1A 5HESA 3KVWA 3EN7A 4QQTA 2X8DA 2HZNA 5J7HA 1NA7A 2UW0A 2W0JA 4IAZA 2CLXA 2UZLA 3EYGA 4XHKB 2XVDA 4D1ZA 3DZQA 5KNJA 4I5PA 3PDTA 4U41A 2HOGA 5L4QA 1Y6BA 4IJ9A 4XV2A 5J5SA 1CKJA 4EWQA 4YPDA 4BDEA 3EN9A 2UVYA 4RWKA 3FPMA 2P3GX 1P2AA 3CTHA 3PIXA 3BKBA 3R71A 4C59A 1KSWA 2BZKB 3IO7A 4IBMA 4NJ3A 1P4FA 4QT1A 2VWWA 3SGCA 3IDCA 2B55A 1ZZ2A 3C51A 3H4JA 1G3NA 1H01A 3AT2A 2Z60A 2YLEA 2O8YA 4NIFB 1W2CA 3MI9A 5KO1A 4EJ7A 3PXRA 2X7FA 3VS4A 4O4CA 1HCLA 1W98A 1YQJA 2HY0A 4DFNA 1UNHA 3GU7A 2W1ZA 5CEIA 2OXXA 3IKAA 3QCXA 2XRUA 2E9NA 4YHJA 4M15A 3HUBA 3SOCA 3AXWA 4AOJA 5I3RA 2OK1A 4QP4A 4AZWA 4DA5A 1Z9XA 3QRJA 2C30A 2QKWB 3CPBA 3VS3A 4H36A 2C47A 3MJ1A 1NVSA 2ITWA 4FBXA 5CX9A 5AUXA 4EH7A 3UOJA 5DYJA 4E26A 2Y6MA 1JKTA 2XEZA 4BGGA 2NNWB 2WZJA 3R9HA 3FL5A 1PXIA 3VUDA 1B38A 3EMGA 4IVDA 1H4LA 4NEUA 3EFKA 5ETIA 3TXOA 3KF7A 5H3QA 3R7UA 5HCYA 3ZFYA 3MH0A 4QMWA 3VS2A 4FSQA 2R3NA 3U4UA 4AA0A 1PXKA 3ZYAA 5FXRA 3KQ7A 3GU4A 4M7IA 3DA6A 5EYMA 3Q2MA 4YBKA 2X6DA 3MB6A 4LV5A 5BYZA 4KBCA 1DS5A 4BCQA 4LOOA 5A14A 1ERKA 1JWHA 2R5TA 4D58A 4DTBA 3W16A 3WZUA 5CQUA 4AOIA 1LEWA 2XA4A 5HKMA 2XCKA 3CKXA 4AGWA 4TTHB 3LZBA 2XKFA 1K9AA 4KB8A 4TNBA 2VX0A 5DLSA 4X2FA 5AP1A 2UW8A 5FUTA 5AUWA 3W2PA 1BI8A 2UW4A 4CKJA 2BHHA 3A4OX 3L8SA 2PMLX 2O65A 2XNPA 4JG8A 5JZNA 4EQMA 5CXHA 1ZYSA 3ORPA 3VJOA 4RJ4A 5IKWA 1O9UA 3U55A 4IW0A 4BR3A 3F7ZA 3MA3A 1TQPA 2YCRA 3I5NA 5AR3A 2FUMA 3VS7A 3GU8A 4QMLA 3QQKA 1FPUA 4CKRA 2QOCA 4J95A 4KWPA 3UIBA 2CJMA 4DINA 5KKRC 2XJ2A 3FY2A 1H1SA 1R3CA 3I7BA 3L1SA 3ORLA 4ZLZA 5EM8A 4RLLA 3F3UA 2ITVA 1PMUA 4RC4A 4BCGA 2VUWA 4XP2A 5KKRB 4ZAUA 2C6KA 3BIZA 4WKQA 3CQWA 3GQIA 3NUXA 3U9CA 2NP8A 4H3PA 3NCGA 2JD5A 5CZIA 3FKLA 3D2IA 4AGUA 4YR8A 3D5WA 3CQUA 1W82A 3GCVA 4TYIA 5DGZA 3NZ0A 2VWVA 3W1FA 1YDRE 4L44A 4IZ5A 2JFLA 2DWBA 2RL5A 1OMWA 3FXWA 3EL7A 3QGWA 3ROCA 1IEPA 2QOIA 4BKJA 3LAUA 3W0NA 4P5ZA 4GG7A 5BVEA 2CKEA 4C8BA 4O0RA 4EYJA 4J98A 4MTAA 4HCTA 5CYIA 2QG7A 4EH2A 3EHAA 5J9YA 4K0YA 4M67A 2X9FA 1PKGA 3OCGA 4RG0A 3OFMA 3RI1A 5H2UA 2UZDA 3WZJA 5AP6A 2GNLA 3G33A 3A2CA 3LFFA 3UP2A 3T3UA 4WRGA 4PP7A 2O2UA 3A8XA 3PSDA 2IF8A 4MXCA 2OJFE 4L3PA 4HPTE 3MVLA 3C0IA 2WTWA 3L8VA 3PA4A 4YTHA 2F7EE 4AN3A 5IEXA 1WBNA 1P14A 3H30A 4ITHA 4KNBA 5AP3A 1YHVA 1MP8A 3CY2A 5CLPA 3VAPA 1OKWA 4IB0A 4IQ6A 3F3ZA 4Y46A 1QL6A 4Q9SA 2JIIA 3EL8A 4FTUA 3R2BA 3R8ZA 3RVGA 3V01A 5IQGA 3IOKA 3VBYA 3QLGA 3LLTA 5IA1A 2YERA 4RA5A 3NUAA 2V62A 2RG6A 3D9VA 5L2SA 3R21A 1CTPE 2J5FA 4WG5A 4CZTA 4RQKA 3PWYA 3VUMA 3HNGA 3PVGA 4LL0A 4GU9A 3E8NA 4UMQA 5M55A 3O5AA 5CI7A 4P7EA 1JVPP 4GK2A 5IDPA 2PZPA 4TPTA 4XBUA 4ANSA 3O51A 4BRXA 1SVEA 2QU5A 2WMVA 4II5A 3PXKA 2AQXA 2PWLA 3MA6A 3ET7A 3UGCA 2B9JA 2QONA 2YDIA 5ANEA 3VUIA 5CVGA 4BTKA 4EC8A 5LVNA 5HG5A 2PL0A 2JFMA 3U6IA 2BZIB 3PZEA 4EK8A 4FV2A 4D2VA 4U81A 4BN1A 3N4TA 4O2ZA 5CT7A 3NIZA 4NT4A 4DG3E 4E6CA 3PZHA 2JKQA 1OBDA 2X7GA 2XYUA 4O0VA 3E62A 4FV0A 4RZWA 2QLQA 4Z7HA 1V0OA 3EYHA 4FEQA 4BI0A 4CCUA 4FKVA 4GK3A 4O96A 3FJQE 2BTRA 4FMQA 5HTIA 3AC5A 2FB8A 3RM6A 4HVHA 2CGVA 4GS6A 4QYFA 5LMBA 2WMWA 4OTRA 3AD6A 3DKGA 4GK4A 4NTSA 4BCNA 4PUZA 3TDVA 3IG7A 3FC1X 4EONA 1OUKA 4HZSA 3DK6A 3UDSA 2WQNA 2EXCX 3IECA 4QRCA 5DHJA 5B0XA 2ITXA 3CR0A 4IDVA 3LXLA 4FV5A 4O7TA 1XWSA 4ACHA 4HJOA 2YLFA 5BVDA 1QMZA 2IW6A 5FBOA 3DB8A 4IB3A 4Y85A 4HVGA 4Y73A 3DLZA 4YTCA 4FTNA 4C3RA 2BFYA 3DAKA 3KMUA 2YM3A 3QZGA 3P79A 3JUHA 5DH3A 3KXHA 4USDA 4AZFA 3AOXA 4JAIA 3ACJA 3Q9XA 4XG7A 4EOQA 5HLNA 5EQYA 3ETAA 2VTHA 4IFCA 1KV1A 2Q0NA 4I6QA 4JAJA 5EFQA 4MF1A 4NFMA 5HE3A 4GVAA 2X0QA 3QCSA 1SYKA 3QWJA 4OTFA 3CD3A 4NCTA 4RIWB 4Z7GA 5DRBA 2OFVA 5IMXA 1W8CA 4KRCA 2H96A 2HELA 4WBOA 5FTOA 5JRSA 5IEVA 3EB0A 4OT6A 3W55A 4C7TA 1BUHA 3DXQA 4JS8A 2XNEA 4MD8E 4YZDA 4A9UA 4DHZA 5AJQA 5A3XA 3MH2A 3Q6UA 3GOPA 3QUPA 2ZAZA 1VYZA 5CEPA 1RE8A 4BCJA 2QO2A 2GU8A 3HV6A 5ANIA 2XNMA 4BCKA 1PF8A 4JBVA 4R5SA 5AP2A 4C02A 4E4XA 2QCSA 1OVEA 4M66A 3Q4CA 3ZSIA 3FY0A 4UWCA 1P5EA 3G15A 3QL8A 3SC1A 3ORTA 4PDYA 4BZOA 5G1XA 5JFXA 2HZ4A 3KU2A 5CAUA 4BCIA 1YXSA 2XNBA 4FTTA 4RFMA 4XG3A 5HHWA 5GZ8A 5TR6A 3AGMA 5HORA 3UTOA 5HX6A 4RT7A 4FGRA 4FTOA 2DQ7X 5L8KA 4HNFA 4FKQA 2W99B 3QQJA 4ACDA 1JLUE 3EN6A 4JOAA 3HDNA 4D1SA 4A06A 1AD5A 2GSFA 4IZYA 2R3MA 4UZHA 3DXPA 3COHA 4IAYA 4BDHA 4BTFA 4ITJA 4C35A 4ZSJA 3LFBA 2Y4PA 5M4CA 4MBJA 3KRLA 2HY81 3ZMMA 5EYKA 1M2QA 4BTMA 3RBWA 3BGQA 1ZYLA 2J5EA 4TWPA 5DE2A 4FKPA 1FQ1B 4QPMA 5HBEA 2PU8A 3UJGA 1VZOA 1FVVA 3NUPA 3R9NA 3ZO1A 3VO3A 3ZONA 3UDTA 2OXDA 3O23A 3FZRA 1RW8A 2VNYA 5L6OA 3ZC6A 2YIRA 4AQKA 3EQHA 5F9EA 4IWOA 5HO8A 2UW3A 4GFGA 5HVKA 3LE6A 4U8ZA 3Q96A 4GH2A 4PY1A 4G3EA 1BYGA 4QYGA 4WNOA 3ZO3A 5AWMA 3HUCA 4G1WA 5DRDA 4BDJA 2E9PA 5HCXA 4JG6A 3FSFA 1YOMA 5DR9A 4PDOA 4RX7A 3PXZA 4QQJA 4F9WA 3MS9A 4XG6A 4CMOA 2C5VA 2W1FA 4MX9A 4DEEA 3G6GA 4I94A 2W4OA 3UYTA 3PRFA 5AA8A 4RWJA 4I92A 3PY3A 5CU3A 3UP7A 4AT4A 4B99A 4CTBA 3ZBXA 3SG9A 4MNEB 4TXCA 3R7IA 3ZUVA 4TWCA 2OI4X 5FD2A 4NCTC 5AA9A 4JT3A 4L46A 2UZEA 2H8HA 2OSCA 4PNKA 5A9UA 1FMOE 3D5VA 3P7AA 4EL9A 3BHTA 4JVGA 4EKLA 4A9YA 5LXMA 5CU6A 4QYYA 2X1NA 1APME 5DNRA 3W33A 4DFLA 2XRWA 5AUUA 5I5ZA 3R1NA 2G15A 1XH9A 3QTIA 4UX9A 5GJFA 2YWPA 4NM7A 2GFSA 2WMXA 1U59A 4FTRA 4EHGA 1G8KA 4BWKA 4N0SA 4TN6A 2IPXA 3R30A 1GZNA 4TYHA 5EDPA 2P33A 3SW4A 3ZH8A 1VYWA 2F7ZE 5I9YA 3F3TA 4AWIA 5KBRA 3TKIA 2OWBA 3W0SA 2PVKA 2VU3A 5DIAA 3GCSA 1WBSA 2VO3A 1W83A 3DTCA 5HI2A 4RFYA 4AQCA 5C8KA 2ZMDA 4ACMA 3KEXA 3ZEWA 1H07A 4DH8A 1ZOGA 3MH3A 3DLSA 4RVLA 2NRUA 3DK7A 3VRZA 4CSVA 3R00A 3FLZA 2YWVA 4F09A 5TE0A 2VX3A 1UNGA 3HKOA 3VC4A 5BMMA 4HW7A 5L2TA 4DLJA 1FGKA 5FXQA 4ACCA 3D14A 1MUOA 3QXOA 3EQFA 4CT1A 5D7VA 3FI4A 4DITA 4UY9A 4CLIA 1XKKA 5CY3A 3PIZA 3QD2B 3KXMA 4AW5A 4R77A 3QBNA 2HK5A 2QOFA 5C27A 4ZSGA 4IANA 2GNIA 2QNJA 4XRLA 5CEOA 3KCFA 3S4QA 3VS6A 3ID6C 4FVPA 4G9RA 3R73A 3OWJA 4MXOA 5KHWA 3PSBA 4LI5A 4XBRA 3RAIA 4PMPA 4GKIA 3QGYA 4LV7A 1K3AA 2ITUA 3HVCA 4M12A 3QHRA 3FC2A 4DE4A 4YJSA 5M44A 3BHVA 5CAVA 4W4XA 3CPCA 3GC9A 3U51A 4E8AA 2W1HA 3HRBA 3NFFB 4HVIA 3F9NA 3LFEA 1Q4LA 3HX4A 4MEDA 2V7AA 5JGAA 5JEBA 5KUPA 1OGUA 3LCSA 5FDPA 4MD7E 2XEYA 5EYDA 3NW6A 4AU8A 3UZTA 2R3IA 3O8PA 2F49A 2J51A 1BL7A 3OBGA 5LOHA 3TM0A 1Q8TA 5F4NA 5IUIA 3MDYA 2WXVA 3LCDA 4AZTA 2YIYA 2YM4A 3CBLA 1XH4A 4QMTA 5I9XA 4OLIA 3RINA 3C7QA 2IVSA 1BMKA 1ZAOA 2CMWA 3KRXA 5FBNC 3ZDUA 3LFQA 2ZOQA 3RK5A 3U8WA 3QUEA 5IMEA 2YZLA 2CNQA 4CCBA 1PXLA 3HECA 3OT8A 3BGZA 2B9HA 5ANKA 4ZTHA 5M53A 1YXUA 2C6MA 3O8TA 3S0OA 5F20A 1YI4A 2WTDA 2W17A 3QTRA 3MTFA 3QTUA 5IG1A 4Z3VA 1PMVA 2XH5A 3AC8A 3P7BA 3U6JA 2EXEA 2XK8A 3P9JA 3TV4A 4AN2A 3FEGA 2O63A 3MJ2A 4RWLA 4CFMA 1XMLA 4KIOA 5C03A 1PXNA 2WKMA 3HA6A 5M08A 4K8AA 2WGJA 2IVVA 4CFWA 4U7ZA 1PXMA 2OFUA 3SLSA 2RG5A 2ZB0A 1RJBA 2ONLC 4JJRA 2UZOA 4UMTA 2ETRA 2PVMA 4GCJA 2XJ0A 2X39A 2IW9A 4GJ3A 4MH7A 5IISA 3NUUA 4U6RA 4NW5A 3DV3A 3KL8A 4JI9A 3ZRLA 4AG8A 4MQ1A 5AIKA 2WELA 3CTJA 5H8BA 5BPYA 3I5ZA 3NNXA 1OECA 2WHBA 5DVRA 4V04A 5GINE 2OZOA 4AXFA 4KBKA 4XH6A 5EOBA 2YM5A 2YIQA 5CAOA 4FIIA 2YM6A 4U43A 1R39A 3BL7A 4EKKA 3D83A 2W5BA 5HLWA 4IX4A 3LPBA 1OKVA 2OJJA 4G6OA 4XP3A 4ZS0A 4YP8A 1JSTA 1XBAA 3C4XA 4FVQA 3MPMA 3WIKA 4PF4A 3PJ8A 4M13A 4QPAA 4WA9A 3SV0A 4AZVA 4YLKA 5LCKA 3F88A 4AE9A 3CXWA 4IAKA 5A4EA 2GQSA 3SD0A 4U5JA 3C4CA 2UZVA 3PUPA 5J79A 2ZFYA 4C2WA 2JDSA 3LVPA 3R9OA 4F7SA 3F5UA 5CSVA 4LRMA 1YOLA 2WMBA 3ERKA 4IE9A 2F7XE 1U5RA 2PY3A 5KZ0A 3HMPA 4FODA 3H9RA 2QURA 5HG9A 5B2KA 3KN5A 2BAQA 5HD4A 2RFNA 5CENA 5J7BA 2JBOA 3KA0A 5CALA 4RX9A 3T9IA 4P2KA 3AT3A 4J7BA 3PPZA 3CGOA 5IQBA 4W4YA 1VR2A 2YDKA 4FL3A 3VVHA 1QPJA 3PFQA 2OIBA 5BUEA 4G3DA 4JDJA 3VHKA 3Q5ZA 1H0WA 2QU6A 3FMLA 1G8AA 1XQZA 3LMIA 2CGWA 4ASDA 2RKUA 1F5QA 3ATTA 3NIEA 4BI2A 4R7IA 5FDXA 3V5QA 3O17A 4O1OA 4DTAA 3EWHA 3MSSA 3EQBA 3KXNA 4NZWB 1OI9A 2NRYA 3DB6A 3MBLA 4DEIA 3MFSA 4FSRA 1XBCA 4WIHA 3NVMB 3TJDA 3DCVA 4O81A 2WQMA 2PE0A 3PP0A 3QRKA 3BI6A 1OPKA 2PMNX 1R78A 4DH7A 2IZUA 3KULA 4ZSEA 3L8PA 3LCTA 1VJYA 5I0BA 1JKLA 3P7CA 2R0IA 3DDQA 3E7VA 4FTMA 1UNLA 4YHFA 5E8UA 2EU9A 3BZ3A 4H39A 3C50A 3AT4A 2QO7A 3PTGA 4XNEA 2VWUA 5I9UA 4FTLA 3DNDA 3W18A 5E1SA 1QPEA 4FKTA 4Y83A 5LVPA 4ORKA 4LGHA 1EH4A 3F6XA 5LWNA 4UMRA 4KD1A 4NW6A 1BKXA 4U0IA 5DT4A 4ZTSA 3F3VA 5HU3A 5EOLA 5GHVA 4FZFB 5BQ0A 2PVHA 5DR6A 3V8SA 4AT3A 3TIZA 4JBQA 4D9UA 2GMXA 4O0XA 3S2PA 4YZCA 3V6SA 3P5KA 4YTFA 1SNUA 4TKSA 1R0EA 2UW9A 1UU9A 3LCKA 5ANJA 4YSMA 4FTIA 4M3QA 3BHYA 4YNEA 2JEDA 2PUNA 1NW1A 5J1VA 3RZBA 4D2WA 2OG8A 3OTUA 3L9LA 5E8XA 3W2SA 1NVRA 4C36A 5B2MA 3GCQA 4M69A 4DEGA 2XKDA 2IG7A 4MUQA 4XP0A 4J8MA 3TI1A 2X81A 2FSTX 2C6EA 3B8QA 2YFXA 3CLYA 3G6HA 3R7GA 4RJ8A 4WRSA 2Y4IB 2WMAA 3OUKA 4YLLA 4FIEA 3D5UA 3TUCA 4R3CA 2YJRA 3M42A 4BIBA 3PY0A 5DR2A 2VD5A 3Q4ZA 2ZM4A 2WMTA 5D41A 4JL9A 3THBA 4EHEA 4BBEA 1W2FA 2X0OA 4ERKA 4FV6A 4KINA 1Q8UA 4IM0A 2EB2A 2W5AA 4W4WA 2W05A 3SVVA 3VWAA 1A9UA 3R7EA 2VTRA 3I0OA 2B9FA 4W9WA 4ZEGA 4L53A 3D15A 3H9FA 5HIBA 3NYOA 3P5JC 2REIA 2WU7A 1IG1A 5IQDA 2YABA 3VS5A 5BUJA 5KMJA 2W7XA 3VN9A 5M51A 3GOKA 3CSVA 4EH9A 4FKSA 1WBTA 3LIJA 3UIMA 3UIUA 3G9LX 3R04A 2VZ6A 2W1IA 3R2YA 4I41A 2R3QA 4IWPA 3R8PA 3AKKA 4CGAA 4GG5A 4N4SA 3LXNA 1Q97A 3V04A 1ZYDA 3FLYA 1M17A 3ZSHA 3PJ1A 1GIJA 3Q4TA 1J1CA 3TNQB 4BYJA 4EOIA 2O5KA 4FI1A 4BVUA 4ERWA 3W0QA 3OOMA 2R4BA 3ZDIA 5AR5A 4PDPA 2OJGA 2BKZA 4JDHA 2PTKA 4BZNA 2IO6A 3WZDA 3UQCA 5IEYA 3DAJA 2BCJA 3W8LA 4BC6A 5EDRA 5CSXA 1Y91A 3CTQA 1XH5A 3HMIA 4WNKA 1KE9A 3SQQA 4BL1A 1PRYA 4D5HA 3R9DA 4L67A 2QOBA 2XK6A 3DKFA 3FWQA 4L7FA 4XG8A 2IN6A 3PG1A 2Z7QA 4M14A 4FT9A 3OCSA 1V0PA 1LPUA 2X4FA 3DDPA 4QD6A 2EXMA 5IPJA 2G2IA 2VWYA 2F4JA 3PJ3A 1J1BA 4EJNA 5LARA 4D4YA 2ACXA 3KVXA 3A7GA 4MNFA 2WOTA 5D10A 1DM2A 1PKDA 2GHMA 4RIWA 2BR1A 4AX8A 2JC6A 2JDVA 2BUJA 2WQBA 3A61A 3OD6X 4LGDA 2EVAA 4UYAA 4WOVA 2UZBA 3JVSA 4U40A 2VTQA 1YVJA 5EQEA 3TZ7A 2HZ0A 2R9SA 2ZDTA 3GU6A 2ITNA 4FT5A 3TG1A 4EH4A 2BKKA 3BLAA 3PUFC 2BIKB 1IR3A 4OTWA 2C3KA 3FMDA 2X2KA 3EQCA 3FMNA 2YIXA 3KMMA 3BLQA 3WI6A 3FZ1A 2Y6OA 3WZEA 2PZYA 4F9YA 5IUGA 3DJ7A 5KBQA 3BU6A 2ZV8A 2P55A 3VIDA 3HA8A 2ZV9A 2VTMA 4BCOA 3B2WA 3JS2A 4NJDA 4WNMA 1I09A 3C1XA 5J1WA 3SKCA 2CNVA 1H28A 4WG4A 4XLIA 4FOCA 3W10A 4WD5A 4LMUA 2QR7A 2PVRA 3ZM9A 2VO0A 3UZRA 1H08A 4DH5A 2KTYA 2ZM1A 4FSTA 4PX6A 5AIRA 1GNGA 4FNZA 3QTXA 4G2FA 2RF9A 3CS9A 4WHZA 1H25A 5BVNA 4DBXA 3OT3A 1Q3DA 2I0HA 4RVKA 3O96A 3VHEA 4CZUA 3BEGA 1NXKA 2B53A 2ITQA 4W8DA 3LFCA 1H27A 4WNPA 4QMMA 4Y5QA 4ZY4A 3OS3A 4DFUA 3CJGA 2ETMA 2VTTA 2A2AA 2X9EA 3IW8A 2BIYA 2C0TA 3JYAA 3R1SA 4NKSA 4QP1A 4TNDA 3ZLXA 4DGGA 1OZ1A 2C5XA 5EW3A 4EH8A 2I7QA 1IAJA 3VUHA 2WO6A 1H0VA 4QPSA 4BWXA 1PYEA 1URCA 3HRFA 4PMMA 3QALE 2XIXA 4LFIA 3TV7A 4AAYA 3CY3A 2FSMX 4E5BA 4MXYA 3C5UA 1Q8YA 1CDKA 2A27A 5TT7A 3LXPA 4FSNA 5EHOA 4F65A 4A4LA 1MRVA 1ZYJA 5F95A 5AX3A 4ANNA 3A7FA 2HZIA 5AV1A 2V5QA 2VWXA 4ZZOA 5AR4A 3RK7A 4QP8A 1Y6AA 1YW2A 3PVWA 4QMQA