4UAAA

Ctx-m-14 class a beta-lactamase in complex with a non-covalent inhibitor at sub-angstrom resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
b'ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 94
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4uaaA00
5GHXA 4OP8A 4KZ7A 5E2GA 4WZ5A 5L2FA 3EQVA 3NDGA 3GR2A 1EI5A 4LV3A 3AGFA 5CHMA 1VM1A 4JXGA 3IXDA 1E3UA 1PW8A 3ISGA 3G2ZA 3NDEA 4JPMA 4BL3A 4KZ6A 1FOFA 1NYMA 2WGVA 2ZD8A 3HVFA 1KE0A 3FV7A 4S2PA 3NI9A 4S2LA 3WS2A 2V1ZA 4FD8A 3MZEA 3VP1A 1PI4A 3S4XA 2XF3A 5AQAA 2P9VA 4E6WA 4IBRA 4MLLA 2QZ6A 3BLMA 5GHYA 1CEGA 3UPPA 1GHIA 1XX2A 2HPBA 5GHZA 4MBHA 4KG5A 1XA1A 3RXWA 5HL1A 1LL9A 2Y2KA 3CJMA 3IXGA 4JXSA 5EVIC 2Y55A 3N8RA 5CHJA 1JWZA 1K57C 1GCEA 1KVMA 4OLGA 1K54C 4ZJ3A 5U47A 4E6XA 1EWZA 4OOMA 1PWDA 4E3OA 1L0FA 4OLDA 4NK3A 1XPBA 3LY3A 4X6TA 3PBSA 2ZC7A 2XFSA 3P98A 4R23A 2P9VB 1NZUA 1HTZA 4GNUA 4QY6A 1CI8A 2J9PA 2A49A 2XK1A 4WMCA 3W8KA 3N8LA 3DWKA 1YQSA 5CEDA 1PZOA 4S2NC 4X53A 4BLMA 1WYBA 3P09A 3UNWA 1ONHA 5HAPA 2H0YA 5CGWA 4PM8A 3OPHA 2EX6A 4R0QA 4GOGA 4K0WA 2HDSA 1ZKJA 2Q9MA 3N4IA 1DJBA 4OPRA 5F1FA 2G2UA 3A3EA 2C6WB 4ZDXA 3ZG0A 2G2WA 4Q8IA 3SS4A 1MWSA 1BULA 3PBNA 4OQHA 1ESIA 1XP4A 1U60A 4Y0OA 3HLDA 5HFOA 2Y2GA 4OQIA 4YINA 3VP2A 4E3IA 4OOYA 1TDLA 4KZ4A 4PMAA 2WGIA 2JBFA 3BFEA 1FCOA 2HP9A 1K55C 2J9OA 3OCNA 2WAEA 3WS4A 1MXOA 3ZG9B 2XGNA 2R9XA 3C7VA 1JTGA 1IYSA 1S6RA 3SOIA 5DF7A 4X56A 3TOIA 5JYOA 1W79A 3MXRA 4MBFA 4Z9QA 3PBRA 1K6RA 4UHUA 5A92A 1FSYA 4KG2A 1I2SA 4WYYA 1Q2PA 3Q82A 2EFXA 1RGYA 4N9LA 5BOHA 2ZQAA 1HD8A 5CTNA 4OVDA 4R1GA 5FAQA 3SH7A 3CG5A 1BLPA 3G31A 5HW3A 4LCMA 2GDNA 4R3JA 4S2MA 5CERA 1PWCA 1YT4A 5JYPA 4PM9A 2Y4AA 1JVJA 3DW0A 4S2KA 1MKIA 3ITAA 1L0DA 3O88A 4GB7A 5CTMA 4ZAMA 5EVID 4OQ0A 3BFDA 4B4XA 1ES4A 4KQOA 4QB8A 3IWOA 2Y59A 1TEMA 4KZ9A 4KZBA 4C75A 4U0XA 5M19A 4JBFA 1JTDA 4IEDA 3UDXA 3PBTA 1W5DA 2ZC4B 2H0TA 1PIOA 3B3XA 3OPPA 4GN2A 1K56D 1KGFA 2DCFA 3VFHA 4JF6A 3M2JA 1JWPA 1HVBA 1IKGA 4ID4A 3VP4A 1K6SA 4DKIA 1S0WA 3N8SA 5HAIA 2VGJA 3HUNA 3GQZA 2WAFA 4DE1A 4KZAA 3RJUA 3HUOA 4B88A 3M6HA 1LI0A 2ZQ8A 2UWXA 4DRTA 3BFGA 4EBPA 4KQQA 3ZCZA 1IYPA 3MZFA 2PU4A 3SH9A 1GHPA 1YLPA 4DXBA 5FI6A 1FSWA 1GHMA 3IXHA 3HUMA 4N1HA 1N4OA 5FI7A 2WUQA 3FKVA 2BLSA 4DXCA 1TVFA 3IWIA 1RGZA 1KGEA 2QPNA 4M3KA 4X69A 1Z6FA 1ERMA 4UA6A 4XUZA 4WEKA 5FAOA 4FCFA 2JE5A 1IEMA 2Y2MA 3V3SA 4QHCA 4H8RA 2Y2IA 4UA9A 3M2KA 3OCLA 4U3TA 2BG1A 4BJPA 1K55A 4WZ4A 1K25A 5J8XA 3OZHA 1CK3A 1I2WA 1DJCA 1IELA 4DE0A 2Y2LA 2CC1A 3G35A 3HBRA 4UA7A 3FWLA 4WEJA 3IXBA 4PPRA 5FQMA 4Y0UA 4L0LA 1MPLA 1Q2QA 1ES2A 5FQIA 4R4SA 2WGWB 4N92A 2HDQA 4FH2A 4JXVA 4A5RA 4E3LA 1I5QA 4YFMA 5A91A 2J8YA 2HP6A 3A3IA 1K38A 3OC2A 1NXYA 4PM6A 3ITBA 1KGGA 2OLVA 4R3BA 1LLBA 4OPYA 4K91A 1O07A 1XXMA 4OONA 4B4ZA 5TR7A 1NRFA 1XGJA 1BLHA 4GD8A 3VP3A 1TDGA 1QMEA 4E3KA 3C5AA 3IF6C 5F1GA 3UN7A 3UY6A 1FR6A 3WS0A 5M18A 3Q7ZA 3PAGA 2E8IA 2FFFB 3IH9A 3UPOA 3M6BA 5FDHA 4C6YA 2WYXA 1BZAA 2IWDA 1EROA 2IWCA 3SH8A 5FSRA 2WKHA 2Q9NA 5KSCA 4OQGA 2Z2MB 3QHYA 3W4OA 4X55A 1L0EA 3C7UA 3PAEA 4CJNA 4QJGA 2EXBA 3LEZA 2ZM2A 4WELA 5AQBA 1NY0A 5GLAA 3WS1A 1ONGA 4CPKA 3BYDA 2V2FF 4U0TA 3EQUA 4MEZA 3NIAA 3UDIA 1SKFA 2WK0A 4JKTA 4C3QA 1YMXA 3PBOA 3GRJA 4ZTKA 4DE3A 1MWUA 1MY8A 5DF9A 3HLFA 3AGEA 5F82A 2XEPA 4JF5A 4EWFA 4WZ5C 1SDEA 1LHYA 3FKWA 5GLDA 3VSLA 2OV5A 3NBLA 4HESA 4ZJ1A 3G34A 2EX8A 2ZC6B 1Y54A 1YM1A 1CEFA 3PBQA 4K0XA 1E4DA 4OPQA 1N9BA 3Q07A 1ERQA 3S1YA 3W4PA 3TG9A 4PM7A 5DTSA 1LI9A 1J9MA 4KZ8A 2Y2NA 3IH8A 3VMAA 4FSFA 5E43A 3LY4A 4N9KA 4LCLA 2C5WB 5A93A 2HDUA 3PTEA 5CECA 1MBLA 4UAAA 4JLFA 5CGSA 2HDRA 3N7WA 3DWZA 5AQ7A 5EVIA 4WBGA 5FQKA 1K57A 1K54A 2ZQDA 1ZG4A 3D4FA 1KVLA 4KG6A 1M6KA 4DDSA 2ZC3B 3HLEA 2PBYA 2ZJ9A 3VOYA 4DF6A 1BTLA 1K56A 1KDSA 1L0GA 1SCWA 5FAPA 4QD4A 3VSKA 3ZG8B 3WS5A 3ZG5A 4JXWA 1SDNA 1ES5A 3BLSA 3UE3A 1VQQA 3IWQA 1ES3A 4S2NA 4IVKA 3WWXA 2WKIA 5EUAA 3JYIA 3UE1A 4DDYA 4EBNA 2B5RA 1NZOA 2Z2LB 3BFFA 1YLTA 1FCNA 5EVIB 1XGIA 3CMZA 4OOLA 3IT9A 3BECA 3OPLA 3WRTA 3WRZA 5E2HA 4EUZA 3GV9A 4HBUA 1DY6A 1W7FA 4KENB 3MKFA 1BSGA 4E3NA 3ZHHA 2XFTA 2JCHA 4S2JA 2WGWA 2VGKA 3ZNYA 1WYCA 1YLZA 3HLWA 3HLGA 3OPRA 3O87A 4KZ3A 3GVBA 3BM6A 3VP0A 4GKUA 5CRFA 5FATA 3IF6B 1C3BA 1FCMA 3I7JA 2ZM8A 1JWVA 4RX3A 3ZGAB 3ZVTA 4RYEA 3NC8A 5DF8A 3UE0A 1NYYA 2XH9A 2Y91A 4PM5A 1K4EA 3Q7VB 3IHAA 5FA7A 1XKZA 1PI5A 1PWGA 2HP5A 3FZCA 4IBXA 3DTMA 4OP5A 4WM9A 5E2FA 4ZBEA 2DNSA 2OSUA 5HAQA 5FQ9A 3S22A 4P85A 4GD6A 4LV1A 3E2KA 1E3UD 2XQZA 2RCXA 5EE8A 4HEFA 2R9WA 2XLNA 2WADA 4OKPA 3HREA 3A3DA 2IWBA 2Y2PA 1FR1A 1OMEA 4DE2A 1AXBA 5EPHA 3SS5A 4EV4A 5GL9A 5KMWA 2X71A 3G2YA 5GLBA 3A3FA 3C4PA 1BLCA 4JF4A 4RA7A 1MWRA 4OPZA 2ZM0A 1FQGA 4KQRA 1NJ4A 4MBKA 4QY5A 1K4FA 1KE3A 5M1AA 2WZXA 3Q81A 1M40A 1GA0A 2WZZA 4GDBA 4NETA 1ALQA 4OH0A 5FI2A 2RL3A 3LO7A 1KDWA 3CZDA 3NCKA 3ZG7B 1W8YA 4RVAA 4GZBA 1W8QA 2J7VA 5EOOA 4Y0TA 1IKIA 5A90A 3V39A 2A3UA 5G18A 1YMSA 1YLYA 1H8YA 1QMFA 4ZJ2A 1YLJA 4P87A 4N1XA 1SHVA 3FYZA 4WMCD 5IHVA 1RP5A 3NY4A 5F83A 4BENA 3A3JA 3N6IA 5DTKA 2EX2A 4HBTA 3VOZA 1ESUA 3GMWA 3QNBA 1YLWA 4XXRA 3MFDA 1GA9A 5EOEA 3QNCA 3ZVWA 1WE4A 2EX9A 2ZMAA 3MXSA 2EXAA 4QU3A 3IQAA 4LV0A 5CEBA 4RX2A 5EVLA 3UDFA 3BRMA 4BQMA 1IYQA 1LL5A 3G4PA 5HX9A 1O7EA 2DRWA 4D2OA 2ZQCA 1ZG6A 3W4QA 3MBZA 5I94A 1BUEA 5CHUA 1KE4A 2Y2HA 4S2OA 4EQIA 2H10A 3VFFA 5KZHA 2XR0A 4EBLA 3BFCA 3AGDA 5TFQA 2ZQ7A 4O7DA 4P0MA 3O3VA 5TGFA 4GDNA 3V50A 3G30A 4IVIA 2Y2JA 1PZPA 2ZQ9A 5DVAA 2X02A 5D3OA 2JC7A 4LENA 4KZ5A 3IF5A 2EFUA 2Y2QA 4XUXA 3E2LA 2XDMA 1PW1A 5AQ9A 3RXXA 3ZFZA 5E2EA 5FQJA 2ZLYA 4Y7PA 2PU2A 3C4OA 1G68A 5EECA 1E25A 1ZC2A 1DJAA 1XA7A 3HLBA 3IF6A 4LV2A 1CI9A 5GLCA 1RCJA 5FASA 3V3RA 1BT5A 1MWTA 2XD1A 3HLCA 2X01A 4F94A 3MKEA 1L2SA 1H8ZA 3GSGA 3Q7VA 4P6BA 5HARA 5FQQA 3GTCA 1HZOA 2Y2OA 3BEBA 4BD1A 2OLUA 2V20A 5DTTA 3O86A 4FH4A 3TSGA 3MZDA 3UO9A 4X68A 1G6AA 2FFYA 4E3JA 3SS3A 2QMIA 2XD5A 2P74A 4R4RA 1IYOA 5CXWA 2H5SA 2ZC5B 3HL9A 5KSHA 1H5XA 5CGXA 3UPNA 3G32A 1PYYA 4S2IA 4E3MA 2WKEA 3LCEA 2I72A 3Q1FA 4MNRA 4BL2A 4BD0A 3ZDJA 3V5MA 3ZNTA 1BLSA 3IHBA
chains in the Genus database with same CATH superfamily
4OP8A 1L3LA 3EQVA 5CHMA 1VM1A 3IXDA 4JPMA 3ISGA 2W1TB 3G2ZA 4BL3A 4KZ6A 1VEUB 1FOFA 1XJ3A 2ZD8A 4S2LA 1FIKA 4FD8A 3GECA 1TS8A 4E6WA 2HJEA 3KSGA 3UPPA 1GHIA 4KG5A 1XA1A 4WLAA 5HL1A 2Y2KA 4HP9A 3FC7A 5HDCA 4ZJ3A 4OOMA 1PWDA 4E3OA 3VE4A 4EETB 3MXQA 2XFSA 2P9VB 2ZOHA 2J9PA 2XK1A 2A49A 3N8LA 2K7SA 3KO6A 4BLMA 1GSVA 1XFNA 5HAPA 3UE6A 4R0QA 4K0WA 4G3WA 2EA9A 2Q9MA 3LEQA 4ZDXA 1UWNX 2OAQ1 2QKPA 3BWLA 1ESIA 1U60A 3HLDA 5HFOA 2Y2GA 4YINA 4E3IA 3L7HA 3HJIA 2WGIA 3QP6A 1FCOA 3B33A 3C38A 1V9YA 3KSIA 2WAEA 3ZG9B 2W3EA 1JTGA 1S6RA 5DF7A 3TOIA 4H6JB 1H8MA 3MXRA 4MBFA 4Z9QA 3KYZA 2UV0E 3NOUC 1Q2PA 3Q82A 2Q0OA 5CTNA 4YWZA 2XA7S 2VLGA 5HW3A 5JYPA 2ZL1A 1PWCA 2OAP1 3DW0A 2O99A 3BFDA 3T4TA 3IWOA 4KZ9A 5M19A 4U0XA 4JBFA 1OJGA 3UDXA 3OPPA 1K56D 2DCFA 4JF6A 1IKGA 2JKRM 4DKIA 5HAIA 3HUNA 3HUOA 5TBMA 2UWXA 4EBPA 1IYPA 3SW1A 1YLPA 4DXBA 5FI6A 1FSWA 3KSHA 3E0YA 4DXCA 2VV8A 4M3KA 1Z6FA 4UA6A 3JPUA 4WEKA 4PAUA 2Y2MA 4H8RA 2Y2IA 3M2KA 4CLCE 2BG1A 1K55A 1K25A 5J8XA 1IELA 1MZUA 5HZHA 2Y2LA 3G35A 2XA7M 4PPRA 4L0LA 1CF0A 4G3VA 2HDQA 4FH2A 4E3LA 2LB5A 3A3IA 3S7OA 1NXYA 1FILA 4R6LA 1N9NA 4K91A 4OONA 3UMEA 5TR7A 3F1NA 3C5AA 5F1GA 4Y3IA 3Q7ZA 3UPOA 4C6YA 1BZAA 3SH8A 5FSRA 4OQGA 3QHYA 3W4OA 1L0EA 3C7UA 3PAEA 4IHQA 2GX5A 5GLAA 3BYDA 5DJUA 2V2FF 4U0TA 3EQUA 4MEZA 3UDIA 4C3QA 1SKFA 2WK0A 5DFXA 3GRJA 3W2ZA 3CITA 5DF9A 4MN6A 2XEPA 4EUVA 3FKWA 1N9LA 3VSLA 4O01A 2ZC6B 1YM1A 4OPQA 4HHDA 3PHYA 4PM7A 5DTSA 1J9MA 4EEPA 2D02A 4KZ8A 2Y2NA 2WKRA 3UB8A 3DWZA 4FUWA 2Y8HA 4NKPA 5AQ7A 5EVIA 2W0NA 2QJ5A 2VX8A 2ZC3B 2W3GA 2JKGA 4II7A 5HWVA 1SKOB 4F3LB 3ZG8B 1D06A 2M1CA 3IWQA 4S2NA 3OLOA 2WKIA 3UE1A 2JKRI 1XGIA 3CMZA 4CLCD 3WRTA 3LIFA 4NXEA 4HBUA 1DY6A 1W7FA 2XFTA 4S2JA 3IX3A 3K2NA 5CRFA 4WL9A 1OTEA 1FCMA 3I7JA 2ZM8A 1JWVA 4RX3A 3ZGAB 4RYEA 3C2WA 3UE0A 2XH9A 4PHTA 5F68A 2HP5A 3DTMA 5E2FA 4ZBEA 2XQZA 2WADA 3HREA 5G4ZA 4LRZE 1T19A 3IS2A 2DMWA 3MSHA 4DE2A 4EV4A 5KMWA 3G2YA 5GLBA 3LR0A 3TW8A 4JF4A 1FQGA 3PXPA 2PD8A 2HF6A 2WZXA 3Q81A 3UB7A 4GDBA 4NETA 4OH0A 5FI2A 1X0OA 3NCKA 1W8YA 4HJ4A 1W8QA 4Y0TA 4R70A 5G18A 1YMSA 1P9WA 4KUKA 4HBTA 3GMWA 1YLWA 2JKTM 3ZVWA 5CEBA 4DJ3A 4RX2A 5EVLA 3BRMA 1LL5A 2D01A 5HX9A 1O7EA 1N9OA 3MBZA 1BUEA 4Y13A 3PYPA 1VETA 1OT6A 2XR0A 2ZBBA 3T1XA 5DVAA 1SZVA 1XFQA 4XUXA 2XDMA 1PW1A 4PKYG 5FQJA 4IUKA 2P04A 2I9VA 5EECA 1XA7A 3HLBA 3IF6A 3NHQA 1T18A 3T1SA 4ESPA 3BEBA 5DTTA 1P0ZA 4R38A 3TSGA 3MZDA 4E3JA 2XD5A 5CXWA 4NXGA 5KSHA 3T50A 3UPNA 1PYYA 4BMWA 1S66L 3H82A 4WF0A 4BD0A 2ZL1B 4K0XA 3GR2A 1EI5A 3F1OA 4LV3A 1E3UA 1PW8A 3NDEA 3HCYA 1NYMA 3HVFA 3NI9A 4MCWA 1TS6A 3VP1A 5F6AA 5AQAA 2QHKA 5HL6A 5TBMB 2HPBA 5GHZA 3KYEA 4E04A 2YKFA 3IXGA 5EVIC 1DP8A 1JWZA 1GCEA 1KVMA 3MQOA 3CPTA 3CI6A 4NK3A 3RFBA 4X6TA 4R23A 4WMCA 3DWKA 1YQSA 4S2NC 1WYBA 3T4QA 4PM8A 3OPHA 4UQIS 4OPRA 5F1FA 3A3EA 2JKTI 5HWWA 2C6WB 3SS4A 1MWSA 1XP4A 3F1NB 4OQIA 4G3KA 4GCZA 3VP2A 4OOYA 2JBFA 2V8FA 2HP9A 2J9OA 4MN5A 2V0WA 3C7VA 1IYSA 4KUOA 1K6RA 5DKLA 4KG2A 4WYYA 3CLOA 1RGYA 4HP4A 4IUHA 5EM0A 2L0WA 2ZQAA 5HD3A 4OVDA 4R1GA 5FAQA 3CG5A 3G31A 5CERA 1YT4A 4XT2A 4PM9A 1MKIA 3ITAA 1L0DA 2JHEA 3P01A 4ZAMA 4OQ0A 4KQOA 1JTDA 2ZC4B 3B3XA 2E8JA 1JWPA 1HVBA 4ID4A 3VP4A 1K6SA 1S0WA 3GQZA 2WAFA 4BBUA 3M6HA 1LI0A 4KQQA 3ZCZA 3MZFA 1D1JA 1T1CA 3R4KA 1P97A 4N1HA 2W27A 2ZMFA 2WUQA 2BLSA 3EGDC 1TVFA 3T4OA 1KGEA 2QPNA 4X69A 4FCFA 2JE5A 1IEMA 4U3TA 3OZHA 4I38A 4KQDA 4DE0A 3IXBA 3C30A 5FQMA 1ES2A 2ACGA 4R4SA 4P6ZM 4N92A 3MQQA 2HP6A 4I3AA 3ITBA 1KGGA 2OLVA 1LLBA 1O07A 1XGJA 1BLHA 4BBTA 1TDGA 1QMEA 3UY6A 3IF6C 3UN7A 2Z6CA 2E8IA 3CUEA 2IWDA 1EROA 2WKHA 3T4SA 1ZHHB 4LRXC 2Z2MB 3F1PB 5HSQA 4CJNA 4QJGA 4WELA 2ZM2A 3WS1A 4GLQA 4YOFA 4JKTA 1YMXA 1OTDA 4DE3A 2GNXA 5F69A 2PAVP 1Y4OA 5F82A 1SDEA 3NBLA 3MQ0A 1LL8A 2O9AA 1E4DA 1PRQA 3Q07A 3S1YA 2XROA 1P9RA 3TG9A 2VEAA 4B93A 3T4KA 3IH8A 4FSFA 1S67L 4N9KA 2C5WB 2HDUA 3PR6A 3PTEA 5CECA 1MBLA 2HDRA 3BY8A 5FQKA 3UB9A 2ZQDA 1ZG4A 1M6KA 4DDSA 3HLEA 2ZJ9A 1Y28A 3VOYA 1K56A 1KDSA 1L0GA 1SCWA 3OOVA 5FAPA 4QD4A 1V9ZA 5IU1A 4QWOA 1VQQA 1LSXA 4EBNA 3QP8A 4CLCB 1NZOA 1K0KA 3OBFA 3BFFA 1MKMA 3EEAA 3IT9A 3WRZA 5E2HA 3GV9A 1F98A 4YNRA 1A0KA 1F5MA 1BSGA 2GJ3A 4E3NA 2WGWA 3L9KA 2VGKA 1WYCA 4KZ3A 3VP0A 3IX8A 1H3QA 3IF6B 4Y5FA 2MJ6A 1XKZA 1PI5A 1PWGA 4WM9A 5HAQA 2OSUA 5FQ9A 3E2KA 3K3DA 3A3DA 2Y2PA 1OMEA 2EWWA 3H9WA 1AXBA 5EPHA 3SS5A 3H82B 4ARZA 3C4PA 5EV0A 4OPZA 1NJ4A 2WZZA 1ALQA 1OTIA 1TS0A 4Z1WA 4JGRA 1KDWA 3ZG7B 3LGOA 2OWHA 2J7VA 1IKIA 3V39A 2A3UA 1J3WA 1YLYA 4ZJ2A 3KSFA 4LLOB 4N1XA 3FYZA 4O0PA 2L4RA 1RP5A 3NY4A 5F83A 3ZQ5A 2WKPA 3VOZA 3CPTB 3QNCA 1WE4A 2EX9A 2ZMAA 4QU3A 2EXAA 3IQAA 4LV0A 3UDFA 3G4PA 2DRWA 2J3WA 2ZQCA 3W4QA 5KIZA 1UGUA 4S2OA 5MC7A 3VFFA 4HJ6A 4EBLA 3AGDA 2QWSA 4O7DA 3NULA 2HZ5A 3O3VA 1Z09A 3V50A 4IVIA 2Y2JA 2ZQ9A 5HPFA 1OTBA 4LENA 4KZ5A 1S1YA 3E2LA 3RXXA 5AQ9A 5E2EA 2ZLYA 4Y7PA 3C4OA 3EWKA 3FG8A 4HH2A 4HQAA 1RCJA 3V3RA 1BT5A 4CLCA 1MWTA 2X01A 1H8ZA 2B95A 3Q7VA 5HARA 5LBRA 5FQQA 4HNBA 2OLUA 1F2KA 3CUEC 4FH4A 3UO9A 2W1TA 5IS1A 1VEUA 4R4RA 1IYOA 3TJZC 2H5SA 2A2LA 4S2IA 2WKEA 3CWFA 5K5BA 4BL2A 3V5MA 4XT2B 3K3CA 5GHXA 4KZ7A 2KX6A 2P08A 5L2FA 3LR5A 4LFUA 1D7EA 4GS9A 1KE0A 3FV7A 3WS2A 2V1ZA 2HJ9C 3MZEA 1LSVA 3D72A 2NUTC 1BYWA 2P9VA 4IBRA 2J3TD 3BLMA 1CEGA 1DP9A 2PHYA 4X1MA 4MBHA 1T1AA 3T12B 3U4LP 1LL9A 2O0YA 2XRNA 3CJMA 2Y55A 3N8RA 5CHJA 1S4RA 2VZWA 5U47A 4E6XA 1L0FA 4OLDA 3LY3A 3PBSA 2ZC7A 1NZUA 3KYQA 2PT7A 4QY6A 1IOUA 4GW9A 5CEDA 1PZOA 4X53A 3UB5P 3H7WA 1ONHA 2H0YA 3RH8B 3QP4A 4Y15A 2EX6A 4AFIA 1ZKJA 1IFQA 2PRFA 2ZOIA 3ICYA 3N4IA 2G2UA 1BULA 3PBNA 5DKKA 3BFEA 1HLUP 1K55C 2JKFA 1MXOA 2XGNA 1YKDA 2LB9A 4X56A 1W79A 3LIDA 1EW0A 3JVVA 1S1ZA 1ACFA 3LIEA 2EFXA 3E98A 1HD8A 3SH7A 4R3JA 5HD5A 3TE8A 2Y4AA 1JVJA 4S2KA 3T4LA 3O88A 4GB7A 4B4XA 1ES4A 4KZBA 4PKYA 5L10A 4C75A 4IEDA 1W5DA 2H0TA 1PIOA 2VGLM 3VFHA 3D3OA 3EOIA 3LYXA 3N8SA 2VGJA 4DE1A 1TS7A 4KZAA 1VB6A 5L07A 3BFGA 1W63M 1GHPA 1KOUA 4HOIA 3HUMA 2Z6DA 3FKVA 5FAOA 4QHCA 4UA9A 4ZRRA 4WZ4A 1CK3A 2IA2A 5FDSA 1DJCA 2ZMVA 2CC1A 3HBRA 3CAXA 3NOTC 3FWLA 5AVEA 1ZTUA 4X1LA 2WKQA 2XSSA 2WGWB 4JXVA 2VV7A 4A5RA 3T1QB 4HY8A 4YFMA 1PNEA 2YKHA 4HJ3A 4ETXA 4GHIA 4R3BA 4OPYA 1XXMA 2R78A 3QP2A 1TF1A 4GD8A 1G28A 1FR6A 3WS0A 3DTEA 5M18A 4CLCC 2QJ7A 1TD5A 3IH9A 5FDHA 2WYXA 3NOPC 2IWCA 4K08A 2B18A 4X55A 2EXBA 1G5UA 4ARZB 1ONGA 4CPKA 5AVFA 3PBOA 3R7WA 1MWUA 4IJGA 3HLFA 4EW7A 3O5YA 2QYBA 4JF5A 2KOIA 5GLDA 2OV5A 4HESA 4ZJ1A 2EX8A 3DTIA 1CEFA 2J80A 3PBQA 1SKOA 4MMNA 2HGVA 1LT0A 2FZ0A 3VMAA 5A93A 1F9IA 5CGSA 2W3DA 4WBGA 1K57A 4P6ZS 1K54A 4KG6A 3D4FA 1KVLA 5FEFA 3VOLA 5FEGA 1BTLA 3T4JA 5TJJA 2V8CA 3VSKA 3WS5A 4JXWA 5J4EA 1SDNA 1ES5A 3BLSA 3UE3A 2JN7A 5HDDA 4IVKA 4DDYA 2PYRA 2B5RA 1YLTA 1FCNA 5EVIB 4QPRA 4JGQA 1JNUA 4KENB 2G7UA 3MKFA 1OTAA 3LIAA 3ZNYA 3HLGA 3HLWA 1STZA 3LI8A 4GKUA 5FATA 1C3BA 2CMNA 1OPXA 1NYYA 2Y91A 4PM5A 3Q7VB 2PYPA 5FA7A 4I5SA 3FZCA 1DP6A 3FPWA 4BBVA 3KX0X 4P85A 4GD6A 3BW6A 3E4QA 4HIAA 4HEFA 2XLNA 2W3HA 2FH5A 5GL9A 3CHWP 3VV4A 3A3FA 1YSQA 1BLCA 1MWRA 2L1MA 2PD7A 4KQRA 4MBKA 4MN7A 1KE3A 5M1AA 4MDZA 4GS9B 1GSXA 2RL3A 3JVUA 5J7EA 3IS2B 1DRMA 4I3IA 1G6OA 5A90A 1UWPX 4I39A 4JGOA 1YLJA 4P87A 2BASA 3V67A 3A3JA 2VJWA 1ESUA 3LUQA 3QNBA 4XXRA 3MFDA 1PFLA 3P7NA 3MXSA 4B9OA 4D2OA 4JGPA 4EQIA 2W3FA 4CQHA 2H10A 5KZHA 3H7WB 4RQ9A 2ZQ7A 4P0MA 5TGFA 4GDNA 4LRYC 4R3AA 1PZPA 2X02A 4I3JA 5D3OA 3B47A 2Y79A 2EFUA 2Y2QA 2V1BA 2PU2A 1E25A 3ZYTA 1VETB 5FL3A 1CI9A 4F94A 5G4YA 3HLCA 3GSGA 4P6BA 3GTCA 2PDRA 4BD1A 3NJAA 4X68A 2FFYA 1ODVA 3UB6A 3HL9A 4Q0IA 1H5XA 3ZNTA 1BLSA 1GSWA 3LFVA 5E2GA 1NRJA 4WZ5A 3NDGA 2OWJA 3AGFA 4JXGA 4S2PA 2WGVA 3T1RA 3A0RA 1PI4A 1XJ4A 2XF3A 3S4XA 4GJ4A 3UMDA 4LPZA 4MLLA 2QZ6A 5GHYA 1CQAA 1XX2A 3RXWA 3F1OB 4JXSA 1K57C 3E4PA 4OLGA 1K54C 1EWZA 4L9GA 2INWA 1XPBA 1YPRA 2V1AA 5HPIA 3P98A 3IBRA 4NXBA 1HTZA 4GNUA 1CI8A 3W8KA 3BQAA 3BJNA 3MS6A 3P09A 3UNWA 5CGWA 4GOGA 4Q0JA 2HDSA 1DJBA 4EXOA 4GHIB 3EEHA 3ZG0A 2G2WA 5HDSA 4Q8IA 4OQHA 2EWVA 4EU0A 4Y0OA 3D9YA 5AJGA 1YSPA 1TDLA 4KZ4A 4PMAA 2K31A 4DN0A 3OCNA 3WS4A 1OJ5A 2R9XA 1OT9A 3MF0A 3SOIA 5JYOA 3PBRA 4UHUA 5A92A 1FSYA 1I2SA 1XJ6A 4N9LA 5L8MA 2A24A 5BOHA 3R7WB 3LR4A 1YAXA 4X25A 1BLPA 4LCMA 2GDNA 4S2MA 3DBAA 2HV1A 2O9CA 2H28A 4UEYA 5CTMA 5EVID 3TRCA 4QB8A 2Y59A 1TEMA 2PR5A 5DJTA 3PBTA 5EM1A 4GN2A 1KGFA 5DFYA 3M2JA 2VKSA 4Y17A 3RTYA 4FTXA 3IBJA 3RJUA 4B88A 3VE3A 2ZQ8A 4L9EA 4DRTA 2PU4A 3SH9A 1GHMA 3IXHA 1N4OA 5FI7A 4DJ2A 2W1RA 3IWIA 3LICA 1RGZA 1AWIA 4XUZA 1ERMA 3V3SA 5J3WA 4NXFA 4BJPA 1NLZA 3OCLA 1VHMA 3MFXA 4HI4A 4DMZA 1I2WA 4UA7A 4WEJA 4Y0UA 3LI9A 1MPLA 1Q2QA 3A0VA 5FQIA 4WN5A 1I5QA 3F1PA 5A91A 2J8YA 1K38A 3OC2A 4PM6A 4B4ZA 1NRFA 2B02A 3VP3A 5EFWA 4E3KA 3GDIA 3PAGA 2FFFB 3M6BA 3S7QA 2PR6A 5EVEA 2V9AA 2Q9NA 5KSCA 4EERA 3EGXC 2VGLS 4H6JA 3LEZA 5AQBA 1NY0A 3NIAA 4ZTKA 1MY8A 2KDKA 3AGEA 3MJQA 4EWFA 2GZAA 4WZ5C 1LHYA 5F5YA 3SZTA 1CJFA 3S7NA 3G34A 1Y54A 4WUJA 2NUPC 1N9BA 3A0SA 1ERQA 3W4PA 2O9BA 4D60A 1LI9A 5HWTA 5E43A 3LY4A 4LCLA 2OOLA 4FOFA 4JLFA 4UAAA 3N7WA 2PBDP 1NLYA 1H0MA 2AVXA 2PBYA 3MMHA 4DF6A 4EQ1A 1WA9A 3ZG5A 1ES3A 3BY9A 5C5KA 3WWXA 5EUAA 3JYIA 2Z2LB 3S7PA 4EESA 4BWIA 4OOLA 3OPLA 3BECA 4EUZA 4EEUA 4Y2FA 3LIBA 3ZHHA 2JCHA 1YLZA 3OPRA 5CX7A 3O87A 3GVBA 3BM6A 3ZVTA 3NC8A 5DF8A 2M7VA 1K4EA 3IHAA 4O8GA 4OP5A 4IBXA 2DNSA 3S22A 1LSWA 3C8CA 4LV1A 1E3UD 2RCXA 5EE8A 2R9WA 4OKPA 2P7JA 2IWBA 2BTFP 1FR1A 2VA0A 2X71A 4RA7A 2ZM0A 3DAVA 4QY5A 1K4FA 4L9FA 1M40A 1GA0A 4M4XA 1T1BA 3BQ8A 3LO7A 3CZDA 3G6OA 3ULFA 4RVAA 4GZBA 5EOOA 2K2NA 1H8YA 1QMFA 4ME4A 3HJKA 4WMCD 1SHVA 5IHVA 3DTKA 4BENA 3N6IA 5DTKA 2EX2A 5L09A 5EOEA 1GA9A 4Q0HA 3LR3A 4BQMA 1IYQA 4ETZA 1ZG6A 5I94A 5CHUA 4F3LA 1KE4A 2Y2HA 3QP5A 3MR0A 2M7UA 2J3TC 3B42A 5IT5A 3FPVA 3BFCA 4HH3A 5TFQA 3E4OA 3G30A 1MC0A 2JC7A 3IF5A 3ZFZA 3NECA 1G68A 1ZC2A 1DJAA 2KLIA 3U2AA 4LV2A 3IX4A 5GLCA 5FASA 1XJ2A 5I5LA 2XD1A 1NWZA 3MKEA 1L2SA 3QP1A 4NEED 1HZOA 2Y2OA 2VK3A 2V20A 3O86A 2V0UA 4NG2A 1S4SA 1G6AA 4UQIM 3SS3A 2QMIA 2P74A 2VV6A 2A24B 2ZC5B 1W63Q 5CGXA 3G32A 4LGWA 4E3MA 3LCEA 2I72A 3Q1FA 4MNRA 5A8BA 3ZDJA 3IHBA
chains in the Genus database with same CATH topology
5GHXA 4OP8A 4KZ7A 5E2GA 4WZ5A 5L2FA 3EQVA 3NDGA 3GR2A 1EI5A 4LV3A 3AGFA 5CHMA 1VM1A 4JXGA 3IXDA 1E3UA 1PW8A 3ISGA 3G2ZA 3NDEA 4JPMA 4BL3A 4KZ6A 1FOFA 1NYMA 2WGVA 2ZD8A 3HVFA 1KE0A 3FV7A 4S2PA 3NI9A 4S2LA 3WS2A 2V1ZA 4FD8A 3MZEA 3VP1A 1PI4A 3S4XA 2XF3A 5AQAA 2P9VA 4E6WA 4IBRA 4MLLA 2QZ6A 3BLMA 5GHYA 1CEGA 3UPPA 1GHIA 1XX2A 2HPBA 5GHZA 4MBHA 4KG5A 1XA1A 3RXWA 5HL1A 1LL9A 2Y2KA 3CJMA 3IXGA 4JXSA 5EVIC 2Y55A 3N8RA 5CHJA 1JWZA 1K57C 1GCEA 1KVMA 4OLGA 1K54C 4ZJ3A 5U47A 4E6XA 1EWZA 4OOMA 1PWDA 4E3OA 1L0FA 4OLDA 4NK3A 1XPBA 3LY3A 4X6TA 3PBSA 2ZC7A 2XFSA 3P98A 4R23A 2P9VB 1NZUA 1HTZA 4GNUA 4QY6A 1CI8A 2J9PA 2A49A 2XK1A 4WMCA 3W8KA 3N8LA 3DWKA 1YQSA 5CEDA 1PZOA 4S2NC 4X53A 4BLMA 1WYBA 3P09A 3UNWA 1ONHA 5HAPA 2H0YA 5CGWA 4PM8A 3OPHA 2EX6A 4R0QA 4GOGA 4K0WA 2HDSA 1ZKJA 2Q9MA 3N4IA 1DJBA 4OPRA 5F1FA 2G2UA 3A3EA 2C6WB 4ZDXA 3ZG0A 2G2WA 4Q8IA 3SS4A 1MWSA 1BULA 3PBNA 4OQHA 1ESIA 1XP4A 1U60A 4Y0OA 3HLDA 5HFOA 2Y2GA 4OQIA 4YINA 3VP2A 4E3IA 4OOYA 1TDLA 4KZ4A 4PMAA 2WGIA 2JBFA 3BFEA 1FCOA 2HP9A 1K55C 2J9OA 3OCNA 2WAEA 3WS4A 1MXOA 3ZG9B 2XGNA 2R9XA 3C7VA 1JTGA 1IYSA 1S6RA 3SOIA 5DF7A 4X56A 3TOIA 5JYOA 1W79A 3MXRA 4MBFA 4Z9QA 3PBRA 1K6RA 4UHUA 5A92A 1FSYA 4KG2A 1I2SA 4WYYA 1Q2PA 3Q82A 2EFXA 1RGYA 4N9LA 5BOHA 2ZQAA 1HD8A 5CTNA 4OVDA 4R1GA 5FAQA 3SH7A 3CG5A 1BLPA 3G31A 5HW3A 4LCMA 2GDNA 4R3JA 4S2MA 5CERA 1PWCA 1YT4A 5JYPA 4PM9A 2Y4AA 1JVJA 3DW0A 4S2KA 1MKIA 3ITAA 1L0DA 3O88A 4GB7A 5CTMA 4ZAMA 5EVID 4OQ0A 3BFDA 4B4XA 1ES4A 4KQOA 4QB8A 3IWOA 2Y59A 1TEMA 4KZ9A 4KZBA 4C75A 4U0XA 5M19A 4JBFA 1JTDA 4IEDA 3UDXA 3PBTA 1W5DA 2ZC4B 2H0TA 1PIOA 3B3XA 3OPPA 4GN2A 1K56D 1KGFA 2DCFA 3VFHA 4JF6A 3M2JA 1JWPA 1HVBA 1IKGA 4ID4A 3VP4A 1K6SA 4DKIA 1S0WA 3N8SA 5HAIA 2VGJA 3HUNA 3GQZA 2WAFA 4DE1A 4KZAA 3RJUA 3HUOA 4B88A 3M6HA 1LI0A 2ZQ8A 2UWXA 4DRTA 3BFGA 4EBPA 4KQQA 3ZCZA 1IYPA 3MZFA 2PU4A 3SH9A 1GHPA 1YLPA 4DXBA 5FI6A 1FSWA 1GHMA 3IXHA 3HUMA 4N1HA 1N4OA 5FI7A 2WUQA 3FKVA 2BLSA 4DXCA 1TVFA 3IWIA 1RGZA 1KGEA 2QPNA 4M3KA 4X69A 1Z6FA 1ERMA 4UA6A 4XUZA 4WEKA 5FAOA 4FCFA 2JE5A 1IEMA 2Y2MA 3V3SA 4QHCA 4H8RA 2Y2IA 4UA9A 3M2KA 3OCLA 4U3TA 2BG1A 4BJPA 1K55A 4WZ4A 1K25A 5J8XA 3OZHA 1CK3A 1I2WA 1DJCA 1IELA 4DE0A 2Y2LA 2CC1A 3G35A 3HBRA 4UA7A 3FWLA 4WEJA 3IXBA 4PPRA 5FQMA 4Y0UA 4L0LA 1MPLA 1Q2QA 1ES2A 5FQIA 4R4SA 2WGWB 4N92A 2HDQA 4FH2A 4JXVA 4A5RA 4E3LA 1I5QA 4YFMA 5A91A 2J8YA 2HP6A 3A3IA 1K38A 3OC2A 1NXYA 4PM6A 3ITBA 1KGGA 2OLVA 4R3BA 1LLBA 4OPYA 4K91A 1O07A 1XXMA 4OONA 4B4ZA 5TR7A 1NRFA 1XGJA 1BLHA 4GD8A 3VP3A 1TDGA 1QMEA 4E3KA 3C5AA 3IF6C 5F1GA 3UN7A 3UY6A 1FR6A 3WS0A 5M18A 3Q7ZA 3PAGA 2E8IA 2FFFB 3IH9A 3UPOA 3M6BA 5FDHA 4C6YA 2WYXA 1BZAA 2IWDA 1EROA 2IWCA 3SH8A 5FSRA 2WKHA 2Q9NA 5KSCA 4OQGA 2Z2MB 3QHYA 3W4OA 4X55A 1L0EA 3C7UA 3PAEA 4CJNA 4QJGA 2EXBA 3LEZA 2ZM2A 4WELA 5AQBA 1NY0A 5GLAA 3WS1A 1ONGA 4CPKA 3BYDA 2V2FF 4U0TA 3EQUA 4MEZA 3NIAA 3UDIA 1SKFA 2WK0A 4JKTA 4C3QA 1YMXA 3PBOA 3GRJA 4ZTKA 4DE3A 1MWUA 1MY8A 5DF9A 3HLFA 3AGEA 5F82A 2XEPA 4JF5A 4EWFA 4WZ5C 1SDEA 1LHYA 3FKWA 5GLDA 3VSLA 2OV5A 3NBLA 4HESA 4ZJ1A 3G34A 2EX8A 2ZC6B 1Y54A 1YM1A 1CEFA 3PBQA 4K0XA 1E4DA 4OPQA 1N9BA 3Q07A 1ERQA 3S1YA 3W4PA 3TG9A 4PM7A 5DTSA 1LI9A 1J9MA 4KZ8A 2Y2NA 3IH8A 3VMAA 4FSFA 5E43A 3LY4A 4N9KA 4LCLA 2C5WB 5A93A 2HDUA 3PTEA 5CECA 1MBLA 4UAAA 4JLFA 5CGSA 2HDRA 3N7WA 3DWZA 5AQ7A 5EVIA 4WBGA 5FQKA 1K57A 1K54A 2ZQDA 1ZG4A 3D4FA 1KVLA 4KG6A 1M6KA 4DDSA 2ZC3B 3HLEA 2PBYA 2ZJ9A 3VOYA 4DF6A 1BTLA 1K56A 1KDSA 1L0GA 1SCWA 5FAPA 4QD4A 3VSKA 3ZG8B 3WS5A 3ZG5A 4JXWA 1SDNA 1ES5A 3BLSA 3UE3A 1VQQA 3IWQA 1ES3A 4S2NA 4IVKA 3WWXA 2WKIA 5EUAA 3JYIA 3UE1A 4DDYA 4EBNA 2B5RA 1NZOA 2Z2LB 3BFFA 1YLTA 1FCNA 5EVIB 1XGIA 3CMZA 4OOLA 3IT9A 3BECA 3OPLA 3WRTA 3WRZA 5E2HA 4EUZA 3GV9A 4HBUA 1DY6A 1W7FA 4KENB 3MKFA 1BSGA 4E3NA 3ZHHA 2XFTA 2JCHA 4S2JA 2WGWA 2VGKA 3ZNYA 1WYCA 1YLZA 3HLWA 3HLGA 3OPRA 3O87A 4KZ3A 3GVBA 3BM6A 3VP0A 4GKUA 5CRFA 5FATA 3IF6B 1C3BA 1FCMA 3I7JA 2ZM8A 1JWVA 4RX3A 3ZGAB 3ZVTA 4RYEA 3NC8A 5DF8A 3UE0A 1NYYA 2XH9A 2Y91A 4PM5A 1K4EA 3Q7VB 3IHAA 5FA7A 1XKZA 1PI5A 1PWGA 2HP5A 3FZCA 4IBXA 3DTMA 4OP5A 4WM9A 5E2FA 4ZBEA 2DNSA 2OSUA 5HAQA 5FQ9A 3S22A 4P85A 4GD6A 4LV1A 3E2KA 1E3UD 2XQZA 2RCXA 5EE8A 4HEFA 2R9WA 2XLNA 2WADA 4OKPA 3HREA 3A3DA 2IWBA 2Y2PA 1FR1A 1OMEA 4DE2A 1AXBA 5EPHA 3SS5A 4EV4A 5GL9A 5KMWA 2X71A 3G2YA 5GLBA 3A3FA 3C4PA 1BLCA 4JF4A 4RA7A 1MWRA 4OPZA 2ZM0A 1FQGA 4KQRA 1NJ4A 4MBKA 4QY5A 1K4FA 1KE3A 5M1AA 2WZXA 3Q81A 1M40A 1GA0A 2WZZA 4GDBA 4NETA 1ALQA 4OH0A 5FI2A 2RL3A 3LO7A 1KDWA 3CZDA 3NCKA 3ZG7B 1W8YA 4RVAA 4GZBA 1W8QA 2J7VA 5EOOA 4Y0TA 1IKIA 5A90A 3V39A 2A3UA 5G18A 1YMSA 1YLYA 1H8YA 1QMFA 4ZJ2A 1YLJA 4P87A 4N1XA 1SHVA 3FYZA 4WMCD 5IHVA 1RP5A 3NY4A 5F83A 4BENA 3A3JA 3N6IA 5DTKA 2EX2A 4HBTA 3VOZA 1ESUA 3GMWA 3QNBA 1YLWA 4XXRA 3MFDA 1GA9A 5EOEA 3QNCA 3ZVWA 1WE4A 2EX9A 2ZMAA 3MXSA 2EXAA 4QU3A 3IQAA 4LV0A 5CEBA 4RX2A 5EVLA 3UDFA 3BRMA 4BQMA 1IYQA 1LL5A 3G4PA 5HX9A 1O7EA 2DRWA 4D2OA 2ZQCA 1ZG6A 3W4QA 3MBZA 5I94A 1BUEA 5CHUA 1KE4A 2Y2HA 4S2OA 4EQIA 2H10A 3VFFA 5KZHA 2XR0A 4EBLA 3BFCA 3AGDA 5TFQA 2ZQ7A 4O7DA 4P0MA 3O3VA 5TGFA 4GDNA 3V50A 3G30A 4IVIA 2Y2JA 1PZPA 2ZQ9A 5DVAA 2X02A 5D3OA 2JC7A 4LENA 4KZ5A 3IF5A 2EFUA 2Y2QA 4XUXA 3E2LA 2XDMA 1PW1A 5AQ9A 3RXXA 3ZFZA 5E2EA 5FQJA 2ZLYA 4Y7PA 2PU2A 3C4OA 1G68A 5EECA 1E25A 1ZC2A 1DJAA 1XA7A 3HLBA 3IF6A 4LV2A 1CI9A 5GLCA 1RCJA 5FASA 3V3RA 1BT5A 1MWTA 2XD1A 3HLCA 2X01A 4F94A 3MKEA 1L2SA 1H8ZA 3GSGA 3Q7VA 4P6BA 5HARA 5FQQA 3GTCA 1HZOA 2Y2OA 3BEBA 4BD1A 2OLUA 2V20A 5DTTA 3O86A 4FH4A 3TSGA 3MZDA 3UO9A 4X68A 1G6AA 2FFYA 4E3JA 3SS3A 2QMIA 2XD5A 2P74A 4R4RA 1IYOA 5CXWA 2H5SA 2ZC5B 3HL9A 5KSHA 1H5XA 5CGXA 3UPNA 3G32A 1PYYA 4S2IA 4E3MA 2WKEA 3LCEA 2I72A 3Q1FA 4MNRA 4BL2A 4BD0A 3ZDJA 3V5MA 3ZNTA 1BLSA 3IHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GHX A;  4OP8 A;  4KZ7 A;  5E2G A;  4WZ5 A;  5L2F A;  3EQV A;  3NDG A;  3GR2 A;  1EI5 A;  4LV3 A;  3AGF A;  5CHM A;  1VM1 A;  4JXG A;  3IXD A;  1E3U A;  1PW8 A;  3ISG A;  3G2Z A;  3NDE A;  4JPM A;  4BL3 A;  4KZ6 A;  1FOF A;  1NYM A;  2WGV A;  2ZD8 A;  3HVF A;  1KE0 A;  3FV7 A;  4S2P A;  3NI9 A;  4S2L A;  3WS2 A;  2V1Z A;  4FD8 A;  3MZE A;  3VP1 A;  1PI4 A;  3S4X A;  2XF3 A;  5AQA A;  2P9V A;  4E6W A;  4IBR A;  4MLL A;  2QZ6 A;  3BLM A;  5GHY A;  1CEG A;  3UPP A;  1GHI A;  1XX2 A;  2HPB A;  5GHZ A;  4MBH A;  4KG5 A;  1XA1 A;  3RXW A;  5HL1 A;  1LL9 A;  2Y2K A;  3CJM A;  3IXG A;  4JXS A;  5EVI C;  2Y55 A;  3N8R A;  5CHJ A;  1JWZ A;  1K57 C;  1GCE A;  1KVM A;  4OLG A;  1K54 C;  4ZJ3 A;  5U47 A;  4E6X A;  1EWZ A;  4OOM A;  1PWD A;  4E3O A;  1L0F A;  4OLD A;  4NK3 A;  1XPB A;  3LY3 A;  4X6T A;  3PBS A;  2ZC7 A;  2XFS A;  3P98 A;  4R23 A;  2P9V B;  1NZU A;  1HTZ A;  4GNU A;  4QY6 A;  1CI8 A;  2J9P A;  2A49 A;  2XK1 A;  4WMC A;  3W8K A;  3N8L A;  3DWK A;  1YQS A;  5CED A;  1PZO A;  4S2N C;  4X53 A;  4BLM A;  1WYB A;  3P09 A;  3UNW A;  1ONH A;  5HAP A;  2H0Y A;  5CGW A;  4PM8 A;  3OPH A;  2EX6 A;  4R0Q A;  4GOG A;  4K0W A;  2HDS A;  1ZKJ A;  2Q9M A;  3N4I A;  1DJB A;  4OPR A;  5F1F A;  2G2U A;  3A3E A;  2C6W B;  4ZDX A;  3ZG0 A;  2G2W A;  4Q8I A;  3SS4 A;  1MWS A;  1BUL A;  3PBN A;  4OQH A;  1ESI A;  1XP4 A;  1U60 A;  4Y0O A;  3HLD A;  5HFO A;  2Y2G A;  4OQI A;  4YIN A;  3VP2 A;  4E3I A;  4OOY A;  1TDL A;  4KZ4 A;  4PMA A;  2WGI A;  2JBF A;  3BFE A;  1FCO A;  2HP9 A;  1K55 C;  2J9O A;  3OCN A;  2WAE A;  3WS4 A;  1MXO A;  3ZG9 B;  2XGN A;  2R9X A;  3C7V A;  1JTG A;  1IYS A;  1S6R A;  3SOI A;  5DF7 A;  4X56 A;  3TOI A;  5JYO A;  1W79 A;  3MXR A;  4MBF A;  4Z9Q A;  3PBR A;  1K6R A;  4UHU A;  5A92 A;  1FSY A;  4KG2 A;  1I2S A;  4WYY A;  1Q2P A;  3Q82 A;  2EFX A;  1RGY A;  4N9L A;  5BOH A;  2ZQA A;  1HD8 A;  5CTN A;  4OVD A;  4R1G A;  5FAQ A;  3SH7 A;  3CG5 A;  1BLP A;  3G31 A;  5HW3 A;  4LCM A;  2GDN A;  4R3J A;  4S2M A;  5CER A;  1PWC A;  1YT4 A;  5JYP A;  4PM9 A;  2Y4A A;  1JVJ A;  3DW0 A;  4S2K A;  1MKI A;  3ITA A;  1L0D A;  3O88 A;  4GB7 A;  5CTM A;  4ZAM A;  5EVI D;  4OQ0 A;  3BFD A;  4B4X A;  1ES4 A;  4KQO A;  4QB8 A;  3IWO A;  2Y59 A;  1TEM A;  4KZ9 A;  4KZB A;  4C75 A;  4U0X A;  5M19 A;  4JBF A;  1JTD A;  4IED A;  3UDX A;  3PBT A;  1W5D A;  2ZC4 B;  2H0T A;  1PIO A;  3B3X A;  3OPP A;  4GN2 A;  1K56 D;  1KGF A;  2DCF A;  3VFH A;  4JF6 A;  3M2J A;  1JWP A;  1HVB A;  1IKG A;  4ID4 A;  3VP4 A;  1K6S A;  4DKI A;  1S0W A;  3N8S A;  5HAI A;  2VGJ A;  3HUN A;  3GQZ A;  2WAF A;  4DE1 A;  4KZA A;  3RJU A;  3HUO A;  4B88 A;  3M6H A;  1LI0 A;  2ZQ8 A;  2UWX A;  4DRT A;  3BFG A;  4EBP A;  4KQQ A;  3ZCZ A;  1IYP A;  3MZF A;  2PU4 A;  3SH9 A;  1GHP A;  1YLP A;  4DXB A;  5FI6 A;  1FSW A;  1GHM A;  3IXH A;  3HUM A;  4N1H A;  1N4O A;  5FI7 A;  2WUQ A;  3FKV A;  2BLS A;  4DXC A;  1TVF A;  3IWI A;  1RGZ A;  1KGE A;  2QPN A;  4M3K A;  4X69 A;  1Z6F A;  1ERM A;  4UA6 A;  4XUZ A;  4WEK A;  5FAO A;  4FCF A;  2JE5 A;  1IEM A;  2Y2M A;  3V3S A;  4QHC A;  4H8R A;  2Y2I A;  4UA9 A;  3M2K A;  3OCL A;  4U3T A;  2BG1 A;  4BJP A;  1K55 A;  4WZ4 A;  1K25 A;  5J8X A;  3OZH A;  1CK3 A;  1I2W A;  1DJC A;  1IEL A;  4DE0 A;  2Y2L A;  2CC1 A;  3G35 A;  3HBR A;  4UA7 A;  3FWL A;  4WEJ A;  3IXB A;  4PPR A;  5FQM A;  4Y0U A;  4L0L A;  1MPL A;  1Q2Q A;  1ES2 A;  5FQI A;  4R4S A;  2WGW B;  4N92 A;  2HDQ A;  4FH2 A;  4JXV A;  4A5R A;  4E3L A;  1I5Q A;  4YFM A;  5A91 A;  2J8Y A;  2HP6 A;  3A3I A;  1K38 A;  3OC2 A;  1NXY A;  4PM6 A;  3ITB A;  1KGG A;  2OLV A;  4R3B A;  1LLB A;  4OPY A;  4K91 A;  1O07 A;  1XXM A;  4OON A;  4B4Z A;  5TR7 A;  1NRF A;  1XGJ A;  1BLH A;  4GD8 A;  3VP3 A;  1TDG A;  1QME A;  4E3K A;  3C5A A;  3IF6 C;  5F1G A;  3UN7 A;  3UY6 A;  1FR6 A;  3WS0 A;  5M18 A;  3Q7Z A;  3PAG A;  2E8I A;  2FFF B;  3IH9 A;  3UPO A;  3M6B A;  5FDH A;  4C6Y A;  2WYX A;  1BZA A;  2IWD A;  1ERO A;  2IWC A;  3SH8 A;  5FSR A;  2WKH A;  2Q9N A;  5KSC A;  4OQG A;  2Z2M B;  3QHY A;  3W4O A;  4X55 A;  1L0E A;  3C7U A;  3PAE A;  4CJN A;  4QJG A;  2EXB A;  3LEZ A;  2ZM2 A;  4WEL A;  5AQB A;  1NY0 A;  5GLA A;  3WS1 A;  1ONG A;  4CPK A;  3BYD A;  2V2F F;  4U0T A;  3EQU A;  4MEZ A;  3NIA A;  3UDI A;  1SKF A;  2WK0 A;  4JKT A;  4C3Q A;  1YMX A;  3PBO A;  3GRJ A;  4ZTK A;  4DE3 A;  1MWU A;  1MY8 A;  5DF9 A;  3HLF A;  3AGE A;  5F82 A;  2XEP A;  4JF5 A;  4EWF A;  4WZ5 C;  1SDE A;  1LHY A;  3FKW A;  5GLD A;  3VSL A;  2OV5 A;  3NBL A;  4HES A;  4ZJ1 A;  3G34 A;  2EX8 A;  2ZC6 B;  1Y54 A;  1YM1 A;  1CEF A;  3PBQ A;  4K0X A;  1E4D A;  4OPQ A;  1N9B A;  3Q07 A;  1ERQ A;  3S1Y A;  3W4P A;  3TG9 A;  4PM7 A;  5DTS A;  1LI9 A;  1J9M A;  4KZ8 A;  2Y2N A;  3IH8 A;  3VMA A;  4FSF A;  5E43 A;  3LY4 A;  4N9K A;  4LCL A;  2C5W B;  5A93 A;  2HDU A;  3PTE A;  5CEC A;  1MBL A;  4UAA A;  4JLF A;  5CGS A;  2HDR A;  3N7W A;  3DWZ A;  5AQ7 A;  5EVI A;  4WBG A;  5FQK A;  1K57 A;  1K54 A;  2ZQD A;  1ZG4 A;  3D4F A;  1KVL A;  4KG6 A;  1M6K A;  4DDS A;  2ZC3 B;  3HLE A;  2PBY A;  2ZJ9 A;  3VOY A;  4DF6 A;  1BTL A;  1K56 A;  1KDS A;  1L0G A;  1SCW A;  5FAP A;  4QD4 A;  3VSK A;  3ZG8 B;  3WS5 A;  3ZG5 A;  4JXW A;  1SDN A;  1ES5 A;  3BLS A;  3UE3 A;  1VQQ A;  3IWQ A;  1ES3 A;  4S2N A;  4IVK A;  3WWX A;  2WKI A;  5EUA A;  3JYI A;  3UE1 A;  4DDY A;  4EBN A;  2B5R A;  1NZO A;  2Z2L B;  3BFF A;  1YLT A;  1FCN A;  5EVI B;  1XGI A;  3CMZ A;  4OOL A;  3IT9 A;  3BEC A;  3OPL A;  3WRT A;  3WRZ A;  5E2H A;  4EUZ A;  3GV9 A;  4HBU A;  1DY6 A;  1W7F A;  4KEN B;  3MKF A;  1BSG A;  4E3N A;  3ZHH A;  2XFT A;  2JCH A;  4S2J A;  2WGW A;  2VGK A;  3ZNY A;  1WYC A;  1YLZ A;  3HLW A;  3HLG A;  3OPR A;  3O87 A;  4KZ3 A;  3GVB A;  3BM6 A;  3VP0 A;  4GKU A;  5CRF A;  5FAT A;  3IF6 B;  1C3B A;  1FCM A;  3I7J A;  2ZM8 A;  1JWV A;  4RX3 A;  3ZGA B;  3ZVT A;  4RYE A;  3NC8 A;  5DF8 A;  3UE0 A;  1NYY A;  2XH9 A;  2Y91 A;  4PM5 A;  1K4E A;  3Q7V B;  3IHA A;  5FA7 A;  1XKZ A;  1PI5 A;  1PWG A;  2HP5 A;  3FZC A;  4IBX A;  3DTM A;  4OP5 A;  4WM9 A;  5E2F A;  4ZBE A;  2DNS A;  2OSU A;  5HAQ A;  5FQ9 A;  3S22 A;  4P85 A;  4GD6 A;  4LV1 A;  3E2K A;  1E3U D;  2XQZ A;  2RCX A;  5EE8 A;  4HEF A;  2R9W A;  2XLN A;  2WAD A;  4OKP A;  3HRE A;  3A3D A;  2IWB A;  2Y2P A;  1FR1 A;  1OME A;  4DE2 A;  1AXB A;  5EPH A;  3SS5 A;  4EV4 A;  5GL9 A;  5KMW A;  2X71 A;  3G2Y A;  5GLB A;  3A3F A;  3C4P A;  1BLC A;  4JF4 A;  4RA7 A;  1MWR A;  4OPZ A;  2ZM0 A;  1FQG A;  4KQR A;  1NJ4 A;  4MBK A;  4QY5 A;  1K4F A;  1KE3 A;  5M1A A;  2WZX A;  3Q81 A;  1M40 A;  1GA0 A;  2WZZ A;  4GDB A;  4NET A;  1ALQ A;  4OH0 A;  5FI2 A;  2RL3 A;  3LO7 A;  1KDW A;  3CZD A;  3NCK A;  3ZG7 B;  1W8Y A;  4RVA A;  4GZB A;  1W8Q A;  2J7V A;  5EOO A;  4Y0T A;  1IKI A;  5A90 A;  3V39 A;  2A3U A;  5G18 A;  1YMS A;  1YLY A;  1H8Y A;  1QMF A;  4ZJ2 A;  1YLJ A;  4P87 A;  4N1X A;  1SHV A;  3FYZ A;  4WMC D;  5IHV A;  1RP5 A;  3NY4 A;  5F83 A;  4BEN A;  3A3J A;  3N6I A;  5DTK A;  2EX2 A;  4HBT A;  3VOZ A;  1ESU A;  3GMW A;  3QNB A;  1YLW A;  4XXR A;  3MFD A;  1GA9 A;  5EOE A;  3QNC A;  3ZVW A;  1WE4 A;  2EX9 A;  2ZMA A;  3MXS A;  2EXA A;  4QU3 A;  3IQA A;  4LV0 A;  5CEB A;  4RX2 A;  5EVL A;  3UDF A;  3BRM A;  4BQM A;  1IYQ A;  1LL5 A;  3G4P A;  5HX9 A;  1O7E A;  2DRW A;  4D2O A;  2ZQC A;  1ZG6 A;  3W4Q A;  3MBZ A;  5I94 A;  1BUE A;  5CHU A;  1KE4 A;  2Y2H A;  4S2O A;  4EQI A;  2H10 A;  3VFF A;  5KZH A;  2XR0 A;  4EBL A;  3BFC A;  3AGD A;  5TFQ A;  2ZQ7 A;  4O7D A;  4P0M A;  3O3V A;  5TGF A;  4GDN A;  3V50 A;  3G30 A;  4IVI A;  2Y2J A;  1PZP A;  2ZQ9 A;  5DVA A;  2X02 A;  5D3O A;  2JC7 A;  4LEN A;  4KZ5 A;  3IF5 A;  2EFU A;  2Y2Q A;  4XUX A;  3E2L A;  2XDM A;  1PW1 A;  5AQ9 A;  3RXX A;  3ZFZ A;  5E2E A;  5FQJ A;  2ZLY A;  4Y7P A;  2PU2 A;  3C4O A;  1G68 A;  5EEC A;  1E25 A;  1ZC2 A;  1DJA A;  1XA7 A;  3HLB A;  3IF6 A;  4LV2 A;  1CI9 A;  5GLC A;  1RCJ A;  5FAS A;  3V3R A;  1BT5 A;  1MWT A;  2XD1 A;  3HLC A;  2X01 A;  4F94 A;  3MKE A;  1L2S A;  1H8Z A;  3GSG A;  3Q7V A;  4P6B A;  5HAR A;  5FQQ A;  3GTC A;  1HZO A;  2Y2O A;  3BEB A;  4BD1 A;  2OLU A;  2V20 A;  5DTT A;  3O86 A;  4FH4 A;  3TSG A;  3MZD A;  3UO9 A;  4X68 A;  1G6A A;  2FFY A;  4E3J A;  3SS3 A;  2QMI A;  2XD5 A;  2P74 A;  4R4R A;  1IYO A;  5CXW A;  2H5S A;  2ZC5 B;  3HL9 A;  5KSH A;  1H5X A;  5CGX A;  3UPN A;  3G32 A;  1PYY A;  4S2I A;  4E3M A;  2WKE A;  3LCE A;  2I72 A;  3Q1F A;  4MNR A;  4BL2 A;  4BD0 A;  3ZDJ A;  3V5M A;  3ZNT A;  1BLS A;  3IHB A; 
#chains in the Genus database with same CATH topology
 4OP8 A;  1L3L A;  3EQV A;  5CHM A;  1VM1 A;  3IXD A;  4JPM A;  3ISG A;  2W1T B;  3G2Z A;  4BL3 A;  4KZ6 A;  1VEU B;  1FOF A;  1XJ3 A;  2ZD8 A;  4S2L A;  1FIK A;  4FD8 A;  3GEC A;  1TS8 A;  4E6W A;  2HJE A;  3KSG A;  3UPP A;  1GHI A;  4KG5 A;  1XA1 A;  4WLA A;  5HL1 A;  2Y2K A;  4HP9 A;  3FC7 A;  5HDC A;  4ZJ3 A;  4OOM A;  1PWD A;  4E3O A;  3VE4 A;  4EET B;  3MXQ A;  2XFS A;  2P9V B;  2ZOH A;  2J9P A;  2XK1 A;  2A49 A;  3N8L A;  2K7S A;  3KO6 A;  4BLM A;  1GSV A;  1XFN A;  5HAP A;  3UE6 A;  4R0Q A;  4K0W A;  4G3W A;  2EA9 A;  2Q9M A;  3LEQ A;  4ZDX A;  1UWN X;  2OAQ 1;  2QKP A;  3BWL A;  1ESI A;  1U60 A;  3HLD A;  5HFO A;  2Y2G A;  4YIN A;  4E3I A;  3L7H A;  3HJI A;  2WGI A;  3QP6 A;  1FCO A;  3B33 A;  3C38 A;  1V9Y A;  3KSI A;  2WAE A;  3ZG9 B;  2W3E A;  1JTG A;  1S6R A;  5DF7 A;  3TOI A;  4H6J B;  1H8M A;  3MXR A;  4MBF A;  4Z9Q A;  3KYZ A;  2UV0 E;  3NOU C;  1Q2P A;  3Q82 A;  2Q0O A;  5CTN A;  4YWZ A;  2XA7 S;  2VLG A;  5HW3 A;  5JYP A;  2ZL1 A;  1PWC A;  2OAP 1;  3DW0 A;  2O99 A;  3BFD A;  3T4T A;  3IWO A;  4KZ9 A;  5M19 A;  4U0X A;  4JBF A;  1OJG A;  3UDX A;  3OPP A;  1K56 D;  2DCF A;  4JF6 A;  1IKG A;  2JKR M;  4DKI A;  5HAI A;  3HUN A;  3HUO A;  5TBM A;  2UWX A;  4EBP A;  1IYP A;  3SW1 A;  1YLP A;  4DXB A;  5FI6 A;  1FSW A;  3KSH A;  3E0Y A;  4DXC A;  2VV8 A;  4M3K A;  1Z6F A;  4UA6 A;  3JPU A;  4WEK A;  4PAU A;  2Y2M A;  4H8R A;  2Y2I A;  3M2K A;  4CLC E;  2BG1 A;  1K55 A;  1K25 A;  5J8X A;  1IEL A;  1MZU A;  5HZH A;  2Y2L A;  3G35 A;  2XA7 M;  4PPR A;  4L0L A;  1CF0 A;  4G3V A;  2HDQ A;  4FH2 A;  4E3L A;  2LB5 A;  3A3I A;  3S7O A;  1NXY A;  1FIL A;  4R6L A;  1N9N A;  4K91 A;  4OON A;  3UME A;  5TR7 A;  3F1N A;  3C5A A;  5F1G A;  4Y3I A;  3Q7Z A;  3UPO A;  4C6Y A;  1BZA A;  3SH8 A;  5FSR A;  4OQG A;  3QHY A;  3W4O A;  1L0E A;  3C7U A;  3PAE A;  4IHQ A;  2GX5 A;  5GLA A;  3BYD A;  5DJU A;  2V2F F;  4U0T A;  3EQU A;  4MEZ A;  3UDI A;  4C3Q A;  1SKF A;  2WK0 A;  5DFX A;  3GRJ A;  3W2Z A;  3CIT A;  5DF9 A;  4MN6 A;  2XEP A;  4EUV A;  3FKW A;  1N9L A;  3VSL A;  4O01 A;  2ZC6 B;  1YM1 A;  4OPQ A;  4HHD A;  3PHY A;  4PM7 A;  5DTS A;  1J9M A;  4EEP A;  2D02 A;  4KZ8 A;  2Y2N A;  2WKR A;  3UB8 A;  3DWZ A;  4FUW A;  2Y8H A;  4NKP A;  5AQ7 A;  5EVI A;  2W0N A;  2QJ5 A;  2VX8 A;  2ZC3 B;  2W3G A;  2JKG A;  4II7 A;  5HWV A;  1SKO B;  4F3L B;  3ZG8 B;  1D06 A;  2M1C A;  3IWQ A;  4S2N A;  3OLO A;  2WKI A;  3UE1 A;  2JKR I;  1XGI A;  3CMZ A;  4CLC D;  3WRT A;  3LIF A;  4NXE A;  4HBU A;  1DY6 A;  1W7F A;  2XFT A;  4S2J A;  3IX3 A;  3K2N A;  5CRF A;  4WL9 A;  1OTE A;  1FCM A;  3I7J A;  2ZM8 A;  1JWV A;  4RX3 A;  3ZGA B;  4RYE A;  3C2W A;  3UE0 A;  2XH9 A;  4PHT A;  5F68 A;  2HP5 A;  3DTM A;  5E2F A;  4ZBE A;  2XQZ A;  2WAD A;  3HRE A;  5G4Z A;  4LRZ E;  1T19 A;  3IS2 A;  2DMW A;  3MSH A;  4DE2 A;  4EV4 A;  5KMW A;  3G2Y A;  5GLB A;  3LR0 A;  3TW8 A;  4JF4 A;  1FQG A;  3PXP A;  2PD8 A;  2HF6 A;  2WZX A;  3Q81 A;  3UB7 A;  4GDB A;  4NET A;  4OH0 A;  5FI2 A;  1X0O A;  3NCK A;  1W8Y A;  4HJ4 A;  1W8Q A;  4Y0T A;  4R70 A;  5G18 A;  1YMS A;  1P9W A;  4KUK A;  4HBT A;  3GMW A;  1YLW A;  2JKT M;  3ZVW A;  5CEB A;  4DJ3 A;  4RX2 A;  5EVL A;  3BRM A;  1LL5 A;  2D01 A;  5HX9 A;  1O7E A;  1N9O A;  3MBZ A;  1BUE A;  4Y13 A;  3PYP A;  1VET A;  1OT6 A;  2XR0 A;  2ZBB A;  3T1X A;  5DVA A;  1SZV A;  1XFQ A;  4XUX A;  2XDM A;  1PW1 A;  4PKY G;  5FQJ A;  4IUK A;  2P04 A;  2I9V A;  5EEC A;  1XA7 A;  3HLB A;  3IF6 A;  3NHQ A;  1T18 A;  3T1S A;  4ESP A;  3BEB A;  5DTT A;  1P0Z A;  4R38 A;  3TSG A;  3MZD A;  4E3J A;  2XD5 A;  5CXW A;  4NXG A;  5KSH A;  3T50 A;  3UPN A;  1PYY A;  4BMW A;  1S66 L;  3H82 A;  4WF0 A;  4BD0 A;  2ZL1 B;  4K0X A;  3GR2 A;  1EI5 A;  3F1O A;  4LV3 A;  1E3U A;  1PW8 A;  3NDE A;  3HCY A;  1NYM A;  3HVF A;  3NI9 A;  4MCW A;  1TS6 A;  3VP1 A;  5F6A A;  5AQA A;  2QHK A;  5HL6 A;  5TBM B;  2HPB A;  5GHZ A;  3KYE A;  4E04 A;  2YKF A;  3IXG A;  5EVI C;  1DP8 A;  1JWZ A;  1GCE A;  1KVM A;  3MQO A;  3CPT A;  3CI6 A;  4NK3 A;  3RFB A;  4X6T A;  4R23 A;  4WMC A;  3DWK A;  1YQS A;  4S2N C;  1WYB A;  3T4Q A;  4PM8 A;  3OPH A;  4UQI S;  4OPR A;  5F1F A;  3A3E A;  2JKT I;  5HWW A;  2C6W B;  3SS4 A;  1MWS A;  1XP4 A;  3F1N B;  4OQI A;  4G3K A;  4GCZ A;  3VP2 A;  4OOY A;  2JBF A;  2V8F A;  2HP9 A;  2J9O A;  4MN5 A;  2V0W A;  3C7V A;  1IYS A;  4KUO A;  1K6R A;  5DKL A;  4KG2 A;  4WYY A;  3CLO A;  1RGY A;  4HP4 A;  4IUH A;  5EM0 A;  2L0W A;  2ZQA A;  5HD3 A;  4OVD A;  4R1G A;  5FAQ A;  3CG5 A;  3G31 A;  5CER A;  1YT4 A;  4XT2 A;  4PM9 A;  1MKI A;  3ITA A;  1L0D A;  2JHE A;  3P01 A;  4ZAM A;  4OQ0 A;  4KQO A;  1JTD A;  2ZC4 B;  3B3X A;  2E8J A;  1JWP A;  1HVB A;  4ID4 A;  3VP4 A;  1K6S A;  1S0W A;  3GQZ A;  2WAF A;  4BBU A;  3M6H A;  1LI0 A;  4KQQ A;  3ZCZ A;  3MZF A;  1D1J A;  1T1C A;  3R4K A;  1P97 A;  4N1H A;  2W27 A;  2ZMF A;  2WUQ A;  2BLS A;  3EGD C;  1TVF A;  3T4O A;  1KGE A;  2QPN A;  4X69 A;  4FCF A;  2JE5 A;  1IEM A;  4U3T A;  3OZH A;  4I38 A;  4KQD A;  4DE0 A;  3IXB A;  3C30 A;  5FQM A;  1ES2 A;  2ACG A;  4R4S A;  4P6Z M;  4N92 A;  3MQQ A;  2HP6 A;  4I3A A;  3ITB A;  1KGG A;  2OLV A;  1LLB A;  1O07 A;  1XGJ A;  1BLH A;  4BBT A;  1TDG A;  1QME A;  3UY6 A;  3IF6 C;  3UN7 A;  2Z6C A;  2E8I A;  3CUE A;  2IWD A;  1ERO A;  2WKH A;  3T4S A;  1ZHH B;  4LRX C;  2Z2M B;  3F1P B;  5HSQ A;  4CJN A;  4QJG A;  4WEL A;  2ZM2 A;  3WS1 A;  4GLQ A;  4YOF A;  4JKT A;  1YMX A;  1OTD A;  4DE3 A;  2GNX A;  5F69 A;  2PAV P;  1Y4O A;  5F82 A;  1SDE A;  3NBL A;  3MQ0 A;  1LL8 A;  2O9A A;  1E4D A;  1PRQ A;  3Q07 A;  3S1Y A;  2XRO A;  1P9R A;  3TG9 A;  2VEA A;  4B93 A;  3T4K A;  3IH8 A;  4FSF A;  1S67 L;  4N9K A;  2C5W B;  2HDU A;  3PR6 A;  3PTE A;  5CEC A;  1MBL A;  2HDR A;  3BY8 A;  5FQK A;  3UB9 A;  2ZQD A;  1ZG4 A;  1M6K A;  4DDS A;  3HLE A;  2ZJ9 A;  1Y28 A;  3VOY A;  1K56 A;  1KDS A;  1L0G A;  1SCW A;  3OOV A;  5FAP A;  4QD4 A;  1V9Z A;  5IU1 A;  4QWO A;  1VQQ A;  1LSX A;  4EBN A;  3QP8 A;  4CLC B;  1NZO A;  1K0K A;  3OBF A;  3BFF A;  1MKM A;  3EEA A;  3IT9 A;  3WRZ A;  5E2H A;  3GV9 A;  1F98 A;  4YNR A;  1A0K A;  1F5M A;  1BSG A;  2GJ3 A;  4E3N A;  2WGW A;  3L9K A;  2VGK A;  1WYC A;  4KZ3 A;  3VP0 A;  3IX8 A;  1H3Q A;  3IF6 B;  4Y5F A;  2MJ6 A;  1XKZ A;  1PI5 A;  1PWG A;  4WM9 A;  5HAQ A;  2OSU A;  5FQ9 A;  3E2K A;  3K3D A;  3A3D A;  2Y2P A;  1OME A;  2EWW A;  3H9W A;  1AXB A;  5EPH A;  3SS5 A;  3H82 B;  4ARZ A;  3C4P A;  5EV0 A;  4OPZ A;  1NJ4 A;  2WZZ A;  1ALQ A;  1OTI A;  1TS0 A;  4Z1W A;  4JGR A;  1KDW A;  3ZG7 B;  3LGO A;  2OWH A;  2J7V A;  1IKI A;  3V39 A;  2A3U A;  1J3W A;  1YLY A;  4ZJ2 A;  3KSF A;  4LLO B;  4N1X A;  3FYZ A;  4O0P A;  2L4R A;  1RP5 A;  3NY4 A;  5F83 A;  3ZQ5 A;  2WKP A;  3VOZ A;  3CPT B;  3QNC A;  1WE4 A;  2EX9 A;  2ZMA A;  4QU3 A;  2EXA A;  3IQA A;  4LV0 A;  3UDF A;  3G4P A;  2DRW A;  2J3W A;  2ZQC A;  3W4Q A;  5KIZ A;  1UGU A;  4S2O A;  5MC7 A;  3VFF A;  4HJ6 A;  4EBL A;  3AGD A;  2QWS A;  4O7D A;  3NUL A;  2HZ5 A;  3O3V A;  1Z09 A;  3V50 A;  4IVI A;  2Y2J A;  2ZQ9 A;  5HPF A;  1OTB A;  4LEN A;  4KZ5 A;  1S1Y A;  3E2L A;  3RXX A;  5AQ9 A;  5E2E A;  2ZLY A;  4Y7P A;  3C4O A;  3EWK A;  3FG8 A;  4HH2 A;  4HQA A;  1RCJ A;  3V3R A;  1BT5 A;  4CLC A;  1MWT A;  2X01 A;  1H8Z A;  2B95 A;  3Q7V A;  5HAR A;  5LBR A;  5FQQ A;  4HNB A;  2OLU A;  1F2K A;  3CUE C;  4FH4 A;  3UO9 A;  2W1T A;  5IS1 A;  1VEU A;  4R4R A;  1IYO A;  3TJZ C;  2H5S A;  2A2L A;  4S2I A;  2WKE A;  3CWF A;  5K5B A;  4BL2 A;  3V5M A;  4XT2 B;  3K3C A;  5GHX A;  4KZ7 A;  2KX6 A;  2P08 A;  5L2F A;  3LR5 A;  4LFU A;  1D7E A;  4GS9 A;  1KE0 A;  3FV7 A;  3WS2 A;  2V1Z A;  2HJ9 C;  3MZE A;  1LSV A;  3D72 A;  2NUT C;  1BYW A;  2P9V A;  4IBR A;  2J3T D;  3BLM A;  1CEG A;  1DP9 A;  2PHY A;  4X1M A;  4MBH A;  1T1A A;  3T12 B;  3U4L P;  1LL9 A;  2O0Y A;  2XRN A;  3CJM A;  2Y55 A;  3N8R A;  5CHJ A;  1S4R A;  2VZW A;  5U47 A;  4E6X A;  1L0F A;  4OLD A;  3LY3 A;  3PBS A;  2ZC7 A;  1NZU A;  3KYQ A;  2PT7 A;  4QY6 A;  1IOU A;  4GW9 A;  5CED A;  1PZO A;  4X53 A;  3UB5 P;  3H7W A;  1ONH A;  2H0Y A;  3RH8 B;  3QP4 A;  4Y15 A;  2EX6 A;  4AFI A;  1ZKJ A;  1IFQ A;  2PRF A;  2ZOI A;  3ICY A;  3N4I A;  2G2U A;  1BUL A;  3PBN A;  5DKK A;  3BFE A;  1HLU P;  1K55 C;  2JKF A;  1MXO A;  2XGN A;  1YKD A;  2LB9 A;  4X56 A;  1W79 A;  3LID A;  1EW0 A;  3JVV A;  1S1Z A;  1ACF A;  3LIE A;  2EFX A;  3E98 A;  1HD8 A;  3SH7 A;  4R3J A;  5HD5 A;  3TE8 A;  2Y4A A;  1JVJ A;  4S2K A;  3T4L A;  3O88 A;  4GB7 A;  4B4X A;  1ES4 A;  4KZB A;  4PKY A;  5L10 A;  4C75 A;  4IED A;  1W5D A;  2H0T A;  1PIO A;  2VGL M;  3VFH A;  3D3O A;  3EOI A;  3LYX A;  3N8S A;  2VGJ A;  4DE1 A;  1TS7 A;  4KZA A;  1VB6 A;  5L07 A;  3BFG A;  1W63 M;  1GHP A;  1KOU A;  4HOI A;  3HUM A;  2Z6D A;  3FKV A;  5FAO A;  4QHC A;  4UA9 A;  4ZRR A;  4WZ4 A;  1CK3 A;  2IA2 A;  5FDS A;  1DJC A;  2ZMV A;  2CC1 A;  3HBR A;  3CAX A;  3NOT C;  3FWL A;  5AVE A;  1ZTU A;  4X1L A;  2WKQ A;  2XSS A;  2WGW B;  4JXV A;  2VV7 A;  4A5R A;  3T1Q B;  4HY8 A;  4YFM A;  1PNE A;  2YKH A;  4HJ3 A;  4ETX A;  4GHI A;  4R3B A;  4OPY A;  1XXM A;  2R78 A;  3QP2 A;  1TF1 A;  4GD8 A;  1G28 A;  1FR6 A;  3WS0 A;  3DTE A;  5M18 A;  4CLC C;  2QJ7 A;  1TD5 A;  3IH9 A;  5FDH A;  2WYX A;  3NOP C;  2IWC A;  4K08 A;  2B18 A;  4X55 A;  2EXB A;  1G5U A;  4ARZ B;  1ONG A;  4CPK A;  5AVF A;  3PBO A;  3R7W A;  1MWU A;  4IJG A;  3HLF A;  4EW7 A;  3O5Y A;  2QYB A;  4JF5 A;  2KOI A;  5GLD A;  2OV5 A;  4HES A;  4ZJ1 A;  2EX8 A;  3DTI A;  1CEF A;  2J80 A;  3PBQ A;  1SKO A;  4MMN A;  2HGV A;  1LT0 A;  2FZ0 A;  3VMA A;  5A93 A;  1F9I A;  5CGS A;  2W3D A;  4WBG A;  1K57 A;  4P6Z S;  1K54 A;  4KG6 A;  3D4F A;  1KVL A;  5FEF A;  3VOL A;  5FEG A;  1BTL A;  3T4J A;  5TJJ A;  2V8C A;  3VSK A;  3WS5 A;  4JXW A;  5J4E A;  1SDN A;  1ES5 A;  3BLS A;  3UE3 A;  2JN7 A;  5HDD A;  4IVK A;  4DDY A;  2PYR A;  2B5R A;  1YLT A;  1FCN A;  5EVI B;  4QPR A;  4JGQ A;  1JNU A;  4KEN B;  2G7U A;  3MKF A;  1OTA A;  3LIA A;  3ZNY A;  3HLG A;  3HLW A;  1STZ A;  3LI8 A;  4GKU A;  5FAT A;  1C3B A;  2CMN A;  1OPX A;  1NYY A;  2Y91 A;  4PM5 A;  3Q7V B;  2PYP A;  5FA7 A;  4I5S A;  3FZC A;  1DP6 A;  3FPW A;  4BBV A;  3KX0 X;  4P85 A;  4GD6 A;  3BW6 A;  3E4Q A;  4HIA A;  4HEF A;  2XLN A;  2W3H A;  2FH5 A;  5GL9 A;  3CHW P;  3VV4 A;  3A3F A;  1YSQ A;  1BLC A;  1MWR A;  2L1M A;  2PD7 A;  4KQR A;  4MBK A;  4MN7 A;  1KE3 A;  5M1A A;  4MDZ A;  4GS9 B;  1GSX A;  2RL3 A;  3JVU A;  5J7E A;  3IS2 B;  1DRM A;  4I3I A;  1G6O A;  5A90 A;  1UWP X;  4I39 A;  4JGO A;  1YLJ A;  4P87 A;  2BAS A;  3V67 A;  3A3J A;  2VJW A;  1ESU A;  3LUQ A;  3QNB A;  4XXR A;  3MFD A;  1PFL A;  3P7N A;  3MXS A;  4B9O A;  4D2O A;  4JGP A;  4EQI A;  2W3F A;  4CQH A;  2H10 A;  5KZH A;  3H7W B;  4RQ9 A;  2ZQ7 A;  4P0M A;  5TGF A;  4GDN A;  4LRY C;  4R3A A;  1PZP A;  2X02 A;  4I3J A;  5D3O A;  3B47 A;  2Y79 A;  2EFU A;  2Y2Q A;  2V1B A;  2PU2 A;  1E25 A;  3ZYT A;  1VET B;  5FL3 A;  1CI9 A;  4F94 A;  5G4Y A;  3HLC A;  3GSG A;  4P6B A;  3GTC A;  2PDR A;  4BD1 A;  3NJA A;  4X68 A;  2FFY A;  1ODV A;  3UB6 A;  3HL9 A;  4Q0I A;  1H5X A;  3ZNT A;  1BLS A;  1GSW A;  3LFV A;  5E2G A;  1NRJ A;  4WZ5 A;  3NDG A;  2OWJ A;  3AGF A;  4JXG A;  4S2P A;  2WGV A;  3T1R A;  3A0R A;  1PI4 A;  1XJ4 A;  2XF3 A;  3S4X A;  4GJ4 A;  3UMD A;  4LPZ A;  4MLL A;  2QZ6 A;  5GHY A;  1CQA A;  1XX2 A;  3RXW A;  3F1O B;  4JXS A;  1K57 C;  3E4P A;  4OLG A;  1K54 C;  1EWZ A;  4L9G A;  2INW A;  1XPB A;  1YPR A;  2V1A A;  5HPI A;  3P98 A;  3IBR A;  4NXB A;  1HTZ A;  4GNU A;  1CI8 A;  3W8K A;  3BQA A;  3BJN A;  3MS6 A;  3P09 A;  3UNW A;  5CGW A;  4GOG A;  4Q0J A;  2HDS A;  1DJB A;  4EXO A;  4GHI B;  3EEH A;  3ZG0 A;  2G2W A;  5HDS A;  4Q8I A;  4OQH A;  2EWV A;  4EU0 A;  4Y0O A;  3D9Y A;  5AJG A;  1YSP A;  1TDL A;  4KZ4 A;  4PMA A;  2K31 A;  4DN0 A;  3OCN A;  3WS4 A;  1OJ5 A;  2R9X A;  1OT9 A;  3MF0 A;  3SOI A;  5JYO A;  3PBR A;  4UHU A;  5A92 A;  1FSY A;  1I2S A;  1XJ6 A;  4N9L A;  5L8M A;  2A24 A;  5BOH A;  3R7W B;  3LR4 A;  1YAX A;  4X25 A;  1BLP A;  4LCM A;  2GDN A;  4S2M A;  3DBA A;  2HV1 A;  2O9C A;  2H28 A;  4UEY A;  5CTM A;  5EVI D;  3TRC A;  4QB8 A;  2Y59 A;  1TEM A;  2PR5 A;  5DJT A;  3PBT A;  5EM1 A;  4GN2 A;  1KGF A;  5DFY A;  3M2J A;  2VKS A;  4Y17 A;  3RTY A;  4FTX A;  3IBJ A;  3RJU A;  4B88 A;  3VE3 A;  2ZQ8 A;  4L9E A;  4DRT A;  2PU4 A;  3SH9 A;  1GHM A;  3IXH A;  1N4O A;  5FI7 A;  4DJ2 A;  2W1R A;  3IWI A;  3LIC A;  1RGZ A;  1AWI A;  4XUZ A;  1ERM A;  3V3S A;  5J3W A;  4NXF A;  4BJP A;  1NLZ A;  3OCL A;  1VHM A;  3MFX A;  4HI4 A;  4DMZ A;  1I2W A;  4UA7 A;  4WEJ A;  4Y0U A;  3LI9 A;  1MPL A;  1Q2Q A;  3A0V A;  5FQI A;  4WN5 A;  1I5Q A;  3F1P A;  5A91 A;  2J8Y A;  1K38 A;  3OC2 A;  4PM6 A;  4B4Z A;  1NRF A;  2B02 A;  3VP3 A;  5EFW A;  4E3K A;  3GDI A;  3PAG A;  2FFF B;  3M6B A;  3S7Q A;  2PR6 A;  5EVE A;  2V9A A;  2Q9N A;  5KSC A;  4EER A;  3EGX C;  2VGL S;  4H6J A;  3LEZ A;  5AQB A;  1NY0 A;  3NIA A;  4ZTK A;  1MY8 A;  2KDK A;  3AGE A;  3MJQ A;  4EWF A;  2GZA A;  4WZ5 C;  1LHY A;  5F5Y A;  3SZT A;  1CJF A;  3S7N A;  3G34 A;  1Y54 A;  4WUJ A;  2NUP C;  1N9B A;  3A0S A;  1ERQ A;  3W4P A;  2O9B A;  4D60 A;  1LI9 A;  5HWT A;  5E43 A;  3LY4 A;  4LCL A;  2OOL A;  4FOF A;  4JLF A;  4UAA A;  3N7W A;  2PBD P;  1NLY A;  1H0M A;  2AVX A;  2PBY A;  3MMH A;  4DF6 A;  4EQ1 A;  1WA9 A;  3ZG5 A;  1ES3 A;  3BY9 A;  5C5K A;  3WWX A;  5EUA A;  3JYI A;  2Z2L B;  3S7P A;  4EES A;  4BWI A;  4OOL A;  3OPL A;  3BEC A;  4EUZ A;  4EEU A;  4Y2F A;  3LIB A;  3ZHH A;  2JCH A;  1YLZ A;  3OPR A;  5CX7 A;  3O87 A;  3GVB A;  3BM6 A;  3ZVT A;  3NC8 A;  5DF8 A;  2M7V A;  1K4E A;  3IHA A;  4O8G A;  4OP5 A;  4IBX A;  2DNS A;  3S22 A;  1LSW A;  3C8C A;  4LV1 A;  1E3U D;  2RCX A;  5EE8 A;  2R9W A;  4OKP A;  2P7J A;  2IWB A;  2BTF P;  1FR1 A;  2VA0 A;  2X71 A;  4RA7 A;  2ZM0 A;  3DAV A;  4QY5 A;  1K4F A;  4L9F A;  1M40 A;  1GA0 A;  4M4X A;  1T1B A;  3BQ8 A;  3LO7 A;  3CZD A;  3G6O A;  3ULF A;  4RVA A;  4GZB A;  5EOO A;  2K2N A;  1H8Y A;  1QMF A;  4ME4 A;  3HJK A;  4WMC D;  1SHV A;  5IHV A;  3DTK A;  4BEN A;  3N6I A;  5DTK A;  2EX2 A;  5L09 A;  5EOE A;  1GA9 A;  4Q0H A;  3LR3 A;  4BQM A;  1IYQ A;  4ETZ A;  1ZG6 A;  5I94 A;  5CHU A;  4F3L A;  1KE4 A;  2Y2H A;  3QP5 A;  3MR0 A;  2M7U A;  2J3T C;  3B42 A;  5IT5 A;  3FPV A;  3BFC A;  4HH3 A;  5TFQ A;  3E4O A;  3G30 A;  1MC0 A;  2JC7 A;  3IF5 A;  3ZFZ A;  3NEC A;  1G68 A;  1ZC2 A;  1DJA A;  2KLI A;  3U2A A;  4LV2 A;  3IX4 A;  5GLC A;  5FAS A;  1XJ2 A;  5I5L A;  2XD1 A;  1NWZ A;  3MKE A;  1L2S A;  3QP1 A;  4NEE D;  1HZO A;  2Y2O A;  2VK3 A;  2V20 A;  3O86 A;  2V0U A;  4NG2 A;  1S4S A;  1G6A A;  4UQI M;  3SS3 A;  2QMI A;  2P74 A;  2VV6 A;  2A24 B;  2ZC5 B;  1W63 Q;  5CGX A;  3G32 A;  4LGW A;  4E3M A;  3LCE A;  2I72 A;  3Q1F A;  4MNR A;  5A8B A;  3ZDJ A;  3IHB A; 
#chains in the Genus database with same CATH homology
 5GHX A;  4OP8 A;  4KZ7 A;  5E2G A;  4WZ5 A;  5L2F A;  3EQV A;  3NDG A;  3GR2 A;  1EI5 A;  4LV3 A;  3AGF A;  5CHM A;  1VM1 A;  4JXG A;  3IXD A;  1E3U A;  1PW8 A;  3ISG A;  3G2Z A;  3NDE A;  4JPM A;  4BL3 A;  4KZ6 A;  1FOF A;  1NYM A;  2WGV A;  2ZD8 A;  3HVF A;  1KE0 A;  3FV7 A;  4S2P A;  3NI9 A;  4S2L A;  3WS2 A;  2V1Z A;  4FD8 A;  3MZE A;  3VP1 A;  1PI4 A;  3S4X A;  2XF3 A;  5AQA A;  2P9V A;  4E6W A;  4IBR A;  4MLL A;  2QZ6 A;  3BLM A;  5GHY A;  1CEG A;  3UPP A;  1GHI A;  1XX2 A;  2HPB A;  5GHZ A;  4MBH A;  4KG5 A;  1XA1 A;  3RXW A;  5HL1 A;  1LL9 A;  2Y2K A;  3CJM A;  3IXG A;  4JXS A;  5EVI C;  2Y55 A;  3N8R A;  5CHJ A;  1JWZ A;  1K57 C;  1GCE A;  1KVM A;  4OLG A;  1K54 C;  4ZJ3 A;  5U47 A;  4E6X A;  1EWZ A;  4OOM A;  1PWD A;  4E3O A;  1L0F A;  4OLD A;  4NK3 A;  1XPB A;  3LY3 A;  4X6T A;  3PBS A;  2ZC7 A;  2XFS A;  3P98 A;  4R23 A;  2P9V B;  1NZU A;  1HTZ A;  4GNU A;  4QY6 A;  1CI8 A;  2J9P A;  2A49 A;  2XK1 A;  4WMC A;  3W8K A;  3N8L A;  3DWK A;  1YQS A;  5CED A;  1PZO A;  4S2N C;  4X53 A;  4BLM A;  1WYB A;  3P09 A;  3UNW A;  1ONH A;  5HAP A;  2H0Y A;  5CGW A;  4PM8 A;  3OPH A;  2EX6 A;  4R0Q A;  4GOG A;  4K0W A;  2HDS A;  1ZKJ A;  2Q9M A;  3N4I A;  1DJB A;  4OPR A;  5F1F A;  2G2U A;  3A3E A;  2C6W B;  4ZDX A;  3ZG0 A;  2G2W A;  4Q8I A;  3SS4 A;  1MWS A;  1BUL A;  3PBN A;  4OQH A;  1ESI A;  1XP4 A;  1U60 A;  4Y0O A;  3HLD A;  5HFO A;  2Y2G A;  4OQI A;  4YIN A;  3VP2 A;  4E3I A;  4OOY A;  1TDL A;  4KZ4 A;  4PMA A;  2WGI A;  2JBF A;  3BFE A;  1FCO A;  2HP9 A;  1K55 C;  2J9O A;  3OCN A;  2WAE A;  3WS4 A;  1MXO A;  3ZG9 B;  2XGN A;  2R9X A;  3C7V A;  1JTG A;  1IYS A;  1S6R A;  3SOI A;  5DF7 A;  4X56 A;  3TOI A;  5JYO A;  1W79 A;  3MXR A;  4MBF A;  4Z9Q A;  3PBR A;  1K6R A;  4UHU A;  5A92 A;  1FSY A;  4KG2 A;  1I2S A;  4WYY A;  1Q2P A;  3Q82 A;  2EFX A;  1RGY A;  4N9L A;  5BOH A;  2ZQA A;  1HD8 A;  5CTN A;  4OVD A;  4R1G A;  5FAQ A;  3SH7 A;  3CG5 A;  1BLP A;  3G31 A;  5HW3 A;  4LCM A;  2GDN A;  4R3J A;  4S2M A;  5CER A;  1PWC A;  1YT4 A;  5JYP A;  4PM9 A;  2Y4A A;  1JVJ A;  3DW0 A;  4S2K A;  1MKI A;  3ITA A;  1L0D A;  3O88 A;  4GB7 A;  5CTM A;  4ZAM A;  5EVI D;  4OQ0 A;  3BFD A;  4B4X A;  1ES4 A;  4KQO A;  4QB8 A;  3IWO A;  2Y59 A;  1TEM A;  4KZ9 A;  4KZB A;  4C75 A;  4U0X A;  5M19 A;  4JBF A;  1JTD A;  4IED A;  3UDX A;  3PBT A;  1W5D A;  2ZC4 B;  2H0T A;  1PIO A;  3B3X A;  3OPP A;  4GN2 A;  1K56 D;  1KGF A;  2DCF A;  3VFH A;  4JF6 A;  3M2J A;  1JWP A;  1HVB A;  1IKG A;  4ID4 A;  3VP4 A;  1K6S A;  4DKI A;  1S0W A;  3N8S A;  5HAI A;  2VGJ A;  3HUN A;  3GQZ A;  2WAF A;  4DE1 A;  4KZA A;  3RJU A;  3HUO A;  4B88 A;  3M6H A;  1LI0 A;  2ZQ8 A;  2UWX A;  4DRT A;  3BFG A;  4EBP A;  4KQQ A;  3ZCZ A;  1IYP A;  3MZF A;  2PU4 A;  3SH9 A;  1GHP A;  1YLP A;  4DXB A;  5FI6 A;  1FSW A;  1GHM A;  3IXH A;  3HUM A;  4N1H A;  1N4O A;  5FI7 A;  2WUQ A;  3FKV A;  2BLS A;  4DXC A;  1TVF A;  3IWI A;  1RGZ A;  1KGE A;  2QPN A;  4M3K A;  4X69 A;  1Z6F A;  1ERM A;  4UA6 A;  4XUZ A;  4WEK A;  5FAO A;  4FCF A;  2JE5 A;  1IEM A;  2Y2M A;  3V3S A;  4QHC A;  4H8R A;  2Y2I A;  4UA9 A;  3M2K A;  3OCL A;  4U3T A;  2BG1 A;  4BJP A;  1K55 A;  4WZ4 A;  1K25 A;  5J8X A;  3OZH A;  1CK3 A;  1I2W A;  1DJC A;  1IEL A;  4DE0 A;  2Y2L A;  2CC1 A;  3G35 A;  3HBR A;  4UA7 A;  3FWL A;  4WEJ A;  3IXB A;  4PPR A;  5FQM A;  4Y0U A;  4L0L A;  1MPL A;  1Q2Q A;  1ES2 A;  5FQI A;  4R4S A;  2WGW B;  4N92 A;  2HDQ A;  4FH2 A;  4JXV A;  4A5R A;  4E3L A;  1I5Q A;  4YFM A;  5A91 A;  2J8Y A;  2HP6 A;  3A3I A;  1K38 A;  3OC2 A;  1NXY A;  4PM6 A;  3ITB A;  1KGG A;  2OLV A;  4R3B A;  1LLB A;  4OPY A;  4K91 A;  1O07 A;  1XXM A;  4OON A;  4B4Z A;  5TR7 A;  1NRF A;  1XGJ A;  1BLH A;  4GD8 A;  3VP3 A;  1TDG A;  1QME A;  4E3K A;  3C5A A;  3IF6 C;  5F1G A;  3UN7 A;  3UY6 A;  1FR6 A;  3WS0 A;  5M18 A;  3Q7Z A;  3PAG A;  2E8I A;  2FFF B;  3IH9 A;  3UPO A;  3M6B A;  5FDH A;  4C6Y A;  2WYX A;  1BZA A;  2IWD A;  1ERO A;  2IWC A;  3SH8 A;  5FSR A;  2WKH A;  2Q9N A;  5KSC A;  4OQG A;  2Z2M B;  3QHY A;  3W4O A;  4X55 A;  1L0E A;  3C7U A;  3PAE A;  4CJN A;  4QJG A;  2EXB A;  3LEZ A;  2ZM2 A;  4WEL A;  5AQB A;  1NY0 A;  5GLA A;  3WS1 A;  1ONG A;  4CPK A;  3BYD A;  2V2F F;  4U0T A;  3EQU A;  4MEZ A;  3NIA A;  3UDI A;  1SKF A;  2WK0 A;  4JKT A;  4C3Q A;  1YMX A;  3PBO A;  3GRJ A;  4ZTK A;  4DE3 A;  1MWU A;  1MY8 A;  5DF9 A;  3HLF A;  3AGE A;  5F82 A;  2XEP A;  4JF5 A;  4EWF A;  4WZ5 C;  1SDE A;  1LHY A;  3FKW A;  5GLD A;  3VSL A;  2OV5 A;  3NBL A;  4HES A;  4ZJ1 A;  3G34 A;  2EX8 A;  2ZC6 B;  1Y54 A;  1YM1 A;  1CEF A;  3PBQ A;  4K0X A;  1E4D A;  4OPQ A;  1N9B A;  3Q07 A;  1ERQ A;  3S1Y A;  3W4P A;  3TG9 A;  4PM7 A;  5DTS A;  1LI9 A;  1J9M A;  4KZ8 A;  2Y2N A;  3IH8 A;  3VMA A;  4FSF A;  5E43 A;  3LY4 A;  4N9K A;  4LCL A;  2C5W B;  5A93 A;  2HDU A;  3PTE A;  5CEC A;  1MBL A;  4UAA A;  4JLF A;  5CGS A;  2HDR A;  3N7W A;  3DWZ A;  5AQ7 A;  5EVI A;  4WBG A;  5FQK A;  1K57 A;  1K54 A;  2ZQD A;  1ZG4 A;  3D4F A;  1KVL A;  4KG6 A;  1M6K A;  4DDS A;  2ZC3 B;  3HLE A;  2PBY A;  2ZJ9 A;  3VOY A;  4DF6 A;  1BTL A;  1K56 A;  1KDS A;  1L0G A;  1SCW A;  5FAP A;  4QD4 A;  3VSK A;  3ZG8 B;  3WS5 A;  3ZG5 A;  4JXW A;  1SDN A;  1ES5 A;  3BLS A;  3UE3 A;  1VQQ A;  3IWQ A;  1ES3 A;  4S2N A;  4IVK A;  3WWX A;  2WKI A;  5EUA A;  3JYI A;  3UE1 A;  4DDY A;  4EBN A;  2B5R A;  1NZO A;  2Z2L B;  3BFF A;  1YLT A;  1FCN A;  5EVI B;  1XGI A;  3CMZ A;  4OOL A;  3IT9 A;  3BEC A;  3OPL A;  3WRT A;  3WRZ A;  5E2H A;  4EUZ A;  3GV9 A;  4HBU A;  1DY6 A;  1W7F A;  4KEN B;  3MKF A;  1BSG A;  4E3N A;  3ZHH A;  2XFT A;  2JCH A;  4S2J A;  2WGW A;  2VGK A;  3ZNY A;  1WYC A;  1YLZ A;  3HLW A;  3HLG A;  3OPR A;  3O87 A;  4KZ3 A;  3GVB A;  3BM6 A;  3VP0 A;  4GKU A;  5CRF A;  5FAT A;  3IF6 B;  1C3B A;  1FCM A;  3I7J A;  2ZM8 A;  1JWV A;  4RX3 A;  3ZGA B;  3ZVT A;  4RYE A;  3NC8 A;  5DF8 A;  3UE0 A;  1NYY A;  2XH9 A;  2Y91 A;  4PM5 A;  1K4E A;  3Q7V B;  3IHA A;  5FA7 A;  1XKZ A;  1PI5 A;  1PWG A;  2HP5 A;  3FZC A;  4IBX A;  3DTM A;  4OP5 A;  4WM9 A;  5E2F A;  4ZBE A;  2DNS A;  2OSU A;  5HAQ A;  5FQ9 A;  3S22 A;  4P85 A;  4GD6 A;  4LV1 A;  3E2K A;  1E3U D;  2XQZ A;  2RCX A;  5EE8 A;  4HEF A;  2R9W A;  2XLN A;  2WAD A;  4OKP A;  3HRE A;  3A3D A;  2IWB A;  2Y2P A;  1FR1 A;  1OME A;  4DE2 A;  1AXB A;  5EPH A;  3SS5 A;  4EV4 A;  5GL9 A;  5KMW A;  2X71 A;  3G2Y A;  5GLB A;  3A3F A;  3C4P A;  1BLC A;  4JF4 A;  4RA7 A;  1MWR A;  4OPZ A;  2ZM0 A;  1FQG A;  4KQR A;  1NJ4 A;  4MBK A;  4QY5 A;  1K4F A;  1KE3 A;  5M1A A;  2WZX A;  3Q81 A;  1M40 A;  1GA0 A;  2WZZ A;  4GDB A;  4NET A;  1ALQ A;  4OH0 A;  5FI2 A;  2RL3 A;  3LO7 A;  1KDW A;  3CZD A;  3NCK A;  3ZG7 B;  1W8Y A;  4RVA A;  4GZB A;  1W8Q A;  2J7V A;  5EOO A;  4Y0T A;  1IKI A;  5A90 A;  3V39 A;  2A3U A;  5G18 A;  1YMS A;  1YLY A;  1H8Y A;  1QMF A;  4ZJ2 A;  1YLJ A;  4P87 A;  4N1X A;  1SHV A;  3FYZ A;  4WMC D;  5IHV A;  1RP5 A;  3NY4 A;  5F83 A;  4BEN A;  3A3J A;  3N6I A;  5DTK A;  2EX2 A;  4HBT A;  3VOZ A;  1ESU A;  3GMW A;  3QNB A;  1YLW A;  4XXR A;  3MFD A;  1GA9 A;  5EOE A;  3QNC A;  3ZVW A;  1WE4 A;  2EX9 A;  2ZMA A;  3MXS A;  2EXA A;  4QU3 A;  3IQA A;  4LV0 A;  5CEB A;  4RX2 A;  5EVL A;  3UDF A;  3BRM A;  4BQM A;  1IYQ A;  1LL5 A;  3G4P A;  5HX9 A;  1O7E A;  2DRW A;  4D2O A;  2ZQC A;  1ZG6 A;  3W4Q A;  3MBZ A;  5I94 A;  1BUE A;  5CHU A;  1KE4 A;  2Y2H A;  4S2O A;  4EQI A;  2H10 A;  3VFF A;  5KZH A;  2XR0 A;  4EBL A;  3BFC A;  3AGD A;  5TFQ A;  2ZQ7 A;  4O7D A;  4P0M A;  3O3V A;  5TGF A;  4GDN A;  3V50 A;  3G30 A;  4IVI A;  2Y2J A;  1PZP A;  2ZQ9 A;  5DVA A;  2X02 A;  5D3O A;  2JC7 A;  4LEN A;  4KZ5 A;  3IF5 A;  2EFU A;  2Y2Q A;  4XUX A;  3E2L A;  2XDM A;  1PW1 A;  5AQ9 A;  3RXX A;  3ZFZ A;  5E2E A;  5FQJ A;  2ZLY A;  4Y7P A;  2PU2 A;  3C4O A;  1G68 A;  5EEC A;  1E25 A;  1ZC2 A;  1DJA A;  1XA7 A;  3HLB A;  3IF6 A;  4LV2 A;  1CI9 A;  5GLC A;  1RCJ A;  5FAS A;  3V3R A;  1BT5 A;  1MWT A;  2XD1 A;  3HLC A;  2X01 A;  4F94 A;  3MKE A;  1L2S A;  1H8Z A;  3GSG A;  3Q7V A;  4P6B A;  5HAR A;  5FQQ A;  3GTC A;  1HZO A;  2Y2O A;  3BEB A;  4BD1 A;  2OLU A;  2V20 A;  5DTT A;  3O86 A;  4FH4 A;  3TSG A;  3MZD A;  3UO9 A;  4X68 A;  1G6A A;  2FFY A;  4E3J A;  3SS3 A;  2QMI A;  2XD5 A;  2P74 A;  4R4R A;  1IYO A;  5CXW A;  2H5S A;  2ZC5 B;  3HL9 A;  5KSH A;  1H5X A;  5CGX A;  3UPN A;  3G32 A;  1PYY A;  4S2I A;  4E3M A;  2WKE A;  3LCE A;  2I72 A;  3Q1F A;  4MNR A;  4BL2 A;  4BD0 A;  3ZDJ A;  3V5M A;  3ZNT A;  1BLS A;  3IHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...