4UAAA

Ctx-m-14 class a beta-lactamase in complex with a non-covalent inhibitor at sub-angstrom resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 94
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4uaaA00
1W8QA 5AQBA 1L2SA 3VP4A 5E2HA 4KZ4A 3D4FA 3W4PA 3OPPA 3OCLA 1K6RA 1PI4A 1MKIA 1XP4A 2EX2A 3DWKA 5FI6A 5HAIA 3SH8A 1LLBA 2PBYA 3G30A 1L0FA 2Y91A 4WMCD 4EV4A 5KZHA 3IF6A 5FQQA 1ES3A 3GRJA 4S2PA 3FYZA 4NETA 4RX3A 1Q2QA 4WELA 4ZJ2A 3UDIA 3PBQA 1KDWA 4WMCA 1EI5A 3UPPA 1NZOA 1XX2A 5FQKA 2XD5A 3SOIA 3IXBA 1BUEA 4QHCA 1Z6FA 1KGGA 4S2JA 5M19A 3RXXA 3V5MA 1WYBA 2HP5A 3ITAA 4K91A 2ZQ8A 5EVID 5TGFA 3ZG8B 3UPOA 3A3IA 4HBUA 4OLDA 4PMAA 2Y2KA 2EX6A 4MBHA 2HP6A 3WS2A 4BENA 3GSGA 1TEMA 3WRZA 2PU2A 4BD0A 5D3OA 3AGFA 2Y2NA 4OPZA 2OSUA 3HLEA 4LV0A 2EXAA 4N9KA 5KSCA 5I94A 4S2NC 5E2EA 3W4QA 3DTMA 4L0LA 5FASA 1CK3A 3N4IA 2EFXA 3A3EA 4IVIA 3LY4A 3ZNTA 5CXWA 1W5DA 2BLSA 2ZC4B 4WEKA 5DF9A 3VP3A 3ZHHA 3NC8A 1JWPA 4XUZA 1KGEA 3MKEA 3TG9A 4F94A 4B88A 4B4ZA 5J8XA 1FCOA 2GDNA 2ZC7A 3MKFA 2ZMAA 4WZ5C 5EVIB 2HDSA 3NBLA 5U47A 3MXRA 5EUAA 4JKTA 1NZUA 3O86A 1GA9A 3IWOA 5FAOA 3WS4A 3ISGA 4JF6A 4RYEA 1KVMA 4LV3A 1L0DA 3LCEA 3BLMA 2XK1A 3HLFA 1FQGA 3BRMA 5CHMA 1IYPA 1I2WA 2Y55A 3WRTA 2IWDA 4R3BA 2FFYA 1SDEA 1ES2A 4QU3A 5EPHA 5GHXA 5EVIC 2EFUA 5CECA 2Y2QA 1YLTA 1L0EA 4DF6A 5A90A 3M6BA 4BQMA 1FR1A 3CJMA 4KG6A 3SS5A 5HFOA 1ONHA 3BLSA 4KZAA 3W4OA 5HW3A 4P87A 4BD1A 4BLMA 1KE4A 3IH8A 4D2OA 3NCKA 3G4PA 4QY6A 5FATA 5E2FA 1RGZA 5GL9A 5CGWA 3MFDA 2WAFA 1VM1A 4KQOA 4EWFA 5JYOA 4R0QA 5F1FA 4C75A 5E43A 1O7EA 2I72A 3CG5A 5FQJA 4JXGA 2XQZA 1H5XA 1H8YA 3WS1A 2XGNA 1SKFA 3HLGA 4GKUA 3P98A 5DTSA 5CEBA 4ZTKA 2P74A 3ZDJA 1ES5A 3BFEA 3Q07A 3Q81A 1NXYA 4UHUA 4WYYA 5FI7A 3UE1A 4P6BA 2Y2LA 2ZM0A 2EXBA 4Z9QA 2HDUA 4B4XA 2HDRA 4WBGA 4E3LA 3Q7ZA 1BTLA 4OVDA 1GHMA 1IYOA 3O3VA 1TVFA 3V50A 1SHVA 5EOEA 1MWRA 3MZDA 3N8SA 1Y54A 2Q9NA 4ZAMA 4IBRA 4EBNA 4JBFA 3HUOA 5EVLA 5KMWA 4U0TA 4BL2A 3BYDA 3BFFA 4DKIA 5CEDA 2VGKA 1QMFA 4QJGA 2R9WA 1NJ4A 1FCMA 1XKZA 3HREA 5GLAA 2QMIA 5HAPA 4OQGA 4OPYA 3C7VA 1ERQA 3CMZA 2Y2OA 2HPBA 3OCNA 4S2NA 1PI5A 3NDGA 1YMSA 4FD8A 1I5QA 4PM9A 4MBFA 4OOYA 3AGEA 1S6RA 2WK0A 4OP5A 3RJUA 2JCHA 1WYCA 3IXDA 4ZBEA 2RL3A 4PM5A 2Y2IA 4E3KA 4FH4A 1YLPA 4MNRA 4E3MA 3M2JA 2C5WB 3A3FA 3BECA 5HL1A 4WZ5A 3EQVA 2WADA 2P9VB 1BSGA 5FAPA 4OQ0A 4DE2A 4OPQA 4OP8A 3NY4A 4QD4A 1CEFA 4C3QA 1PYYA 2ZC3B 3GR2A 3IH9A 3OZHA 5EECA 3NDEA 1MBLA 3MBZA 1FOFA 2XF3A 3HUNA 4MLLA 3ZCZA 3N8LA 4BL3A 3E2KA 3UDXA 4S2KA 1HD8A 3LEZA 3FZCA 1I2SA 1YLYA 3IT9A 4KZ8A 1K57A 2WKEA 4S2LA 3V3SA 5EVIA 4DDYA 4WZ4A 4XUXA 1K56D 4Y0TA 5E2GA 4GOGA 4Y0OA 1DY6A 1FR6A 1KVLA 5CTNA 1PWGA 2V2FF 2A3UA 4JLFA 1KDSA 4CPKA 5DTKA 4R4SA 3PAGA 4CJNA 1K56A 3NIAA 3HBRA 1ONGA 4KG5A 1YT4A 3ZVTA 5M1AA 2X71A 2XEPA 5CTMA 4HEFA 1NRFA 1YLWA 4WM9A 3AGDA 1XA7A 1QMEA 2EX8A 4KQQA 2J8YA 3GV9A 3IHBA 1NY0A 4OKPA 5FDHA 3S1YA 2JE5A 1G6AA 5IHVA 5BOHA 1S0WA 3B3XA 3PAEA 1KGFA 3Q1FA 2J9OA 3VP1A 2E8IA 2WZXA 5TR7A 2Y2MA 3G34A 5HX9A 1O07A 3HVFA 1TDGA 4DRTA 3LO7A 1K55C 4KENB 2RCXA 4P85A 5HAQA 2ZQAA 3ZNYA 4U3TA 4X56A 2G2UA 4KG2A 1K57C 1SCWA 5CGSA 4E3JA 1E4DA 5CRFA 1JWZA 4OOLA 3FKWA 1BLSA 4KZBA 4MEZA 3OPHA 3PBRA 3N7WA 3IXHA 4X53A 1OMEA 3E2LA 1NYMA 1ALQA 2EX9A 3IHAA 5CHUA 4ZJ3A 4EUZA 4N1XA 4E6XA 3HLDA 1WE4A 2WGWA 3S4XA 5EOOA 1W8YA 2J7VA 5AQ7A 2ZM2A 2V1ZA 1N9BA 4K0XA 3O87A 4R4RA 4YINA 4PM7A 2WZZA 3ZG0A 2Y2JA 4OONA 1ZG6A 4O7DA 4JF5A 4GN2A 1PWCA 2WUQA 2V20A 4ZJ1A 2ZQ7A 1PZOA 1CEGA 1YQSA 2WGWB 4GD8A 5A92A 5M18A 4KQRA 4KZ9A 1BZAA 4NK3A 4E6WA 5GHYA 1W79A 4LCLA 3ZVWA 3C4OA 3VFHA 4OPRA 1CI9A 2OLUA 4OLGA 4Y0UA 3BFDA 4EQIA 2Z2MB 2H0YA 2BG1A 2WAEA 1IKGA 1MXOA 1Q2PA 3QHYA 4IEDA 5CGXA 3SH9A 3ZG5A 3G35A 2JC7A 3HLBA 1PZPA 4X6TA 1XGJA 3ZG7B 4RA7A 1BT5A 4X55A 1E3UD 2A49A 1XXMA 4LV1A 1K6SA 2ZQDA 1M40A 2ZC5B 3BM6A 3DW0A 4OQHA 2B5RA 3IF5A 1K38A 4WEJA 1DJBA 4C6YA 1ERMA 2XH9A 4PM6A 1E3UA 3C4PA 1MWTA 3UY6A 4KZ3A 3MXSA 4ZDXA 3UPNA 2X02A 1IEMA 2C6WB 2Y4AA 4HESA 3GMWA 2P9VA 1YLZA 1H8ZA 5F83A 2VGJA 5GLBA 1YM1A 4XXRA 3UE0A 2XFSA 2H10A 1XGIA 2XR0A 1VQQA 5DF8A 1GCEA 1BLHA 1SDNA 4LV2A 3VFFA 1YMXA 5DF7A 4JPMA 2UWXA 3VSLA 1RGYA 4GZBA 3QNCA 3HLCA 2OV5A 3BFGA 2PU4A 4Q8IA 5JYPA 1JVJA 1ESIA 4IVKA 1IELA 2QZ6A 3VP2A 2HDQA 1LHYA 4UA9A 1JTGA 3G2ZA 4S2IA 3VOYA 2ZJ9A 4GNUA 2H0TA 2Y59A 1IYQA 4MBKA 4PM8A 3RXWA 3JYIA 2DRWA 2FFFB 1KE3A 3HL9A 1K55A 3A3DA 3TSGA 5FQ9A 1K54C 3Q7VA 1XA1A 1EWZA 1PW8A 4UA6A 4JXWA 3HUMA 1PIOA 3N6IA 4DDSA 4DE3A 1BLPA 3IXGA 4KZ7A 3UN7A 1TDLA 5FSRA 3BEBA 4Y7PA 1MPLA 2ZQCA 3IQAA 4QY5A 1HVBA 4UA7A 3P09A 4YFMA 3WS5A 3A3JA 4N1HA 3MZEA 5HARA 2Y2GA 5FI2A 5A91A 4E3IA 4E3NA 4KZ5A 3IF6B 2CC1A 3Q7VB 4S2OA 1LI9A 2XD1A 4IBXA 2OLVA 4GDNA 3OC2A 2J9PA 1NYYA 2WGVA 4RVAA 2DNSA 1C3BA 3N8RA 4X69A 3WWXA 4BJPA 1FSWA 1LL9A 1DJCA 2ZM8A 1ZKJA 4OQIA 3SS4A 3SS3A 3QNBA 4X68A 1BULA 3C5AA 5EE8A 3I7JA 1JTDA 3GTCA 4A5RA 5L2FA 3ZGAB 2Y2HA 3SH7A 4QB8A 3IF6C 4JF4A 3G2YA 3G32A 4S2MA 5AQ9A 2WGIA 3TOIA 3FWLA 1AXBA 3PBOA 4LENA 3DWZA 2ZLYA 2WYXA 3LY3A 5TFQA 4K0WA 2G2WA 3FV7A 4P0MA 3GQZA 1IKIA 3WS0A 2HP9A 1K4EA 3O88A 3M2KA 3OPLA 2JBFA 2WKIA 4DE0A 1CI8A 3IWIA 4JXVA 1L0GA 3NI9A 1XPBA 1LI0A 1FCNA 4PPRA 1RCJA 4R1GA 5GHZA 1GHPA 1E25A 3V3RA 4DXBA 2DCFA 1K25A 3PBNA 2WKHA 5GLDA 1U60A 4GDBA 5FQIA 3M6HA 4EBLA 1GHIA 1PW1A 4R23A 5CHJA 2ZQ9A 2X01A 1HTZA 2H5SA 4HBTA 3CZDA 1K4FA 4ID4A 3UE3A 1YLJA 2R9XA 3G31A 4FH2A 4JXSA 1DJAA 3S22A 4KZ6A 5KSHA 2ZD8A 4LCMA 1G68A 3IWQA 3VOZA 4E3OA 4EBPA 1BLCA 4H8RA 3W8KA 4UAAA 1KE0A 1M6KA 3OPRA 1W7FA 3HLWA 4N92A 3ZG9B 5DVAA 1J9MA 4R3JA 2Q9MA 1MY8A 3ITBA 5FAQA 4GB7A 4GD6A 3PBTA 2XDMA 2IWCA 3UDFA 1RP5A 1MWSA 1MWUA 2ZC6B 4FSFA 5GLCA 5AQAA 3VMAA 1HZOA 1ZG4A 4U0XA 5A93A 5CERA 3ZFZA 1ES4A 5F1GA 3PBSA 5FA7A 1LL5A 3C7UA 1K54A 2QPNA 5G18A 2Z2LB 3GVBA 4DXCA 2Y2PA 4OOMA 1N4OA 3UO9A 5F82A 1GA0A 1IYSA 2XLNA 4FCFA 1ESUA 5FQMA 1FSYA 3V39A 4M3KA 4RX2A 2XFTA 4N9LA 5DTTA 1PWDA 4OH0A 2IWBA 3UNWA 1EROA 3FKVA 3PTEA 3MZFA 1JWVA 3VSKA 3Q82A 1ZC2A 3EQUA 4DE1A 3BFCA 3VP0A
chains in the Genus database with same CATH superfamily
5AQBA 1LT0A 3W4PA 3OCLA 1NLYA 1MC0A 3DWKA 3G30A 3TW8A 1ES3A 4NETA 1Q2QA 4H6JB 3PBQA 1KDWA 3T4KA 2GJ3A 1Z6FA 1TS7A 2O9AA 4II7A 4EESA 3IBJA 1NRJA 4UQIM 4OLDA 4MBHA 2HP6A 4Q0JA 4Y17A 3LIBA 4OPZA 4N9KA 5KSCA 5TBMA 5I94A 3CPTB 3DTMA 5DF9A 3ZHHA 1KOUA 1PNEA 3NC8A 3R7WA 1JWPA 1KGEA 3MKEA 2K31A 2QHKA 4CQHA 1NZUA 3O86A 3NOPC 2XSSA 3WS4A 4JF6A 3RH8B 4KUKA 5F6AA 1EW0A 3E4OA 1FQGA 3BRMA 1IYPA 1I2WA 3MQ0A 4LGWA 5CECA 2Y2QA 1F9IA 4DF6A 3NHQA 4BQMA 1FR1A 3CJMA 3BLSA 4BD1A 1KE4A 3IH8A 3A0VA 5GL9A 3MFDA 2WAFA 1VM1A 4EWFA 4R0QA 2Z6DA 2O0YA 4UQIS 1O7EA 5FQJA 2XQZA 4K08A 3H7WB 1SZVA 5DTSA 3CUEC 3ZDJA 3B33A 3BFEA 1NXYA 3UE1A 2Y2LA 5FL3A 2J3TD 4B4XA 2HDUA 4WBGA 2D02A 1BTLA 1OTBA 5AVFA 2W3FA 3O3VA 3U2AA 1MWRA 3U4LP 2JHEA 4GLQA 3LYXA 2V0UA 4DKIA 2VKSA 3D72A 4QJGA 5GLAA 3HREA 4HH3A 5IS1A 4OPYA 3CMZA 2HPBA 4S2NA 1PI5A 3NDGA 4FD8A 4PM9A 3RJUA 2W3EA 1YLPA 3M2JA 4PKYA 1V9YA 3IS2A 3EQVA 4ZRRA 4OPQA 2KOIA 1CEFA 2ZL1B 3IH9A 3GDIA 3HUNA 4MLLA 4Y3IA 3UDXA 2JKRM 3LEZA 3IBRA 4S2LA 1PFLA 4HJ6A 5EVIA 4WZ4A 2V1BA 1K56D 5HD5A 5E2GA 4AFIA 1FR6A 3ZQ5A 2V2FF 3LR3A 4CPKA 4G3VA 1K56A 3NIAA 3NOTC 3ZVTA 5M1AA 5CTMA 4WM9A 4NXGA 5I5LA 1XA7A 2J8YA 1NY0A 5IHVA 5BOHA 3PAEA 2ZMFA 1O07A 3HVFA 3W2ZA 4KENB 1Y4OA 4P85A 5HAQA 3FKWA 5J4EA 4BBUA 1NYMA 4ZJ3A 2EX9A 3EOIA 3HLDA 3T50A 3MQOA 2PAVP 3IX4A 2B02A 2V1ZA 1N9BA 4I3AA 4O7DA 5IU1A 4JF5A 1PWCA 1PZOA 5M18A 1YQSA 5GHYA 1W79A 4LCLA 2PD8A 3ZVWA 3C4OA 2XROA 3UE6A 5DFXA 4L9GA 3L7HA 5CGXA 4IEDA 3QHYA 1MXOA 3ZG5A 4O0PA 3ZG7B 3KSHA 2A49A 3TRCA 1XXMA 4GCZA 1T1AA 1K6SA 3DW0A 1H0MA 1K38A 3UB9A 1ERMA 4O8GA 2VX8A 3EGDC 3UPNA 2C6WB 2Y4AA 1OTAA 3C30A 4ARZA 2QWSA 5DFYA 2XFSA 2XR0A 5DF8A 2L1MA 1GCEA 1SDNA 4WUJA 4JPMA 2FZ0A 2VZWA 5HL6A 1VETA 4S2IA 2ZJ9A 1XJ6A 3ULFA 2JKGA 4PM8A 3RXWA 2FFFB 1K55A 5FQ9A 1JNUA 3VE4A 4KZ7A 3UN7A 1TDLA 4UA7A 1LSWA 4HHDA 4YFMA 2VEAA 5FI2A 5L10A 5A91A 1G5UA 5CX7A 3ZYTA 2CC1A 2B18A 1C3BA 4M4XA 1F2KA 4X68A 3I7JA 1JTDA 5L2FA 2Y2HA 3SH7A 2XRNA 4S2MA 2WGIA 1G6OA 1AXBA 2PRFA 3LY3A 3T1QB 1IKIA 3WS0A 4Y2FA 1K4EA 3T1SA 4DE0A 3UMEA 4JXVA 3HCYA 1XJ2A 5HWTA 3GECA 2QYBA 3PBNA 2WKHA 5F68A 4GDBA 4EBLA 3SZTA 2BASA 3JVUA 2X01A 1MKMA 2H5SA 3H82B 2R78A 1K4FA 4FH2A 1DJAA 3S22A 1G68A 3IWQA 3VOZA 2JN7A 4H8RA 4EEUA 4UAAA 3HLWA 3ZG9B 1J9MA 1MY8A 5FAQA 3LIAA 3PBTA 4Q0HA 2PD7A 1OTIA 5AJGA 2IWCA 4FSFA 3VMAA 1HZOA 1ZG4A 1H8MA 5F1GA 2YKFA 2W3GA 5F82A 3S7PA 1IYSA 1ESUA 5G4YA 1FSYA 2EWVA 3V39A 2XFTA 5DTTA 3QP1A 1PWDA 2HGVA 3FKVA 3PTEA 3MZFA 3VSKA 5DJUA 1NWZA 3VP4A 4KZ4A 1L3LA 4HJ3A 1MKIA 2EX2A 5HAIA 3SH8A 1LLBA 2Y91A 5HDDA 2Y8HA 4WMCD 4EV4A 2QKPA 2HF6A 3GRJA 3FYZA 4ZJ2A 4X25A 4WMCA 1EI5A 4LRZE 4MN5A 1NZOA 3UPPA 4QHCA 5M19A 3NJAA 4JGOA 4JGQA 4DN0A 2HP5A 3H9WA 4HBUA 4PMAA 3VE3A 4BENA 2PU2A 2Y2NA 2OSUA 4S2NC 3W4QA 4L0LA 2EFXA 3UMDA 3A3EA 3LI9A 5CXWA 2OAQ1 3VP3A 4G3WA 4XUZA 4HY8A 2ZC7A 1D1JA 5EVIB 3NBLA 1GA9A 3ISGA 1KVMA 1L0DA 1VEUB 2IWDA 4B9OA 1SDEA 3MF0A 5EVIC 1S1YA 1TD5A 4F3LB 1P97A 5HFOA 1ONHA 3W4OA 5C5KA 4BLMA 4QY6A 2A24B 5EFWA 5F1FA 4I3IA 1CQAA 3CG5A 4HNBA 1Z09A 3BQ8A 1H8YA 3WS1A 1SKFA 5CEBA 3P01A 4ZTKA 1ES5A 4MN6A 4MCWA 4P6BA 2ZM0A 3PYPA 4E3LA 3TJZC 1GHMA 1YAXA 4HIAA 2J3WA 5EOEA 3MZDA 3CLOA 1FILA 4U0TA 3BYDA 5K5BA 2VGKA 2VV8A 1NJ4A 3C38A 2AVXA 3DTKA 2Y2OA 3OCNA 3AGEA 2WK0A 2RL3A 1LL8A 1S1ZA 4E3MA 4EQ1A 5HSQA 5HL1A 3QP6A 2WADA 4OQ0A 4DE2A 3NY4A 4QD4A 4C3QA 4O01A 3GR2A 2V8CA 5EECA 1MBLA 1GSXA 3LR0A 1YKDA 2JKTM 2PHYA 3ZCZA 3N8LA 3E2KA 4S2KA 1YLYA 4R70A 1K57A 4GJ4A 2P7JA 4WLAA 4Y0OA 1DY6A 1PWGA 4JLFA 5DTKA 4R4SA 4KG5A 1YT4A 2XEPA 1NRFA 1YLWA 3AGDA 1CF0A 3R4KA 2JE5A 3B3XA 3Q1FA 3VP1A 4BBVA 4EU0A 1TDGA 3LO7A 1K55C 2RCXA 5TJJA 4U3TA 2G2UA 5CGSA 3S7OA 3KO6A 5CRFA 4B93A 1BLSA 1YPRA 4KZBA 4MEZA 3K3DA 4X53A 5FEFA 5CHUA 2OOLA 4LLOB 4E6XA 1WE4A 2LB9A 5AQ7A 2ZM2A 4KUOA 4R4RA 3O87A 2WZZA 3ZG0A 2Y2JA 4OONA 2D01A 2W1TB 4I5SA 4ZJ1A 2VK3A 2WGWB 1OT6A 4CLCB 3F1OA 3MJQA 4OPRA 1CI9A 4Y0UA 3BFDA 4PKYG 1OTEA 1IKGA 1Q2PA 3G35A 4CLCC 4RA7A 4X55A 2LB5A 1N9LA 4OQHA 2B5RA 1DJBA 2XH9A 4PM6A 2X02A 3HJKA 3B42A 3GMWA 1H8ZA 4G3KA 5GLBA 1YM1A 4XXRA 1XGIA 3QP2A 3VV4A 2IA2A 2PYRA 3VFFA 1GSVA 5FEGA 4GZBA 2PU4A 1YSQA 2QZ6A 2HDQA 5DKKA 1JTGA 3G2ZA 3LGOA 4GNUA 2H0TA 2M7UA 3JYIA 2DRWA 1XA1A 1EWZA 1PW8A 4JXWA 3N6IA 3IXGA 5FSRA 3BEBA 1P9WA 3LR4A 3T4TA 2ZQCA 2PR5A 3A3JA 4WL9A 3WS5A 2Y2GA 4KZ5A 1XJ4A 3Q7VB 4S2OA 2VV6A 1SKOB 3OC2A 2J9PA 3F1NB 4X69A 3WWXA 2QJ7A 4BJPA 4OQIA 1LL9A 3IX8A 3MS6A 3QNBA 4A5RA 1FIKA 4GHIA 3G32A 3DTIA 4FOFA 4FTXA 4LENA 3FV7A 4P0MA 3MXQA 1ACFA 3NECA 3M2KA 3IWIA 4NEED 1T1CA 1L0GA 3BY8A 4PPRA 1RCJA 4GS9A 5GHZA 3CI6A 5F5YA 4DXBA 5CHJA 3CZDA 3UE3A 5KIZA 2R9XA 4P6ZM 1M6KA 1W7FA 2OWHA 2Q9MA 2CMNA 2V9AA 3ICYA 4GB7A 2FH5A 2HV1A 2ZC6B 5GLCA 5CERA 1ES4A 2QPNA 5G18A 4DXCA 2Y2PA 4OOMA 2XLNA 1P9RA 3HJIA 1UGUA 4N9LA 4OH0A 3S7NA 3UNWA 1DP9A 3EQUA 3BFCA 4EXOA 1W8QA 1L2SA 2P04A 3D4FA 3OPPA 4R38A 4H6JA 1K6RA 1PI4A 1XP4A 2E8JA 5FI6A 2PBYA 1L0FA 4HP9A 4S2PA 4WELA 3UDIA 4ETXA 4P6ZS 5FQKA 2XD5A 3IXBA 1BUEA 1KGGA 4S2JA 2KX6A 3NULA 3RXXA 3CPTA 2ZQ8A 3UPOA 3A3IA 4NXFA 2Y2KA 4BBTA 3WS2A 2HZ5A 1TEMA 4BD0A 5D3OA 3T1RA 4LV0A 2EXAA 2VA0A 4EEPA 3NOUC 3N4IA 4IVIA 3LY4A 2V8FA 4F94A 4B88A 4B4ZA 5J8XA 3MKFA 2ZMAA 5HWVA 2HDSA 5TBMB 1NLZA 3D9YA 3MXRA 2O99A 3IWOA 5FAOA 1W63Q 4RYEA 4LV3A 3R7WB 4HH2A 3CWFA 3HLFA 2FFYA 3OOVA 1ES2A 5EPHA 3T12B 2NUPC 5L8MA 1L0EA 2KDKA 5A90A 3M6BA 5J3WA 5MC7A 1VB6A 4P87A 4WF0A 3B47A 2O9BA 4D2OA 3NCKA 3G4PA 5FATA 1MZUA 5CGWA 5JYOA 4C75A 4R6LA 3P98A 3RFBA 1TS6A 4WYYA 4UHUA 2BTFP 1TVFA 4PHTA 3V50A 1SHVA 3N8SA 5IT5A 1Y54A 4ZAMA 4IBRA 3TE8A 2PYPA 5EVLA 2W3HA 5KMWA 3SW1A 1S4SA 3BWLA 2A2LA 1XKZA 5HDSA 4RQ9A 3LR5A 3KYEA 3C7VA 4EERA 3UDFA 1I5QA 4MBFA 4OOYA 4OP5A 2JCHA 3CITA 2M1CA 2WKPA 3IXDA 4ZBEA 1A0KA 2Y2IA 4PM5A 2ZL1A 4E3KA 4FH4A 2JKRI 2C5WB 3A3FA 3BECA 4WZ5A 2J80A 4YOFA 2XA7M 4OP8A 1PYYA 3E4PA 1DP6A 2J3TC 3MBZA 1FOFA 2XF3A 3LIEA 3IS2B 1HD8A 5DJTA 3FZCA 2WKEA 4DDYA 4XUXA 4IUHA 4GOGA 1KVLA 5CTNA 2A3UA 3MFXA 2M7VA 4BWIA 4EETB 4CJNA 1ONGA 2X71A 4HEFA 1UWPX 1QMEA 2EX8A 3GV9A 4OKPA 5FDHA 1G6AA 2J9OA 2E8IA 5HX9A 3S7QA 1OTDA 2ZQAA 3ZNYA 4X56A 4E3JA 5EM1A 3EEHA 3PBRA 4EUVA 3N7WA 1TF1A 3IXHA 3E2LA 1ALQA 4EUZA 1STZA 4N1XA 3S4XA 4I38A 2J7VA 3L9KA 4K0XA 3MMHA 4YINA 4PM7A 3A0SA 2XA7S 4GN2A 4LRXC 2WUQA 2ZQ7A 1CEGA 3CHWP 5A92A 4KZ9A 1Y28A 1BZAA 2V0WA 4GS9B 2I9VA 4EQIA 1TS0A 2Z2MB 2H0YA 2BG1A 2WAEA 3SH9A 3HLBA 4X6TA 2PBDP 2K2NA 2ZC5B 3IF5A 3D3OA 3C4PA 1MWTA 2W1RA 3MXSA 4ZDXA 1IEMA 4HESA 2H28A 1T19A 3PHYA 3F1PA 2P9VA 3CAXA 1YLZA 3BQAA 3UE0A 4Y15A 1X0OA 1VQQA 5F69A 1BLHA 4JGRA 4MMNA 4Y5FA 2UWXA 5EV0A 3HLCA 2OV5A 4Q8IA 2G7UA 4ARZB 1JVJA 2ZOIA 4IVKA 3VP2A 1LHYA 4UA9A 2PDRA 2Y59A 4MBKA 5HD3A 1ODVA 1KE3A 2Q0OA 3TSGA 2V1AA 4UA6A 1PIOA 4DE3A 1VETB 3IQAA 3P09A 3MSHA 3MZEA 5HARA 4E3IA 4E3NA 3O5YA 3JPUA 1LI9A 3K3CA 2OLVA 4IBXA 3EWKA 4RVAA 2DNSA 3UB5P 1AWIA 2ZM8A 2NUTC 3C5AA 3GTCA 2PT7A 3ZGAB 4JF4A 1OPXA 5AQ9A 5FDSA 3PBOA 2WYXA 4K0WA 1LSVA 3GQZA 4JGPA 2HP9A 4HP4A 4NXEA 4E04A 3OPLA 1CI8A 1H3QA 3C8CA 1LI0A 3H82A 4R1GA 1WA9A 1U60A 5FQIA 3DAVA 4R23A 2ZQ9A 4UEYA 2QJ5A 4ID4A 4JXSA 5KSHA 2WKRA 4LRYC 3W8KA 1KE0A 5AVEA 2O9CA 4R3JA 4GD6A 1IFQA 1S4RA 2XDMA 3UB8A 1RP5A 1MWSA 1MWUA 4L9FA 4U0XA 3ZFZA 1PRQA 4PAUA 4L9EA 3MQQA 1LL5A 3C7UA 3EEAA 1K54A 3GVBA 5FQMA 3QP8A 4M3KA 4RX2A 2ZOHA 2IWBA 4DMZA 1JWVA 1GSWA 3VP0A 4ESPA 2ZMVA 5E2HA 1XJ3A 4I39A 4LFUA 4R3AA 3C2WA 1OT9A 2HJEA 3BW6A 5KZHA 3IF6A 2VGLM 4NG2A 5FQQA 2VV7A 1P0ZA 1N9NA 4RX3A 4YWZA 4BMWA 1XX2A 3K2NA 3SOIA 4QWOA 3RTYA 4IUKA 3QP4A 3V5MA 1WYBA 3ITAA 4K91A 5EVID 5TGFA 3ZG8B 1T1BA 2EX6A 3GSGA 3WRZA 3KYQA 3AGFA 3PR6A 3HLEA 5E2EA 5FASA 1CK3A 1T18A 3ZNTA 1W5DA 2BLSA 2ZC4B 4WEKA 4D60A 3TG9A 1FCOA 2GDNA 3BY9A 3P7NA 4WZ5C 1VEUA 5U47A 5EUAA 4JKTA 4NXBA 5LBRA 4ME4A 1J3WA 1OJGA 4DJ2A 4F3LA 4X1LA 3LCEA 3JVVA 3BLMA 2XK1A 2B95A 5CHMA 2Y55A 4XT2A 3WRTA 1YSPA 4R3BA 4YNRA 4QU3A 5GHXA 2EFUA 3E0YA 3LFVA 4HJ4A 1YLTA 2UV0E 3LIFA 1S66L 2VGLS 2A24A 2L0WA 2GNXA 3UB7A 1S67L 4KG6A 3SS5A 1V9ZA 4KZAA 5HW3A 5HDCA 5HPIA 2K7SA 5E2FA 1RGZA 3FG8A 1XFQA 2JKFA 2WKQA 4KQOA 2KLIA 5E43A 2I72A 4JXGA 1H5XA 1K0KA 2XGNA 3OBFA 3HLGA 4GKUA 2P74A 3Q07A 3Q81A 5FI7A 5HWWA 2W27A 2EXBA 4Z9QA 2HDRA 3Q7ZA 2MJ6A 4OVDA 1IYOA 3T4JA 3FPWA 2Y79A 2Q9NA 4EBNA 2OAP1 4JBFA 3LI8A 3HUOA 4BL2A 3BFFA 5CEDA 1QMFA 2Z6CA 2R9WA 1FCMA 2QMIA 5HAPA 4OQGA 1ERQA 1YMSA 1S6RA 1WYCA 3FPVA 2JKTI 3PXPA 3T1XA 2ACGA 4MNRA 4FUWA 3F1PB 2P9VB 1BSGA 5FAPA 3FC7A 4HOIA 2ZC3B 2INWA 3OZHA 3NDEA 3BJNA 4BL3A 1I2SA 3IT9A 4KZ8A 3V3SA 4Y0TA 2OWJA 1KDSA 4IJGA 3PAGA 3DBAA 1F98A 3HBRA 5L07A 4GW9A 3T4QA 4NKPA 4KQQA 3IHBA 3S1YA 1S0WA 1KGFA 2WZXA 5TR7A 2Y2MA 3G34A 4DJ3A 4HQAA 4DRTA 1D7EA 4KG2A 1K57C 1SCWA 1E4DA 1JWZA 4OOLA 3OPHA 1IOUA 4CLCD 1DRMA 1OMEA 4MN7A 1G28A 3CUEA 3IHAA 2W1TA 2WGWA 4Z1WA 4CLCA 5EOOA 1W8YA 4KQDA 2DMWA 3G6OA 1HLUP 2W3DA 1ZG6A 3V67A 3H7WA 2V20A 4GD8A 4KQRA 4NK3A 4E6WA 2GX5A 3VFHA 3LUQA 2OLUA 4OLGA 4Q0IA 3VOLA 2ZBBA 2GZAA 3F1OB 3EGXC 2JC7A 1PZPA 1XGJA 1BT5A 1E3UD 4IHQA 4LV1A 2ZQDA 1M40A 3BM6A 3OLOA 4WEJA 4CLCE 4C6YA 1LSXA 1E3UA 2EWWA 3UY6A 3T4SA 4KZ3A 5DKLA 1F5MA 1W63M 3LIDA 3KSGA 5F83A 2VGJA 2H10A 4LV2A 1YMXA 5DF7A 1ZHHB 3VSLA 5HPFA 1RGYA 3QNCA 3BFGA 1DP8A 5JYPA 1ESIA 1IELA 1UWNX 3VOYA 1IYQA 3HL9A 3A3DA 3E4QA 1K54C 3Q7VA 4DDSA 3LEQA 3HUMA 3KX0X 1SKOA 3LICA 1BLPA 2P08A 4Y7PA 1MPLA 4QY5A 1HVBA 3F1NA 4N1HA 3IF6B 3UB6A 1OJ5A 2XD1A 4ETZA 4GDNA 1NYYA 2WGVA 2EA9A 3N8RA 2W0NA 4I3JA 5J7EA 1FSWA 3SS3A 1DJCA 4Y13A 1ZKJA 4QPRA 3SS4A 2VJWA 1BULA 5EE8A 1BYWA 4LPZA 5HZHA 4QB8A 3IF6C 2L4RA 1N9OA 3G2YA 2VLGA 3KYZA 3TOIA 3A0RA 3FWLA 3DWZA 3KSIA 2ZLYA 4X1MA 5TFQA 2G2WA 3MR0A 1VHMA 4GHIB 3O88A 3E98A 2JBFA 2WKIA 3NI9A 1XPBA 1FCNA 3T4OA 1GHPA 1E25A 2YKHA 3V3RA 4WN5A 2DCFA 1K25A 3DTEA 5GLDA 4HI4A 4EW7A 3M6HA 1GHIA 1PW1A 1HTZA 4HBTA 1YLJA 3G31A 4MDZA 4XT2B 4KZ6A 5EVEA 2ZD8A 4LCMA 1D06A 4E3OA 4EBPA 1BLCA 1CJFA 3OPRA 3QP5A 4N92A 5A8BA 5DVAA 3ITBA 1TS8A 3KSFA 1ZTUA 5AQAA 5EM0A 5A93A 2HJ9C 3PBSA 5FA7A 3IX3A 2Z2LB 5G4ZA 3UO9A 1N4OA 1GA0A 4FCFA 1XFNA 2PR6A 1EROA 5L09A 3Q82A 1ZC2A 4DE1A 3T4LA
chains in the Genus database with same CATH topology
1W8QA 5AQBA 1L2SA 3VP4A 5E2HA 4KZ4A 3D4FA 3W4PA 3OPPA 3OCLA 1K6RA 1PI4A 1MKIA 1XP4A 2EX2A 3DWKA 5FI6A 5HAIA 3SH8A 1LLBA 2PBYA 3G30A 1L0FA 2Y91A 4WMCD 4EV4A 5KZHA 3IF6A 5FQQA 1ES3A 3GRJA 4S2PA 3FYZA 4NETA 4RX3A 1Q2QA 4WELA 4ZJ2A 3UDIA 3PBQA 1KDWA 4WMCA 1EI5A 3UPPA 1NZOA 1XX2A 5FQKA 2XD5A 3SOIA 3IXBA 1BUEA 4QHCA 1Z6FA 1KGGA 4S2JA 5M19A 3RXXA 3V5MA 1WYBA 2HP5A 3ITAA 4K91A 2ZQ8A 5EVID 5TGFA 3ZG8B 3UPOA 3A3IA 4HBUA 4OLDA 4PMAA 2Y2KA 2EX6A 4MBHA 2HP6A 3WS2A 4BENA 3GSGA 1TEMA 3WRZA 2PU2A 4BD0A 5D3OA 3AGFA 2Y2NA 4OPZA 2OSUA 3HLEA 4LV0A 2EXAA 4N9KA 5KSCA 5I94A 4S2NC 5E2EA 3W4QA 3DTMA 4L0LA 5FASA 1CK3A 3N4IA 2EFXA 3A3EA 4IVIA 3LY4A 3ZNTA 5CXWA 1W5DA 2BLSA 2ZC4B 4WEKA 5DF9A 3VP3A 3ZHHA 3NC8A 1JWPA 4XUZA 1KGEA 3MKEA 3TG9A 4F94A 4B88A 4B4ZA 5J8XA 1FCOA 2GDNA 2ZC7A 3MKFA 2ZMAA 4WZ5C 5EVIB 2HDSA 3NBLA 5U47A 3MXRA 5EUAA 4JKTA 1NZUA 3O86A 1GA9A 3IWOA 5FAOA 3WS4A 3ISGA 4JF6A 4RYEA 1KVMA 4LV3A 1L0DA 3LCEA 3BLMA 2XK1A 3HLFA 1FQGA 3BRMA 5CHMA 1IYPA 1I2WA 2Y55A 3WRTA 2IWDA 4R3BA 2FFYA 1SDEA 1ES2A 4QU3A 5EPHA 5GHXA 5EVIC 2EFUA 5CECA 2Y2QA 1YLTA 1L0EA 4DF6A 5A90A 3M6BA 4BQMA 1FR1A 3CJMA 4KG6A 3SS5A 5HFOA 1ONHA 3BLSA 4KZAA 3W4OA 5HW3A 4P87A 4BD1A 4BLMA 1KE4A 3IH8A 4D2OA 3NCKA 3G4PA 4QY6A 5FATA 5E2FA 1RGZA 5GL9A 5CGWA 3MFDA 2WAFA 1VM1A 4KQOA 4EWFA 5JYOA 4R0QA 5F1FA 4C75A 5E43A 1O7EA 2I72A 3CG5A 5FQJA 4JXGA 2XQZA 1H5XA 1H8YA 3WS1A 2XGNA 1SKFA 3HLGA 4GKUA 3P98A 5DTSA 5CEBA 4ZTKA 2P74A 3ZDJA 1ES5A 3BFEA 3Q07A 3Q81A 1NXYA 4UHUA 4WYYA 5FI7A 3UE1A 4P6BA 2Y2LA 2ZM0A 2EXBA 4Z9QA 2HDUA 4B4XA 2HDRA 4WBGA 4E3LA 3Q7ZA 1BTLA 4OVDA 1GHMA 1IYOA 3O3VA 1TVFA 3V50A 1SHVA 5EOEA 1MWRA 3MZDA 3N8SA 1Y54A 2Q9NA 4ZAMA 4IBRA 4EBNA 4JBFA 3HUOA 5EVLA 5KMWA 4U0TA 4BL2A 3BYDA 3BFFA 4DKIA 5CEDA 2VGKA 1QMFA 4QJGA 2R9WA 1NJ4A 1FCMA 1XKZA 3HREA 5GLAA 2QMIA 5HAPA 4OQGA 4OPYA 3C7VA 1ERQA 3CMZA 2Y2OA 2HPBA 3OCNA 4S2NA 1PI5A 3NDGA 1YMSA 4FD8A 1I5QA 4PM9A 4MBFA 4OOYA 3AGEA 1S6RA 2WK0A 4OP5A 3RJUA 2JCHA 1WYCA 3IXDA 4ZBEA 2RL3A 4PM5A 2Y2IA 4E3KA 4FH4A 1YLPA 4MNRA 4E3MA 3M2JA 2C5WB 3A3FA 3BECA 5HL1A 4WZ5A 3EQVA 2WADA 2P9VB 1BSGA 5FAPA 4OQ0A 4DE2A 4OPQA 4OP8A 3NY4A 4QD4A 1CEFA 4C3QA 1PYYA 2ZC3B 3GR2A 3IH9A 3OZHA 5EECA 3NDEA 1MBLA 3MBZA 1FOFA 2XF3A 3HUNA 4MLLA 3ZCZA 3N8LA 4BL3A 3E2KA 3UDXA 4S2KA 1HD8A 3LEZA 3FZCA 1I2SA 1YLYA 3IT9A 4KZ8A 1K57A 2WKEA 4S2LA 3V3SA 5EVIA 4DDYA 4WZ4A 4XUXA 1K56D 4Y0TA 5E2GA 4GOGA 4Y0OA 1DY6A 1FR6A 1KVLA 5CTNA 1PWGA 2V2FF 2A3UA 4JLFA 1KDSA 4CPKA 5DTKA 4R4SA 3PAGA 4CJNA 1K56A 3NIAA 3HBRA 1ONGA 4KG5A 1YT4A 3ZVTA 5M1AA 2X71A 2XEPA 5CTMA 4HEFA 1NRFA 1YLWA 4WM9A 3AGDA 1XA7A 1QMEA 2EX8A 4KQQA 2J8YA 3GV9A 3IHBA 1NY0A 4OKPA 5FDHA 3S1YA 2JE5A 1G6AA 5IHVA 5BOHA 1S0WA 3B3XA 3PAEA 1KGFA 3Q1FA 2J9OA 3VP1A 2E8IA 2WZXA 5TR7A 2Y2MA 3G34A 5HX9A 1O07A 3HVFA 1TDGA 4DRTA 3LO7A 1K55C 4KENB 2RCXA 4P85A 5HAQA 2ZQAA 3ZNYA 4U3TA 4X56A 2G2UA 4KG2A 1K57C 1SCWA 5CGSA 4E3JA 1E4DA 5CRFA 1JWZA 4OOLA 3FKWA 1BLSA 4KZBA 4MEZA 3OPHA 3PBRA 3N7WA 3IXHA 4X53A 1OMEA 3E2LA 1NYMA 1ALQA 2EX9A 3IHAA 5CHUA 4ZJ3A 4EUZA 4N1XA 4E6XA 3HLDA 1WE4A 2WGWA 3S4XA 5EOOA 1W8YA 2J7VA 5AQ7A 2ZM2A 2V1ZA 1N9BA 4K0XA 3O87A 4R4RA 4YINA 4PM7A 2WZZA 3ZG0A 2Y2JA 4OONA 1ZG6A 4O7DA 4JF5A 4GN2A 1PWCA 2WUQA 2V20A 4ZJ1A 2ZQ7A 1PZOA 1CEGA 1YQSA 2WGWB 4GD8A 5A92A 5M18A 4KQRA 4KZ9A 1BZAA 4NK3A 4E6WA 5GHYA 1W79A 4LCLA 3ZVWA 3C4OA 3VFHA 4OPRA 1CI9A 2OLUA 4OLGA 4Y0UA 3BFDA 4EQIA 2Z2MB 2H0YA 2BG1A 2WAEA 1IKGA 1MXOA 1Q2PA 3QHYA 4IEDA 5CGXA 3SH9A 3ZG5A 3G35A 2JC7A 3HLBA 1PZPA 4X6TA 1XGJA 3ZG7B 4RA7A 1BT5A 4X55A 1E3UD 2A49A 1XXMA 4LV1A 1K6SA 2ZQDA 1M40A 2ZC5B 3BM6A 3DW0A 4OQHA 2B5RA 3IF5A 1K38A 4WEJA 1DJBA 4C6YA 1ERMA 2XH9A 4PM6A 1E3UA 3C4PA 1MWTA 3UY6A 4KZ3A 3MXSA 4ZDXA 3UPNA 2X02A 1IEMA 2C6WB 2Y4AA 4HESA 3GMWA 2P9VA 1YLZA 1H8ZA 5F83A 2VGJA 5GLBA 1YM1A 4XXRA 3UE0A 2XFSA 2H10A 1XGIA 2XR0A 1VQQA 5DF8A 1GCEA 1BLHA 1SDNA 4LV2A 3VFFA 1YMXA 5DF7A 4JPMA 2UWXA 3VSLA 1RGYA 4GZBA 3QNCA 3HLCA 2OV5A 3BFGA 2PU4A 4Q8IA 5JYPA 1JVJA 1ESIA 4IVKA 1IELA 2QZ6A 3VP2A 2HDQA 1LHYA 4UA9A 1JTGA 3G2ZA 4S2IA 3VOYA 2ZJ9A 4GNUA 2H0TA 2Y59A 1IYQA 4MBKA 4PM8A 3RXWA 3JYIA 2DRWA 2FFFB 1KE3A 3HL9A 1K55A 3A3DA 3TSGA 5FQ9A 1K54C 3Q7VA 1XA1A 1EWZA 1PW8A 4UA6A 4JXWA 3HUMA 1PIOA 3N6IA 4DDSA 4DE3A 1BLPA 3IXGA 4KZ7A 3UN7A 1TDLA 5FSRA 3BEBA 4Y7PA 1MPLA 2ZQCA 3IQAA 4QY5A 1HVBA 4UA7A 3P09A 4YFMA 3WS5A 3A3JA 4N1HA 3MZEA 5HARA 2Y2GA 5FI2A 5A91A 4E3IA 4E3NA 4KZ5A 3IF6B 2CC1A 3Q7VB 4S2OA 1LI9A 2XD1A 4IBXA 2OLVA 4GDNA 3OC2A 2J9PA 1NYYA 2WGVA 4RVAA 2DNSA 1C3BA 3N8RA 4X69A 3WWXA 4BJPA 1FSWA 1LL9A 1DJCA 2ZM8A 1ZKJA 4OQIA 3SS4A 3SS3A 3QNBA 4X68A 1BULA 3C5AA 5EE8A 3I7JA 1JTDA 3GTCA 4A5RA 5L2FA 3ZGAB 2Y2HA 3SH7A 4QB8A 3IF6C 4JF4A 3G2YA 3G32A 4S2MA 5AQ9A 2WGIA 3TOIA 3FWLA 1AXBA 3PBOA 4LENA 3DWZA 2ZLYA 2WYXA 3LY3A 5TFQA 4K0WA 2G2WA 3FV7A 4P0MA 3GQZA 1IKIA 3WS0A 2HP9A 1K4EA 3O88A 3M2KA 3OPLA 2JBFA 2WKIA 4DE0A 1CI8A 3IWIA 4JXVA 1L0GA 3NI9A 1XPBA 1LI0A 1FCNA 4PPRA 1RCJA 4R1GA 5GHZA 1GHPA 1E25A 3V3RA 4DXBA 2DCFA 1K25A 3PBNA 2WKHA 5GLDA 1U60A 4GDBA 5FQIA 3M6HA 4EBLA 1GHIA 1PW1A 4R23A 5CHJA 2ZQ9A 2X01A 1HTZA 2H5SA 4HBTA 3CZDA 1K4FA 4ID4A 3UE3A 1YLJA 2R9XA 3G31A 4FH2A 4JXSA 1DJAA 3S22A 4KZ6A 5KSHA 2ZD8A 4LCMA 1G68A 3IWQA 3VOZA 4E3OA 4EBPA 1BLCA 4H8RA 3W8KA 4UAAA 1KE0A 1M6KA 3OPRA 1W7FA 3HLWA 4N92A 3ZG9B 5DVAA 1J9MA 4R3JA 2Q9MA 1MY8A 3ITBA 5FAQA 4GB7A 4GD6A 3PBTA 2XDMA 2IWCA 3UDFA 1RP5A 1MWSA 1MWUA 2ZC6B 4FSFA 5GLCA 5AQAA 3VMAA 1HZOA 1ZG4A 4U0XA 5A93A 5CERA 3ZFZA 1ES4A 5F1GA 3PBSA 5FA7A 1LL5A 3C7UA 1K54A 2QPNA 5G18A 2Z2LB 3GVBA 4DXCA 2Y2PA 4OOMA 1N4OA 3UO9A 5F82A 1GA0A 1IYSA 2XLNA 4FCFA 1ESUA 5FQMA 1FSYA 3V39A 4M3KA 4RX2A 2XFTA 4N9LA 5DTTA 1PWDA 4OH0A 2IWBA 3UNWA 1EROA 3FKVA 3PTEA 3MZFA 1JWVA 3VSKA 3Q82A 1ZC2A 3EQUA 4DE1A 3BFCA 3VP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8Q A;  5AQB A;  1L2S A;  3VP4 A;  5E2H A;  4KZ4 A;  3D4F A;  3W4P A;  3OPP A;  3OCL A;  1K6R A;  1PI4 A;  1MKI A;  1XP4 A;  2EX2 A;  3DWK A;  5FI6 A;  5HAI A;  3SH8 A;  1LLB A;  2PBY A;  3G30 A;  1L0F A;  2Y91 A;  4WMC D;  4EV4 A;  5KZH A;  3IF6 A;  5FQQ A;  1ES3 A;  3GRJ A;  4S2P A;  3FYZ A;  4NET A;  4RX3 A;  1Q2Q A;  4WEL A;  4ZJ2 A;  3UDI A;  3PBQ A;  1KDW A;  4WMC A;  1EI5 A;  3UPP A;  1NZO A;  1XX2 A;  5FQK A;  2XD5 A;  3SOI A;  3IXB A;  1BUE A;  4QHC A;  1Z6F A;  1KGG A;  4S2J A;  5M19 A;  3RXX A;  3V5M A;  1WYB A;  2HP5 A;  3ITA A;  4K91 A;  2ZQ8 A;  5EVI D;  5TGF A;  3ZG8 B;  3UPO A;  3A3I A;  4HBU A;  4OLD A;  4PMA A;  2Y2K A;  2EX6 A;  4MBH A;  2HP6 A;  3WS2 A;  4BEN A;  3GSG A;  1TEM A;  3WRZ A;  2PU2 A;  4BD0 A;  5D3O A;  3AGF A;  2Y2N A;  4OPZ A;  2OSU A;  3HLE A;  4LV0 A;  2EXA A;  4N9K A;  5KSC A;  5I94 A;  4S2N C;  5E2E A;  3W4Q A;  3DTM A;  4L0L A;  5FAS A;  1CK3 A;  3N4I A;  2EFX A;  3A3E A;  4IVI A;  3LY4 A;  3ZNT A;  5CXW A;  1W5D A;  2BLS A;  2ZC4 B;  4WEK A;  5DF9 A;  3VP3 A;  3ZHH A;  3NC8 A;  1JWP A;  4XUZ A;  1KGE A;  3MKE A;  3TG9 A;  4F94 A;  4B88 A;  4B4Z A;  5J8X A;  1FCO A;  2GDN A;  2ZC7 A;  3MKF A;  2ZMA A;  4WZ5 C;  5EVI B;  2HDS A;  3NBL A;  5U47 A;  3MXR A;  5EUA A;  4JKT A;  1NZU A;  3O86 A;  1GA9 A;  3IWO A;  5FAO A;  3WS4 A;  3ISG A;  4JF6 A;  4RYE A;  1KVM A;  4LV3 A;  1L0D A;  3LCE A;  3BLM A;  2XK1 A;  3HLF A;  1FQG A;  3BRM A;  5CHM A;  1IYP A;  1I2W A;  2Y55 A;  3WRT A;  2IWD A;  4R3B A;  2FFY A;  1SDE A;  1ES2 A;  4QU3 A;  5EPH A;  5GHX A;  5EVI C;  2EFU A;  5CEC A;  2Y2Q A;  1YLT A;  1L0E A;  4DF6 A;  5A90 A;  3M6B A;  4BQM A;  1FR1 A;  3CJM A;  4KG6 A;  3SS5 A;  5HFO A;  1ONH A;  3BLS A;  4KZA A;  3W4O A;  5HW3 A;  4P87 A;  4BD1 A;  4BLM A;  1KE4 A;  3IH8 A;  4D2O A;  3NCK A;  3G4P A;  4QY6 A;  5FAT A;  5E2F A;  1RGZ A;  5GL9 A;  5CGW A;  3MFD A;  2WAF A;  1VM1 A;  4KQO A;  4EWF A;  5JYO A;  4R0Q A;  5F1F A;  4C75 A;  5E43 A;  1O7E A;  2I72 A;  3CG5 A;  5FQJ A;  4JXG A;  2XQZ A;  1H5X A;  1H8Y A;  3WS1 A;  2XGN A;  1SKF A;  3HLG A;  4GKU A;  3P98 A;  5DTS A;  5CEB A;  4ZTK A;  2P74 A;  3ZDJ A;  1ES5 A;  3BFE A;  3Q07 A;  3Q81 A;  1NXY A;  4UHU A;  4WYY A;  5FI7 A;  3UE1 A;  4P6B A;  2Y2L A;  2ZM0 A;  2EXB A;  4Z9Q A;  2HDU A;  4B4X A;  2HDR A;  4WBG A;  4E3L A;  3Q7Z A;  1BTL A;  4OVD A;  1GHM A;  1IYO A;  3O3V A;  1TVF A;  3V50 A;  1SHV A;  5EOE A;  1MWR A;  3MZD A;  3N8S A;  1Y54 A;  2Q9N A;  4ZAM A;  4IBR A;  4EBN A;  4JBF A;  3HUO A;  5EVL A;  5KMW A;  4U0T A;  4BL2 A;  3BYD A;  3BFF A;  4DKI A;  5CED A;  2VGK A;  1QMF A;  4QJG A;  2R9W A;  1NJ4 A;  1FCM A;  1XKZ A;  3HRE A;  5GLA A;  2QMI A;  5HAP A;  4OQG A;  4OPY A;  3C7V A;  1ERQ A;  3CMZ A;  2Y2O A;  2HPB A;  3OCN A;  4S2N A;  1PI5 A;  3NDG A;  1YMS A;  4FD8 A;  1I5Q A;  4PM9 A;  4MBF A;  4OOY A;  3AGE A;  1S6R A;  2WK0 A;  4OP5 A;  3RJU A;  2JCH A;  1WYC A;  3IXD A;  4ZBE A;  2RL3 A;  4PM5 A;  2Y2I A;  4E3K A;  4FH4 A;  1YLP A;  4MNR A;  4E3M A;  3M2J A;  2C5W B;  3A3F A;  3BEC A;  5HL1 A;  4WZ5 A;  3EQV A;  2WAD A;  2P9V B;  1BSG A;  5FAP A;  4OQ0 A;  4DE2 A;  4OPQ A;  4OP8 A;  3NY4 A;  4QD4 A;  1CEF A;  4C3Q A;  1PYY A;  2ZC3 B;  3GR2 A;  3IH9 A;  3OZH A;  5EEC A;  3NDE A;  1MBL A;  3MBZ A;  1FOF A;  2XF3 A;  3HUN A;  4MLL A;  3ZCZ A;  3N8L A;  4BL3 A;  3E2K A;  3UDX A;  4S2K A;  1HD8 A;  3LEZ A;  3FZC A;  1I2S A;  1YLY A;  3IT9 A;  4KZ8 A;  1K57 A;  2WKE A;  4S2L A;  3V3S A;  5EVI A;  4DDY A;  4WZ4 A;  4XUX A;  1K56 D;  4Y0T A;  5E2G A;  4GOG A;  4Y0O A;  1DY6 A;  1FR6 A;  1KVL A;  5CTN A;  1PWG A;  2V2F F;  2A3U A;  4JLF A;  1KDS A;  4CPK A;  5DTK A;  4R4S A;  3PAG A;  4CJN A;  1K56 A;  3NIA A;  3HBR A;  1ONG A;  4KG5 A;  1YT4 A;  3ZVT A;  5M1A A;  2X71 A;  2XEP A;  5CTM A;  4HEF A;  1NRF A;  1YLW A;  4WM9 A;  3AGD A;  1XA7 A;  1QME A;  2EX8 A;  4KQQ A;  2J8Y A;  3GV9 A;  3IHB A;  1NY0 A;  4OKP A;  5FDH A;  3S1Y A;  2JE5 A;  1G6A A;  5IHV A;  5BOH A;  1S0W A;  3B3X A;  3PAE A;  1KGF A;  3Q1F A;  2J9O A;  3VP1 A;  2E8I A;  2WZX A;  5TR7 A;  2Y2M A;  3G34 A;  5HX9 A;  1O07 A;  3HVF A;  1TDG A;  4DRT A;  3LO7 A;  1K55 C;  4KEN B;  2RCX A;  4P85 A;  5HAQ A;  2ZQA A;  3ZNY A;  4U3T A;  4X56 A;  2G2U A;  4KG2 A;  1K57 C;  1SCW A;  5CGS A;  4E3J A;  1E4D A;  5CRF A;  1JWZ A;  4OOL A;  3FKW A;  1BLS A;  4KZB A;  4MEZ A;  3OPH A;  3PBR A;  3N7W A;  3IXH A;  4X53 A;  1OME A;  3E2L A;  1NYM A;  1ALQ A;  2EX9 A;  3IHA A;  5CHU A;  4ZJ3 A;  4EUZ A;  4N1X A;  4E6X A;  3HLD A;  1WE4 A;  2WGW A;  3S4X A;  5EOO A;  1W8Y A;  2J7V A;  5AQ7 A;  2ZM2 A;  2V1Z A;  1N9B A;  4K0X A;  3O87 A;  4R4R A;  4YIN A;  4PM7 A;  2WZZ A;  3ZG0 A;  2Y2J A;  4OON A;  1ZG6 A;  4O7D A;  4JF5 A;  4GN2 A;  1PWC A;  2WUQ A;  2V20 A;  4ZJ1 A;  2ZQ7 A;  1PZO A;  1CEG A;  1YQS A;  2WGW B;  4GD8 A;  5A92 A;  5M18 A;  4KQR A;  4KZ9 A;  1BZA A;  4NK3 A;  4E6W A;  5GHY A;  1W79 A;  4LCL A;  3ZVW A;  3C4O A;  3VFH A;  4OPR A;  1CI9 A;  2OLU A;  4OLG A;  4Y0U A;  3BFD A;  4EQI A;  2Z2M B;  2H0Y A;  2BG1 A;  2WAE A;  1IKG A;  1MXO A;  1Q2P A;  3QHY A;  4IED A;  5CGX A;  3SH9 A;  3ZG5 A;  3G35 A;  2JC7 A;  3HLB A;  1PZP A;  4X6T A;  1XGJ A;  3ZG7 B;  4RA7 A;  1BT5 A;  4X55 A;  1E3U D;  2A49 A;  1XXM A;  4LV1 A;  1K6S A;  2ZQD A;  1M40 A;  2ZC5 B;  3BM6 A;  3DW0 A;  4OQH A;  2B5R A;  3IF5 A;  1K38 A;  4WEJ A;  1DJB A;  4C6Y A;  1ERM A;  2XH9 A;  4PM6 A;  1E3U A;  3C4P A;  1MWT A;  3UY6 A;  4KZ3 A;  3MXS A;  4ZDX A;  3UPN A;  2X02 A;  1IEM A;  2C6W B;  2Y4A A;  4HES A;  3GMW A;  2P9V A;  1YLZ A;  1H8Z A;  5F83 A;  2VGJ A;  5GLB A;  1YM1 A;  4XXR A;  3UE0 A;  2XFS A;  2H10 A;  1XGI A;  2XR0 A;  1VQQ A;  5DF8 A;  1GCE A;  1BLH A;  1SDN A;  4LV2 A;  3VFF A;  1YMX A;  5DF7 A;  4JPM A;  2UWX A;  3VSL A;  1RGY A;  4GZB A;  3QNC A;  3HLC A;  2OV5 A;  3BFG A;  2PU4 A;  4Q8I A;  5JYP A;  1JVJ A;  1ESI A;  4IVK A;  1IEL A;  2QZ6 A;  3VP2 A;  2HDQ A;  1LHY A;  4UA9 A;  1JTG A;  3G2Z A;  4S2I A;  3VOY A;  2ZJ9 A;  4GNU A;  2H0T A;  2Y59 A;  1IYQ A;  4MBK A;  4PM8 A;  3RXW A;  3JYI A;  2DRW A;  2FFF B;  1KE3 A;  3HL9 A;  1K55 A;  3A3D A;  3TSG A;  5FQ9 A;  1K54 C;  3Q7V A;  1XA1 A;  1EWZ A;  1PW8 A;  4UA6 A;  4JXW A;  3HUM A;  1PIO A;  3N6I A;  4DDS A;  4DE3 A;  1BLP A;  3IXG A;  4KZ7 A;  3UN7 A;  1TDL A;  5FSR A;  3BEB A;  4Y7P A;  1MPL A;  2ZQC A;  3IQA A;  4QY5 A;  1HVB A;  4UA7 A;  3P09 A;  4YFM A;  3WS5 A;  3A3J A;  4N1H A;  3MZE A;  5HAR A;  2Y2G A;  5FI2 A;  5A91 A;  4E3I A;  4E3N A;  4KZ5 A;  3IF6 B;  2CC1 A;  3Q7V B;  4S2O A;  1LI9 A;  2XD1 A;  4IBX A;  2OLV A;  4GDN A;  3OC2 A;  2J9P A;  1NYY A;  2WGV A;  4RVA A;  2DNS A;  1C3B A;  3N8R A;  4X69 A;  3WWX A;  4BJP A;  1FSW A;  1LL9 A;  1DJC A;  2ZM8 A;  1ZKJ A;  4OQI A;  3SS4 A;  3SS3 A;  3QNB A;  4X68 A;  1BUL A;  3C5A A;  5EE8 A;  3I7J A;  1JTD A;  3GTC A;  4A5R A;  5L2F A;  3ZGA B;  2Y2H A;  3SH7 A;  4QB8 A;  3IF6 C;  4JF4 A;  3G2Y A;  3G32 A;  4S2M A;  5AQ9 A;  2WGI A;  3TOI A;  3FWL A;  1AXB A;  3PBO A;  4LEN A;  3DWZ A;  2ZLY A;  2WYX A;  3LY3 A;  5TFQ A;  4K0W A;  2G2W A;  3FV7 A;  4P0M A;  3GQZ A;  1IKI A;  3WS0 A;  2HP9 A;  1K4E A;  3O88 A;  3M2K A;  3OPL A;  2JBF A;  2WKI A;  4DE0 A;  1CI8 A;  3IWI A;  4JXV A;  1L0G A;  3NI9 A;  1XPB A;  1LI0 A;  1FCN A;  4PPR A;  1RCJ A;  4R1G A;  5GHZ A;  1GHP A;  1E25 A;  3V3R A;  4DXB A;  2DCF A;  1K25 A;  3PBN A;  2WKH A;  5GLD A;  1U60 A;  4GDB A;  5FQI A;  3M6H A;  4EBL A;  1GHI A;  1PW1 A;  4R23 A;  5CHJ A;  2ZQ9 A;  2X01 A;  1HTZ A;  2H5S A;  4HBT A;  3CZD A;  1K4F A;  4ID4 A;  3UE3 A;  1YLJ A;  2R9X A;  3G31 A;  4FH2 A;  4JXS A;  1DJA A;  3S22 A;  4KZ6 A;  5KSH A;  2ZD8 A;  4LCM A;  1G68 A;  3IWQ A;  3VOZ A;  4E3O A;  4EBP A;  1BLC A;  4H8R A;  3W8K A;  4UAA A;  1KE0 A;  1M6K A;  3OPR A;  1W7F A;  3HLW A;  4N92 A;  3ZG9 B;  5DVA A;  1J9M A;  4R3J A;  2Q9M A;  1MY8 A;  3ITB A;  5FAQ A;  4GB7 A;  4GD6 A;  3PBT A;  2XDM A;  2IWC A;  3UDF A;  1RP5 A;  1MWS A;  1MWU A;  2ZC6 B;  4FSF A;  5GLC A;  5AQA A;  3VMA A;  1HZO A;  1ZG4 A;  4U0X A;  5A93 A;  5CER A;  3ZFZ A;  1ES4 A;  5F1G A;  3PBS A;  5FA7 A;  1LL5 A;  3C7U A;  1K54 A;  2QPN A;  5G18 A;  2Z2L B;  3GVB A;  4DXC A;  2Y2P A;  4OOM A;  1N4O A;  3UO9 A;  5F82 A;  1GA0 A;  1IYS A;  2XLN A;  4FCF A;  1ESU A;  5FQM A;  1FSY A;  3V39 A;  4M3K A;  4RX2 A;  2XFT A;  4N9L A;  5DTT A;  1PWD A;  4OH0 A;  2IWB A;  3UNW A;  1ERO A;  3FKV A;  3PTE A;  3MZF A;  1JWV A;  3VSK A;  3Q82 A;  1ZC2 A;  3EQU A;  4DE1 A;  3BFC A;  3VP0 A; 
#chains in the Genus database with same CATH topology
 5AQB A;  1LT0 A;  3W4P A;  3OCL A;  1NLY A;  1MC0 A;  3DWK A;  3G30 A;  3TW8 A;  1ES3 A;  4NET A;  1Q2Q A;  4H6J B;  3PBQ A;  1KDW A;  3T4K A;  2GJ3 A;  1Z6F A;  1TS7 A;  2O9A A;  4II7 A;  4EES A;  3IBJ A;  1NRJ A;  4UQI M;  4OLD A;  4MBH A;  2HP6 A;  4Q0J A;  4Y17 A;  3LIB A;  4OPZ A;  4N9K A;  5KSC A;  5TBM A;  5I94 A;  3CPT B;  3DTM A;  5DF9 A;  3ZHH A;  1KOU A;  1PNE A;  3NC8 A;  3R7W A;  1JWP A;  1KGE A;  3MKE A;  2K31 A;  2QHK A;  4CQH A;  1NZU A;  3O86 A;  3NOP C;  2XSS A;  3WS4 A;  4JF6 A;  3RH8 B;  4KUK A;  5F6A A;  1EW0 A;  3E4O A;  1FQG A;  3BRM A;  1IYP A;  1I2W A;  3MQ0 A;  4LGW A;  5CEC A;  2Y2Q A;  1F9I A;  4DF6 A;  3NHQ A;  4BQM A;  1FR1 A;  3CJM A;  3BLS A;  4BD1 A;  1KE4 A;  3IH8 A;  3A0V A;  5GL9 A;  3MFD A;  2WAF A;  1VM1 A;  4EWF A;  4R0Q A;  2Z6D A;  2O0Y A;  4UQI S;  1O7E A;  5FQJ A;  2XQZ A;  4K08 A;  3H7W B;  1SZV A;  5DTS A;  3CUE C;  3ZDJ A;  3B33 A;  3BFE A;  1NXY A;  3UE1 A;  2Y2L A;  5FL3 A;  2J3T D;  4B4X A;  2HDU A;  4WBG A;  2D02 A;  1BTL A;  1OTB A;  5AVF A;  2W3F A;  3O3V A;  3U2A A;  1MWR A;  3U4L P;  2JHE A;  4GLQ A;  3LYX A;  2V0U A;  4DKI A;  2VKS A;  3D72 A;  4QJG A;  5GLA A;  3HRE A;  4HH3 A;  5IS1 A;  4OPY A;  3CMZ A;  2HPB A;  4S2N A;  1PI5 A;  3NDG A;  4FD8 A;  4PM9 A;  3RJU A;  2W3E A;  1YLP A;  3M2J A;  4PKY A;  1V9Y A;  3IS2 A;  3EQV A;  4ZRR A;  4OPQ A;  2KOI A;  1CEF A;  2ZL1 B;  3IH9 A;  3GDI A;  3HUN A;  4MLL A;  4Y3I A;  3UDX A;  2JKR M;  3LEZ A;  3IBR A;  4S2L A;  1PFL A;  4HJ6 A;  5EVI A;  4WZ4 A;  2V1B A;  1K56 D;  5HD5 A;  5E2G A;  4AFI A;  1FR6 A;  3ZQ5 A;  2V2F F;  3LR3 A;  4CPK A;  4G3V A;  1K56 A;  3NIA A;  3NOT C;  3ZVT A;  5M1A A;  5CTM A;  4WM9 A;  4NXG A;  5I5L A;  1XA7 A;  2J8Y A;  1NY0 A;  5IHV A;  5BOH A;  3PAE A;  2ZMF A;  1O07 A;  3HVF A;  3W2Z A;  4KEN B;  1Y4O A;  4P85 A;  5HAQ A;  3FKW A;  5J4E A;  4BBU A;  1NYM A;  4ZJ3 A;  2EX9 A;  3EOI A;  3HLD A;  3T50 A;  3MQO A;  2PAV P;  3IX4 A;  2B02 A;  2V1Z A;  1N9B A;  4I3A A;  4O7D A;  5IU1 A;  4JF5 A;  1PWC A;  1PZO A;  5M18 A;  1YQS A;  5GHY A;  1W79 A;  4LCL A;  2PD8 A;  3ZVW A;  3C4O A;  2XRO A;  3UE6 A;  5DFX A;  4L9G A;  3L7H A;  5CGX A;  4IED A;  3QHY A;  1MXO A;  3ZG5 A;  4O0P A;  3ZG7 B;  3KSH A;  2A49 A;  3TRC A;  1XXM A;  4GCZ A;  1T1A A;  1K6S A;  3DW0 A;  1H0M A;  1K38 A;  3UB9 A;  1ERM A;  4O8G A;  2VX8 A;  3EGD C;  3UPN A;  2C6W B;  2Y4A A;  1OTA A;  3C30 A;  4ARZ A;  2QWS A;  5DFY A;  2XFS A;  2XR0 A;  5DF8 A;  2L1M A;  1GCE A;  1SDN A;  4WUJ A;  4JPM A;  2FZ0 A;  2VZW A;  5HL6 A;  1VET A;  4S2I A;  2ZJ9 A;  1XJ6 A;  3ULF A;  2JKG A;  4PM8 A;  3RXW A;  2FFF B;  1K55 A;  5FQ9 A;  1JNU A;  3VE4 A;  4KZ7 A;  3UN7 A;  1TDL A;  4UA7 A;  1LSW A;  4HHD A;  4YFM A;  2VEA A;  5FI2 A;  5L10 A;  5A91 A;  1G5U A;  5CX7 A;  3ZYT A;  2CC1 A;  2B18 A;  1C3B A;  4M4X A;  1F2K A;  4X68 A;  3I7J A;  1JTD A;  5L2F A;  2Y2H A;  3SH7 A;  2XRN A;  4S2M A;  2WGI A;  1G6O A;  1AXB A;  2PRF A;  3LY3 A;  3T1Q B;  1IKI A;  3WS0 A;  4Y2F A;  1K4E A;  3T1S A;  4DE0 A;  3UME A;  4JXV A;  3HCY A;  1XJ2 A;  5HWT A;  3GEC A;  2QYB A;  3PBN A;  2WKH A;  5F68 A;  4GDB A;  4EBL A;  3SZT A;  2BAS A;  3JVU A;  2X01 A;  1MKM A;  2H5S A;  3H82 B;  2R78 A;  1K4F A;  4FH2 A;  1DJA A;  3S22 A;  1G68 A;  3IWQ A;  3VOZ A;  2JN7 A;  4H8R A;  4EEU A;  4UAA A;  3HLW A;  3ZG9 B;  1J9M A;  1MY8 A;  5FAQ A;  3LIA A;  3PBT A;  4Q0H A;  2PD7 A;  1OTI A;  5AJG A;  2IWC A;  4FSF A;  3VMA A;  1HZO A;  1ZG4 A;  1H8M A;  5F1G A;  2YKF A;  2W3G A;  5F82 A;  3S7P A;  1IYS A;  1ESU A;  5G4Y A;  1FSY A;  2EWV A;  3V39 A;  2XFT A;  5DTT A;  3QP1 A;  1PWD A;  2HGV A;  3FKV A;  3PTE A;  3MZF A;  3VSK A;  5DJU A;  1NWZ A;  3VP4 A;  4KZ4 A;  1L3L A;  4HJ3 A;  1MKI A;  2EX2 A;  5HAI A;  3SH8 A;  1LLB A;  2Y91 A;  5HDD A;  2Y8H A;  4WMC D;  4EV4 A;  2QKP A;  2HF6 A;  3GRJ A;  3FYZ A;  4ZJ2 A;  4X25 A;  4WMC A;  1EI5 A;  4LRZ E;  4MN5 A;  1NZO A;  3UPP A;  4QHC A;  5M19 A;  3NJA A;  4JGO A;  4JGQ A;  4DN0 A;  2HP5 A;  3H9W A;  4HBU A;  4PMA A;  3VE3 A;  4BEN A;  2PU2 A;  2Y2N A;  2OSU A;  4S2N C;  3W4Q A;  4L0L A;  2EFX A;  3UMD A;  3A3E A;  3LI9 A;  5CXW A;  2OAQ 1;  3VP3 A;  4G3W A;  4XUZ A;  4HY8 A;  2ZC7 A;  1D1J A;  5EVI B;  3NBL A;  1GA9 A;  3ISG A;  1KVM A;  1L0D A;  1VEU B;  2IWD A;  4B9O A;  1SDE A;  3MF0 A;  5EVI C;  1S1Y A;  1TD5 A;  4F3L B;  1P97 A;  5HFO A;  1ONH A;  3W4O A;  5C5K A;  4BLM A;  4QY6 A;  2A24 B;  5EFW A;  5F1F A;  4I3I A;  1CQA A;  3CG5 A;  4HNB A;  1Z09 A;  3BQ8 A;  1H8Y A;  3WS1 A;  1SKF A;  5CEB A;  3P01 A;  4ZTK A;  1ES5 A;  4MN6 A;  4MCW A;  4P6B A;  2ZM0 A;  3PYP A;  4E3L A;  3TJZ C;  1GHM A;  1YAX A;  4HIA A;  2J3W A;  5EOE A;  3MZD A;  3CLO A;  1FIL A;  4U0T A;  3BYD A;  5K5B A;  2VGK A;  2VV8 A;  1NJ4 A;  3C38 A;  2AVX A;  3DTK A;  2Y2O A;  3OCN A;  3AGE A;  2WK0 A;  2RL3 A;  1LL8 A;  1S1Z A;  4E3M A;  4EQ1 A;  5HSQ A;  5HL1 A;  3QP6 A;  2WAD A;  4OQ0 A;  4DE2 A;  3NY4 A;  4QD4 A;  4C3Q A;  4O01 A;  3GR2 A;  2V8C A;  5EEC A;  1MBL A;  1GSX A;  3LR0 A;  1YKD A;  2JKT M;  2PHY A;  3ZCZ A;  3N8L A;  3E2K A;  4S2K A;  1YLY A;  4R70 A;  1K57 A;  4GJ4 A;  2P7J A;  4WLA A;  4Y0O A;  1DY6 A;  1PWG A;  4JLF A;  5DTK A;  4R4S A;  4KG5 A;  1YT4 A;  2XEP A;  1NRF A;  1YLW A;  3AGD A;  1CF0 A;  3R4K A;  2JE5 A;  3B3X A;  3Q1F A;  3VP1 A;  4BBV A;  4EU0 A;  1TDG A;  3LO7 A;  1K55 C;  2RCX A;  5TJJ A;  4U3T A;  2G2U A;  5CGS A;  3S7O A;  3KO6 A;  5CRF A;  4B93 A;  1BLS A;  1YPR A;  4KZB A;  4MEZ A;  3K3D A;  4X53 A;  5FEF A;  5CHU A;  2OOL A;  4LLO B;  4E6X A;  1WE4 A;  2LB9 A;  5AQ7 A;  2ZM2 A;  4KUO A;  4R4R A;  3O87 A;  2WZZ A;  3ZG0 A;  2Y2J A;  4OON A;  2D01 A;  2W1T B;  4I5S A;  4ZJ1 A;  2VK3 A;  2WGW B;  1OT6 A;  4CLC B;  3F1O A;  3MJQ A;  4OPR A;  1CI9 A;  4Y0U A;  3BFD A;  4PKY G;  1OTE A;  1IKG A;  1Q2P A;  3G35 A;  4CLC C;  4RA7 A;  4X55 A;  2LB5 A;  1N9L A;  4OQH A;  2B5R A;  1DJB A;  2XH9 A;  4PM6 A;  2X02 A;  3HJK A;  3B42 A;  3GMW A;  1H8Z A;  4G3K A;  5GLB A;  1YM1 A;  4XXR A;  1XGI A;  3QP2 A;  3VV4 A;  2IA2 A;  2PYR A;  3VFF A;  1GSV A;  5FEG A;  4GZB A;  2PU4 A;  1YSQ A;  2QZ6 A;  2HDQ A;  5DKK A;  1JTG A;  3G2Z A;  3LGO A;  4GNU A;  2H0T A;  2M7U A;  3JYI A;  2DRW A;  1XA1 A;  1EWZ A;  1PW8 A;  4JXW A;  3N6I A;  3IXG A;  5FSR A;  3BEB A;  1P9W A;  3LR4 A;  3T4T A;  2ZQC A;  2PR5 A;  3A3J A;  4WL9 A;  3WS5 A;  2Y2G A;  4KZ5 A;  1XJ4 A;  3Q7V B;  4S2O A;  2VV6 A;  1SKO B;  3OC2 A;  2J9P A;  3F1N B;  4X69 A;  3WWX A;  2QJ7 A;  4BJP A;  4OQI A;  1LL9 A;  3IX8 A;  3MS6 A;  3QNB A;  4A5R A;  1FIK A;  4GHI A;  3G32 A;  3DTI A;  4FOF A;  4FTX A;  4LEN A;  3FV7 A;  4P0M A;  3MXQ A;  1ACF A;  3NEC A;  3M2K A;  3IWI A;  4NEE D;  1T1C A;  1L0G A;  3BY8 A;  4PPR A;  1RCJ A;  4GS9 A;  5GHZ A;  3CI6 A;  5F5Y A;  4DXB A;  5CHJ A;  3CZD A;  3UE3 A;  5KIZ A;  2R9X A;  4P6Z M;  1M6K A;  1W7F A;  2OWH A;  2Q9M A;  2CMN A;  2V9A A;  3ICY A;  4GB7 A;  2FH5 A;  2HV1 A;  2ZC6 B;  5GLC A;  5CER A;  1ES4 A;  2QPN A;  5G18 A;  4DXC A;  2Y2P A;  4OOM A;  2XLN A;  1P9R A;  3HJI A;  1UGU A;  4N9L A;  4OH0 A;  3S7N A;  3UNW A;  1DP9 A;  3EQU A;  3BFC A;  4EXO A;  1W8Q A;  1L2S A;  2P04 A;  3D4F A;  3OPP A;  4R38 A;  4H6J A;  1K6R A;  1PI4 A;  1XP4 A;  2E8J A;  5FI6 A;  2PBY A;  1L0F A;  4HP9 A;  4S2P A;  4WEL A;  3UDI A;  4ETX A;  4P6Z S;  5FQK A;  2XD5 A;  3IXB A;  1BUE A;  1KGG A;  4S2J A;  2KX6 A;  3NUL A;  3RXX A;  3CPT A;  2ZQ8 A;  3UPO A;  3A3I A;  4NXF A;  2Y2K A;  4BBT A;  3WS2 A;  2HZ5 A;  1TEM A;  4BD0 A;  5D3O A;  3T1R A;  4LV0 A;  2EXA A;  2VA0 A;  4EEP A;  3NOU C;  3N4I A;  4IVI A;  3LY4 A;  2V8F A;  4F94 A;  4B88 A;  4B4Z A;  5J8X A;  3MKF A;  2ZMA A;  5HWV A;  2HDS A;  5TBM B;  1NLZ A;  3D9Y A;  3MXR A;  2O99 A;  3IWO A;  5FAO A;  1W63 Q;  4RYE A;  4LV3 A;  3R7W B;  4HH2 A;  3CWF A;  3HLF A;  2FFY A;  3OOV A;  1ES2 A;  5EPH A;  3T12 B;  2NUP C;  5L8M A;  1L0E A;  2KDK A;  5A90 A;  3M6B A;  5J3W A;  5MC7 A;  1VB6 A;  4P87 A;  4WF0 A;  3B47 A;  2O9B A;  4D2O A;  3NCK A;  3G4P A;  5FAT A;  1MZU A;  5CGW A;  5JYO A;  4C75 A;  4R6L A;  3P98 A;  3RFB A;  1TS6 A;  4WYY A;  4UHU A;  2BTF P;  1TVF A;  4PHT A;  3V50 A;  1SHV A;  3N8S A;  5IT5 A;  1Y54 A;  4ZAM A;  4IBR A;  3TE8 A;  2PYP A;  5EVL A;  2W3H A;  5KMW A;  3SW1 A;  1S4S A;  3BWL A;  2A2L A;  1XKZ A;  5HDS A;  4RQ9 A;  3LR5 A;  3KYE A;  3C7V A;  4EER A;  3UDF A;  1I5Q A;  4MBF A;  4OOY A;  4OP5 A;  2JCH A;  3CIT A;  2M1C A;  2WKP A;  3IXD A;  4ZBE A;  1A0K A;  2Y2I A;  4PM5 A;  2ZL1 A;  4E3K A;  4FH4 A;  2JKR I;  2C5W B;  3A3F A;  3BEC A;  4WZ5 A;  2J80 A;  4YOF A;  2XA7 M;  4OP8 A;  1PYY A;  3E4P A;  1DP6 A;  2J3T C;  3MBZ A;  1FOF A;  2XF3 A;  3LIE A;  3IS2 B;  1HD8 A;  5DJT A;  3FZC A;  2WKE A;  4DDY A;  4XUX A;  4IUH A;  4GOG A;  1KVL A;  5CTN A;  2A3U A;  3MFX A;  2M7V A;  4BWI A;  4EET B;  4CJN A;  1ONG A;  2X71 A;  4HEF A;  1UWP X;  1QME A;  2EX8 A;  3GV9 A;  4OKP A;  5FDH A;  1G6A A;  2J9O A;  2E8I A;  5HX9 A;  3S7Q A;  1OTD A;  2ZQA A;  3ZNY A;  4X56 A;  4E3J A;  5EM1 A;  3EEH A;  3PBR A;  4EUV A;  3N7W A;  1TF1 A;  3IXH A;  3E2L A;  1ALQ A;  4EUZ A;  1STZ A;  4N1X A;  3S4X A;  4I38 A;  2J7V A;  3L9K A;  4K0X A;  3MMH A;  4YIN A;  4PM7 A;  3A0S A;  2XA7 S;  4GN2 A;  4LRX C;  2WUQ A;  2ZQ7 A;  1CEG A;  3CHW P;  5A92 A;  4KZ9 A;  1Y28 A;  1BZA A;  2V0W A;  4GS9 B;  2I9V A;  4EQI A;  1TS0 A;  2Z2M B;  2H0Y A;  2BG1 A;  2WAE A;  3SH9 A;  3HLB A;  4X6T A;  2PBD P;  2K2N A;  2ZC5 B;  3IF5 A;  3D3O A;  3C4P A;  1MWT A;  2W1R A;  3MXS A;  4ZDX A;  1IEM A;  4HES A;  2H28 A;  1T19 A;  3PHY A;  3F1P A;  2P9V A;  3CAX A;  1YLZ A;  3BQA A;  3UE0 A;  4Y15 A;  1X0O A;  1VQQ A;  5F69 A;  1BLH A;  4JGR A;  4MMN A;  4Y5F A;  2UWX A;  5EV0 A;  3HLC A;  2OV5 A;  4Q8I A;  2G7U A;  4ARZ B;  1JVJ A;  2ZOI A;  4IVK A;  3VP2 A;  1LHY A;  4UA9 A;  2PDR A;  2Y59 A;  4MBK A;  5HD3 A;  1ODV A;  1KE3 A;  2Q0O A;  3TSG A;  2V1A A;  4UA6 A;  1PIO A;  4DE3 A;  1VET B;  3IQA A;  3P09 A;  3MSH A;  3MZE A;  5HAR A;  4E3I A;  4E3N A;  3O5Y A;  3JPU A;  1LI9 A;  3K3C A;  2OLV A;  4IBX A;  3EWK A;  4RVA A;  2DNS A;  3UB5 P;  1AWI A;  2ZM8 A;  2NUT C;  3C5A A;  3GTC A;  2PT7 A;  3ZGA B;  4JF4 A;  1OPX A;  5AQ9 A;  5FDS A;  3PBO A;  2WYX A;  4K0W A;  1LSV A;  3GQZ A;  4JGP A;  2HP9 A;  4HP4 A;  4NXE A;  4E04 A;  3OPL A;  1CI8 A;  1H3Q A;  3C8C A;  1LI0 A;  3H82 A;  4R1G A;  1WA9 A;  1U60 A;  5FQI A;  3DAV A;  4R23 A;  2ZQ9 A;  4UEY A;  2QJ5 A;  4ID4 A;  4JXS A;  5KSH A;  2WKR A;  4LRY C;  3W8K A;  1KE0 A;  5AVE A;  2O9C A;  4R3J A;  4GD6 A;  1IFQ A;  1S4R A;  2XDM A;  3UB8 A;  1RP5 A;  1MWS A;  1MWU A;  4L9F A;  4U0X A;  3ZFZ A;  1PRQ A;  4PAU A;  4L9E A;  3MQQ A;  1LL5 A;  3C7U A;  3EEA A;  1K54 A;  3GVB A;  5FQM A;  3QP8 A;  4M3K A;  4RX2 A;  2ZOH A;  2IWB A;  4DMZ A;  1JWV A;  1GSW A;  3VP0 A;  4ESP A;  2ZMV A;  5E2H A;  1XJ3 A;  4I39 A;  4LFU A;  4R3A A;  3C2W A;  1OT9 A;  2HJE A;  3BW6 A;  5KZH A;  3IF6 A;  2VGL M;  4NG2 A;  5FQQ A;  2VV7 A;  1P0Z A;  1N9N A;  4RX3 A;  4YWZ A;  4BMW A;  1XX2 A;  3K2N A;  3SOI A;  4QWO A;  3RTY A;  4IUK A;  3QP4 A;  3V5M A;  1WYB A;  3ITA A;  4K91 A;  5EVI D;  5TGF A;  3ZG8 B;  1T1B A;  2EX6 A;  3GSG A;  3WRZ A;  3KYQ A;  3AGF A;  3PR6 A;  3HLE A;  5E2E A;  5FAS A;  1CK3 A;  1T18 A;  3ZNT A;  1W5D A;  2BLS A;  2ZC4 B;  4WEK A;  4D60 A;  3TG9 A;  1FCO A;  2GDN A;  3BY9 A;  3P7N A;  4WZ5 C;  1VEU A;  5U47 A;  5EUA A;  4JKT A;  4NXB A;  5LBR A;  4ME4 A;  1J3W A;  1OJG A;  4DJ2 A;  4F3L A;  4X1L A;  3LCE A;  3JVV A;  3BLM A;  2XK1 A;  2B95 A;  5CHM A;  2Y55 A;  4XT2 A;  3WRT A;  1YSP A;  4R3B A;  4YNR A;  4QU3 A;  5GHX A;  2EFU A;  3E0Y A;  3LFV A;  4HJ4 A;  1YLT A;  2UV0 E;  3LIF A;  1S66 L;  2VGL S;  2A24 A;  2L0W A;  2GNX A;  3UB7 A;  1S67 L;  4KG6 A;  3SS5 A;  1V9Z A;  4KZA A;  5HW3 A;  5HDC A;  5HPI A;  2K7S A;  5E2F A;  1RGZ A;  3FG8 A;  1XFQ A;  2JKF A;  2WKQ A;  4KQO A;  2KLI A;  5E43 A;  2I72 A;  4JXG A;  1H5X A;  1K0K A;  2XGN A;  3OBF A;  3HLG A;  4GKU A;  2P74 A;  3Q07 A;  3Q81 A;  5FI7 A;  5HWW A;  2W27 A;  2EXB A;  4Z9Q A;  2HDR A;  3Q7Z A;  2MJ6 A;  4OVD A;  1IYO A;  3T4J A;  3FPW A;  2Y79 A;  2Q9N A;  4EBN A;  2OAP 1;  4JBF A;  3LI8 A;  3HUO A;  4BL2 A;  3BFF A;  5CED A;  1QMF A;  2Z6C A;  2R9W A;  1FCM A;  2QMI A;  5HAP A;  4OQG A;  1ERQ A;  1YMS A;  1S6R A;  1WYC A;  3FPV A;  2JKT I;  3PXP A;  3T1X A;  2ACG A;  4MNR A;  4FUW A;  3F1P B;  2P9V B;  1BSG A;  5FAP A;  3FC7 A;  4HOI A;  2ZC3 B;  2INW A;  3OZH A;  3NDE A;  3BJN A;  4BL3 A;  1I2S A;  3IT9 A;  4KZ8 A;  3V3S A;  4Y0T A;  2OWJ A;  1KDS A;  4IJG A;  3PAG A;  3DBA A;  1F98 A;  3HBR A;  5L07 A;  4GW9 A;  3T4Q A;  4NKP A;  4KQQ A;  3IHB A;  3S1Y A;  1S0W A;  1KGF A;  2WZX A;  5TR7 A;  2Y2M A;  3G34 A;  4DJ3 A;  4HQA A;  4DRT A;  1D7E A;  4KG2 A;  1K57 C;  1SCW A;  1E4D A;  1JWZ A;  4OOL A;  3OPH A;  1IOU A;  4CLC D;  1DRM A;  1OME A;  4MN7 A;  1G28 A;  3CUE A;  3IHA A;  2W1T A;  2WGW A;  4Z1W A;  4CLC A;  5EOO A;  1W8Y A;  4KQD A;  2DMW A;  3G6O A;  1HLU P;  2W3D A;  1ZG6 A;  3V67 A;  3H7W A;  2V20 A;  4GD8 A;  4KQR A;  4NK3 A;  4E6W A;  2GX5 A;  3VFH A;  3LUQ A;  2OLU A;  4OLG A;  4Q0I A;  3VOL A;  2ZBB A;  2GZA A;  3F1O B;  3EGX C;  2JC7 A;  1PZP A;  1XGJ A;  1BT5 A;  1E3U D;  4IHQ A;  4LV1 A;  2ZQD A;  1M40 A;  3BM6 A;  3OLO A;  4WEJ A;  4CLC E;  4C6Y A;  1LSX A;  1E3U A;  2EWW A;  3UY6 A;  3T4S A;  4KZ3 A;  5DKL A;  1F5M A;  1W63 M;  3LID A;  3KSG A;  5F83 A;  2VGJ A;  2H10 A;  4LV2 A;  1YMX A;  5DF7 A;  1ZHH B;  3VSL A;  5HPF A;  1RGY A;  3QNC A;  3BFG A;  1DP8 A;  5JYP A;  1ESI A;  1IEL A;  1UWN X;  3VOY A;  1IYQ A;  3HL9 A;  3A3D A;  3E4Q A;  1K54 C;  3Q7V A;  4DDS A;  3LEQ A;  3HUM A;  3KX0 X;  1SKO A;  3LIC A;  1BLP A;  2P08 A;  4Y7P A;  1MPL A;  4QY5 A;  1HVB A;  3F1N A;  4N1H A;  3IF6 B;  3UB6 A;  1OJ5 A;  2XD1 A;  4ETZ A;  4GDN A;  1NYY A;  2WGV A;  2EA9 A;  3N8R A;  2W0N A;  4I3J A;  5J7E A;  1FSW A;  3SS3 A;  1DJC A;  4Y13 A;  1ZKJ A;  4QPR A;  3SS4 A;  2VJW A;  1BUL A;  5EE8 A;  1BYW A;  4LPZ A;  5HZH A;  4QB8 A;  3IF6 C;  2L4R A;  1N9O A;  3G2Y A;  2VLG A;  3KYZ A;  3TOI A;  3A0R A;  3FWL A;  3DWZ A;  3KSI A;  2ZLY A;  4X1M A;  5TFQ A;  2G2W A;  3MR0 A;  1VHM A;  4GHI B;  3O88 A;  3E98 A;  2JBF A;  2WKI A;  3NI9 A;  1XPB A;  1FCN A;  3T4O A;  1GHP A;  1E25 A;  2YKH A;  3V3R A;  4WN5 A;  2DCF A;  1K25 A;  3DTE A;  5GLD A;  4HI4 A;  4EW7 A;  3M6H A;  1GHI A;  1PW1 A;  1HTZ A;  4HBT A;  1YLJ A;  3G31 A;  4MDZ A;  4XT2 B;  4KZ6 A;  5EVE A;  2ZD8 A;  4LCM A;  1D06 A;  4E3O A;  4EBP A;  1BLC A;  1CJF A;  3OPR A;  3QP5 A;  4N92 A;  5A8B A;  5DVA A;  3ITB A;  1TS8 A;  3KSF A;  1ZTU A;  5AQA A;  5EM0 A;  5A93 A;  2HJ9 C;  3PBS A;  5FA7 A;  3IX3 A;  2Z2L B;  5G4Z A;  3UO9 A;  1N4O A;  1GA0 A;  4FCF A;  1XFN A;  2PR6 A;  1ERO A;  5L09 A;  3Q82 A;  1ZC2 A;  4DE1 A;  3T4L A; 
#chains in the Genus database with same CATH homology
 1W8Q A;  5AQB A;  1L2S A;  3VP4 A;  5E2H A;  4KZ4 A;  3D4F A;  3W4P A;  3OPP A;  3OCL A;  1K6R A;  1PI4 A;  1MKI A;  1XP4 A;  2EX2 A;  3DWK A;  5FI6 A;  5HAI A;  3SH8 A;  1LLB A;  2PBY A;  3G30 A;  1L0F A;  2Y91 A;  4WMC D;  4EV4 A;  5KZH A;  3IF6 A;  5FQQ A;  1ES3 A;  3GRJ A;  4S2P A;  3FYZ A;  4NET A;  4RX3 A;  1Q2Q A;  4WEL A;  4ZJ2 A;  3UDI A;  3PBQ A;  1KDW A;  4WMC A;  1EI5 A;  3UPP A;  1NZO A;  1XX2 A;  5FQK A;  2XD5 A;  3SOI A;  3IXB A;  1BUE A;  4QHC A;  1Z6F A;  1KGG A;  4S2J A;  5M19 A;  3RXX A;  3V5M A;  1WYB A;  2HP5 A;  3ITA A;  4K91 A;  2ZQ8 A;  5EVI D;  5TGF A;  3ZG8 B;  3UPO A;  3A3I A;  4HBU A;  4OLD A;  4PMA A;  2Y2K A;  2EX6 A;  4MBH A;  2HP6 A;  3WS2 A;  4BEN A;  3GSG A;  1TEM A;  3WRZ A;  2PU2 A;  4BD0 A;  5D3O A;  3AGF A;  2Y2N A;  4OPZ A;  2OSU A;  3HLE A;  4LV0 A;  2EXA A;  4N9K A;  5KSC A;  5I94 A;  4S2N C;  5E2E A;  3W4Q A;  3DTM A;  4L0L A;  5FAS A;  1CK3 A;  3N4I A;  2EFX A;  3A3E A;  4IVI A;  3LY4 A;  3ZNT A;  5CXW A;  1W5D A;  2BLS A;  2ZC4 B;  4WEK A;  5DF9 A;  3VP3 A;  3ZHH A;  3NC8 A;  1JWP A;  4XUZ A;  1KGE A;  3MKE A;  3TG9 A;  4F94 A;  4B88 A;  4B4Z A;  5J8X A;  1FCO A;  2GDN A;  2ZC7 A;  3MKF A;  2ZMA A;  4WZ5 C;  5EVI B;  2HDS A;  3NBL A;  5U47 A;  3MXR A;  5EUA A;  4JKT A;  1NZU A;  3O86 A;  1GA9 A;  3IWO A;  5FAO A;  3WS4 A;  3ISG A;  4JF6 A;  4RYE A;  1KVM A;  4LV3 A;  1L0D A;  3LCE A;  3BLM A;  2XK1 A;  3HLF A;  1FQG A;  3BRM A;  5CHM A;  1IYP A;  1I2W A;  2Y55 A;  3WRT A;  2IWD A;  4R3B A;  2FFY A;  1SDE A;  1ES2 A;  4QU3 A;  5EPH A;  5GHX A;  5EVI C;  2EFU A;  5CEC A;  2Y2Q A;  1YLT A;  1L0E A;  4DF6 A;  5A90 A;  3M6B A;  4BQM A;  1FR1 A;  3CJM A;  4KG6 A;  3SS5 A;  5HFO A;  1ONH A;  3BLS A;  4KZA A;  3W4O A;  5HW3 A;  4P87 A;  4BD1 A;  4BLM A;  1KE4 A;  3IH8 A;  4D2O A;  3NCK A;  3G4P A;  4QY6 A;  5FAT A;  5E2F A;  1RGZ A;  5GL9 A;  5CGW A;  3MFD A;  2WAF A;  1VM1 A;  4KQO A;  4EWF A;  5JYO A;  4R0Q A;  5F1F A;  4C75 A;  5E43 A;  1O7E A;  2I72 A;  3CG5 A;  5FQJ A;  4JXG A;  2XQZ A;  1H5X A;  1H8Y A;  3WS1 A;  2XGN A;  1SKF A;  3HLG A;  4GKU A;  3P98 A;  5DTS A;  5CEB A;  4ZTK A;  2P74 A;  3ZDJ A;  1ES5 A;  3BFE A;  3Q07 A;  3Q81 A;  1NXY A;  4UHU A;  4WYY A;  5FI7 A;  3UE1 A;  4P6B A;  2Y2L A;  2ZM0 A;  2EXB A;  4Z9Q A;  2HDU A;  4B4X A;  2HDR A;  4WBG A;  4E3L A;  3Q7Z A;  1BTL A;  4OVD A;  1GHM A;  1IYO A;  3O3V A;  1TVF A;  3V50 A;  1SHV A;  5EOE A;  1MWR A;  3MZD A;  3N8S A;  1Y54 A;  2Q9N A;  4ZAM A;  4IBR A;  4EBN A;  4JBF A;  3HUO A;  5EVL A;  5KMW A;  4U0T A;  4BL2 A;  3BYD A;  3BFF A;  4DKI A;  5CED A;  2VGK A;  1QMF A;  4QJG A;  2R9W A;  1NJ4 A;  1FCM A;  1XKZ A;  3HRE A;  5GLA A;  2QMI A;  5HAP A;  4OQG A;  4OPY A;  3C7V A;  1ERQ A;  3CMZ A;  2Y2O A;  2HPB A;  3OCN A;  4S2N A;  1PI5 A;  3NDG A;  1YMS A;  4FD8 A;  1I5Q A;  4PM9 A;  4MBF A;  4OOY A;  3AGE A;  1S6R A;  2WK0 A;  4OP5 A;  3RJU A;  2JCH A;  1WYC A;  3IXD A;  4ZBE A;  2RL3 A;  4PM5 A;  2Y2I A;  4E3K A;  4FH4 A;  1YLP A;  4MNR A;  4E3M A;  3M2J A;  2C5W B;  3A3F A;  3BEC A;  5HL1 A;  4WZ5 A;  3EQV A;  2WAD A;  2P9V B;  1BSG A;  5FAP A;  4OQ0 A;  4DE2 A;  4OPQ A;  4OP8 A;  3NY4 A;  4QD4 A;  1CEF A;  4C3Q A;  1PYY A;  2ZC3 B;  3GR2 A;  3IH9 A;  3OZH A;  5EEC A;  3NDE A;  1MBL A;  3MBZ A;  1FOF A;  2XF3 A;  3HUN A;  4MLL A;  3ZCZ A;  3N8L A;  4BL3 A;  3E2K A;  3UDX A;  4S2K A;  1HD8 A;  3LEZ A;  3FZC A;  1I2S A;  1YLY A;  3IT9 A;  4KZ8 A;  1K57 A;  2WKE A;  4S2L A;  3V3S A;  5EVI A;  4DDY A;  4WZ4 A;  4XUX A;  1K56 D;  4Y0T A;  5E2G A;  4GOG A;  4Y0O A;  1DY6 A;  1FR6 A;  1KVL A;  5CTN A;  1PWG A;  2V2F F;  2A3U A;  4JLF A;  1KDS A;  4CPK A;  5DTK A;  4R4S A;  3PAG A;  4CJN A;  1K56 A;  3NIA A;  3HBR A;  1ONG A;  4KG5 A;  1YT4 A;  3ZVT A;  5M1A A;  2X71 A;  2XEP A;  5CTM A;  4HEF A;  1NRF A;  1YLW A;  4WM9 A;  3AGD A;  1XA7 A;  1QME A;  2EX8 A;  4KQQ A;  2J8Y A;  3GV9 A;  3IHB A;  1NY0 A;  4OKP A;  5FDH A;  3S1Y A;  2JE5 A;  1G6A A;  5IHV A;  5BOH A;  1S0W A;  3B3X A;  3PAE A;  1KGF A;  3Q1F A;  2J9O A;  3VP1 A;  2E8I A;  2WZX A;  5TR7 A;  2Y2M A;  3G34 A;  5HX9 A;  1O07 A;  3HVF A;  1TDG A;  4DRT A;  3LO7 A;  1K55 C;  4KEN B;  2RCX A;  4P85 A;  5HAQ A;  2ZQA A;  3ZNY A;  4U3T A;  4X56 A;  2G2U A;  4KG2 A;  1K57 C;  1SCW A;  5CGS A;  4E3J A;  1E4D A;  5CRF A;  1JWZ A;  4OOL A;  3FKW A;  1BLS A;  4KZB A;  4MEZ A;  3OPH A;  3PBR A;  3N7W A;  3IXH A;  4X53 A;  1OME A;  3E2L A;  1NYM A;  1ALQ A;  2EX9 A;  3IHA A;  5CHU A;  4ZJ3 A;  4EUZ A;  4N1X A;  4E6X A;  3HLD A;  1WE4 A;  2WGW A;  3S4X A;  5EOO A;  1W8Y A;  2J7V A;  5AQ7 A;  2ZM2 A;  2V1Z A;  1N9B A;  4K0X A;  3O87 A;  4R4R A;  4YIN A;  4PM7 A;  2WZZ A;  3ZG0 A;  2Y2J A;  4OON A;  1ZG6 A;  4O7D A;  4JF5 A;  4GN2 A;  1PWC A;  2WUQ A;  2V20 A;  4ZJ1 A;  2ZQ7 A;  1PZO A;  1CEG A;  1YQS A;  2WGW B;  4GD8 A;  5A92 A;  5M18 A;  4KQR A;  4KZ9 A;  1BZA A;  4NK3 A;  4E6W A;  5GHY A;  1W79 A;  4LCL A;  3ZVW A;  3C4O A;  3VFH A;  4OPR A;  1CI9 A;  2OLU A;  4OLG A;  4Y0U A;  3BFD A;  4EQI A;  2Z2M B;  2H0Y A;  2BG1 A;  2WAE A;  1IKG A;  1MXO A;  1Q2P A;  3QHY A;  4IED A;  5CGX A;  3SH9 A;  3ZG5 A;  3G35 A;  2JC7 A;  3HLB A;  1PZP A;  4X6T A;  1XGJ A;  3ZG7 B;  4RA7 A;  1BT5 A;  4X55 A;  1E3U D;  2A49 A;  1XXM A;  4LV1 A;  1K6S A;  2ZQD A;  1M40 A;  2ZC5 B;  3BM6 A;  3DW0 A;  4OQH A;  2B5R A;  3IF5 A;  1K38 A;  4WEJ A;  1DJB A;  4C6Y A;  1ERM A;  2XH9 A;  4PM6 A;  1E3U A;  3C4P A;  1MWT A;  3UY6 A;  4KZ3 A;  3MXS A;  4ZDX A;  3UPN A;  2X02 A;  1IEM A;  2C6W B;  2Y4A A;  4HES A;  3GMW A;  2P9V A;  1YLZ A;  1H8Z A;  5F83 A;  2VGJ A;  5GLB A;  1YM1 A;  4XXR A;  3UE0 A;  2XFS A;  2H10 A;  1XGI A;  2XR0 A;  1VQQ A;  5DF8 A;  1GCE A;  1BLH A;  1SDN A;  4LV2 A;  3VFF A;  1YMX A;  5DF7 A;  4JPM A;  2UWX A;  3VSL A;  1RGY A;  4GZB A;  3QNC A;  3HLC A;  2OV5 A;  3BFG A;  2PU4 A;  4Q8I A;  5JYP A;  1JVJ A;  1ESI A;  4IVK A;  1IEL A;  2QZ6 A;  3VP2 A;  2HDQ A;  1LHY A;  4UA9 A;  1JTG A;  3G2Z A;  4S2I A;  3VOY A;  2ZJ9 A;  4GNU A;  2H0T A;  2Y59 A;  1IYQ A;  4MBK A;  4PM8 A;  3RXW A;  3JYI A;  2DRW A;  2FFF B;  1KE3 A;  3HL9 A;  1K55 A;  3A3D A;  3TSG A;  5FQ9 A;  1K54 C;  3Q7V A;  1XA1 A;  1EWZ A;  1PW8 A;  4UA6 A;  4JXW A;  3HUM A;  1PIO A;  3N6I A;  4DDS A;  4DE3 A;  1BLP A;  3IXG A;  4KZ7 A;  3UN7 A;  1TDL A;  5FSR A;  3BEB A;  4Y7P A;  1MPL A;  2ZQC A;  3IQA A;  4QY5 A;  1HVB A;  4UA7 A;  3P09 A;  4YFM A;  3WS5 A;  3A3J A;  4N1H A;  3MZE A;  5HAR A;  2Y2G A;  5FI2 A;  5A91 A;  4E3I A;  4E3N A;  4KZ5 A;  3IF6 B;  2CC1 A;  3Q7V B;  4S2O A;  1LI9 A;  2XD1 A;  4IBX A;  2OLV A;  4GDN A;  3OC2 A;  2J9P A;  1NYY A;  2WGV A;  4RVA A;  2DNS A;  1C3B A;  3N8R A;  4X69 A;  3WWX A;  4BJP A;  1FSW A;  1LL9 A;  1DJC A;  2ZM8 A;  1ZKJ A;  4OQI A;  3SS4 A;  3SS3 A;  3QNB A;  4X68 A;  1BUL A;  3C5A A;  5EE8 A;  3I7J A;  1JTD A;  3GTC A;  4A5R A;  5L2F A;  3ZGA B;  2Y2H A;  3SH7 A;  4QB8 A;  3IF6 C;  4JF4 A;  3G2Y A;  3G32 A;  4S2M A;  5AQ9 A;  2WGI A;  3TOI A;  3FWL A;  1AXB A;  3PBO A;  4LEN A;  3DWZ A;  2ZLY A;  2WYX A;  3LY3 A;  5TFQ A;  4K0W A;  2G2W A;  3FV7 A;  4P0M A;  3GQZ A;  1IKI A;  3WS0 A;  2HP9 A;  1K4E A;  3O88 A;  3M2K A;  3OPL A;  2JBF A;  2WKI A;  4DE0 A;  1CI8 A;  3IWI A;  4JXV A;  1L0G A;  3NI9 A;  1XPB A;  1LI0 A;  1FCN A;  4PPR A;  1RCJ A;  4R1G A;  5GHZ A;  1GHP A;  1E25 A;  3V3R A;  4DXB A;  2DCF A;  1K25 A;  3PBN A;  2WKH A;  5GLD A;  1U60 A;  4GDB A;  5FQI A;  3M6H A;  4EBL A;  1GHI A;  1PW1 A;  4R23 A;  5CHJ A;  2ZQ9 A;  2X01 A;  1HTZ A;  2H5S A;  4HBT A;  3CZD A;  1K4F A;  4ID4 A;  3UE3 A;  1YLJ A;  2R9X A;  3G31 A;  4FH2 A;  4JXS A;  1DJA A;  3S22 A;  4KZ6 A;  5KSH A;  2ZD8 A;  4LCM A;  1G68 A;  3IWQ A;  3VOZ A;  4E3O A;  4EBP A;  1BLC A;  4H8R A;  3W8K A;  4UAA A;  1KE0 A;  1M6K A;  3OPR A;  1W7F A;  3HLW A;  4N92 A;  3ZG9 B;  5DVA A;  1J9M A;  4R3J A;  2Q9M A;  1MY8 A;  3ITB A;  5FAQ A;  4GB7 A;  4GD6 A;  3PBT A;  2XDM A;  2IWC A;  3UDF A;  1RP5 A;  1MWS A;  1MWU A;  2ZC6 B;  4FSF A;  5GLC A;  5AQA A;  3VMA A;  1HZO A;  1ZG4 A;  4U0X A;  5A93 A;  5CER A;  3ZFZ A;  1ES4 A;  5F1G A;  3PBS A;  5FA7 A;  1LL5 A;  3C7U A;  1K54 A;  2QPN A;  5G18 A;  2Z2L B;  3GVB A;  4DXC A;  2Y2P A;  4OOM A;  1N4O A;  3UO9 A;  5F82 A;  1GA0 A;  1IYS A;  2XLN A;  4FCF A;  1ESU A;  5FQM A;  1FSY A;  3V39 A;  4M3K A;  4RX2 A;  2XFT A;  4N9L A;  5DTT A;  1PWD A;  4OH0 A;  2IWB A;  3UNW A;  1ERO A;  3FKV A;  3PTE A;  3MZF A;  1JWV A;  3VSK A;  3Q82 A;  1ZC2 A;  3EQU A;  4DE1 A;  3BFC A;  3VP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...