4UAJA

Crystal structure of nqrf in hexagonal space group
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
280
structure length
280
Chain Sequence
GVKKWECTVISNDNKATFIKELKLAIPDGESVPFRAGGYIQIEAPAHHVKYADFDVPEKYRGDWDKFNLFRYESKVDEPIIRAYSMANYPEEFGIIMLNVRIATPPPNNPNVPPGQMSSYIWSLKAGDKCTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGARSKREMFYVEDFDGLAAENDNFVWHCALSDPQPEDNWTGYTGFIHNVLYENYLKDHEAPEDCEYYMCGPPMMNAAVINMLKNLGVEEENILLDDFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na(+)-translocating NADH-quinone reductase subunit F
publication title Structure of the V. cholerae Na+-pumping NADH:quinone oxidoreductase.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 77
structure length 280
sequence length 280
ec nomenclature ec 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).
pdb deposition date 2014-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4uajA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4uajA02
1ZM3A 1QUFA 3WBJA 4C0SA 1KK0A 3ZBTA 2HDNB 1TLLA 1HA3A 2J7KA 1QVFB 4FWTA 1VQMB 4YHBA 1YITB 3E20A 4RD6A 1FNDA 1R5NA 4PC2A 3I1FA 1WDTA 1VQPB 3LYUA 2PIAA 1N0VC 2NPFA 3ZBUA 2GPJA 3E1YE 4DQKA 3CCVB 2B7BA 1QVGB 3MHPA 1JB9A 4B47A 4ACAA 5FA6A 3I55B 4TMZA 2FX3A 3WY9A 2BVNA 1OGIA 2RC5A 4M2LA 4M1KA 3CD6B 2BGIA 1G7SA 1ELOA 5H5JA 3B8HA 3AGQA 3U6BA 1VQ5B 4H9GA 3MCAA 3WNBA 2VNJA 1QFZA 3P26A 3W5VA 1B23P 2YWEA 2QTZA 1YJWB 3G4SB 1KRHA 3W2FA 1ZM2A 2VZLA 1M1KD 2EFGA 3W5HA 3OJXA 5GV8A 2OK7A 1OB5A 2QTLA 1EFTA 1JNYA 4ZGQB 3P27A 4NCNA 1QFYA 2D74A 3LVBA 3CCQB 5AN9A 1Q7YD 2DERA 4NBSA 1F20A 4ZV4A 3ZZTA 1XB2A 1QUEA 4U9UA 3CCMB 1QH0A 3SJZA 1N8RD 3A1FA 2QMUA 1YHQB 3VNUA 1ZM4A 3ZZ0A 4F7DA 1IJFA 3CB4A 1VQLB 1FNBA 2VNKA 1DDGA 3CC7B 1EP3B 2VNIA 1S72B 3LO8A 1IB0A 2ZITA 4RJLA 1EFUA 1U2RA 1W34A 1BQEA 1CNFA 1KK3A 3CMEB 1YJ9B 1KQSB 2R6HA 1VQ8B 2DY1A 4YAUA 4PGOA 4Y9UA 2OK8A 3B82A 1JA0A 2YWHA 1TUIA 4TMWA 4Y9RA 5TR9A 3CXCB 4RD0A 3AVYA 4RCZA 3WBKA 4YALA 2GQFA 3CRZA 1S0UA 1FNCA 1SKQA 1YI2B 5H59A 2BF4A 4HE6A 1KK1A 1VQOB 3ES9A 3CMAB 4FK8A 1DDIA 2BV3A 4ZGNB 4G5GA 1G7CA 3AVUA 4N3GA 1DARA 2CNDA 1E63A 1R5BA 4LBVA 4PC3A 4LBZA 3QFRA 3WXMA 1H85A 3W2EA 1KK2A 5JBQA 2AHOA 3MMPA 3FPKA 5GV7A 3QFSA 2DCUA 3U6KA 2YWGA 4BPRA 1FRQA 4PC6A 1A8PA 4AC9A 5TY0A 3VO1A 2VYQA 4DQLA 4RD3A 3JQRA 3OJWA 4M53A 1M90D 1QG0A 1VQNB 3FJOA 1W2BB 4C43A 1E62A 3LRXA 4P3YA 4RD2A 4AF6A 4Q7JB 3CCUB 4ACBA 2QDXA 1OB2A 1I7PA 1QFJA 4IW3B 2C77A 4RD1A 1VQ4B 4G1VA 1NJID 1TVCA 1CNEA 4TMVA 1D8TA 2DETA 1GAWA 1H42A 4G1BA 4QFMA 4PC1A 1Q86D 2B7CA 2QA4B 1JA1A 2X3UA 2BMWA 1G7TA 2YWFA 1IJEA 4MYUA 2C78A 3QFTA 4MYTA 2BN4A 4UAJA 4YAOA 2PMDA 4QHYA 1GAQA 2EIXA 4M0LA 4TN1A 3CPWB 1QGYA 3QSYA 2OTLB 5THXA 2RC6A 1VQ6B 4PC7A 4B43A 1FDRA 4TMXA 3W5UA 3AVWA 1OGJA 1W35A 1NDHA 1BJKA 1Q82D 1ZM9A 2HMAA 3W2GA 3G71B 3I56B 3W2HA 1W87A 1JJ2B 4B3XA 4EH1A 5KSWB 2CRVA 3ZC3A 1D2EA 3U2QA 1EP1B 1BX0A 2XNJA 1QGZA 1EXMA 5EMNA 1F60A 5HXBA 3AGPA 3OW2B 4AF7A 3CCEB 4M4SA 1XE1A 2BM1A 2QN6A 1EFCA 2VNHA 4HE5A 1AMOA 1J9ZA 3WNDA 2QEXB 4Y7CA 2BGJA 4LBWA 1UMKA 3WNCA 5TV2A 3AVVA 1CQXA 4FN5A 3WYAA 1SM4A 4P6VF 1K73D 3AVXA 1KTVA 1B2RA 3PENA 2BPOA 1DG1G 1R5OA 4ZCMA 3CCSB 3OZWA 2DEUA 3CCJB 1FNMA 2OTJB 4RCYA 4YAWA 1YJNB 3CW2A 3JQQA 1D1NA 4B4DA 4K1XA 3G6EB 5DSZA 1GJRA 2B5OA 1AIPA 1KC8D 2BSAA 3V76A 1Q81D 2HCJB 3JQPA 1K8AD 3VO2A 1VQKB 3CC4B 1N0UA 4B48A 1VQ9B 1KD1D 3W2IA 4YAFA 1GO2A 1G7RA 1BX1A 3AVTA 3B78A 2BM0A 4ZCIA 2XEXA 3J81k 1KJZA 1EWYA 3QE2A 4TMTA 4WQMA 1QGAA 3QFCA 4ZCLA 1GR1A 1K9MD 1GVHA 3VNVA 3VMFA 1FRNA 1YIJB 3CCRB 2XNCA 3OZUA 1VQ7B 1QX4A 4R71A 1EP2B 3ZZUA 4LBYA 4N3NA 3CC2B 1TTTA 4LC0A 3OZVA 2E1RA 4B44A 1ZUNB 2PLFA 1E64A 4RD4A 4J0QA 3CCLB
chains in the Genus database with same CATH superfamily
3U7FB 2QRHA 1E7SA 5NULA 1Z2NX 3BX1A 2PUDA 3CISA 3ND8A 1BW9B 3BDVA 1RP7A 2JFWA 1G8YA 1IVYA 3BD9A 2R5FA 3MCUA 1M2VB 3HDYA 5B7QA 4C3ZA 4I50F 4C0JA 4BQFA 3M7IA 1BCSA 2D1FA 1PFQA 1MX3A 1HZZA 1VOTA 2ZCVA 3EZ9A 3H87A 3ZW8A 4FFVA 4AQ7A 5EESA 5DWDA 1UWCA 2R1TA 3BJEA 4I4TA 3K5PA 3LX8A 4R51A 5FBRB 1VQMB 5KKAA 4AP9A 3AHFA 1T9CA 1XQBA 2ZU0C 4JLVA 3ZWYA 4PC2A 4BQQA 3MSXA 3CZAA 3OE1A 4ITRC 4JFAA 5AVOA 1XXHB 2FEOA 1EDBA 4LOLA 1UBJS 5IXJA 4DYDA 3OMWA 3I9V6 1M72A 5C31A 1NTOA 2HK9A 2YV1A 3C6MA 3HGQA 3IXQA 4F60A 1KMHA 2HI0A 4INOA 4JOBA 2C99A 3OO0A 3GH1A 2XECA 4MYRA 4WUVA 5B1HA 4EPRA 4YPOA 4LZNA 2ZDQA 3THXB 2B4QA 4GPZA 3JD1A 5G4KA 3FSRA 3PDWA 2QU8A 2PEZA 3KBOA 4NBWA 4GMXA 3O4VA 4M0KA 5IYQA 3OF3A 3E1YE 2QT0A 4XGQA 2MSLA 1A04A 3T5CA 5AI6A 2B7BA 5B7PA 1Y3DE 4GLLA 2OBLA 4BFSA 2ZXIA 3VYVA 2VHXA 1BMDA 1CX9B 1T5LA 1Y5IA 4LQDA 1Y8CA 4XH9B 4F4FA 2HQRA 1J1IA 4PSUA 1XFAA 3NM6B 1A1VA 1SHTX 4M1KA 3CD6B 1PIWA 3B9PA 3HY6A 1IAVA 3RSLA 3JQ9C 3ZCRA 4MWSA 1BU8A 4HS4A 5DHPA 4NK4A 4DANA 4BNKA 1BVUA 2EERA 2EKLA 3O8DA 5HUQA 4QUHA 3ZE8A 5I7FA 3HFGA 1MQAA 3TSZA 4WNAA 4CWAA 1G5HA 5DXAA 4YUXA 3C6ZA 3TCKA 3H9NA 1APBA 5ALZA 3BQJA 2HSDA 3NYWA 3DHEA 1H2ZA 4L4SA 4MV5A 4Y2GA 1PK8A 1QF9A 4KI0A 4BLPA 2XBMA 1RAEA 2FWBA 4ND2A 2CFRA 1A2OA 3IUJA 5GJWC 1CPYA 1SKUA 2HXSA 3H6HA 4J7CA 4MPTA 4ALNA 3VI3B 4YYEA 1RJ9A 3OZRA 4HNGA 3B6IA 3TQFA 4DA8A 2QZ4A 4JXZA 1I2DA 2WICA 3GLUA 3MOGA 4O4LB 2JCSA 1E20A 2H0AA 2ZI6A 3M6VA 3G4SB 2XB2A 2ZYRA 4ARZB 3K0KA 1NFFA 1U8AA 2Z3ZA 1BXRB 1TADA 2HCFA 3ZDRA 1T5IA 3CUEF 1UOOA 3ZDYB 1TJ5A 3JATA 5HFJA 4CM4A 3ZYCA 4XWGA 4MWEA 2JLBA 4JLNA 4QJBA 3AG6A 4A0HA 3RRFA 3VX3A 5A6SA 4I9UA 5JQGB 4BTEA 3F6EX 2HPHA 5IH3A 1NNEA 4OYLA 4D92A 4X20B 2F3PA 2QYSA 1JNYA 4DR7B 1NWCA 1JQ5A 1M9NA 4PGMA 2IPNA 3MJDA 3QXJA 3Q2KA 4YCLA 1ZK3A 2ZULA 4P98A 2FVYA 2P0AA 3EC2A 5BVHB 5IAOA 2HSWA 5AH0A 3TK1A 4NBSA 3JY6A 3WQRA 4WJLA 3B52X 4ZEWA 3OQIB 4D4IA 4PLCA 3EPKA 1QRTA 4ZAGA 2AJCA 4YQEA 3V2IA 3N58A 3LGSA 4F3RA 5L3QB 1E7WA 4KVAA 4U2KA 3V7YA 4AJJA 1J7JA 2AI2A 3AX6A 2QSJA 3KB6A 4WXRA 5HF6A 4ENSA 2VP5A 5HXAA 3TG8A 3T1OA 3KALA 1Z56C 3PUWA 4UUNA 1ZNQO 3SKXA 3RE1A 1N2CA 1DTWA 1GFZA 2DIEA 4OPSA 2OD9A 3ND7A 2QROA 3Q10A 1SHUX 4PHGA 5BOSB 5FUYA 3JQGB 5AXAA 4PZAA 2YVUA 4G65A 1JA9A 4EHIA 3T53B 4UHFA 3LO8A 1C81A 1TTQB 1OAOA 3HUDA 4QUBA 4ZP1A 4BFYA 4C04A 1I2MA 1KPGA 2JD2A 3Q7QA 3KSUA 4GPBA 1PDOA 5DO9A 4IVNA 2E0IA 2B34A 3JYNA 3PQ8A 5AJZA 3A3BA 5KVSA 4D81A 1SAYA 4KSYA 2XCSB 2WF9A 1XRNA 5GWXA 2X8WA 3A0UA 1NIJA 1X1DA 2QVZX 3GVCA 1WXEA 3AF2A 5DBEX 5TQJA 1HNNA 3TRIA 1WCYA 4Y2UA 1YFJA 1RZ3A 1ZMOA 2YOFA 5BV8A 1KQSB 5KTMA 1M8GA 1JTVA 2C04A 4NS1A 5EE1A 3AZQA 4LTNA 5EKTA 3TTYA 2A5FA 4CT0A 1NF2A 2GYWA 3G5TA 1GFWA 4P25A 1JFLA 2OHVA 3F5MA 4RFSB 4GZ6A 4CIVA 3A32A 4PM4A 2EBHX 4DR4B 2CVQA 4OSOA 1BJTA 2ZTMA 4IHAA 4MUBA 5FD8A 2WIFA 5KJFA 4NBTA 4NCJA 1E1MA 3T5DA 3WSTA 4KE8A 3QXXA 3CSSA 4R2JA 1UD5A 2JFNA 3IQWA 2BR3A 4E1AA 1AQYA 4RF2A 5JS8A 1UEXC 2Y66A 5AD1A 2VP4A 1ZL0A 3CRZA 5L6LB 4K7JA 5K8CA 1Z7WA 4DRYA 3STTA 2F1MA 1LLCA 2YDXA 3CUVA 3E84A 3ZXSA 4KPEC 3PA6A 1JPJA 1K88A 1UODA 3HDVA 4QXRA 4R01A 3V7WA 2IGTA 2OGUA 2QN7A 1W8IA 3ELUA 1E9VA 1BKDR 3P8ZA 4LHZA 4IOMA 4JI7B 1Y3BE 2CLOB 1SC1A 4UKDA 4XM2A 3SQXA 1L7EA 3LDHA 5GQSA 4ZGNB 3GJYA 1Y1QA 4XIJA 5AT1A 5TVGA 4RM0A 1CZUA 4EPWA 4FGWA 4MCIA 4CIBA 4WZAB 1XQ9A 2Y1OA 4KN6A 4J1TC 5GP1A 2J0QA 1ESZA 1ZSYA 2PPVA 4IEIA 1NE7A 5E1BA 2DGDA 1MB4A 2JGKA 3V1UA 3R8XA 1WV1A 1M54A 3FRHA 3ZTYA 1ZUIA 4LY9A 2J8ZA 3JW8A 2C2GA 2WZDA 3R7LA 4D8YA 2RI6A 1GN8A 2QX6A 3IDSA 2BGTA 4E6EA 1NLYA 1U2GC 2AX3A 3HA2A 1P2DA 4M36A 2W6IA 3W3ZB 4JR2A 4XORA 4M49A 4EB6A 4C20A 5LD2C 2WHPB 3LLVA 3BDIA 1QOQB 1T0BA 4KGXA 4BPRA 1X8KA 3EYAA 4RC9A 1RLIA 4Y98A 3KXDA 4Z9BA 1COWA 1Q77A 1N2BA 1JYEA 2VNAA 4ZOLF 2OBFA 1A8PA 2VCHA 3KT0A 1W4BA 1ZX1A 3MINA 3MFQA 1TZCA 4ZCPA 3KETA 4MPRA 2VF7A 3O1LA 1ZNZA 4PGFA 4EFNA 1MF7A 2Q3MA 1QP0A 2PH3A 3KPVA 1OZAA 3VM6A 1YAJA 1WZIA 1KBQA 4NV0A 2D4HA 2DHRA 3C0KA 3M83A 4BJ5A 3RF7A 1R9JA 2OP0A 1RI3A 3TLZA 2BM8A 2H8GA 4HYTA 1UK7A 3U7QB 1XMOB 1O9BA 2WNHA 1J8YF 1IFXA 4YT4A 5BSHA 5DLYA 1E62A 1OOEA 4RA6B 1E9SA 1FFXA 1ISMA 3ANTA 4OV6B 4PW0A 3R7BA 5ADUS 1F0KA 3HPRA 4NOMA 5J47A 3A3PA 3WE7A 3BIWA 1ECFA 1SD2A 4JGBA 5KDDA 3R0XA 5EVJA 5D5QA 2XSZD 1P0PA 4P3PA 5BSMA 1PHPA 1LNSA 3KQYA 4B6JA 5F23A 1KPHA 4BVKA 4I3HA 4D0RA 1TX4B 1LLDA 1H93A 1UEJA 1YXMA 2IYUA 3IO3A 2M5SA 1Q7RA 4G0ZA 2OQ2A 1YFKA 2VDLB 3E7DA 1DUSA 1E1KA 2WLTA 3RT1A 2QGNA 3CCFA 1Y80A 5EPOA 2LKCA 3DTVD 4BB5A 4ZK2A 2DPYA 2VRWA 3SF8A 3ZVNA 1FFBA 1RBMA 4RTPA 3TQQA 2C3OA 2DETA 2YWJA 4RK5A 4S1PA 5COBA 4BN5A 1UKCA 1R4ZA 3CN9A 4UCXA 3SP1A 4IQFA 1XRJA 5FJIA 1GYPA 1GPWB 3ET5A 3T61A 3V1NA 1TRHA 3LGXA 3I2GA 3DAOA 4H60A 1KKMA 1PGQA 2J45A 4IG4A 2ZBUA 1M2OB 3JALB 5CFRA 2COUA 3PWKA 2GFQA 4KQJA 1GKLA 4ZU6X 2FSHA 1SUBA 3LUCA 4TQGA 5F7XA 3CT6A 3GARA 4QYIA 3HCRA 2WG2A 5FPTA 4BMYA 1ADFA 1KMQA 1M34E 4WLEA 4L9SA 3NORA 4YCBA 4FHFA 4OREX 1YTLA 4YAOA 2FSVC 1V96A 1EK0A 5HIMA 2H2HA 3EDCA 4C7BA 1FMCA 3NZEA 1T1IA 2ISQA 2EJCA 4WZLA 3D8SA 4U0KA 3N8GA 1BSVA 1E6UA 1XVAA 3Q3AA 3JWGA 2IYOA 1Z0DA 1P29A 3I39X 3IMFA 3KHUA 2PZEA 5DJ5A 1TQDA 4R9SA 4J3NA 4QUGA 4UD6A 5CEEA 2DQ4A 2N75A 2JFHA 1F6DA 3AEXA 1S4MA 1X1EA 5FUWA 1Y5MA 4MV6A 2E6KA 1U3TA 2IWHA 3SEZA 4YRCA 4DLLA 2NZ2A 1P80A 2VCYA 3EGEA 1GGFA 1K5DA 2ZT6A 2M32A 2O2ZA 1NYTA 1Q84A 3WGOA 5EWJA 1MPTA 2AV6A 1ODCA 2FZCA 3LUFA 5A4IS 1NQVA 1QGED 3F3MA 5L53A 2PX3A 2EYQA 4WASA 5EEHA 5IC6A 4W5TA 1D4FA 2QR3A 3CPEA 4U2CA 4FOSA 1ADCA 3E22A 4O4IA 3DE6X 4EWLA 3G1UA 1R0YA 3LQRA 2V0NA 2K7ZA 4OM8A 5ALVA 1H2RS 2G04A 1JWLA 1GSIA 2WTBA 1U8XX 5T6MA 1KC3A 3L7OA 1ZCFA 3PDIB 4LVNA 3R5KA 4Q15A 2CYBA 5CX4A 5DDIP 3BOSA 3DE2X 3OX2A 3Q9NA 3GJXC 5BV7A 2OG2A 1QBGA 2YXDA 2YXEA 4QOGA 2ON6A 1D1SA 4Q3AA 2R1UA 1GQRA 4B3FX 2R8OA 4DSNA 2QW8A 2Y1KA 1NN5A 3DMRA 3B3JA 2O0HA 1V8BA 2C4MA 1KTVA 3AR3A 4HMQA 3PENA 3Q11A 5G3YA 3A6LA 3U37A 3M9WA 3PHCA 4TLAA 1KIAA 3KE9A 1R6XA 1BE8A 4HPXB 4OFBA 1KOFA 5AKZA 4CE6A 4F2DA 4LRYA 5LM3A 2FKAA 1SBCA 2GN9A 2WM3A 5K51A 1VMDA 3M1IA 1ZXLA 3OZTA 1YUBA 1PT7A 3OP1A 2VHUA 1ZCZA 2E4AA 4FBGA 4OB6A 5DIFA 5LD2B 1JEYA 3G8CA 3J7AC 1TO6A 2Q8PA 4N0QA 1J9EA 1CQIB 1IBCA 5CEJA 2X8JA 4JP2A 4GRIA 5EXTA 1AV6A 1HYBA 4WOKA 2ZJFA 2OWEA 3Q1LA 3TAUA 4BNGA 4YTEA 4O1MA 2I62A 3F2VA 2XMCA 2NT4A 4OD0A 1NW3A 2IP2A 2OYRA 4Q9AA 4TKUB 4C7MA 4YP7A 4WESB 1U63A 4GDFA 3RU7A 4F46A 2B21A 1N2JA 5BYJA 1AKEA 2REOA 4B48A 3VBEA 2A67A 5JZ9A 1CQWA 2JIMA 2YL2A 1KD1D 3BD8A 2J31A 4XOUA 5A4DA 1YB4A 4CIAA 3DO5A 4FQ7A 4W99A 1DC5A 4M55A 4NESA 2OD7A 3SJCA 2OAP1 3HEAA 3TFOA 3GVHA 1HDYA 3E9ZA 5KU1A 4CGZA 2RG1A 1BW9A 4ISCA 4M54A 4ETIA 3ETDA 2F3SA 3M4YA 1YR8A 2BM0A 4ZMSA 4EO7A 1G8JA 1M2VA 2GPAA 4L5JA 4CMAA 5B1SA 1MNAA 3NJ4A 3HKCB 4GYKA 4Z7NB 4EFKA 2EKPA 3VU0A 2X4LA 2ZVQX 4FM9A 1RWPA 2CWWA 3HY3A 5IF9A 1ZVKA 3QX7A 4OY3A 3ZNQA 1X2EA 3ZCQA 5JZSA 2HYIC 3WWYA 2AJBA 1XP5A 5IW8A 4Y2TA 3AB7A 4GPEA 1XZJA 3G02A 5AKYA 4WQMA 3OMLA 1TAQA 2KX7A 4HLUC 3R8FA 5L45A 1E3TA 4I36A 2ZUSA 2ZBFA 1IUPA 1VCHA 2GN2A 3GD5A 1KJJA 3FFWA 2W0MA 1V0FA 4M99A 2XLCA 4OA5A 4EB0A 3WIDA 4MVJG 4MW5A 3HB0A 4DB4A 1JL3A 2JASA 3JWIA 2A1TS 3LOUA 3GFPA 1FVHA 3ASQA 2C7RA 4AWBA 3VMFA 2ES4A 3THXA 1L3BA 5DTMA 1OV6A 3M70A 3NC1C 4YV0A 1OC4A 1VQ7B 2ZVDA 3HBFA 4Z9FA 1VSQA 1P9WA 4XGKA 3VNSA 1WNFA 1XU9A 3GZTB 4KQ6A 5A88A 2F1OA 1IHPA 1JE1A 2I6QA 2WJPA 1Z63A 2ZB2A 1D1QA 1PCXA 1RXUA 3TIIA 2DR0A 1XF1A 4KK4A 4KLZA 3AR5A 3LW8A 4YLGA 5CVDA 1Q16A 1C80A 4RSMA 4UM5A 4D41A 2V6FA 5JD6A 4KG7A 2W2QA 3CSDA 3QEAZ 1N92A 2FWNA 3WLKX 1H3EA 4BB0A 1XYYA 1O95A 2MU1A 3AF4A 4FVTA 1Z4NA 1E2IA 3OPYB 4K9QA 4RD4A 4KODA 4MUFA 5GGYA 4DS3A 4WZTA 3N0VA 3JD3A 3HRKA 3KFLA 1N36B 1NMXA 4EFDA 2AXNA 1WD5A 4E1BA 5K45A 2VP9A 1NFQA 1TYDE 1XQXA 2CDRA 2ZJ3A 3ETJA 1LBEA 4WX2B 5JDIA 3G0DA 3QLTA 4HXFB 4DEXA 5CG1A 5KNDD 2P4QA 2LTAA 4J75A 4FDAA 2XD4A 4RPBA 4WD3A 1ULTA 1U02A 4M83A 4FUTA 3QEKA 4TS4A 1BHJA 3DDZX 3FNHA 3G3EA 2V4MA 4MJXA 4PFQA 1TLLA 4TKLA 1SU7A 3I42A 2V3VA 4K87A 4X91A 4Z4UA 1EFKA 3A31A 4JJZA 4LZWA 4N7BA 3N74A 4D0GA 1W30A 5BW5A 3Q38A 1QVFB 2YW2A 4YACA 5DNEA 5JYEA 4LJ5A 1KYIA 1PV2A 1XVUA 4ZODA 1J0DA 1D0IA 4O4LA 4BWFB 5L3VA 2ORWA 3GQBB 5SZHB 2FEWB 4ARZA 2FWPA 1VG1A 1Y5RA 4A23A 1BXRA 2CZGA 1FVFA 1WDTA 4OHCA 3R6TA 3I5AA 1T2VA 1VZ3A 3G2MA 3G82C 3AUKA 1QV7A 4IO1A 4P7BA 5JQGA 2WQ6A 1JUDA 3OHMA 4NNOA 3ONYA 2AX4A 2YJZA 4X20A 1LGYA 1OH8A 2FPOA 1KEZA 4KE6A 3D02A 3KJZA 3T0GA 5JIBA 2P67A 2VJMB 1ZUHA 4LECA 4CF5A 2HEGA 4MVJM 4CTNA 4F9TA 3CJQA 4U7PB 1J97A 3JPYA 5BVHA 2O57A 4LDAA 3RTDA 2BMVA 3GZJA 2NXEA 3OQIA 5HS6A 1KVSA 2EJTA 3MHPA 2DU8A 3RYIB 1QQBA 4IWXA 4Q1AA 5L3QA 1ZMRA 3LKBA 4OOVA 1SCAA 4HDRB 4BKRA 1OFUX 3ROQA 4Z8XA 3V8QA 3NDPA 1OGYA 2YY5A 3OWHA 3HWWA 1I4WA 3AGQA 5GM1A 3ORYA 2D2VA 5CK5A 3EVCA 3BHMA 4HGYA 3GLQA 4OO3A 1CERA 2QQ0A 3KPWA 3FF1A 3JQGA 1EESA 4HRYA 2PGAA 4FX5A 3MCAA 3HG7A 1UJ5A 3ZH9B 1L4BA 3QLEA 1G5QA 2HSGA 2POCA 5IAGA 1SCKA 3IT1A 3D59A 3KDSE 3PB3A 4EUNA 1ONPA 2IC5A 4XVUA 4I6EA 3TH5A 5FTWA 1U0LA 1VIMA 1J9GA 4HP8A 3UJ7A 3G23A 2QNBA 2VBTA 2W9XA 2RE8A 1ZNXA 2H4XA 2AC4A 2WDZA 3H5TA 3I9MA 1YS9A 1MDBA 1PW5A 5HKBA 3T8YA 2C7BA 5KCZA 4J9VA 4DSOA 2DP4E 3IHWA 2EDCA 2X4DA 1JALA 1XD8A 3HADA 5D7BA 4OQYA 3IA7A 4NCHA 1QX3A 1DAOA 3NB0A 5K0EA 4KNWA 1BVHA 1PYDA 4RFSA 4IXWA 4DLKA 3ZJTA 1C0IA 1OB5A 3IRVA 4C2UA 2G9VA 4RLHA 4CT5A 4DLRA 3B20A 1EFTA 3LA8A 4QVJA 4L28A 2CLFB 2IA5A 3J80A 2DWCA 3OBBA 2QTAA 5ALOA 1M83A 5JYDA 5KPJA 1Q7YD 3C7AA 1K6JA 2FK7A 3ICVA 1EGQA 3E18A 4G2NA 4BB9A 2YNMD 2HSEA 2RIRA 3O38A 4Y8VA 1Y5NA 4TZ0A 1PG5A 1NVMB 4NFHA 5TGDA 4AJKA 4B8YA 4XWAA 3SJZA 2YIMA 1ADJA 4G9GA 4I19A 4UEWA 3VGPA 3IRUA 2A30A 1T5OA 1YHQB 1RRCA 2N47A 2PQ6A 5KS2A 2V6BA 3GYBA 3NKFA 3P2IA 5TMEA 5TQ0B 4G84A 5BYAA 4WXYB 4MR7B 1ODJA 3IS3A 2OBSA 1N3IA 4S1WA 4BFWA 2D7DA 4PZYA 1WZEA 3CLUD 1XV5A 3KL9A 4JD5A 4MLDA 4I6GA 3VSCA 3GU3A 4D9NA 5GVSA 2HYDA 4ZXPA 3L8ZA 4CLHA 1NVAA 1BDMA 4RAQA 5JECA 1POXA 2IS6A 1CRWG 2HSJA 1JU4A 3L18A 1XD2B 1W0KD 5CP8A 4WZAA 3WDKA 2HO4A 5FHRA 1EE2A 5CCBA 2YINC 2PNFA 4BO2A 3NGLA 3JYQA 3VPXA 2ZATA 1DRJA 1T6YA 1OFGA 4KQKA 1VYHA 4LHEA 4QJ3A 4N9WA 1CRPA 8LDHA 2WWVD 2ZUVA 2I8LA 1XPOA 3MJTA 1H69A 1ACJA 2Q49A 2Y8EA 2C7VA 3JQ9A 3MGGA 3QWFA 2WHPA 2FMFA 2WIGA 1F06A 2ZROA 2A0UA 3CPHA 4JT8A 4ZO6A 1YR1A 3UJ3X 1XZPA 2RJ3A 4CKBB 3PG5A 3CZCA 4LOAA 3UQYS 3VAAA 1TYEB 1PQPA 5EKXA 1F6BA 3MA0A 3EBLA 1L4MA 2I91A 1ESEA 1GRVA 1IHDA 3BH4A 1PWXA 2HFKA 2WTEA 1UBLS 3CF2A 3O3OB 1THZA 3MUNA 3MD9A 2AMFA 5EA2A 3LYHA 4J43A 4JB3A 1JECA 5JBNA 3EGVA 2V5VA 1HMYA 2IYNA 5DZSA 4RPGA 4YRJA 2GM4A 2YW9A 3II6X 2XXAB 1ZS9A 2XMZA 2WE7A 3M6AA 4QTTB 3T1NA 5J4HA 4D6XA 3DYVA 2IY9A 2W2PA 4W7IA 2K5UA 3BJZA 1RM3A 3U7QA 8OHMA 4G0VA 3IXMA 3JRWA 4PICA 1JJBA 1GPDG 4EKDA 2J3HA 2O05A 2WAXA 2QTBA 2Y67A 1T8WA 4MQMA 1MEEA 1MJNA 2MSDB 2ZXFA 3F6YA 2VVTA 3K53A 4MSUA 4PNZA 4N76A 4BO6A 3L7DA 4EI8A 3I0ZA 1RI1A 4BN0A 5FB3A 5CBPB 3TTWA 4M87A 1F8FA 5M3BA 2VTEA 721PA 1E5TA 1P8AA 4HX2A 1SKQA 5I9LA 2BF4A 2GPBA 3I1JA 5D86A 1VC2A 2K87A 1VQOB 1GU0A 4L08A 4MVYA 3I9LA 1VXOA 1JMKC 4KI7A 1E69A 5COQA 3REGA 1USUA 3DCIA 2HNKA 4EQ6B 4EYKA 1Q1EA 4B4KA 1BMFD 4HMOA 4Y3UA 5E38A 2HF8A 1G9SA 2A9FA 3BRCA 3I4FA 1JHRA 3OZBA 4JJ7A 1HI9A 4N3GA 2R2GA 2W22A 4TSRA 3IEMA 2NQ8A 1TAUA 2W6OA 3AM3A 1E1LA 2IKSA 1L7AA 5JMOA 3TZCA 2WUEA 3ZD9A 4Q01A 2JLUA 4FUQA 5ADVA 3LC1O 1H4SA 4B7CA 2Q5HA 2QLNA 4IHQA 1H85A 5BQPA 4YUYA 1KK2A 1NI4B 1T5HX 3L7MA 3JZAA 2PL5A 3M2PA 3PV0A 3EXHC 3ZD6A 1ABEA 1N6OA 1MCZA 2E89A 4RLSA 5ALWA 1T3GA 3WHIA 1MQSA 1OI4A 1M7GA 1HQDA 3GRUA 5HZMA 1T8UA 2V4UA 3KS9A 4QEKA 3RARA 3U6KA 1M2OA 1GTL1 1L5SA 3JALA 4XIGS 5BR1A 5LMCA 3OG9A 1R5JA 2JGIA 3AR7A 2VJDA 4HATA 4PINA 4PZDA 2A33A 4NOKA 4RZ3A 4TT8A 2RONA 3L06A 2WI8A 4BMNA 4X66B 1QRDA 2BMDA 2F7SA 1V1RB 1QFXA 3KAKA 2YVQA 1BHO1 3Q15C 4DC9A 3IYLW 2R96A 5IWAB 2C8VA 1TU4A 1JAZA 2V7UA 4JKIA 4K28A 4KUHA 2OAQ1 1Z4OA 3TQHA 2F8SA 2ZUEA 4UBMA 3WRYC 2ZZFA 4RDKA 3OI7A 4KBYA 3JQRA 5FF9A 4M53A 4FCTA 5DNVA 1WP6A 1D2AA 2HPAA 2P2ZA 1Z83A 2KPOA 3HSKA 1D4OA 3JQAB 3MUFA 4JB8A 2DBQA 4QGAA 1CZLA 2DTDA 3OZEA 5DMXA 1XZLA 2IBSA 3QE4A 2WWFA 3HK2A 1W2BB 4URWR 3T7TA 2D0OB 2RARA 2OGTA 4OGFA 5FV7A 1R0WA 4QBGB 4X1YB 3F73A 5KYTA 2QUKA 2ERCA 5L4NA 3BRWD 2XCLA 2DFDA 4A6DA 4D1YA 4QKQA 4PHCA 3CX7A 4Y30A 1N2HA 2C54A 4MMZB 2AG0A 4JJIA 1XTBA 3KT3A 2A3RA 3JQFC 3T5MA 2ANCA 4XB2A 4JLPA 4HAVA 1B0AA 1T2AA 2VXYA 1PBTA 3KSZO 3QPCA 3EFOB 4U4AA 3E03A 1THMA 1MRSA 2YWCA 5FWXB 3JQ8A 2C7GA 1N6PA 2JCXA 1L8XA 2Q9UA 3D6HA 1CNEA 3EIHA 3ROMA 3K1AB 1K6MA 3TVDA 2ZIZA 2G5TA 3NONA 3HB1A 4EGFA 4D3ZA 3DEJA 2PT9A 1CIVA 2QSUA 2LKDA 4RLQA 3R3UA 3RAPR 5CVTA 4TL8A 3AKDA 3MAJA 4CV2A 3Q12A 5JJCA 4ER5A 3PDIA 4JUDX 1W29A 4CN9A 2ZYVX 2RI0A 4KUGA 4DK0A 2BMWA 3TTUA 4OH7A 1PJ2A 4B40A 1ZVJA 4AZ0A 4MUXA 6PFKA 4YHHB 3R9IA 1HKHA 3KFXA 4C4XA 4MYUA 1JFSA 5H16A 3D6JA 3ZWQA 4EP1A 1Q0QA 1C0EA 4UAJA 3MEQA 5EHIA 3OUTA 1EZZA 4Q1BA 1XCMA 4RSGA 3C41J 1CG6A 5D3QA 2JVKA 4J1TA 4UC0A 5G02A 1XR3A 4QHYA 4AJEA 4DIUA 4XD7A 3G2IA 2G1PA 2EIXA 3T9CA 2OTLB 1TD1A 1NUQA 5B30A 2OLEA 2REQB 3HJBA 4TMXA 3W5UA 5K5EA 4ARCA 1W35A 1JZTA 3OH8A 4N82A 5FNZA 2HH9A 4P92A 4R2KA 5FFMA 5MN6A 3UGJA 5EINA 1U2GA 4JR0A 4ND3A 2P9FA 3IEXA 4KXLA 3ZWPA 3WG9A 2BZGA 1V3VA 1UK8A 4L7QA 1JSRA 2GLXA 2PU7A 1CQIA 2QRLA 4O4LF 4QQ8A 1GZSA 1Y6RA 1LTHR 3FDJA 2JGRA 1CYDA 1UD6A 3DLHA 1E2PA 4E14A 1ZJWA 4TKUA 2G0NA 1TB4A 2A4KA 3PFNA 3R7FA 4C0KA 5P8WA 2I6GA 3B3GA 4P3KA 4JI4B 1NUAA 4Q5IA 1LNZA 3A6JA 2XPCA 3COWA 3KQPA 2ZZEA 4K6HA 1SUSA 1TC1A 5JQGF 4ZCTA 1CF9A 4K88A 1TXGA 2XCQA 3T9FA 1SVUA 4D3YA 2NX2A 3FLAA 6Q21A 2OFPA 2WHQA 4XRGA 2ZJAA 3EDOA 2XGJA 4TQAA 4AVYA 3R3WA 2HMUA 1J5EB 3Q7PA 4F7WA 3K5WA 1G66A 4CKEB 4Q3DA 3S81A 2CUKA 2IUYA 4B0OA 1EUYA 3AC0A 2C95A 2DM6A 2PWPA 4MIOA 1JR3A 4N54A 4UAUA 3HKCA 4Q9JA 1QYRA 4AMBA 1J9ZA 1E3WB 2CHGA 1B6RA 3AHDA 4NJMB 3AF3A 3HDHA 1PT8A 2XQJA 3DNMA 1NUPA 2H5LA 3KXKA 5I7VA 3SQWA 3FIJA 2IRWA 3SFZA 1QO7A 5HCUA 2AFHE 3V8VA 4DDMA 1AB5A 1F4LA 4PRKA 1Q0TA 1T5DX 2R7NA 2OQRA 1BE6A 1PR2A 3ORSA 1EYZA 1SCIA 1E58A 1U7XA 2CCKA 2NPOA 2QTVB 2BPOA 4IZ6A 1YDWA 4R2WA 2OFFA 4E5KA 2JJ1D 3G6WA 4XLAA 5JPCA 1ZVMA 4IS3A 1X1QA 4GG1A 4EY3A 1YQ9A 1BFDA 1CXZA 3GEMA 1HTTA 1EJBA 2ILTA 3EXHB 4YJGB 1RC8A 4I0WB 4C01A 4G9EA 2W6JA 3VZCA 3GWZA 1I9GA 2QVCA 2G1UA 4JP3A 3OCZA 1XX6A 2OV6A 4G41A 4RVNA 4OQMA 3SS7X 4OHRA 2C2XA 5BW8A 5KYUB 4DNOA 2IZ0A 4JVNA 3A4TA 3NTQA 4I3FA 1N3BA 1LFAA 4K1XA 3G6EB 1RAHA 2FZ5A 2CFSA 4TVSA 3NS7A 1D9ZA 1WZNA 2WT4A 5AXBA 1Z15A 3F97A 4EGCB 2ROQA 3QEMB 4H6WA 3IQGX 4RDLA 3G7UA 1NW7A 2FSVA 2WINI 1N5MA 3H18A 1WPGA 2JAHA 1NQXA 2CXTA 3A27A 3DT9A 4K2HA 3OPYA 4MGYR 4ND5A 1U3WA 5THQA 3HU2A 3I6BA 2CXNA 4BKPA 3A05A 3W2IA 2VATA 4EDHA 4ZYUA 1U2PA 4BO4A 2NADA 1B00A 5C1OA 4O0LA 2C20A 2GD0A 5E6UB 4JI3B 3T7AA 1T0IA 4H0NA 3HU1A 1NR7A 1BX1A 3ZGXA 4A16A 4HYQA 1E79D 2FUCA 2R5WA 1G6HA 3VR3D 2X9QA 4OQPA 1YVUA 3V9PA 4BMXA 1EUCB 2UYGA 4BE7B 5I7WA 2OPHA 2XDYA 4QQRA 1K86A 2HWUA 2VUIB 1N77A 3PFBA 1EJ2A 1WXQA 1NMQA 1A9OA 2Y1FA 3GQBA 3SX4A 2B7LA 3QE2A 4CG1A 1WMFA 2VPYA 3P2MA 1T9AA 3A8JA 2PA3A 2FR1A 4RORA 4CTJA 1KXZA 1MO6A 2OG1A 5BO5A 1Q74A 2LDXA 1Y1PA 1TOAA 3TZEA 4RX1A 3NP7A 1M1NB 4IIGA 3PNKA 4Q4DA 1DQZA 2B8WA 2YS6A 3H2SA 3HCWA 3LQKA 5A4MS 1FTNA 1ODFA 4KQFA 4S1OA 3TCNA 1XTUA 4AMVA 1NYRA 1WMDA 3FFAA 3NOXA 5EZ6B 5AXDA 5EUCA 5C5EA 4D9FA 4X94A 1J1UA 1JFFB 2VJMA 2HPZA 1YIJB 4P7FA 1AE1A 2WFLB 1DEKA 4BVFA 5J4YA 5AM5A 1OQAA 2H2FA 4JH0A 3FWNA 4AM8A 1YDHA 1F12A 1GL7A 1SKAA 2PR2A 2QW1A 2A7QA 2ZI9A 3IE0A 2MSKA 3M5PA 1RXCA 1LSSA 1KAGA 1UKVY 4GICA 4TV8F 1Z62A 4X7PA 4G0YA 3P7MA 5DNAA 3V48A 1QV9A 5LKAA 3OTQA 3R5TA 3MTJA 4HDRA 4HGOA 1XMJA 2BI8A 1M66A 4Z0NA 2O06A 2ZXEA 3PC8C 2H9IA 1W4CA 2JZCA 2MDTA 3HXTA 2OEPA 4M88A 3R9KA 6ABPA 5JO0A 1H4TA 5EY5B 3N0XA 2Q5FA 1NR1A 3EISA 2QSZA 3N5KA 5F2EA 1P81A 3CG4A 2VR1A 2HADA 5JSQA 5H02A 4CQLB 1Q0SA 2Z08A 2C2OA 1QUFA 2Q4RA 1QR2A 1Q92A 1X7WB 5EFOA 4K6KA 1FRVA 1N1EA 1XEWX 1NVXQ 1YQDA 1LZKA 2QS9A 3NLLA 4RIIA 5EGNA 3FG9A 1H23A 5I4KA 1ZK1A 3D1LA 3TRJA 5A9RA 2J7KA 3IUMA 4GYYA 4NKRA 3ZU4A 4DSAA 1BXGB 3C8DA 1XNQB 1KYWA 3C5EA 1Q0RA 4MUKA 2DAPA 5GMOA 2ZL6A 2WUDA 3PWZA 3OIGA 5DU2A 3ZXIA 2V7TA 5FFFA 3KSBC 3CRNA 4L9RA 2F8LA 3NRJA 5HKOA 1E5QA 5EJAA 1PUJA 3FPBA 4M37A 4M0FA 2HM7A 2POQX 5C8DA 3I6ZA 4QECA 1J56A 4HQKA 4JENA 3DW1X 4E09A 4XL9A 2A59A 1RVV1 2CB0A 1KZ7B 3CBGA 4GBED 4GPD1 4ROSA 3VDRA 2H5EA 1XXLA 1NRIA 3KXPA 5JYBA 1G4UR 2GPJA 4DWWA 1VLZA 3TQCA 3WJ7A 1MAWA 5AFSA 5MN5A 2YUIA 4CV1A 2QP9X 3DH0A 4R81A 4K8RB 3FB4A 2KBEA 2JIZA 3IAS1 1BNCA 4KR9A 1V2HE 2W4MA 2W70A 3E05A 3NR2A 1EE1A 1II8B 2WMNB 3G2OA 3L49A 3TW8B 3LBNA 3OZGA 1XELA 5HRUA 2X42A 4HLUA 2VPIA 4Y2XA 3AVPA 1P2SA 3B85A 5AVRA 1D2MA 1ODLA 2BJVA 2FX3A 2GF2A 3KSMA 4FBLA 2ESRA 3E5MA 4MKIA 4MQEB 4M2LA 3GBSA 4UXIA 5IEBA 2O6LA 3I6MA 5TQ0A 1Q83A 1G7SA 1YRHA 3G1TA 4MR7A 1CJTC 4N18A 4EPXA 2NTJA 2CVHA 1SC6A 2FSSA 5CG2A 3ADBA 2ZAYA 3QVVA 2XZPA 1KZ4A 2FR0A 4ONEA 2ORVA 4AROA 1S2IA 2J30A 4CW7A 4C88A 3V8MA 2QLTA 4ZD6A 2HJVA 4OXRA 4EJFA 1G8SA 1XD2A 1LBTA 4YI3A 5AI9A 1KBOA 1OFHA 1K89A 1I6MA 5CDYA 3W5VA 2XIQA 2G36A 5CRIA 4QARA 2JIQA 1Z38A 3TDMA 2IYLD 4XW2A 3NXKA 4H35A 1KO4A 3SZRA 4RFVA 1QB8A 2B8JA 2GO7A 2V9PA 3DAGA 3EAFA 3EQZA 4MUHA 3U4HA 4AX8A 1B14A 3I2JA 3D43A 3NATA 4MARA 4Y2JA 3SEQA 4AZ0B 3BB1A 4ZEMA 1ADGA 4JQCA 1NT4A 4XWWA 3VPBA 4BIMA 3SVTA 5ICCA 2QT9A 3PIIA 4QU8A 2CXQA 3WZLA 2PX4A 4BX3A 3OX3A 4CKBA 2PLRA 2PO7A 2ZAGA 2DKOA 3TAHA 3IMKA 1PR1A 3GEPA 3SHOA 1HYHA 4TVKA 3EPLA 2GJ9A 1YJAA 3CP8A 2I29A 1UOPA 3NT4A 3QU4A 1F2UB 2B3DA 1TYBE 4W7SA 5AM0A 3HXLA 2HLDD 4FIDA 1F14A 1YE5A 2QMQA 3I01M 4J49A 2ACKA 4MVJF 2FMUA 5CTAA 5DGHA 2CK3A 4FJ1A 4HNUA 2QPAA 3SR4A 2XXAA 1GNLA 3GT0A 3KAJA 4PFJA 4TWJA 1VBNA 2XCIA 1VHQA 4TKZA 4ZEVA 5C4MA 2XYGA 4ZTZB 1P75A 3X2SA 3D6UA 3JYHA 4E0FA 4MYSA 4BLVA 3EH2A 1EVEA 3G9TA 5KX5B 1QUEA 1Z0JA 3T15A 3WB9A 3WQSB 5CIYA 3HN6A 2IHTA 4W5WA 5B2ZA 2GZMA 1XQVA 2ZW9A 1W75A 4KP7A 1SPXA 2AR0A 3IILA 2JGLA 4H08A 3BXPA 5IYPA 3VNUA 1JRLA 3EXIB 1A88A 5HZBA 1X1CA 1GA1A 2H54A 3TW4A 2QXTA 3IUEA 3UXYA 1IBMB 3MT7A 1TVMA 2O7QA 1CY1A 4XUEA 2IDJA 3Q0EA 5EVCA 1W49A 2CXSA 1FFHA 5AKEA 1QIGA 1PJRA 4BN4A 4WGGA 4EUSA 5C34B 3IC5A 2OHOA 4EQ6A 2VNIA 2WUFA 2YYZA 1I32A 3ZE6A 3QY0A 2IIQA 1VPEA 4AJIA 1B8NA 3EZNA 5DW0A 3X1WA 2FX2A 4F5YA 1XJCA 1NWHA 4TV9B 4GECA 3PNMA 3KPYA 3U3DA 3WYFA 1OXVA 1IZYA 2JFPA 2HQOA 4DY6A 1V5VA 1SELA 1VKOA 3RS4A 1G8PA 5KINB 1NNUA 1NI4A 1JX6A 3OPVA 3EXG2 1H94A 3WXBA 3EVZA 4UPEA 3LXUX 2HF7A 3GIDA 3SIXA 1KK3A 1L7BA 1ZNWA 1XDWA 1Y4UA 4WA7A 4CFZA 5KYKA 3ZIAA 1AA9A 1V16B 3AUUA 4ILEA 4PYRA 4QWWA 3MZ0A 2VXCA 3K05A 3AV0B 2Y1CA 2NMVA 5GY7A 1VRCA 1L1FA 2GEUA 3ZJ5A 5A06A 2GF9A 5CNIA 2H48A 2YVKA 3TCXB 3VZDA 4P2GA 4YAUA 1V1RA 2VAMA 4Y6PA 4Z2YA 3L0YA 1O57A 2ID9A 3BGIA 3UK0A 3ASSA 1UD2A 1UPUA 2I3DA 3TMKA 5DN6D 4BAGA 1YS1X 1EB8A 4KAJA 1KC1A 1XYGA 4NCXA 3NYIA 3IQZA 4QYWA 5FPSA 1DIRA 3S1SA 4WIAA 2PKCA 4X00A 3TG2A 3JQAA 4JWTA 3ASUA 3CRMA 2HBRA 3H13A 4FW9A 5JPIA 2HIGA 1A8QA 2VYND 2ODNA 1VJTA 2ZYHA 2ZZKA 5A5DA 3FKSA 1UAAA 2X4IA 4GSKA 2BZ1A 4IMPA 4CMGA 1W4AA 2GVNA 3F71A 3UKJA 4A9AA 2JAPA 4X1YA 3LTNC 1PEKE 3VXKA 4XDZA 2HEIA 4IGIA 5IDWA 4I9HA 3U7EB 2X8KA 1OI3A 5GZ6A 5TEVA 1DEXA 3H9EO 4NCIA 3VV3A 3EY9A 1ZUD1 2O3RA 4ABTA 4XIIA 2OENG 4J7UA 4ALJA 5IVKA 3T41A 2ID4A 4TXHA 2LZ0A 1R88A 4JASB 4DCJA 3GJ5A 3AJAA 4LDPA 5ANRB 5EE5B 2FW9A 1VXRA 4RVDA 2HCRA 1E2KA 3EFOA 3G0IA 3K9NA 4DYVA 5FWXA 4KO3S 4XR6A 1OI7A 1Z73A 2Z30A 4K9KA 1DOZA 1AQJA 4JBGA 4AS3A 1E1NA 2CY0A 3BKXA 3EIUA 3K1AA 3F3YA 3KJEA 3N8HA 4YVFA 3V9AA 4BMSA 1JZSA 1HKUA 2Q5JA 3AKEA 3QFRA 1Q7TA 4GZLA 621PA 3N6XA 3G8BA 4XAQA 5E1OA 4BQPA 3GP3A 1CEEA 2FPRA 2AHOA 2X0RA 2XE4A 3SLNA 1RZRD 5B7GA 4BNTA 3L6DA 4MUAA 3UW1A 1IZ0A 3V4SA 5HGJA 3H94A 1DCMA 1FDIA 4LRWA 3NFRA 4XJTA 2CSUA 4OI2A 1H6CA 4ZQCB 5EI5A 1K4YA 3DMYA 1JEJA 2YV4A 5C37A 3S29A 1JPVA 4URVR 4DARA 4UTRA 3OEWA 3BY2A 1E2JA 2AS0A 3CLKA 3PXEA 1U7HA 1IVNA 2HX1A 4GM4A 1HE5A 4OU5A 2C5FA 1VRVA 2BBSA 4GXNA 1XMVA 1U1DA 1WAMA 1E2FA 5D3ZA 1J8MF 1DV1A 1PR5A 4RD3A 2REQA 4QFBA 4WOPA 3TD9A 1QG0A 3E4CA 3GVKA 3FN4A 1A7AA 4UDNA 4MQ6A 4RHTA 3RYCB 3DBIA 2FUG6 5LBIA 4XTRA 3ASVA 1SU8A 3RUAA 2A94A 3GV0A 4I4LA 4I9GA 3MLAA 2XWSA 3TDKA 3KR0A 1DSSG 4K0RA 2O2DA 4YYZA 4CKEA 1F17A 1GRNA 3RTGA 1XDZA 1Z4LA 2BF7A 2JC3A 3ICWA 1DRVA 4J94A 4C03A 1NUHA 1K0UA 4RZIA 3DZ8A 5CB0A 2HUPA 4R8SA 4QHSA 3KLBA 3OA0A 2DQZA 1PKXA 1KSHA 5KCMA 5ITSA 1L7QA 1SXJD 3H75A 1GA4A 1CUXA 2JAXA 1PNRA 1ZIDA 1CUUA 4K9OA 5K8TA 4P7KA 4NLLA 3ZE0B 4ARIA 1Y1RA 4KLNA 3PXAA 2C4WA 4AECA 2H1FA 2XQFA 5IC5A 4BVAA 2UYCA 2PUFA 4YAGA 4DWOA 1AS3A 3UY4A 4OLAA 4AO6A 4HF7A 3RM3A 3O4HA 3W6PA 4W8GA 1UXOA 2GJAA 2LBPA 3LNNA 1M6VB 1IHOA 1M6HA 5AOVA 3RSCA 2XUIA 2NZUG 1XTIA 2Z0MA 4UDXX 1AN0A 1E3WA 2B7CA 3ILYA 4NJMA 2IZZA 5HHTA 5BWNA 1GTRA 2JLWA 3RJ9A 2IEYA 3OUUA 3YASA 1DC8A 1G7TA 4MICA 4PPQA 5HMMA 4I1YA 3W78A 4JU9A 2X6RA 2Q5QA 1NQ5A 1SG0A 2XWJI 5LZ7A 2ZG6A 4DBLE 3C3AA 1RHJA 4REMA 1SKBA 2G9UA 2QTVA 2JIPA 4HV4A 1VHTA 3IR7A 3OLXA 4CU2A 1UQTA 1IN6A 2JFGA 1QGYA 4O5OA 4L5AA 5E2IA 4B43A 1U5BB 3IVAA 3LGAA 5CA1F 2J48A 1NVWQ 3EXHA 4YJGA 3SHVA 2RI1A 3D5EA 5ICGA 1KJIA 2J3KA 4OSEA 5FR2A 4B6EA 4C21A 1DC3A 4YMHA 3X44A 4PNHA 2YJTD 5K2OA 4CCYB 1M33A 5KYUA 3SLKA 5TDHA 3FDZB 3WSWA 2R62A 3PRJA 5G0SA 1RAFA 5JD5A 4ZVVA 3ZHSA 4HWPA 4HY3A 4E2XA 1WKVA 3QVXA 2YRFA 4ZYZA 2P2CA 2RHLA 5I5GA 4BFTA 5J1TB 1RZVA 1YKFA 4L76A 2ZUBA 4PAMA 1VGRA 3QEMA 4L8YA 4URUR 1B6SA 1N8NA 4LYGA 4WKOA 5LOVB 4B7ZA 4KE7A 1E3IA 4MRMA 1E0SA 1N6RA 2RHGB 1UWLA 1Z7EA 3CO0S 3UBMA 3WRYA 2PEYA 3E58A 4JI1B 3C3EA 2IEDA 1EFRD 3WYEA 3LMKA 4PTZA 2XT6A 3GXBA 2P78A 1QPGA 4Q34A 5FULA 2A84A 4LXIA 4GOJA 3RFFA 2Q27A 1Z5ZA 2VH5R 4PQYA 3CT4A 1V26A 5HQTA 5EAIA 5JPDA 5E6UA 3GEIA 5TPWB 1HQYE 2YJGA 4CIDA 1TU3A 1NW4A 3WLQA 3R6DA 4NZ9A 4OBXA 5D6OA 1G3MA 4WKGA 1OYOA 2PS1A 2ZJ2A 5DMHA 1EUCA 5IJ0B 3HCCA 2QEXB 1Z6PA 3HFJA 4TRJA 821PA 2OO5C 5HEKA 1G0NA 3W5SA 4NU6A 5C3UA 3JQFA 2XMBA 3DAHA 5DBFA 5K9ZA 3T5GA 3S2SA 4EHNA 4QGGA 4RDIA 1C3XA 3ZW7A 3GAAA 3BK7A 4Q3LA 4MLZA 4XCVA 1L4HA 5CH8A 4YRGA 3HN2A 3UFXA 1BRMA 4D9JA 1UFQA 1C4XA 4BATA 4BPBA 1G63A 3ZV3A 3A1VA 5TJ9A 3VU8A 1M1NA 3BZUA 4LRTB 1JIVA 1N6IA 1XCPA 2R4TA 3VVBA 1JQKA 4LE0A 5I9NA 3E2MA 4GI5A 4G25A 4CM9D 4AUNA 1Z5GA 4KX5A 1FNMA 1ETUA 1SK8A 1JFFA 2BTOA 2O8CB 1R9NA 2QRKA 2WFLA 3C7KA 3MM4A 3RVDA 4M1ZA 1LWOA 1F8UA 4ZREA 3Q8XB 4GLJA 5JLJA 2FEXA 1K3FA 5CURA 1YE3A 4KLRA 4YJDA 3KYIB 2FFQA 2VJBA 2Y1EA 1H6DA 5JUWA 3OD5A 1BFUA 1PTKA 2WAOA 4OG2A 4EHHA 5E0KB 2OO3A 4A92A 4L4RA 1Q81D 3GLHA 3B2EA 1ML3A 1K8AD 2F1RA 3GJTA 2DE0X 3DKVA 1RLTA 2NUAB 5H4GA 1NJFA 1EKXA 2PU5A 4DIMA 1R0KA 3LL7A 4ZO8A 1TVKB 2H4YA 4CQLA 3DEAA 1B1AA 1J23A 1X7WA 5KJ1A 3EASA 3GRFA 2VQSA 4G1EB 4BNHA 3OKXA 3LSTA 2QUZA 9GPBA 4AN1A 3ZK8A 1F3OA 3PGA1 3PXDA 5I4CA 4XQ9A 1FXUA 4HUTA 5ECYA 1B3BA 3HKEB 3AZPA 3IOMA 3KLNA 4Y18A 5EMLA 1BXGA 1PZXA 3HRHA 3DE5X 1NXXA 2WEKA 4MV7A 4PIMA 4DJDC 2R48A 1FX1A 3GHYA 5CFZA 2XBLA 4QASA 2I2WA 2PHZA 3BWVA 3IUPA 1SQFA 3BQMB 3FYCA 5B3AA 5I7RA 2ZIAA 2WR8A 2QRMA 3CWQA 3COSA 3ZLJA 3TVTA 5BURA 1ACMA 3ND6A 1U3UA 1O8CA 3E1KA 3P52A 4J7AA 1WOYA 2WJAA 1LBHA 4AIIA 4DZZA 3TPFA 4RGVA 3X43A 4UQLA 2W2NA 1LC3A 3SGLA 1HETA 1I7LA 4GUAA 1KI9A 5K8LA 2V1XA 2GD1O 2RHWA 1LPMA 2AXEA 3EA5A 3A2MA 3ZCVA 3EZXA 4H3KB 8AT1A 1G8AA 3KNZA 3B1FA 4Y0VA 1W93A 1II8A 2PA0A 5EHQA 3TW8A 3V1MA 3WKBA 1Y6GA 3NDBB 3KTAB 2C61A 1O3YA 2X2OA 1EP2B 1WSWA 1X92A 3A10A 5F3RA 1SXJE 3EARA 1XHFA 4WUTA 3U4AA 4ZCRA 2C7PA 1H8HD 1PG0A 3EE6A 1LQUA 4MQEA 3VR6D 2MR5A 5LR6A 4OJYA 4JP1A 4YONB 2CVPA 3FJYA 5I9BA 3N0RA 2O7SA 4J0HA 2B4TO 2GAOA 1XZEA 4J0QA 2FE4A 3L4SO 3HAGA 4V0SA 1E1QD 2H2WA 5HUHA 2XBUA 4KQ2A 2R86A 3LHFA 3GJ4A 2NSJA 4JC5A 4OQ4A 4U2FA 2C5BA 4JCOA 5ETJA 1ULSA 2C3PA 1RTTA 2PGDA 4WDQA 1UPBA 3E3OA 3OHSX 3DA8A 4L73A 4C0SA 4M1MA 4PHHA 5EZ5A 2YXPX 1BU5A 2YFQA 5HM8A 2GUWA 3K9BA 2PD6A 1W94A 2HSZA 1Z35A 2IZ5A 1J0XO 2VJNA 3C1TA 4HFJA 4FKBA 4PZ0A 5BQ3A 1DAGA 1A5SB 3AEKB 3PC7A 3DTYA 3NM4A 4GS5A 1AB6A 5G0TA 1XPRA 5BSUA 2QVLA 1RQ7A 1ZR4A 4YHBA 3UMCA 4QUZA 3PCTA 3RNOA 3FMOB 1W0JD 3M6MD 3QFHA 3TZHA 4TKMA 3PL1A 5DASA 3OZIA 2NZXA 1PT9A 4UHKA 5BORA 2AI1A 3GLRA 4BO7A 5HBRA 3PNBA 1D5WA 1AQNA 4AXBA 1AK9A 2CVFA 1I30A 2IHYA 3QHPA 2I6UA 4A27A 1HR0B 4DY4A 2XUFA 5CXQA 4EYEA 1JLMA 4E5SA 3A9TA 1F2UA 2G0TA 3OKPA 1MFZA 2F3TA 2F9LA 3BFPA 1MT3A 3I6YA 3LYUA 4HNAB 4NQRA 4XLTA 3PC4A 4F1KA 5B2FA 4FBMA 2NPFA 3G79A 3WDMA 2HHAA 1Y3IA 3CUYA 3C74A 1I4TD 5KWEA 2JW5A 2PN1A 4UNPA 3IHTA 4JT9A 4QQNA 4OFWA 4DQKA 1DRWA 2P8JA 2ISSD 3SCZA 1QR6A 5KQGA 2PK3A 1KZYC 1GGJA 3NBFA 2JFYA 1T25A 2GDJA 2EGHA 4J8PA 2AMJA 5KX5A 3B6EA 1KF0A 3C6KA 1WEKA 3THSA 1LPOA 4OA8A 3PVDA 3OICA 3WICA 1ZDMA 3QBJA 5CNKA 3U56A 2GPSA 2OORC 2A58A 2RMKA 4O33A 3ILHA 2AG1A 2VT6A 3HJRA 2O1XA 3BM5A 2BHTA 4DN6A 4OP3A 3GW8A 1E5LA 1Z7BA 2CNKA 2GSDA 3OEED 1GZVA 1XRLA 5CLQA 1KDYA 1SH7A 2JKYA 3JWHA 3Q6IA 4XJXA 1MW8X 2C88A 5BQ5A 3L41A 3LD9A 3TBFA 3TKLA 2LIPA 3OLZA 2G07A 3F47A 4TV9A 3ZJ4A 3HE3A 1DXHA 2ZTLA 2O5RA 3IEPA 1V39A 1WUIS 3EVDA 3HKDB 3QKRB 2REBA 3WMWA 1DEAA 2GK6A 1HL3A 4GMGA 3K9WA 5F4BA 1RTKA 2MHCA 4NFYA 4DR2B 5JASA 2YC4C 2Q2VA 3E35A 4ITUA 3PC8A 4F4JA 4J90A 1QXSA 4IDDA 3TOXA 5A5GA 1UD3A 4PRLA 1V16A 4PE5B 3T4UA 3PCXA 1NJSA 3FSGA 2WM8A 4OU4A 3FFTA 1X6VA 1B6TA 1SUDA 2R85A 3PNQA 4DOMA 1SUIA 1K06A 3LDGA 4NJEB 4X60A 3RVSA 2V7XA 4XDGA 5AIAA 1JVSA 4ZV7A 3THRA 5HVNA 5AW3A 1G3QA 2H2IA 3BWMA 1W9HA 3KR9A 5EKDA 1H2WA 3VOTA 4MIEA 4BEVA 4CBVA 2C4HA 3FZQA 3AP3A 3RD5A 1LV8A 2D74A 3CCQB 2EG5A 3A35A 3PQFA 3U61B 5EE0A 2J46A 1JMVA 3ZCSA 2HQSA 4YDQA 4Z4HA 4L4ZA 1ISHA 1VDZA 2WYIA 4OIMA 1DI0A 1R8JA 2VWGA 2GEFA 1I51A 4JOQA 2W0SA 4ZQEA 1TUBB 3QJGA 4FN4A 4KN8A 4OFZA 4I4CA 2IW1A 4WXHA 1GRRA 3MWJA 1JLLB 3CPJB 4GI7A 4MH0R 4B46A 4CR8A 3ZTWA 1Z6YA 1I14A 1ZINA 1Q57A 4RS3A 3NG1A 2ABWA 3SJPA 4IGKA 2X5KO 3WZ2A 4TWZA 2AWOA 3Q4GA 1DG9A 2C07A 2FLKA 2G5PA 1IK4A 3D8RA 1EWKA 2PM8A 3UICA 2QAIA 2WD9A 1PLJA 2WSLA 4PLYA 3WR5A 1J2JA 4LMBA 1UQRA 4IILA 2VDWB 1USGA 1M1YE 3HDQA 3C3BA 2D6FA 4MV4A 2X2FA 5JV5A 1FSSA 1AF7A 3RUFA 1V7PC 2NN3C 3KZKA 4ESHA 5B4VA 1YDFA 3DOUA 1MOZA 2XUDA 3OU2A 3RHSA 4EG7A 6LDHA 2ZCJA 2P7HA 1K1EA 4O2AB 2OM6A 5JMPA 3SZ3A 2ENWA 2FPUA 3E8SA 2J3MA 1G20B 1P7YA 5ELMA 5IHXA 1OD6A 1W34A 4W1RA 1YJCA 5FO1A 2GZSA 4GOKA 4QAJA 1T29A 5DHAA 4RY8A 3L40A 1QVRA 2V7QD 1QORA 1IXSB 1EEHA 3D2CA 3KR2A 1U9CA 4IIUA 4QBFA 1RWMA 3OCXA 4UVGA 2X4GA 1SO8A 1W52X 3I2HA 1K7SN 5MFZA 5HF9A 3N8DA 2P90A 4EEXA 5FWAA 1I3NA 1DLIA 2DBRA 2FZVA 1H1DA 2ONKA 4WKBA 4Z4TA 4KPFC 3TB4A 7ADHA 1H66A 1XMIA 2QORA 1QJCA 4XNFA 1I80A 2YWHA 1A0OA 4RF5A 4RDXA 1OTXA 2P9YA 1EVZA 4TMWA 3RIEA 4X64B 1CNMA 3FZYA 4AS2A 4UM9D 3A9VA 4N6GA 2GJSA 1E2QA 3HU3A 1SKYB 3RYCA 2HIAA 4IP0A 4ZARA 4CKXA 5KTPA 1A8IA 1QP7A 1P7ZA 1H9CA 2J9YB 2GT1A 2PL1A 2P69A 1GTG1 1T26A 3P71T 4KO8A 3A1SA 2ZJOA 4L07A 1WOMA 1VZ2A 2CHQA 2OTCA 2VPPA 1FNCA 5DTIA 2XNKA 4BNVA 2QK4A 4XM3A 1X8LA 2PVCA 3W9YA 1YWGO 4CLOB 3ELYA 1PZEA 2RCYA 3LPNA 4TRMA 1UBFA 1MPXA 1T8RA 4XLHA 2AT1A 4Z4QA 3LQ6A 2AF3C 2PAFA 3RGWS 2WJZB 2WIKA 2GFIA 3MW8A 2P0EA 3PP8A 3CLRD 3JTEA 1A5ZA 4Q1VA 3SXPA 5IN4A 2BH2A 4TROA 4C08A 3WL5A 1MORA 1ZN2A 2Y1GA 4QUIA 3LKVA 4RIGA 4UBKA 3IIIA 4ALMA 3E8XA 4JSYA 2VHJA 1KH2A 2ZSHA 4JR1A 2DBYA 2F43B 4OK5A 2Z4RA 2FWRA 3RK1A 2OILA 4MI6A 1NMYA 4GWGA 4WECA 3VR0A 1D8AA 1M6VA 3ZIUA 3SMQA 2VDKB 4K9LA 4M21A 3AMVA 1Z4KA 3PX3A 4YI5A 3FPKA 3BSYA 3FHOA 3HFSA 3TNDA 4E3ZA 2IITA 4XQGA 2ARKA 1VCIA 4F3NA 3MMZA 4IZHA 1FY2A 3U3ZA 4FPXA 5DBHX 2VDUE 1RE0A 4OYYA 3SQOA 5EZYB 1ZY2A 5HR5A 5DLQC 3F1KA 2V6GA 4W9NA 5CFLA 3D6TB 1GGNA 4RADA 4RZQA 2HCTA 3HL4A 2JLXA 5IK2D 1DAPA 5CIWA 1XEFA 1B74A 4HPJB 3M3HA 1II0A 2ZPTX 3NEPX 1U5BA 4TTVA 4F9EA 2Z8ZA 2B1GA 1YBMA 2H9AA 2R751 2GEKA 3LZDA 3L4BC 1FL9A 2NZVG 3UKDA 4FZJA 3H2JA 3OJOA 2XOKA 3WTCA 4BVGA 3NHLA 3CC8A 5JSKA 3I28A 4XWTA 2I9PA 4CCYA 4F93B 4MI3A 2CEAA 3LRXA 3FDZA 2BFNA 3WGMA 3F9RA 3RTEA 4IINA 5CMLA 3DEIA 3W77A 2BZ0A 1HSZA 4G0WA 2AYZA 4QXQA 1Y6FA 3IESA 2JGNA 1PWYE 3AUJB 4I46A 2ZSAA 1F8XA 4JDUA 3U3KA 1I7PA 2WSBA 3FCXA 3OM8A 5LOVA 4YMGA 4QQKA 1KMNA 2G1AA 1KARA 2PDAA 2XEDA 1PW7A 2VUHB 2ZWPA 4IHJF 4BMDA 1Q9SA 1YDGA 4B3BA 1XZHA 1MVOA 1GPH1 1MV8A 4I5DA 1AT1A 1WSDA 1ZD4A 2QN8A 2TMGA 4XRRA 5CDTA 2ADMA 3EIXA 5JTTA 1CJKC 1KQGA 3EJ6A 5IDYA 1H2AS 2PH1A 3Q7RA 3AFNA 3NBUA 1SU4A 2P9CA 3FA2A 3H8WA 2B4RO 2Z1DA 4OB7A 5K0NA 5TPWA 3TOCA 3U5TA 4DJJA 1Q14A 1H42A 4G1BA 4RY2A 1S01A 3UMMA 1GT6A 3ZV5A 1RQLA 3E23A 2VSFA 4FHEA 2W48A 5IJ0A 3IJPA 4YDRA 2R4QA 1L4LA 4UTPA 1Y63A 5AKJA 4C5CA 5CH5A 4D9MA 2EBFX 2QA5A 4OX9Y 2P2GA 3KD3A 1P4GA 3PR2B 4PR3A 1IY1A 1Y9JA 2I71A 4UNNA 2EP5A 1WXGA 2IX9A 2WA2A 4IDEA 3JRNA 4OFXA 1E61A 1H2HA 3DOFA 3L4KA 2QDKA 3BE5A 3AHHA 5EWLB 1MD9A 1FCJA 1T35A 4FDUA 1YI8A 5DHQA 2GLTA 1JXQA 1OWPA 2HWWA 1H2EA 2Q3EA 5ERGB 4ZEOA 3GLHE 3NI2A 1DWUA 4Y7DA 1AN9A 2ECQA 4IO0A 4MP6A 5AK0A 5CITA 1DUVG 2P4EA 1ZI8A 1IYZA 3KKMA 2JGJA 3MWLA 1KFEB 4FJ0A 1J06A 3GDHA 4OOFA 3WMGA 1W6UA 4ALKA 1R1DA 3AF5A 5L51A 1SVMA 4KRFA 4N39A 4ZGWA 1FB5A 2O8CA 1GEEA 1X0VA 4L3VA 2UV8A 3WK4A 1L7OA 4BS9A 3W2GA 1SUCA 4FZ5A 4WRRA 3TIGA 3K71B 1E3ZA 3G71B 1EINA 3P9IA 3CS3A 4JODA 1I3MA 3SQLA 2JFXA 1TD9A 1UJ4A 3I61A 4BUJA 1MAHA 4YJ3F 4M7WA 1T8SA 4KITB 2GEBA 4DMFA 2BKUA 1HNWB 1Z68A 2DUNA 3HVUA 3DYBA 1FZQA 1ZITA 5AVJA 5J9FA 2I2AA 4YRNA 2CNWA 1ORRA 2D1QA 2NUAA 3QMWA 4RCVA 1HWYA 1NVFA 4AJ9A 1DJNA 3ZHCA 4RM3A 3SXUB 1RI5A 2QUHA 2BHNA 4ETMA 2WHXA 3VKFA 1AX9A 1TVKA 3MG9A 1QQAA 1IK6A 1UUFA 4LEIA 3WNVA 3AU8A 3HO1A 4YXWA 1SUFA 2FETA 4K40A 2I7XA 2WYUA 3DZJA 4KR0A 4Y9SA 3ZKAA 4L6IA 4EW2A 2H1RA 5KX5F 4UEKA 2CF6A 1Y7HA 1BH2A 3E27A 3KR1A 1DWPA 3P20A 3PJGA 3W4KA 2CMDA 3HKEA 3ZWKA 1J21A 2DHEA 5HILA 4DTCA 4LBWA 4KFTA 3WNCA 5K8IA 3WSVA 1R6TA 2PAAA 2WZQA 3FMPB 5TV2A 2Q7OE 4DNRB 4F2PA 1IHUA 4DUGA 3AEUB 4Q6WA 4NBLA 1HUQA 4MO2A 3NTRA 1K73D 1KETA 4WZZA 4LSWA 2AI3A 5LBTA 5EHGA 1HT0A 3F96A 1RBQA 3Q0IA 4DLNA 2JHAA 5EJ4A 4E5NA 5K8VA 2XDAA 4LJAA 1VBMA 3GUCA 1XI2A 3EHEA 4TV9F 3ZVMA 3GCDA 4XLCA 3CCSB 3AVQA 1Z6ZA 4LQCA 1RYFA 2DEUA 1KVRA 4NHEA 3RT9A 2WPDD 1X1TA 5JANA 5KTNA 1EAMA 3JYLA 3P9YA 5EL0A 4OX9B 2ZREA 4KL8S 1EH5A 1ONBA 4JBIA 5KYVA 4B84A 3JQQA 1J90A 3B1YA 1TGVA 3OWOA 3FX2A 3ZY3A 1GJRA 1RR6A 1PZMA 3D7NA 4G26A 4ADSG 1GLNA 1DPGA 3GLVA 1W25A 3KTAA 3MWKA 3LBHA 5C8YA 2EBUA 2UKDA 5KBYA 4KXNA 3IB6A 3BERA 2NNWB 3RLIA 3SQNA 2HCJB 4E31A 1MW9X 3EZ6A 4WVFA 3I4LA 2Q4TA 4FI3C 3GB9A 2E55A 3AH8A 4IUDS 1N0UA 4S24A 3WL7A 7AT1A 1ZVVA 1U8UA 3QNWA 4MHTA 1QYDA 3DDUA 2YBEA 2B4KA 3BH0A 4TQ9A 5DTQA 3EY4A 3IPLA 2RHHA 1IU9A 3Q2OA 1EWRA 2QUIA 5IWCA 1UP4A 2KHZA 4J9UE 3QZUA 7REQB 4WPGA 1FDTA 1RWQA 4FYHA 1T4CB 4EW1A 3IQEA 3K9FC 4A36A 2PANA 4IYJA 2XAAA 4MA0A 1KYTA 2RHBA 4ZEXA 4P53A 5CYPA 3R09A 4L0DA 2QUAA 4ASUA 1C4OA 3L9WA 1OE0A 2PWZA 3ASPA 3CW9A 3KYJB 3QEJA 1G41A 2ZJZA 3AEKA 5U1PA 4ZVSA 3ZU3A 1F4PA 3WYCA 3RS7A 1VYVA 5TT1A 2OO7A 2R0QC 2QMOA 5HOEA 5BNFA 3PQ6A 4FZ3A 3VR6H 4QVAA 4Z1MD 3DBOB 4E21A 1KDOA 1E2UA 1H5UA 4LDZA 4EO9A 4HUQB 4TMYA 1LDGA 1RKVA 3AB8A 3BD6A 2E48A 3RQSA 5IUNC 3FHLA 4E6PA 3DMTA 1YRAA 3ONFA 4EGSA 2BSQA 2ODQA 1M2WA 2VEOA 3U1BA 2FQQA 3PF8A 2IT1A 2XJ4A 3PR3A 4CI9A 4F5EA 3IUQA 3ILSA 3JCZA 1E1YA 3UYKA 3RU2A 3ZOKA 3FSEA 3UGQA 3A8KA 2FN4A 4HNAA 1VE7A 5CXSA 2A5LA 1OXKB 2ONZA 2MR6A 2H0RA 4MV3A 1XVLA 1IMJA 1PR9A 3CZ5A 5T4HA 1PFUA 1CDZA 1RJWA 4RPIA 2OO5A 1MO3A 4Z4RA 3MJHA 1VSTA 2J59A 1M2JA 1SXGA 4LV8B 4A7PA 4L02A 4Y2HA 4G0XA 1RC1A 3IR6A 2XOXA 3IAHA 4II7A 2P7IA 4P4LA 4EBFA 5AUQA 4S05A 2F55A 1QRUA 3CR7A 1BWSA 4JBHA 3BXGA 4ZAZA 2J32A 2JL1A 3C3WA 1EI9A 3EIEA 4DPLA 1Q1ZA 2QQEA 5D1NA 1BTOA 1C9DB 4XYMA 3BTOA 2E1RA 2P6PA 2QGFA 3CLSC 1NAIA 5TNXA 3WGZA 3UBTA 2QVGA 2PQMA 5ITZB 1KP9A 2WKWA 1OI2A 4QYSA 3RFTA 3WGUA 5IAAA 4ZZ0A 2MIIA 3KEWA 3H6GA 4J1SA 5K0TA 3PUKA 2X6QA 5CDUA 5MGBA 1N57A 1YSCA 1RZUA 2C2WA 1F0PA 2E9SA 3L3BA 2P9ZA 3M4NA 4MYHA 4OTZA 1F9EA 4QDZA 2I55A 3KZOA 3RSFA 5IPFA 1BQ3A 1Q3KA 2B8EA 5JH7B 1YQEA 2I76A 3GROA 1ES9A 1NONA 2B94A 3HKDA 1TL7C 3HABA 3P32A 3QKRA 4JIGA 3RI3A 4KPGA 4R16A 4V0OA 3LRTA 5A7HA 2XCUA 3ZY4A 4E4RA 3FE2A 3FMGA 3PVZA 4FFOA 5HDBB 3SXJA 4X7BA 4D96A 2W8BB 4HVLA 3WDLA 4BLSA 1V9CA 4UUAA 2YHSA 4XM1A 3DHWC 5J35A 1FNNA 1Z2OX 3DZHA 3IDZA 2ZYDA 4KSBA 3G9QA 4RJKA 5IFKA 1C2YA 2X8AA 1CJMA 3OSZA 2PJDA 3D7SA 1X1RA 2FQWA 2P0YA 2PXXA 1T36B 4NJEA 2ZEJA 3OQPA 4IQ4A 5K3DA 3UB4A 2F9MA 4U0JA 4B73A 4KYIB 1ZIPA 3EVTA 3RUCA 4P5EA 1T9GS 2AG6A 1Z5OA 3R41A 2WSMA 2GXSA 2VCEA 2JAWA 2WDPA 3Q9UA 4UVIA 5TQ2B 4EVSA 4I1UA 2J0VA 1G2IA 2VJPA 3LY9A 4YBRA 4BV9A 4NZMA 2IH2A 3RO7A 1J2EA 2XNHA 3OFNA 3OCCA 2QI9C 3TINA 6REQB 4Y2RA 3EIWA 1TUBA 3MCTA 2PKQO 1HMPA 3PZBA 5BN3B 2O54A 4ZRMA 5LQCA 1JAXA 3O5AA 4TMZA 1JLLA 4NEQA 5BMVB 4TYNA 4JLKA 5HDQA 4X92A 4L85A 3L84A 1PYGA 5KYWA 2XB4A 4C7OB 1VP9A 3RWMB 1QRSA 3OQJA 4L15A 2QZPA 4WXEA 2GESA 4LYHA 3SX2A 2A1TR 3U6BA 3T4EA 3VTKA 4RNCA 1TMOA 2VDWA 1DKOA 1C9MA 3PRYA 2XKAA 1NQAO 4NVRA 4IIXA 1C7QA 2GPNA 1A76A 3T0FA 3WOVA 4DCVA 2CVOA 1HLFA 4OPMA 4HI0E 1P4MA 3QKWA 4BCCA 1O96B 3HUEA 5JSHA 1LDBA 1AH2A 4O2AA 3R7WB 1XD9A 2EZ4A 3UH1A 2AEMA 4UOZA 1G20A 4IM7A 1XRQA 2Y4OA 3OP4A 4GXTA 4DQDA 1KY5A 1DZ3A 1E32A 2RAVA 3AR6A 1SBIA 5CFOA 3T5TA 2XNDA 3MILA 2PMKA 3KT8A 1P4SA 4WN9B 5LOVF 5FBQB 4DZTA 2OXRA 2HZ7A 3KSAC 1ZHOA 1POWA 1S8AA 1L1RA 3VYTB 1ZM2A 3FPPA 2RFLA 4CNQA 3ILXA 4Q4HB 3UTCA 4F97A 3TW0A 4IIYA 5JNTA 5K0ZA 2ZBRA 3GAMA 1C29B 4IY1A 3VPDA 1FNSA 1P1RA 3R0VA 4WK0B 3K70C 3N87A 1JKJB 3DB2A 4Y0NA 2FGJA 4LRUA 4TYYA 1C7RA 3ZHOA 1NN3A 4PONA 3RT7A 5HJEA 4R1LA 2ZWMA 2XMPA 5DYGA 3RSOA 2X8LA 3P27A 3FZEA 1R27A 2GM9A 4N3CA 1OX6A 4BP8A 4DK1A 2CV1A 5C9ZA 3DXYA 4HRXA 2NSLA 5KKNB 1N2GA 4NMWA 3ZE7A 1M75A 2YIDA 2ZJ1A 4ZTBA 1Y4AE 3BAFA 3H8SA 1P1JA 2G8LA 2G7MC 2WUGA 1V1MB 1UC5B 4WFKA 4TYQA 4YFVA 2UXCB 4AZSA 3EBPA 1R8XA 1NVTA 1XNRB 4O8CA 4N0DA 4B34A 3TNFA 3ADCA 1JDZA 3O74A 2BYTA 5CJJA 1ENZA 1RRPA 3EEIA 2ATEA 4CLOA 3DEYX 4R9RA 3CB4A 4NBUA 4KN9S 3T4PA 4B32A 2IY7A 3B5JA 4Q24A 3VZQA 3WJ1A 3ZS8A 1VQLB 4INZA 5H82A 1X8JA 2GCPA 2AD5A 3IP9A 4ME6A 4AN4A 5K0FA 5EIOA 2ZB3A 5IULC 4WL0A 5ECWA 3LA6A 4C4SA 4LXHA 1KMIY 2Z3WA 4P5DA 4W9RA 1P39A 4M8SA 3UN1A 5ALIA 4J0KA 4D56A 3A3GA 1SXQA 2F43A 1DKLA 3NHYA 4M3NA 2NO9A 1R8QA 5LP1A 4LHSA 2FJUA 1ZESA 1NOKA 2CXHA 3OVMA 1W19A 4UE3S 4MOWA 2R60A 1TM5E 2H85A 1AO0A 1PV4A 2Y1LA 3S7ZA 2JBWA 2PS0A 4XLEA 2OORA 4KMRA 3K15A 1VMAA 3BB4A 1J25A 3D8NA 3HYCA 1U8CB 2V03A 3QE0A 4LYDA 1KOLA 4M7OA 2AR7A 1VLLA 3GZNB 3A4MA 3DHNA 4M60A 4P22A 3KOWA 4QSMA 5EZYA 5AW8A 1KWKA 3L0SA 4G4IA 3H1TA 2WKSA 2MT9A 3FUVA 4PGOA 4YRFA 4UDYX 1VKNA 5BWBA 1Q0HA 3PTAA 4QYTA 2E37A 1SNYA 2NP7A 3IKTA 4P36A 2VDJA 4EX7A 3HZZA 1OFUA 1VHOA 3V2HA 2E85A 4H1TA 5CU7A 1QRRA 2QRNA 2ZI3A 1FJ2A 2I2DA 3OE7D 4LRXA 3TSWA 4XARA 5FRDA 1C3EA 3PI6A 3TZ6A 2GK3A 1MX5A 4KN5A 3LS2A 4D5GA 2AHRA 2ACWA 1Y8RB 4YALA 2BUAA 2DQKA 1RCTE 3BK1A 1VCMA 4R7ZA 3PNPA 5F5LA 4YWHA 3WQHA 3TTXA 2C5HA 3OZCA 2AMLA 2Q1YA 1KRXA 5L4LA 5KNBA 1YONA 3EA4A 1YT5A 1NRKA 1FTGA 3G05A 2AEEA 5K4AA 3X1XA 1EM8B 3MBOA 3U40A 2BDEA 4OLFA 1T9DA 3J81A 4FB5A 4HE6A 1CB7A 3LOPA 4ZAWA 1QF6A 4FMBB 4D8WA 1WWKA 4QHTA 1ZM7A 3GN1A 4QO7A 4PS1A 3DVRX 4ZGGA 2MWMA 4GR9A 3O7WA 4FS8A 2C4KA 2PZAA 1Q1AA 1Z74A 3CF0A 2I67A 3FVRA 4LE1A 4GC9A 1RWKA 1N5LA 4FP9A 5JZVA 2FUEA 4RY0A 4DBZA 3KYCB 2O5CA 4KV9A 4K05A 1H6AA 4NF2A 3ECAA 1PJTA 4OKIA 4UHDA 4D8XA 1WPRA 4Y2YA 3QX8A 7ABPA 2XA2A 2C58A 5C8YF 4QC2A 1KZGB 3F4LA 2P9EA 1KEEA 1P3Y1 4KH0A 2DCUA 1IEQA 2EL7A 3A25A 2OXTA 2IHZA 3T38A 5D3MB 3CXRA 2WW8A 1JHAA 1TZJA 4WFIA 1ABBA 3HJHA 1W8DA 2P5SA 1NDUA 1CLUA 1WXWA 2WIAA 4IJUA 5BW6B 1DG3A 2H57A 1DIHA 3OIFA 1T9HA 4IDBA 4D3SA 3S8YA 2ZR8A 1FJXA 4N1AA 3BL5A 4MI9A 4OAOA 5EWLA 3RKRA 2ADFA 3I76A 2AOTB 5SYNA 2HRRA 3HXQA 1QG6A 3RHZA 4S1NA 4D42A 4DQLA 4INJA 2C00A 5FP0A 2X5NA 3FWZA 2JDID 5CW2A 3U3RA 4BQNA 2GSWA 3ZDDA 5TGTA 3EEYA 2GXAA 1KRWA 3QXCA 3O21A 5A2GA 3DE4X 2R25B 4OMFG 3DEHA 3FROA 1NURA 3NBKA 4PPFA 2EJUA 3H97A 1UC8A 4PPYA 2ZL5A 2CLEB 3NTOA 3UMJA 2CF4A 3UAWA 4BBAA 3DS8A 1Y9ZA 4WXPA 2I3AA 4E2FA 3H42B 4KO4S 4MA4A 3HVKA 3ESQA 2EFDB 2Y9PB 1BYIA 1FYEA 1QDUA 3ECCA 4TSFD 2HJRA 3B1KA 5CR9A 1VBFA 3SSMA 3K70B 1GN9A 3TUZC 4B9AA 1P9RA 3GCWA 4OXKA 2AF4C 3HJUA 2VWHA 1Y1KE 2W2XA 1QH9A 3ZGLA 5FPHA 2PH7A 2GAJA 1J00A 5BPFA 1KQFA 1FSFA 2B4YA 1H8EA 2P30A 3BWYA 3VZPA 3GLIB 3IVGA 1XZ8A 1M2GA 1W7AA 1YU9A 3I9OA 3C7TA 1ESCA 3SXUA 3Q5GA 5FPYA 4M1OA 5JMTA 1DCKA 3QENA 4WV3A 3LQEA 5LNK6 3QVKA 3R3YA 3VTZA 7MDHA 4UEOA 3RSGA 4F1JA 3D6FA 3PBKA 3Q9LA 1A27A 1T4BA 1IN8A 3DEKA 1SVWA 1DIOB 1VIAA 2HRDA 2ZJYA 3AY0A 3GRVA 3RG8A 1CUWA 3U13A 4MDEA 1RYZA 2F4VB 1J4AA 1PJCA 2VP3A 4OJNA 2J9ZB 3E3NA 3D1JA 1QK4A 3K30A 3L7LA 2V3CC 5FA5A 1SA0B 1XN1A 1GTMA 4F11A 1Q7CA 1QHSA 5CT8A 3NOOA 4KR6A 1NV8A 4UREA 1RQXA 3WP0A 5K7SA 1MAAA 1H9AA 3AEUA 3AILA 3KO8A 1OTHA 3JWEA 1GFSA 5AESA 1EP9A 4WZKA 3MWYW 2ASEA 2XIJA 4MRPA 5JXHA 2NQ2C 4W6ZA 2CCJA 4BNWA 1AGYA 4TN1A 1JE0A 2IWRA 4B6SA 2C3UA 2JJYA 5A4KA 4CMEC 1BOFA 4PYNA 1KI7A 2JRCA 3B7WA 1Y6ZA 3AF1A 2ZJ7A 2MSCB 5IARA 1VYUA 2FI1A 1C9KA 2RBEA 2ZYWX 4BKUA 1GZ5A 2F6RA 4AY6A 4BKMA 2KE5A 3QLVC 4YN3A 1KU6A 4M1TA 4GD3Q 4TLBA 2BE7A 4A73A 1XL1A 5DYIA 5DK4A 5I7AA 4O3FA 2PY6A 4WWVA 5KSWB 4NBKA 2LXNA 4URZR 3H19A 3WVNA 3WLHA 2H6EA 3E5NA 3C4VA 1CUGA 1PBNA 2Q1XA 1UIMA 3DO8A 2WWTA 4B3RB 4LNUB 4A0SA 2FW8A 3T5PA 1IOLA 5IP5A 1YNOA 1TM7E 3X2EA 3L4BA 4LJYA 3RB8A 3CN7A 1G9TA 1XJ0A 4FYPA 4H77A 2MMGA 1W0CA 3SSNA 1UKYA 5HXBA 5ALNA 7REQA 1T4CA 4LWOA 4CF3A 5TPZD 4M4SA 3B36A 1AHHA 3PSHA 1AS2A 1FF9A 1GA6A 2ETVA 1AMOA 1JXAA 1V6AA 1K27A 2FNAA 2XNSA 2IU4A 3U39A 3KQHA 4HX5A 4DV3B 1RIFA 1NVKA 4HZIA 4Y7CA 1E0AA 1EHIA 1TKAA 5CDFE 3WV4A 4YUVA 4EQZA 5FH9A 2VJYA 3WLNA 1N7HA 1N2ZA 3R6KA 2WTXA 4PTYA 1XFDA 1XUOA 5DULA 2KWIA 1ECJA 3AVVA