4UAJA

Crystal structure of nqrf in hexagonal space group
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
280
structure length
280
Chain Sequence
GVKKWECTVISNDNKATFIKELKLAIPDGESVPFRAGGYIQIEAPAHHVKYADFDVPEKYRGDWDKFNLFRYESKVDEPIIRAYSMANYPEEFGIIMLNVRIATPPPNNPNVPPGQMSSYIWSLKAGDKCTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGARSKREMFYVEDFDGLAAENDNFVWHCALSDPQPEDNWTGYTGFIHNVLYENYLKDHEAPEDCEYYMCGPPMMNAAVINMLKNLGVEEENILLDDFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the V. cholerae Na+-pumping NADH:quinone oxidoreductase.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
molecule keywords Na(+)-translocating NADH-quinone reductase subunit F
total genus 77
structure length 280
sequence length 280
ec nomenclature ec 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).
pdb deposition date 2014-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4uajA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4uajA02
3CCLB 1YITB 5TV2A 1QVGB 1NDHA 2HDNB 1S0UA 4J0QA 1VQNB 1QFJA 1D8TA 2RC6A 3U6BA 2VNJA 3CCVB 3QSYA 3AGQA 4C43A 2OK8A 4TMWA 3G71B 4B44A 5HXBA 4B43A 4TMTA 1GJRA 4G1BA 1W87A 4RD2A 4ZGNB 1BQEA 4LC0A 3ZZTA 4TN1A 2DY1A 4FK8A 1KK2A 2BMWA 3QE2A 3VNVA 2CRVA 3FJOA 1CNEA 2HMAA 4P3YA 4RD3A 2QMUA 1DARA 4LBYA 1EP1B 4EH1A 3JQQA 5GV8A 3I1FA 4ZV4A 3G6EB 1SM4A 4QFMA 2BN4A 5EMNA 1Q7YD 2OK7A 2BF4A 1FRNA 3VMFA 5JBQA 1K73D 4PC2A 4G1VA 2D74A 5GV7A 4PC7A 3P27A 2BPOA 3ZBUA 1ELOA 4BPRA 3AVVA 4Y9UA 4HE5A 3G4SB 3W5HA 1QUEA 4NCNA 4ZCLA 1ZM2A 4WQMA 3CC4B 3AVXA 2BM1A 1ZUNB 2VNIA 2EIXA 2CNDA 4FN5A 1QFYA 1NJID 4UAJA 1DG1G 1JB9A 1QG0A 1QFZA 4PC6A 3W2IA 1G7RA 3LRXA 5DSZA 2VNKA 1DDIA 3A1FA 1YJNB 1B2RA 2QEXB 1Q86D 1GAQA 1SKQA 4M0LA 4ZCMA 3AVYA 1W2BB 4B48A 3OZWA 4B3XA 2QA4B 1TUIA 1KRHA 4RCYA 4C0SA 1KQSB 1OB5A 1ZM4A 1JA1A 4NBSA 1OB2A 1QX4A 3B8HA 1IJEA 3QFTA 3QFRA 3QFSA 4LBZA 1K8AD 1FNCA 1AIPA 3CCMB 1VQKB 1YIJB 4Q7JB 3FPKA 5H5JA 1JNYA 3W2GA 4YALA 1BJKA 1F20A 2PIAA 1K9MD 1FDRA 2YWHA 1OGJA 1FRQA 4H9GA 1IB0A 1ZM9A 4LBWA 5TY0A 4Y9RA 4B47A 4ACBA 3E20A 4Y7CA 2B5OA 1EWYA 2DETA 3CPWB 3CCJB 1AMOA 4FWTA 2NPFA 3CMAB 2GPJA 1VQOB 4G5GA 3MMPA 1UMKA 1VQMB 1VQ4B 1WDTA 2PLFA 1R5OA 1FNBA 2QTLA 3OJXA 4ACAA 1QGAA 1YJWB 2C77A 1GO2A 4F7DA 3J81k 4YAWA 3AVTA 4M4SA 2VZLA 3I55B 1F60A 2BVNA 2QTZA 3ES9A 3CMEB 1EXMA 4YAOA 2OTJB 3ZZUA 3LYUA 1Q82D 1E64A 1EFCA 4M53A 1CQXA 1E62A 3OW2B 4B4DA 5TR9A 3VO2A 1TTTA 3OJWA 4DQLA 4AF6A 4TMVA 3WBKA 1VQ8B 3PENA 1G7CA 3U2QA 1BX0A 3CCUB 4RD4A 2PMDA 1QGYA 2EFGA 4N3GA 1N0UA 3P26A 3CW2A 3OZVA 1EFTA 1H85A 3WNBA 4PC3A 2ZITA 2XEXA 1KK1A 3AGPA 3ZZ0A 3W2EA 1IJFA 1H42A 4MYTA 4RJLA 5KSWB 1DDGA 1TLLA 1EP2B 3WYAA 3CC2B 4ZCIA 3B78A 4AC9A 2C78A 2RC5A 3QFCA 1KK3A 1D2EA 4N3NA 4IW3B 2XNJA 2QN6A 1KTVA 1JJ2B 1TVCA 3W2FA 5THXA 1GAWA 2B7CA 2YWEA 4M2LA 3CCEB 4YAUA 1M1KD 3WNDA 1VQ6B 3LVBA 2J7KA 1A8PA 2X3UA 3AVWA 2HCJB 1JA0A 4QHYA 1VQ9B 1FNDA 1FNMA 1VQPB 4PC1A 3SJZA 1OGIA 3ZBTA 3U6KA 3CXCB 2DEUA 1Q81D 4YAFA 1QGZA 3CCSB 4M1KA 1BX1A 3ZC3A 1GVHA 2BGJA 3MHPA 4PGOA 3WXMA 1W35A 1N8RD 4RD6A 5H59A 4P6VF 4TMZA 4RD1A 2YWFA 3WNCA 5AN9A 3WY9A 4ZGQB 3CD6B 3VNUA 1B23P 2BM0A 4TMXA 1G7SA 2XNCA 1CNFA 1YJ9B 2VNHA 3WBJA 2QDXA 3CCQB 2YWGA 1M90D 3LO8A 3JQRA 1R5NA 3W5UA 1ZM3A 1VQ7B 2E1RA 1KC8D 2BGIA 4LBVA 4RD0A 1XE1A 3I56B 1KJZA 4HE6A 1HA3A 2GQFA 2B7BA 1R5BA 1EP3B 2DERA 3VO1A 2BSAA 4DQKA 3CRZA 4R71A 3CCRB 4AF7A 4YHBA 2AHOA 3V76A 3CC7B 1EFUA 1G7TA 1QH0A 4MYUA 1YHQB 1GR1A 1VQLB 1VQ5B 1W34A 1D1NA 4K1XA 3AVUA 1N0VC 1XB2A 1S72B 3W5VA 1KD1D 1KK0A 2OTLB 1U2RA 2BV3A 1YI2B 3JQPA 1QUFA 1E63A 3B82A 3CB4A 3W2HA 2R6HA 3OZUA 2FX3A 1I7PA 2DCUA 1J9ZA 3E1YE 4RCZA 2VYQA 3MCAA 5FA6A 4U9UA 1QVFB
chains in the Genus database with same CATH superfamily
3B7PA 3SIPA 1SR8A 5AW2A 3GI1A 3LQYA 3PS9A 2CBGA 4B40A 2CL7X 1T2NA 4XFKA 1RADA 4X8LA 4RDLA 4Q4LA 1I5RA 5EPOA 2DBZA 1O8CA 1FOEB 4R1TA 3CP8A 4GC9A 4XVUA 1NMQA 4OPVA 3FTCA 4G0VA 2IHZA 2VTVA 2TMDA 16PKA 3OFVA 4LEIA 2BEWB 2JD2A 3S0JA 3UC5A 4BX0A 2WM8A 1EJ2A 4PAGA 1USGA 2QUIA 1V1RA 2ZZFA 1NVGA 2UZIR 4XCQA 1SKAA 1GGKA 1HORA 1NJSA 3WWOA 2J0EA 2YIVX 4OK3A 3H1PA 3UV3A 4JI8B 2VRCA 4BO6A 4PVCA 4O25A 3UT5A 1X8JA 1MGOA 2WD9A 2GJ4A 1DHRA 4V0KA 4FKMA 2XQJA 5E6RA 1NQTA 5AICA 3S28A 1TK3A 3O2SB 3WQRA 3BEOA 4GYYA 1N1EA 1ZGBA 3FIJA 2I62A 2ZIAA 3W9UA 1F4LA 3I2YX 3FRJA 3NTRA 2XHZA 1AN0A 3SC4A 3DR5A 2BKEA 4QTXA 1D1TA 4FEGA 4ZO6A 1BGWA 2JCSA 1GG8A 1V4BA 3T95A 1TU4A 2C83A 5FBRB 3UJNA 4DV7B 4LNAA 1EGVB 3TAXA 1HDXA 4N7MA 5LPNA 2CJYA 1ECPA 1T34A 1KJWA 2VQSA 5A3VA 1W36C 3T53B 2HQ1A 4URUR 1JIJA 2GK4A 4B7UA 2C82A 2VDPB 3PD7A 3Q0IA 4CIXA 4OK6A 3F90A 2F3TA 2GZSA 4QXAA 3F78A 3FCSB 5ICCA 2CFOA 5AKZA 3KZMA 1E1MA 3U17A 3QBVA 4RTOA 4GOLD 3RIGA 3WMWA 1HQDA 2Z8YM 4DMRA 1E0DA 1HSZA 4BKOA 1SUDA 5CK5A 4RD3A 1DTSA 5CT4A 5T5QA 2IH4A 4X05A 4D9BA 2OO5C 1NC1A 1WB5A 4IIEA 4BVKA 3KWJA 1TF7A 5D7BA 3C43A 1ZMTA 5C52B 3X0DA 4G63A 4RXUA 2JLXA 2L0XA 2XYRA 4KVFA 1NJ8A 4Q34A 1TGVA 1XELA 4GKAA 3AR3A 4WXHA 3AWDA 2A0YA 4EW3A 2GJRA 4P86A 1RYYA 3O3NB 1P2DA 3Q1KA 4IHJA 4O2RA 5E4JA 5AKKA 3HKDA 3L7YA 1MW9X 3T5BA 1SUBA 4R7GA 4LHEA 4D8VA 1NBWB 1M54A 1FP1D 1YQTA 3EODA 4GMGA 2QTFA 1J4AA 3VR6D 3R6TA 1I18A 1Z0IA 1NC3A 4YP1A 5T4EA 4B4OA 2Y99A 4EB3A 3ZWYA 4LXHA 4DSUA 1ZMRA 2C96A 4IKOA 4C1BA 3K9QO 2GVNA 1BCRB 2FSPA 1NJ5A 2GCEA 3QX9A 4BFCA 4EUNA 2BPOA 2CNWA 4HNQA 4X1KA 5FUMA 1WDLA 2RIRA 1E2LA 1R37A 4E2WA 3W1VA 4FFLA 3M1LA 1Q22A 4D97A 3C7KA 4HE5A 1AKNA 2ZJYA 3GG2A 3KWFA 1OFIA 3DAGA 1MOQA 3I45A 4PF1A 4UXHA 1CW2B 1Q83A 1T3ZA 2P69A 4JU9A 4MPDA 5I7AA 3TGWA 4GZ3A 4ENSA 2AD5A 4F1KA 4NY1A 1X38A 2JLUA 4CF3A 3DZCA 4F5ZA 8MHTA 1GNRA 2C1EA 4P0PB 1T10A 4CTMA 5K2OA 3WLPA 5BSMA 3ZCRA 2GLXA 4HDAA 1AKTA 4RPJA 5A62A 4KYIB 4Q9JA 4ZT7A 1WJGA 5LQRA 3TZCA 4EFMA 1FFSA 5L46A 4IEIA 4BX9A 4B6GA 1P0FA 1G7RA 2PK3A 3GJSA 4NBLA 3NTVA 4PBTA 2L2QA 2NU9B 3PFIA 4Y7DA 5IKOA 1EH5A 3F6RA 3H84A 2VNKA 1U4NA 1LJ8A 2YFYA 2VCEA 3G49A 3NOQA 1Y5NA 1DU4A 2NW6A 2GRJA 3QPWA 4K3VA 1W1WA 1OAKA 3AG6A 2V31A 3QTLA 3RG8A 4M60A 3Q3AA 1V47A 2OD9A 3K8OE 3NHAA 4KQWA 1IPEA 3REGA 4KWTA 2DH6A 1AU9A 3KB8A 3V6MA 1HG1A 3TLZA 1I33A 3UJHA 1MJFA 1J23A 5EINA 4XWWA 2Z43A 3NV7A 4PNPA 3UPTA 4LHWA 4DR6B 2I3AA 1OFUX 1QF9A 3AFIA 3N2IA 3RE1A 5BRJA 621PA 3ULKA 1KGSA 1XJ0A 3QEKA 3QKIA 3R4VA 4NCKA 1KRHA 1NSTA 2QUBA 4O8ZA 3B70A 2JRCA 4XLEA 5AVZA 3F5FA 1U6KA 5AIAA 5TEWA 4RY2A 4RTKA 1Y48E 3HNRA 1CB0A 2INGX 3O1JC 3M4ZA 4U2CA 1CZOA 4AY2A 1YL6A 3A31A 1KO1A 1KYYA 1RFGE 1YB7A 3UMVA 3ZI0A 1ISIA 3MFYA 3WS7A 4LC1A 2DFKB 5CLJA 3JQGA 1CJTC 2K7FA 4MGYR 5FLEX 1KEUA 3CUKA 3ROEA 4AKHA 1MB3A 3BXGA 1T2CA 3BGIA 4LBZA 5KVVA 4F3KA 2ZVJA 3TLCA 1E59A 4I4CA 2GX6A 5IX8A 5DDIP 3UT5B 3T52A 3WGVA 1ZP6A 5EZ6B 5M29A 2GBGA 2GYYA 4O4IF 2Q1SA 3OX2A 2Z5LA 3HCAA 2JGRA 4US0R 1E9RA 4FDVA 1DOAA 1KEEB 1RW4A 2QK4A 1UBMS 4FOLA 4XYMA 4Q1EA 2XGMA 3TZKA 4FBMA 1W0KA 1Z17A 1SXJB 3K0AB 3NTUA 1F20A 2PAFA 3C87A 4OQFA 3H86A 1SMKA 3ITNA 2VHJA 2QRQA 1DIOB 1JIQA 2EX1A 1MAUA 1PR2A 4H18A 5IW8A 4RIIA 2F43A 4QT0A 1FXUA 1J8VA 2OSBA 3QMVA 3V8BA 1O08A 4KPGA 2HXYA 2HJWA 4TTIA 1OR8A 2HF7A 3O0TA 1LX7A 4LSZA 3I8SA 4X8MA 3UGQA 4EZBA 1TYCA 5LSAA 1ADYA 1IDOA 1T5SA 2CLSA 2WYWA 2PV0A 4LQCA 2F90A 1DXHA 3DT6A 1SH7A 5EXEA 3KR9A 2DLCX 3NAGA 1H9AA 1NVXQ 1UZLA 2ZUVA 5A88A 1A97A 1YE3A 3DJFA 3H97A 1U0OC 3TFWA 4DCTA 4DN6A 4CM8A 2XDQB 2QX7A 1VG0B 4CTOA 3K0SA 5BW8A 2VSNA 2D2XA 1B1AA 5F9FA 3EMDA 1EFHA 3MT8A 2H1LA 3SBOA 3O21A 1VHDA 2FGJA 3BE6A 2P5TB 3U40A 2JI4A 1EEHA 1BCSA 2HWWA 3CV3A 3DWIA 4NK5A 4WECA 3EEIA 3EA4A 4Z4WA 2PT9A 3G0GA 4DS3A 4B7XA 2CUTA 2R1TB 2CUKA 1YZHA 4OQQA 3QUQA 3H11B 5CD1A 3JTEA 4UBNA 4F5WA 5F4OA 4D9GA 1YACA 2E6UX 2XMCA 3DBOB 4LGMA 5JROA 5TT1A 2GETA 4YAWA 1XEXA 3BZBA 5F1OA 1QC5B 2GUWA 4M4SA 4ATNA 4FYMA 4HY3A 2G0AA 2WHYA 3P5BA 4G24A 1OFUA 4J0FA 3TOXA 1KAHA 4I66A 2PUFA 1N2HA 1NQXA 3INGA 2ZRLA 1EXDA 3ZZUA 5K4HA 3R9WA 1YS7A 2YHSA 2FPSA 2VJAA 4PBRA 4F71A 1LB1B 2HSEA 5JSQA 4FFRA 1VF7A 1CQXA 3T3PB 2V6JA 3OZIA 1NR7A 2J3KA 3AKCA 2P6MA 1N0HA 3JWEA 1ICIA 1OYWA 5EGSA 5F21A 2HRRA 3EIUA 4X97A 4RTMA 10MHA 4KN8A 4PFKA 1KI6B 4E1AA 2BFNA 4RVOA 3TYXA 3V8MA 3L6DA 2B6HA 2ZVQX 4Q1FA 4E6EA 4MIEA 2ZRPA 2J6CA 3BCHA 3QKTA 2X0KA 2G07A 4NV0A 5IM4A 4I55B 4GGMX 1G21E 2QVBA 3ICCA 5H82A 2JFQA 4KO4S 4OQEA 1JSRA 3WLNA 1U63A 2EFYA 3LTEA 3IO5A 1W4RA 2O5RA 5A02A 1V5GA 1K8ZB 3Q1LA 2HMVA 5C46F 3U4QB 3RS0A 4BGIA 1H6AA 4YA6A 3SC6A 4MUEA 1VG8A 2PX5A 4EQ6B 1QIIA 4TXMA 5F76A 4BZWA 1PZEA 3PT5A 3TZQA 5HQTA 2EZ8A 1P81A 2DECA 2DE0X 1QRUA 2QX6A 1N2SA 3L8MA 4OF4A 4Q1CA 3DDYA 4X7DA 1SZDA 2HIHA 3GF4A 2RJNA 3GJTA 3OQBA 5PNTA 1JAZA 3TRDA 4EARA 5CYOA 2ATCA 2ZUCA 3CW2A 4HJXA 3PQ6A 3TPCA 4B6QA 1X7DA 1NWCA 1IHPA 1GRNA 1YI0A 5ESWA 4TZ6A 5KTSA 1D2HA 1VLJA 4P98A 3WK8A 4AG6A 1FYWA 5ABPA 3CMCO 2HRBA 1QZTA 1XFAA 4YCMA 1VCMA 3IEXA 5EP4A 1UINA 3HABA 1FFGA 1GGFA 1P19A 1GPH1 3VV2A 5ICEA 1UPCA 4YMGA 5J23A 4WINA 2FG5A 4KUGA 4MQEB 4KQMA 2BFEA 4JEIA 1T2DA 4Z4SA 1KARA 3P9NA 3R5XA 3ANSA 2RG7A 3QKRB 5C35A 3ZLTA 3E70C 3LO5A 2ECFA 4HYEA 2RGEA 3I9OA 4C3ZA 3DV0A 1NZFA 4P3OA 1V8FA 4MUMA 2EDAA 2R0QC 5KNLA 5F7OA 1E7QA 2YYSA 3EFBA 3LYHA 2A5DA 1EP2B 1M6YA 4I1SA 3FVQA 4HSGA 5E3IA 2JLYA 4AC9A 4IMRA 1E3XA 2Y92A 1EM8A 4RY8A 1GDDA 2DFPA 1HX7A 2XNDD 1JECA 1Z6YA 2OBMA 1UKVY 1ZK4A 1CVIA 4IHAA 1LY1A 2BY4A 3SI7A 3VYSB 5AVKA 1G8GA 1UKZA 2XNJA 1Y7IA 5IDWA 1YFJA 1ADCA 1W4ZA 4CDNA 5BSHA 1MLDA 5AVJA 3FAZA 4LDRA 1MJHA 1UPUA 1QH1A 3IKJA 1YHZA 2FWJA 1N25A 3HJTA 4ESHA 1N6HA 2I2XB 3AJDA 4H1VA 1BWPA 1NF9A 4OHBA 4D98A 1E8MA 4LQLA 1OROA 1XPJA 3ZVMA 3QVKA 2ET6A 5FB3A 2Y1CA 1Q2UA 3FUWA 4CWAA 5CT9A 3QJYA 5IDVA 1R9JA 3ZV6A 4ZVNA 1E9BA 3OZAA 3PKJA 2CLKB 3RW9A 3KXIA 2IHKA 3K96A 4NYIQ 3PDIB 5DISB 5K0BA 4GKJB 2EWVA 1W4LA 1K28D 1KS9A 4H15A 1JA0A 5CW2A 4B5LA 2XRMA 2FMFA 3QPBA 5F5NA 3ZR4B 2RONA 5IAAA 1FYDA 2ZSHA 3P9YA 2IKSA 2OUKA 1KTIA 2YJ5A 5D6OA 1FS6A 1N8KA 1XDUA 3QXGA 2H5IA 4FOPA 2GCIA 3X43A 4DLNA 1P9WA 3DCNA 4L51A 4Z86A 1T9ZA 5GM2A 3UAYA 3G9QA 4KH0A 2Z6BD 1OLSA 4HWTA 3FROA 4PYNA 3WDMA 3C3MA 4GFDA 5DYWA 2WMDA 3KRTA 4S1PA 1HC7A 1GVHA 5JS8A 1AK2A 1M5UA 3R5TA 2V03A 2Z57A 1SVWA 1U7PA 2CEAA 3GUCA 1I2BA 5I48A 4ENVA 5KU7A 2WMOB 4EPWA 3D2AA 1UZAA 1XLTA 1H6DA 4G0ZA 1B41A 1II8A 3V4ZA 5FLXA 3NM4A 1H2HA 3TRIA 2G5GX 3HYLA 5B1SA 1ND6A 3WLQA 4RTQA 1CFZA 1TW3A 2ASEA 3KR1A 1E2UA 5KAMA 4C4RA 5JY1A 4ZREA 3U4DA 3WK6A 1K6IA 3IEUA 2QA5A 4ASUD 3K20A 3VNUA 2WKSA 3NDJA 5EIWA 2HMWA 1BXGB 1Z47A 1UC5B 2BM0A 2O3TA 3A58B 1Z3IX 2XNCA 2JFHA 4Y3UA 3SBEA 1MORA 5CU7A 2AFIB 3PC8A 2CNKA 3AUJB 5CVCA 1VE5A 3H04A 3FUUA 4A0GA 4BXOA 4BNYA 2RJ3A 5HM8A 4UM8B 1US8A 3ANTA 3D6HA 4HQFA 1EK0A 1M2NA 1HETA 2VT6A 3K9LA 1ZOSA 2EL7A 4AS3A 4IMJB 4LDZA 1V45E 4OHWA 1MJ5A 1Y9DA 4JKIA 4E5YA 1EIWA 4M55A 5AHWA 1OJ7A 4DUGD 2PS3A 3RU7A 2CKMA 1SOWA 1OC4A 2OOSA 7REQA 1EE2A 4TMYA 2WJZB 3ABIA 4L72A 4NZZA 3U3OA 3EXIA 1O03A 3VYUB 5AOAA 1G18A 1W2GA 3MJSA 5HFNA 4TGLA 1IQUA 4A0RA 1Z4MA 4ECAA 1GQ2A 3CC7B 3OFNA 4DA4A 4UBMA 5DGIA 3BIWA 1S89A 1ZK2A 5JD4A 3FZNA 3OPVA 4BHTA 4KNWA 4AP9A 4TXNA 4QECA 1S8NA 3AF5A 3CJTA 4JD5A 3EIOA 4QDZA 1GFSA 1JV2B 3Q9SA 4ABYA 1YS2X 2JFPA 4B3TB 1G2IA 1P73A 1XZHA 1ZJ5A 2XZTA 5AKYA 1XJ5A 3V80A 1ZVVA 4ZKDA 2NZXA 1URPA 3HBAA 4GLBA 8GPBA 3ADDA 1U3FA 2I5PO 3JQBC 2ZYAA 4IAOA 1ABBA 5JI2E 4LX8A 1N2IA 3TQRA 4YLGA 1JPVA 1P7VA 1Q95A 3BD6A 4Q48A 1KE2A 5FDFA 2ZRMA 3DMYA 1AZTA 5BV7A 3MS2A 1YI2B 1KVRA 1JDVA 2EARA 3LLVA 2J6HA 4K6HA 4BVJA 4EYGA 5JSUA 3AP2A 4LRTB 1UBFA 3STUA 4CF6A 4OKIA 1WV0A 1MC4A 1XAJA 3FPJA 3Q6QA 1ZVQA 1LBTA 3QI2A 1I7PA 1ESZA 1QYRA 4IH9A 1VKNA 4L07A 3T7EA 1XZAA 2X9GA 5DTMA 4A6DA 5JZBA 2NO0A 4F5DA 3GCGA 3GWZA 1W9MA 2BH2A 3KP1A 1PZFA 1JZSA 4A0QA 5BQXA 4LOKA 4LVOA 1DIGA 4GYWA 3RHSA 1IWBB 1PK8A 2AUMA 1X1TA 4HCJA 2I2AA 1OWLA 4FMDB 4LY9A 1ZQ1A 4PRYA 3QKSB 4BOYA 1QVGB 3A4YA 4PGHA 1IHMA 1L4YA 4WOCA 1NFRA 1YZTA 1KVUA 4QASA 3ZDBA 1S0UA 1PVDA 4DSZA 2QQFA 4GDMA 2C7QA 1YZQA 1FUYB 2CVQA 3GLVA 3AIKA 1D2CA 1U6IA 2VJLA 4Z0TA 1YR8A 3SJBA 3UAGA 4BX3A 1FX1A 1G3QA 1E6LA 1MENA 4ER7A 4OY3A 1R88A 2W2LD 1RC1A 2WMYA 1DJPA 1KEWA 4JYBA 1YDFA 1O7JA 2FQYA 3E9RA 3G8DA 1KQGA 3OFKA 4G4JA 3SDBA 3E03A 1VLMA 1UC4B 3UHJA 1XMSA 5HTOA 3AEKB 2D62A 4YYEA 4CI9A 4UUMA 1Z6XA 5I3ZA 3RBAA 3AUAA 1CPYA 4DQXA 4HAVA 2QZ4A 1IIBA 5AJTA 3GT4A 3HB5X 5EJ9A 3Q8LA 4AY6A 1QB7A 3RIHA 1N5KA 3QW2A 4RLFA 3WLSA 4DJ5X 4Q1BA 3G5TA 1W4CA 1D03A 3IOCA 1M6VB 1XAGA 5C1BA 2XUPA 1U2ZA 2I2WA 2FPOA 5FLYA 2FPXA 1F0NA 3QLVA 4AJEA 1PNRA 3VKWA 3BYZA 1U0GA 2YXDA 4G8BA 4YJHA 4HVCA 4WESB 5BQ5A 1X7WB 2QTNA 2QSUA 1QG2A 2JHGA 3GMTA 1WS6A 2L42A 2P7IA 3L7NA 4MKGA 4MZXA 4PZUA 2IU4A 3KEWA 4ZZ3A 1TO1E 4MCJA 3JARA 3WBBA 4CFZA 4JFAA 2GTHA 5A3RA 1GARA 5ECDA 1Z5OA 5JXWA 5FUVA 2XDQA 1GN8A 2A88A 2WF6A 3R3SA 4AXXA 2H8KA 1GAEO 1U5CA 1QHEA 3AO0B 4O0LA 4OB7A 2FWAA 1VLYA 4RJ2A 4NBRA 1G291 3QPUA 2YJZA 3E3OA 4WL0A 1IJBA 1RR6A 3DZDA 2QGFA 2O8EB 4QVGA 5I45A 3IODA 1PJ7A 1ZUHA 3G6WA 5HIIA 1INLA 3R5KA 1VE6A 2VLBA 4H7KA 1JT9A 1NUAA 1U11A 1T3TA 2NZWA 1Q92A 3IJ5A 1U81A 3T3NA 1DAPA 1PQWA 4G84A 1TZMA 4YCAA 4ZV4A 1XGKA 5J2TF 3IIIA 2BHSA 5EJMA 3ROGA 1UK7A 3VH2A 1JH8A 4FW8A 4E31A 4IVPA 2CFTA 1LPAB 1WQ1R 5KNDH 2A9OA 2P4EA 2YH2A 3OMXA 5G41A 1M2VA 1XUOA 2VUHB 4D02A 2ZUSA 1BOOA 4GW3A 4GC5A 4B4WA 3HYNA 4M0MA 3PUMA 3TDNA 5KAPA 1JDBC 4RAQA 3GLFE 1XQBA 2QEQA 3D0QA 3H5WA 5ALHA 1FU4A 1IZ0A 1GR0A 3EWSA 2WZDA 3OPQA 3NEJA 4QBTA 4RXTA 4QFBA 2DT5A 5L7WA 4IGEA 3DVAB 3BDVA 3LQEA 2ZXHA 4BPRA 1DS6A 1U28A 2FN7A 3LRTA 4IIVA 5E4FA 1SKBA 1XD9A 2Z04A 4W9RA 3JALB 5FV4A 1BAPA 2PZBA 4XRRA 3V5NA 3DXXA 4GE0A 4TLCA 2WHXA 1QUEA 3MGBA 1B14A 4UKDA 3ZW7A 3EOBI 3OPXA 3KOUA 1Y6ZA 3CLTC 5LMNB 4WQMA 3ZX5A 4TKVA 1RPZA 1SCQA 1E60A 1Y3FE 1D2RA 2HDHA 4X92A 5B1YA 3HFJA 4KFUA 2A35A 3I34X 4U9IS 4EA9A 1O4WA 2VBSA 1BWRA 5IXYA 1EA7A 1RKXA 4N8EA 3D3WB 4AG5A 3G3EA 1U7UA 3GFGA 2YFKA 5CXSA 2JHPA 3WMEA 1F0YA 4NF2A 4BFLA 4Q7EA 3EPHA 3WGUA 1IEVA 2NO7A 5KQMA 1RC0A 3O9ZA 2BT4A 3D2LA 2Y3IA 3C3JA 1NYTA 4RUKA 2AE2A 2HADA 3CE6A 2HEGA 2AHRA 4FIZA 3HCRA 2YBDA 3PXXA 3QNMA 4R2XA 1J6UA 2OFOA 3ADPA 3I04A 4GVPA 2OWDA 4QQRA 1PR4A 1DAGA 1W0JD 3NU1A 4HK4A 4EHFA 3FTNA 2C42A 2HUPA 3UB2A 1GAQA 3VA7A 1LVGA 2CVFA 1GPMA 5LZ5A 1RIFA 1S7GA 1E5DA 4MV1A 5KOJA 5TNXA 2ATVA 3JASA 3FPBA 4QU8A 4RHYA 4BFSA 3IBSA 3PA6A 4RTLA 1XXHB 1M0EA 2CYBA 1OXKB 5LJLA 4DSOA 4IV5A 4NZMA 1CY1A 3NXSA 4OAQA 4OI4A 4PSCA 4UFNA 5BNIA 3NEPX 5LYJF 1C2TA 1KXZA 1KH1A 3ZGZA 1P31A 3RRNA 4N0DA 2PL5A 2PM8A 2VBGA 2ZZKA 3GUZA 3ZIUA 1YQGA 4IH4A 3O8NA 3CEJA 4GXRA 2PZGA 4Q66C 4S05A 4N03A 3WC4A 2A58A 2VF4X 1XWWA 3NC1C 3AR6A 5A89A 1KEZA 4YMHA 1PDOA 2FR8A 1IZ7A 2UYGA 1FDOA 3BMXA 2ZTGA 2JZCA 2WD8A 4ISBA 2D5BA 3B85A 3QEAZ 1F2TA 3E9DA 5DPMA 3BCDA 2G4LA 3HVIA 1NBME 2HTEA 2EQBA 2W98A 3A6ZA 3A35A 1GA4A 2V6MA 1LZLA 3R0JA 3QELB 1DCMA 4NCIA 2XVMA 2Z08A 1EI9A 1XCPA 4FYHA 3RVPA 4CG3A 2QGZA 4ERNA 1GZ6A 2C5EA 2OENG 3WL5A 2D8MA 1TYDE 3C4QA 4C29A 3FGNA 2YW2A 1P9NA 1I1NA 3B52X 2IYQA 4U1RA 4CCAA 2NV4A 1UBGA 3TK1A 4DLZA 4S1WA 2WSYB 3HR8A 2QT1A 3HRKA 4F96A 3RC9A 3LL7A 2BE9A 4MGIR 4ON9A 4YCLA 3ZE1B 3L5OA 4KIGA 1L5HA 3TECE 1R0WA 2OG2A 1YA6A 4QOIA 1V8PA 4DUPA 1JTEA 4RACA 3O7WA 3DE6X 3SQNA 2G9QA 4URFA 1SHLA 3VMMA 2CMHA 1OAOC 3BK2A 1CY4A 1GEEA 3NHKA 4MLDA 3U62A 4R9UC 3MCZA 5L6MB 2JFZA 4MHTA 4L9AA 2WKPA 3UYKA 2DFDA 2ZYUX 4NMMA 3AU8A 3RV4A 3DMNA 2CBXA 2YX1A 3JD1A 1J22A 2QPTA 4MWDA 4A73A 4B2YA 4ZMRA 5JMOA 4P1VA 3D6VA 1A8IA 2GPJA 3UJPA 3F3MA 1N3YA 3MMPA 9ABPA 1UMKA 1ANKA 1Y3CE 2OQ2A 3Q7SA 3D3QA 4J43A 1VPTA 3W0LB 4AO7A 2NZ2A 2YKGA 2IYRA 4F2HA 2QGGA 2PWBA 2ZSFA 4XARA 1ML3A 3PR3A 1JXMA 1RQXA 3FDXA 3U48A 3EMBA 1EVEA 1FDVA 4C5AA 4DUGA 5J2TB 1HM5A 1GO2A 5CBKA 3E1GA 3OCVA 3SOPA 3TZ6A 2WG2A 1HL3A 1QO7A 1Q7EA 1D6NA 3GARA 3N2YA 5MF6A 4JELA 1C1HA 3AEQA 2DPMA 1RAAA 2DBQA 5DSTA 2WFMA 1EXMA 1GCGA 4NX2A 3SICE 3ZY5A 4Z1OA 4MLZA 4IXTA 3U5TA 4XOIA 1XPRA 2Q5HA 2OTJB 1BXRB 1VXOA 1YQWA 1YHYA 3L8GA 3GFQA 3OX3A 5HJ5A 1U5AA 1QTQA 4KR6A 4M53A 2I34A 3ISXA 1WWKA 2FHSA 2XQKA 5EQTA 1HT3A 4OA5A 2WMNB 3LOPA 3EW9A 3HY3A 1HYEA 4DDKA 2WTAA 1EVIA 5AW0A 5B2ZA 1QZXA 3IGFA 3PU6A 3ZDDA 3K5WA 4C4YA 3PUYA 4YJGB 1N6IA 4NCAA 1E0SA 1U8YA 3V4SA 2RAVA 5D3MB 1HY3A 5ALZA 2ZCJA 4HWGA 4QVJA 3A1NA 1EZ4A 1AY0A 1N7GA 4KNVA 1VZ3A 5CIWA 3VR5A 1HDCA 2ORED 2PRIA 3WZMA 5GZ6A 1VQ8B 2I4TA 1I36A 2VJJA 1DT3A 4HAYA 4PTLA 4OGWA 2RB4A 2P9QA 3VGJA 4C05A 2GXAA 3THYB 3HSKA 3AH8A 4RD4A 5K5EA 1TT7A 1VLVA 1QIKA 3SHOA 1SCKA 3MJDA 3GP5A 4E7OA 4LHYA 1DQZA 4D8UA 4AECA 4E3ZA 2AWNA 3ROMA 2YWRA 3IPLA 2P3OA 5A4DA 2CE2X 2O7VA 1VHOA 4L2IB 3DAHA 4DABA 2M2IA 1KSJA 4QGHA 1H65A 4TVOA 5COBA 2AZ4A 2WHEA 4BNDA 4BYGA 1Z0AA 3I72A 1YCFA 3I9V6 3WYNA 1EBUA 2RB5A 3TFQA 4D42A 1TRHA 3MLEA 2F3RA 5IM4F 3CF4G 1BS1A 3EZFA 3W2EA 3JARB 1KO7A 1Q0LA 1E2QA 2Z09A 2WKRA 1I24A 5TRDA 5BWCA 3PX2A 3QVSA 1TTQB 2ZROA 3WGJA 3HZOA 3CA8A 2UVQA 1VL1A 5ILGA 4AW9A 2CJWA 5B7QA 1QP0A 2H2WA 4YEDA 3IDOA 2QRNA 1F12A 4FMCB 5G0WA 1IN8A 1N2CB 3VYVA 5EP2A 1UCFA 3EIQA 2OKCA 2VTBB 5BRNA 4MITA 2JLSA 1CZNA 4XPIA 2XYGA 3ST7A 5DX0A 5KQLA 1HGXA 5LVAA 2BISA 4YJKA 2XPCA 3ETJA 2NX2A 2VAMA 1COWD 2Q9UA 3MWDB 5CNMA 1MA3A 1WHTB 1FFXA 3UNXA 4AVZA 2C7PA 1O9GA 1U3VA 4KE7A 2IXEA 1YVUA 3OU6A 2OL4A 2GJ8A 2QNBA 4OHYA 5LLTA 3FFBA 3CCEB 1TEVA 4OSEA 5CA1A 3HO1A 1UDRA 3DYIA 1HURA 2RHBA 1A9XB 3B9QA 3SN6A 1JMVA 4MVJI 3VSBA 3C97A 4IMIB 3T9FA 1XXLA 3EN0A 1CUDA 2JGIA 4XDGA 2GH1A 2EEZA 3DGEC 4CQJA 3EVDA 4WK0B 1L4BA 2Q5CA 5TMEA 1JEAA 1VL6A 2HCJB 5GMOA 4XRGA 4F2PA 1KIMA 1ZHFA 3L05A 4BASA 2AMVA 1V1JA 5DE3A 3PQ8A 3ZQUA 4R2HA 5JECA 4HDSB 4PCLA 1PYDA 5HW0A 2QBYA 1N33B 3OE5A 3WJ7A 5ITZA 1J24A 1PQ4A 4DDVA 1ZHOA 5CUQA 1RYHA 2QSJA 5CLQA 1UXIA 1KERA 1JIKA 1RZ3A 1P2GA 2P2SA 5DYTA 4IZHA 3S2EA 5K45A 2AEMA 2J31A 2J33A 4C22A 2EZ4A 1A9RA 2MSKA 4LGVA 3LIIA 3MPOA 4R16A 4K40A 4X84A 3LD9A 3UO8B 5C18A 1Z7WA 4EPTA 4I3GA 3GB9A 3IDSA 2QD1A 4QGSA 3DOUA 3RFXA 5JATA 1XA4A 4QTYA 1HT1E 1PW7A 3ET5A 2I1VB 3CX3A 2BKLA 2DVMA 4W5WA 3C5WP 1E2EA 1XDZA 2JD0A 3ZD8A 1Q0ZA 3BGDA 3MTAA 4K6FA 3WO1A 2V0NA 4OJTA 3NNNA 4AJ9A 4PQRA 2DJIA 1DX4A 2PTGA 3A4TA 4H77A 3OG9A 4JSRA 4G2TA 3TNDA 4BBZA 4QGAA 2VH1A 2VHZA 3LF1A 2R3SA 4KKTA 4GD3Q 4KLNA 4PNEA 1SHJA 3II6X 3RYFB 3S29A 3BKWA 3LHDA 1AS0A 2RAFA 2ZE5A 5TMDA 1GITA 5HRUA 4Z4GA 3E7FA 2H1OA 4QRIA 3WYDA 2HPHA 1NJ1A 1OZGA 4P9NA 4D4IA 3AUSA 3ILVA 1ATZA 3L46A 4HBGA 4JJIA 1ZWKA 5JZVA 1XD8A 3IXLA 3BJZA 2C00A 2G8NA 2JI6A 3DV2A 3PQ4A 1GADO 3R5HA 1IH8A 1IJKA 3FPAA 2IXDA 1NV9A 5FIUA 2D06A 1FRVA 2RAPA 4J94A 1NQOA 2PBFA 5ERXA 2IXBA 3QF4B 1XU7A 4HV4A 4L8YA 2GD6A 4GPIB 4JR1A 2PNFA 5FOXA 3TR0A 1JHPA 1FTGA 2CV0A 1N5DA 3PYLA 2I8AA 4OAPA 4S04A 1BE8A 4CJXA 2J30A 2JGJA 4YUAA 4FZJA 4GU5A 4FOTA 2GM4A 2J0SA 3WYCA 3CTPA 4AF7A 3NHPA 3BWDD 3PFBA 1SVUA 2RARA 2VJPA 3TQQA 4CLOA 1CDDA 1CIPA 3MINB 3DXZA 4J0EA 4KB5A 2OE2A 4J6FA 2KB0A 3TNLA 4ER5A 2PLNA 3F71A 1NLYA 3DVLA 4FQ5A 3DMFA 5BN5A 2O8FA 3GP8A 2YN0A 5ARCA 2EF1A 1VECA 3PGLA 3ISVA 3CZ9A 3CURA 3COSA 4CKEA 4YEJA 4NV3A 1DT5A 1MVLA 5ALQA 3IKLA 5TXGA 2FRXA 4KRXA 1RYMA 2BE7A 2JIBA 1MNQA 3KFVA 4X63A 1N0VC 1LI4A 2EKDA 2G9VA 4PYMA 4CF5A 1U2SA 3IL2A 5E3HA 5EPEA 4EA6A 1RAHA 2R6FA 2X4DA 3DKVA 3D3EA 4PSAA 2UKDA 2XTZA 2FW6A 4F1JA 4S0XA 5A6SA 3KT6A 1DIRA 3UA3A 1Q50A 1FFBA 4C7OA 3N59A 1X3LA 4OPOA 3T34A 4P26A 3P9RA 4NHEA 2O54A 2PKXA 4P7BA 3WK7A 2GR9A 4RMIA 1ZNYA 2Y66A 1FTWA 5JXJA 4JLKA 1OU4A 1RPNA 1SCAA 5C32A 4ZALA 1DJLA 1XMVA 3BMCA 4JL6A 3STYA 3WKAA 3EASA 1YRAA 4D6PA 1EDOA 1WNTA 3MMXA 4KJXA 2NWQA 1CE8B 2ZUWA 4ODIA 5K0LA 1Y82A 3TL6A 4PW0A 2HWXA 2WYUA 3DCYA 1HSOA 1ZL2A 3ZU2A 4I8DA 1ISPA 2DPLA 3DE1X 1SY7A 2YJTD 2YVQA 1HNWB 5IF9A 1OX4A 5BNZA 1ULHA 1AJEA 2WINI 1T6NA 4OQNA 1AT1A 4G0UA 3T6KA 1ZQ9A 3LL4A 1DQRA 2QJRA 4DG5A 2FSIA 2MYPA 4WEQA 3AF3A 4HADA 3ETGA 3KU1A 3ZYCA 4JP3A 5HS4A 2G1PA 2O5EA 1DTWB 2AN5A 4F0JA 4FLEA 1ECGA 4YACA 1P2TA 1THMA 4WWHA 3GT7A 1E1RD 1UBJS 2FYTA 1BQ4A 1RKUA 3CE9A 3UHOA 1M7HA 1G5TA 3GZTB 3WDKA 3BIFA 1P4RA 3ORFA 4N39A 1X70A 4CKWB 3LF2A 4ITUA 1P5FA 4OLJA 4ZDWA 3P0JA 5DO9A 5H3LA 2YW9A 3N7AA 2BZGA 3FNIA 3BJMA 1E1NA 2P65A 2XTNA 4X64B 1FBTA 4TN1A 1QHGA 2PX2A 5F5LA 5HBRA 2DY1A 1I9GA 3H2JA 1SVLA 4DR3B 3RQSA 2FVYA 2XEDA 2SKCA 4QOHA 2WKQA 3Q10A 4E6PA 5LCXA 4FFWA 1ZS9A 1AXGA 2E37A 3B1YA 1RS0A 2C9MA 3THXA 2CKDA 5FOUA 3SHFA 3GYGA 5FI5A 3UFXA 1VTKA 2M1ZA 3ZE2B 4U7DA 3OKFA 3NBKA 4KG7A 1XWFA 5E0OA 2JAXA 2PLAA 1ZA2A 1GKLA 3CF6R 3UMSA 1ODKA 3P4XA 1T5OA 1T5HX 1EU1A 4MK4A 1DAKA 4LRSB 2ZPUA 4RKFA 4HWSA 2R1VB 1KETA 3Q7QA 4NS1A 4HLCA 1B8UA 1SHZA 5CH8A 2CN1A 4XYGA 1N9KA 1J2YA 1PR9A 4X1YB 2EFHB 1D2GA 2FLKA 2JCYA 2PJZA 4UHDA 2CJPA 2DHDA 3K5IA 5I7RA 5JD5A 4QFMA 5F4JA 1I01A 1Q7YD 1OLUB 2W6NA 2GEBA 3D26A 2VZ0A 4IIJA 4NNJA 4JHLA 7YASA 4WHMA 3BB4A 4FU0A 4BU1A 4EG5A 2J32A 4AJPA 1OXXK 3HTXA 2ZBUA 1W94A 2AGVA 1LH0A 4F60A 1HK7A 1LU9A 1QLHA 5CA1B 2ST1A 2A5GA 3KPVA 5BOVA 3ECAA 1O6BA 4FYIA 2X3FA 4CNBA 1JHVA 2BR4A 2CLMB 3I42A 1FFXB 2DAPA 1FFEA 2PIDA 5A3SA 1JAHA 4CKYA 1P6QA 1JYFA 1I2ZA 5TQ0A 2PRSA 3S40A 3VR3D 4L8JA 1NMZA 1RM4A 4XM3A 2OHJA 4MCAA 5M2QA 3W4IA 1H05A 3WGYA 1WCV1 3NBMA 5CDTA 5I4BA 2IIQA 2EAUA 4PYQA 4RZXA 1V5FA 4D0NA 3LXMA 4K0RA 1D6MA 1X1BA 4YUXA 5KYWA 4W9MC 4J7CA 4XVQA 2PUBA 3HXKA 1BTOA 2FP4A 2QAIA 2JAWA 4NU8X 3H11A 4DHEA 2B2XA 2GWHA 2O5VA 3A6HA 3QA9A 3R3UA 4YT8A 1PWZA 2ZXIA 2YMPA 1NHGA 4BMVA 2R25B 1C8BA 3DNPA 2GBPA 2O6HA 1JQLB 1QG0A 5CJ2A 4Q3AA 4B6FA 1CEEA 2QDKA 3T5PA 5SYNA 1QFZA 1N57A 3WB9A 1K3TA 1HBJA 4ZVQA 1AUXA 4HQNA 4PO1A 3FKQA 3I6YA 1WCIB 4FS8A 3UMGA 2UYHA 5KYGA 3HXOA 2JHAA 1JG7A 2JFUA 4OYHA 5LZ8A 1VI5A 4WSOA 2ZZMA 2X6QA 2N42A 4NOLA 5IXJA 2OB2A 1L7MA 2RGRA 1SCUB 3IBTA 2XNHA 1NVMB 3TNYA 2XQVA 2OCYC 4Y1FA 5JD3A 1YAHA 3Q87B 1OX6A 1GGHA 2GNPA 3GMIA 3IT0A 4MS4A 2JFBA 2HSDA 1A9QA 3GRUA 4M7PA 5AKJA 5EKDA 5LLDA 2WG0A 2WU0A 4L4YA 5THKA 4I9NA 1KJ8A 2ZAMA 4DF3A 1HEUA 2JJ8A 3LGXA 4GSKA 3SF0A 4JI0B 4IDOA 1O4VA 2XXJA 3W3AD 1FSPA 4KWEA 1FLNA 2PJUA 3EOZA 3L0CA 4QO7A 4RJKA 4W9NC 4UUBA 3F73A 1A5SB 2NZUG 2H06A 1B3RA 1Q0QA 4YJHB 5FNVA 5D3MA 5FOSA 3WL6A 1J7JA 3ZKWB 5IDQA 3KHUA 2XBMA 4QLOA 4YJGA 3ITDA 2YQ4A 5ITSA 3ROQA 4V0MA 3ZE9A 3D1VA 1CB7A 2FDCA 1KZLA 4RHEA 5IT5A 4F6RA 5BYBA 4B4UA 1RKVA 3LT0A 1JKJB 1KAMA 1Y3BE 3OOYA 4LVUA 5IVIA 3RUAA 1YOVA 3WVNA 2FUKA 3ML1A 4HEJA 3ZWXA 1S3FA 1P2FA 4R83A 1KVQA 3U4CA 5CFOA 3L7DA 2H9AA 5KYNA 4KN5A 4Q12A 3FOAA 1JFSA 4CMEC 4PLCA 2P67A 4C0BA 4INOA 2IYFA 5F4MA 2HMTA 3HCFA 4HF7A 4UXJA 2O20A 2HLDA 3MYRA 1NY6A 3SEZA 1AB5A 2X7XA 1W48A 3E58A 4QNMA 4PXAA 1BMDA 3ZY2A 1A9YA 5I7UA 1XZ8A 3Q9UA 3OU7A 1MDBA 1NF8A 2VVTA 3PHHA 4GLOA 4OQZA 3UMBA 5A2GA 4RPIA 4F21A 4JMLA 1G4AE 3Q39A 1YU6A 1VGQA 2Y1KA 4Q37A 4QYWA 1L5LA 1GZ7A 5HKBA 3X1ZA 4W7SA 1YHNA 2JJ2A 1AK9A 1TX4B 4F8YA 5JQGB 5GY7A 4H9GA 2XCSB 4LXTA 4OHXA 3KK0A 4G07A 1LNZA 2CHVA 2HSZA 4JYPA 5ICMA 2NYRA 2FV8A 1EDDA 1GPBA 5E1OA 3ZWQA 2WUEA 1QIFA 3HYTA 4AN1A 1G8MA 2MSWA 1ZRMA 5IJ9B 1TOAA 2J0UA 3ZCXA 4B1FA 4X3PA 3DZGA 1NT2A 3A4MA 3HUTA 4LXQA 3B5IA 1YUBA 3NBUA 3O3OB 5A9TA 1OFVA 1Q3TA 2G7MC 4JUBA 4PIMA 4XX1A 2R8ZA 3MCVA 1I1QB 4JYCA 1RJFA 2VZEA 2REOA 1X2EA 1DRUA 4U7GA 4BUZA 2AVNA 1ZW6A 3H7IA 3KZNA 3SYNA 1TJ3A 1IVNA 1ZSNA 3W2TA 4AZWA 3QVMA 1ZKDA 3D6MA 1GN9A 4D8XA 2VHVA 4N6GA 4CKCB 3I4LA 1WCXA 2A0WA 2XKJE 4TS3A 1M10A 4CQLB 2FI1A 4MB2A 1R8YA 2G40A 2G71A 1IIRA 1YJWB 4FJ2A 1SEVA 4H0NA 3ZD9A 5LQMA 1BFDA 2Z6AA 4JJKA 2R7LA 1AQUA 2EJUA 2W6OA 5AQEA 2ZRNA 5F3WB 3DTNA 2IYPA 4PSDA 1AF4A 4LRXA 1YJXA 4B0OA 1AE1A 1IBLB 1D0SA 4XL9A 1Q74A 1XTPA 2DQ4A 2ID8A 5JZSA 1P6XA 2HO5A 2QN7A 2J8ZA 4X45A 2JZOA 2JI9A 3ESAA 3P0RA 5CB4A 3OTOB 1Y6FA 2WJ4A 4HH3C 4I36A 4D74A 4OHVA 4TXLA 1QVVA 4FXPA 1N75A 3NW9A 1A8SA 1MQSA 1QHHB 1WULS 3GGCA 2V7BA 3H4VA 3T7RA 1R6UA 3W1WA 4P58A 5JQGF 5CJJA 5L45A 2RHHA 3QKWA 5L4NA 1MABA 5DW3A 5TR9A 1UDAA 2JIZD 3T7SA 5KOHB 3RSFA 4ZOLF 4J0DA 3OZRA 4JI1B 1ABFA 1UKBA 3ZDAA 5EKTA 1QKKA 1UBHS 2CWDA 4DE5A 2WB2A 3DLPX 1HYGA 4BMZA 1PJBA 3OPMA 4XD7D 1UOOA 1RJWA 3OQNA 1XI2A 2BHLA 3VTFA 1TYBE 3OTIA 4DA6A 1I7QB 3PENA 1WW3A 3RJMA 1WXDA 1O95A 3QBDA 3ZKAA 3U2QA 2GCGA 3AUFA 4HPJB 3P96A 1XDDA 5LZ2A 4BNUA 3EIXA 5EJ6A 2B4AA 3RYIA 4KQKA 1ZWLA 4DR2B 3LS2A 2RGYA 3KQVA 5DX1A 4BLOA 1EUCB 3L01A 4YYZA 2V9PA 4YRMA 4LDAA 4D56A 4MVJG 5DOZA 4WEOA 1UZNA 1VPVA 5B7PA 1KKMA 2B69A 2Z8ZA 4R6WA 1BXGA 4PR3A 1CQJA 3VV3A 3WIDA 4EM6A 1EFTA 4W9NA 1ZR2A 3ZDCA 3LGAA 4X94A 4S1OA 3GFTA 1SBYA 4RKQA 3U7RA 4JZYA 1XTRA 4NFYA 3KT0A 2PUTA 4PZYA 4OLFA 2A1UB 1QVAA 3LC7O 4KSCA 4OXXA 2I4MA 4QVKA 3UCEA 1MX1A 3EHEA 1O6GA 2WJ6A 1QKJA 4RMGA 1C0IA 2W71A 1NR1A 1H42A 1YDMA 4H7DA 4G8DA 2CLDX 3Q5GA 2C29D 4IO0A 4XUGB 5DM1A 3OFSA 5EWJB 4XIYA 3GLIE 4ZYXA 4MGHA 3WIEA 1V9SA 3JQ9A 4YCNA 2RAUA 3ELDA 4YELA 5HNKA 2CMKA 2ILTA 1DC8A 4KR0A 5JCZA 5JXIA 1P7ZA 3P9ZA 4PU0A 2C78A 2RC5A 1CUZA 1O58A 1SC6A 1A7AA 1WD5A 2EGUA 2I67A 2BJVA 3G6KA 1E2IA 3LFUA 2OGWA 1N1DA 5TPWB 4P3NA 1FRZA 2YHAA 4IW3B 3KDPA 4DNFA 1A4IA 3RKUA 2FPIB 3KSAC 2QN6A 4LV6A 1RE0A 4AL4A 2PRJA 1K7EB 4HNAA 5A9RA 2AOXA 1VCIA 3UIEA 3W4KA 4Q3NA 4EHIA 5EN4A 2D5IA 2SHKA 3KC2A 4F2GA 2XCOA 4UDXX 4M3NA 4AQYB 1KPIA 3NQ41 2B78A 3UMFA 4QT4A 4ZJYA 5B12A 5C8VA 2PUEA 3DZKA 4G5FA 5EE9A 3LVBA 1FC0A 2WSMA 2YICA 5B1EA 3MMZA 1NL3A 4EHLA 1OSNA 2JIOA 4DLLA 1PZXA 2HWUA 3P9PA 4D96A 1CFJA 2J3IA 3CPSA 3KQWA 4FUTA 1A8PA 3TJMA 1J1UA 2R8BA 1KZYC 3KSDO 1N7IA 2LBPA 1A5ZA 5IT0A 2P1DA 1ZCZA 3KQMA 4PIVA 1VJGA 4WKCA 3OCJA 2YV3A 1VDZA 1IN6A 1Q5PA 1WX1A 2BEUA 1O2DA 4TMFA 2IKQA 5DKFA 1EB9A 2XWQA 5DM60 4YR7A 2GKOA 3G1TA 1DKRA 4QVIA 2E4UA 1EWQA 1C8LA 1DO2A 2P27A 2PMCA 2FSGA 2WE8A 4BO4A 5A3JA 5C3UA 2X9NA 4RVUA 2GCPA 4XIJA 1J5EB 3S70A 3IT1A 4XE5A 3OX1A 4GOMD 3V8NA 3IQGX 2KM1A 4IOJA 1BW9B 2QG4A 3SP1A 3BMNB 4KLZA 4S2UA 2LD4A 1CSEE 1IG3A 1RM0A 1PKVA 2P3LA 3KOXA 3IMFA 3Q3CA 2A9RA 4AURA 5I7WA 1XPOA 1TMKA 4W5RA 3BSYA 2GHRA 2XVAA 1K6JA 1L7RA 3W1EA 2G6BA 4WXRA 3ZE0B 5BSYA 4C20A 4LC9A 3OURA 1LDMA 4FYWA 1JFVA 5ER6A 1CDOA 2E85A 1CEXA 4JR2A 4DFDA 2I03A 2AYXA 3AYZB 4DCOA 1KDVA 3Q6MA 2CXTA 2HJRA 2Z8YA 4RA9B 5GONF 1YD7A 2DYKA 2WUGA 1ORHA 2Q07A 3HYRA 1DBRA 4CVNA 4Z4CA 3F3SA 3HDVA 1Q7CA 1ATIA 3C0KA 3R9XA 5ARDA 3ETLA 5J3JA 2JGMA 4AWBA 2O3QA 2PEZA 4KXMA 2Q9CA 4FMCF 1XALA 2W11A 4H59A 3E48A 2IHUA 5FJIA 2PFSA 1PNTA 2PZLA 2XE4A 1B4DA 3G79A 3WADA 3LHIA 5FLKA 3WBJA 1OKKA 2EHJA 1AS3A 2E49A 2WZQA 3F5DA 1H1TA 2PKYX 4RTPA 3KAJA 2OD7A 3TMYA 2ERCA 1IEWA 4BWYA 3J80A 4U0JA 221PA 3H9UA 4BPBA 2ONCA 1BJTA 2XB6A 3KEGA 3KZVA 5K3SA 1Z6PA 4EQ6A 1UBSB 1JLRA 3WLJA 2JIDA 5JJLA 7GPBA 4X7PA 2FVXA 1PK7A 1C0PA 2I7XA 1UJMA 5BN4B 4B85A 1SOUA 1J2JA 3MTQA 2I2BA 4CLXA 3JQAB 3ZHYA 3C2QA 1J07A 2A9FA 2I91A 4G4GA 5ULLA 2BSAA 4D3XA 3N58A 3J7AC 3DVSX 3KKPA 4AKEA 4E33A 1DXOA 2P1RA 2P41A 1CULC 2C4KA 2WSIA 2ONZA 2AHOA 4F9GA 3PA1A 1N32B 2EJVA 2WUVA 1IBSA 5EHGA 1EG2A 4HT3B 1RWWA 3ZE7A 2G83A 3R5JA 3HXMA 1SQGA 3TLJA 1JNXX 2FWMX 2EF0A 4BKMA 5FI1B 3R9XB 1QH0A 4WBNF 3SDZA 2DOGA 1X9GA 3PGVA 5EXPA 2EXXA 2C9OA 3LIPA 2RHDA 4IDHA 1S2NA 1XEXB 4JDUA 3D8TA 4MROA 1X1QA 3PD0A 2ZE8A 1D1NA 3SBXA 1CLUA 1Y4AE 2AK3A 5I6DA 3IAS1 2QRLA 3PQ7A 4DXAA 1JHAA 2CJWB 2BIFA 3L8FA 4G3XA 1O9BA 3LAWA 3W5AA 1OFTA 2ZRIA 3RS2A 3QOWA 1M5RA 4X91A 2TMYA 3ECSA 1X0XA 3DL4A 3R3WA 3DL7A 2WIKA 2YOHA 1UT5A 5C8DA 1X1SA 3RBZA 1GZDA 2BBOA 4NBUA 4NG5A 1JIUA 1JEQB 2HCTA 2VF8A 2OCLA 3JAKB 5FPSA 4BV3A 2QPLA 1N0WA 4LWPA 3SZMA 1NUQA 1JE0A 2OTCA 4B3RB 3GCXA 3ZLUA 4HO1X 2WIJA 4TSFA 4MR8B 2C4TA 3DZJA 3TG2A 4BVLA 1P75A 1OWMA 1UP6A 2WOJA 2XW6A 2PFGA 2ZK7A 3CM0A 3EJ6A 1X13A 3EBPA 3G9XA 2LDXA 1KJJA 1KJYA 1Y1QA 3E3MA 4XR9A 4PAAA 2JB9A 5BN5B 3QI7A 1QTRA 2QNIA 3JATB 5SZJA 1RT9A 4EYSA 5ALSA 5GZ1A 5FTJA 7REQB 4JYZA 1M1NB 1GL6A 1ZITA 3K70B 2ZYIA 4YJ2B 1OBCA 2C97A 2OYCA 3D31A 4J2OA 1OC2A 3ZHRA 4E4TA 4ZHSA 1DV2A 1NBIA 5BUSA 5L9AA 3HGQA 2PPLA 3MCTA 5CDHA 1N2XA 2HNKA 4KVGA 4Z4HA 2VUIB 2QE7D 2JKYA 4DC1A 5BSGA 1M0SA 1E3TA 3BMQB 4YHHB 1US8B 1WDKA 1NYRA 1J0AA 1CRPA 1MIOA 2CE7A 3GDOA 1Y7HA 2NXJA 2PT5A 4GMKA 4ZVVA 3NI2A 1ILWA 1TF2A 3FDZA 4M37A 1Y42X 3PHGA 4W5NA 3GRKA 1HDGO 4E11A 3LHKA 3EOAI 1SCBA 4RIHA 2W9XA 2WVAA 2OCDA 3AR2A 1M8KA 4E08A 3BAFA 4K8OA 4LYHA 3LY5A 1O87A 4FDLA 4JCOA 1TVKA 2HA5A 3DULA 3H1BA 3IQZA 4KR7A 1EGHA 4POOA 1WHSB 3K9BA 4RE6A 5JAUA 1IVSA 1OXMA 4U6SA 3ABQB 5CPFA 4GMDA 1I4OA 3OF2A 4NFSA 5JH7A 1C9MA 4BTVA 2VRNA 1QK3A 3GPIA 3NRCA 3TF5A 3RC1A 4YMSA 1RHKA 2Q3HA 3C6ZA 4O08A 1B0ZA 3F1KA 1B6RA 3UH1A 1MX5A 4CV3A 2MSLA 3DFIA 1E7RA 2GNAA 3IBYA 3LPAA 1V8BA 1WIWA 2YCBA 3LZ6A 3I30X 3OZGA 1MG0A 5DIFA 4WN9B 1YNOA 2VYVD 2CMDA 1SOVA 3LC1O 4II2A 3WQZA 1FSFA 2NLOA 2PSFA 4Z4RA 1PX0A 3GMSA 1K98A 4P3YA 4TM7A 3JQBA 4W82A 2IVZA 2BGMA 5ENVA 4MEJA 5BV8A 3BFKA 4YRRA 5LZ9A 3RC8A 3OVMA 3BQJA 1WOSA 5B3JA 1OH7A 2V9CA 1TQ2A 3PUVA 5CT5A 3GGSA 4LVNA 2Q6LA 2ZIWB 1TC1A 4FCWA 3L0ZA 3KELA 2PX3A 3NT2A 2C9DA 2ZJZA 4Y2GA 4UFOA 4MEBA 3EC1A 1Z5VA 1WBJB 2YBEA 4WWVA 5H81A 1TZKA 3Q6IA 1VGRA 1VE1A 3HV2A 1L0BA 2F1OA 1CJCA 2VA8A 3ZCSA 4DIMA 6Q21A 1R9MA 3EPJA 5GJBA 3EMVA 4RAOA 2OXRA 2OECA 3QEJA 5L6LB 1YR1A 1LFDB 4NL4H 2X0NA 5H9WA 3ONFA 5DNAA 1Y4SA 5D6NA 2H4HA 3FSGD 1I7DA 1CS0A 3DCJA 3MWYW 4PRZA 4X8IA 3J81A 4HDMA 3B7WA 3STHA 2AKEA 4ZOQI 5C80A 3T99A 2W6JD 5C9ZA 4OQYA 2XRYA 4CT0A 4AP6A 3EH2A 2R4QA 1ODCA 3UBMA 2COUA 2QXTA 1VFNA 3KS9A 5SV2A 3TSCA 4G1VA 3R7WB 1UJ4A 1W5SA 2QP9X 1GFIA 1KDPA 1XBTA 2BFPA 1QHHA 3QXSA 4HZUB 4ZANA 4JS0A 3BFVA 2O2GA 2XGOA 3IAAA 3IPCA 4DM4A 5HFJA 1YZLA 5EJ7A 5AW9A 1UC8A 3ER9A 2H63A 2ZRDA 4L5AA 5L3SA 1X0VA 1XCMA 5I4CA 1OXVA 1L7QA 3W6NA 3H2BA 1UEJA 1U2GA 2IYTA 1X14A 2J08A 2ZVPX 1BCRA 4AFNA 1EEXB 3ZPNA 1QG6A 2FJPA 4KKXB 2G4CA 3ZBQA 2QB5A 2BM1A 4YJDA 4BTLA 1WMBA 4M0UA 1F6BA 4YRJA 4BVFA 3DV0B 1OV4A 3FYTA 5HKLA 2VAWA 3DUFB 1KR5A 4AJ4A 5CVVA 1Z0DA 3OFJA 4MWEA 3SQXA 5AW4A 1U9CA 4CR6A 5FPTA 2N47A 2XCRB 3ADCA 3QWHA 4EVQA 3W2IA 1KNQA 4CG2A 5C37A 5LIRA 3KUKA 2O48X 3NASA 3O8BA 3PUKA 2UZ3A 2Z5VA 4NZPA 4OL9A 5KOJB 1X1CA 2R86A 3DOOA 2C2WA 5JAPA 3L1HA 1NP7A 1AGNA 4A3SA 3KTFA 3HP7A 1TD1A 4CW7A 4Z51A 3SLRA 4I5FA 5T6MA 2QEXB 1SB9A 2NXCA 4I1PA 1ZCAA 3OCWA 2F9FA 2IDZA 3K8YA 3FHJA 3OPOA 1JXAA 3HJBA 5D5QA 2V7GA 1N4AA 4R98A 3V9AA 1IHUA 4JQYA 2YFQA 4G9BA 1PJLA 3EWNA 2P6NA 3RLFA 2CF6A 3FKSD 3REOA 2W48A 1WMEA 4B48A 2X1LA 2AXPA 4HPWA 1WMDA 1N4DA 1P0PA 4NQRA 1ZKMA 2QA4B 2VRCD 1G2OA 4L75A 3IVAA 1EAMA 1UIRA 3OO1A 4J7UA 2JIPA 1IAVA 3RLIA 1YQQA 3V7UA 4BZXA 4OOXA 4D6XA 2VTKA 5JSHA 5LXTA 2XSZD 4XI9A 4OM7A 5I8WA 5LOVB 1NZDA 2DKFA 3F8WA 2VK8A 3O8QB 3RYCB 1YJ5A 2IK8A 4D9JA 1XNGA 3X1YA 4UM5A 4IGFA 2XCLA 4NBSA 2BEVA 4M9RA 2QT9A 1HNNA 3TUIC 1Y1RA 5H7XA 2J46A 2G9UA 2IU6A 2BJWA 3E53A 4HGRA 2NUTA 2XT6A 4I1RA 1IXYA 2ID7A 4OM8A 4OUKX 3IQEA 5MN4A 3D5EA 3JD2A 2CWWA 3JALA 3LBNA 4L0CA 1RAEA 5AP9A 4DEVA 2O3JA 3LBHA 3FN4A 1I80A 4PZLA 1UXJA 2PQ0A 5DI3A 5EHQA 4E94A 3C98A 2Q3MA 2I4NA 3TI7A 1MIOB 1YIJB 2XD9A 4IOMA 4RM3A 4U5XA 1WMSA 4B3JA 2P77A 3MAAC 2IEBA 2XCIA 3PSAA 3U49A 1XQWA 3D4OA 2I71A 3ROTA 2YMMA 1KMHA 3P9SA 5DWDA 4UD6A 1M2VB 5ADWA 1N06A 2DIEA 1Z6AA 3ZHXA 3IULA 3RAEC 4BGEA 1RSZA 2GEFA 1R3UA 3DUWA 5AVWA 2C61A 4Z53A 1M66A 4RF5A 4EB6A 3QUCA 2C20A 1ZG3A 1E4YA 1YMVA 3GA5A 5D3QA 3V1MA 5BR8B 1YBVA 4Q4HA 5BPHA 1M7BA 1EFRA 1L7VC 2RE8A 4KGDA 2QRZA 1E3IA 4J2HA 3FM9A 3N3AC 4KMRA 4ZCQA 3ZI4A 1NVAA 4M54A 2AN4A 3I52A 4RK7A 1HE8B 3LDUA 4BNWA 4D0GA 1JKXA 1G8PA 2VEDA 3PXCX 4BMOB 4LF4B 4IJ6A 4MVJA 3DOIA 2RK3A 3CCCA 1R8XA 5AVRA 3COVA 3JAKA 3LGSA 3HKCA 1IONA 5BNTA 5C34B 1SHUX 3G8BA 4RJJA 4X24A 1XA3A 4AK9A 2F3QA 4D9HA 1Z36A 2BGWA 1F06A 4K9MA 3AY7A 2BFDA 1X7XB 1QGAA 1PWYE 1Q0TA 1IK6A 1CUGA 4NYJQ 3E5RA 5L4SA 3RNLA 3U0BA 4DWJA 2YHIA 3KXPA 5CX1A 2JD1A 1K92A 3RO7A 3BORA 4P34A 3TINA 4L3VA 2G28A 2PGDA 3R7BA 3UWPA 2JLWA 3HNPA 4HTAA 3H5OA 2ZTSA 3EXHC 3ES9A 3T3GA 4FMPA 2TYSB 5B7GA 5DI3B 4Q4AA 5BO5A 2KBFA 3DC2A 3FOZA 2RGUA 4GRIA 4P36A 3OW2B 1TNDA 4QXMA 3VR2D 4TLMB 2C2OA 2OBYA 2PKRA 5L40A 2ERXA 1AF7A 4A7PA 4PS0A 3QY9A 1R1DA 4RJIA 1ST2A 2DHRA 4CMJA 2VF2A 4RHXA 3ILXA 3MILA 1Z3CA 2A1IA 2QLBA 3D1LA 5H9VA 4BRZA 5I7HA 4RNCA 3JQAA 4RQUA 3RRZA 4D1YA 2I0FA 2QMYA 4FJ1A 1ETHA 3GXBA 4XZ3A 5HF6A 1JKMA 3C8DA 2GXSA 3HC7A 3PUZA 4S35A 3AZOA 4LE2A 5HKKD 5KSOA 1Y63A 5IKMA 1RJDA 1R64A 2WAAA 2I7CA 2OV3A 3R3HA 2QRMA 1Q7BA 3TAUA 3MHTA 5JCJA 4M8LA 3R40A 2QLTA 1FYXA 5TS3A 1G20B 5GQSA 2MR5A 3VM6A 1WV1A 4NH0A 3WGOA 1DKQA 3P26A 4Y2RA 4EELA 3TD2A 1NFQA 4EYEA 5G1NA 3FTFA 3IAHA 3WLHA 1SQ0A 3CQ9A 4LHSA 1H85A 2REQA 4OFZA 4KHPB 4RWZA 3RT7A 1B00A 4DWWA 5LIPA 3E35A 4LXYA 2OUIA 4O4JF 1JWBB 2WOOA 1BMQA 1KI2A 2EZTA 2K2QB 4IDFA 1EB8A 3B12A 4PIPA 4RA9A 2OAQ1 1LPBB 3AGPA 3NHBA 2CDAA 3JYOA 4J16A 4Q05A 3ZY6A 4DA8A 5JO9A 4QXQA 4B17A 4PRKA 3K0FA 2HNAA 1U2TA 1YC2A 3O5AA 2BBTA 2YYYA 2M6KA 3WNQA 1TADA 3GIWA 4IDPA 2JH9A 3D3KA 4DRXA 4ADSG 4JK3A 3EEFA 3E9CA 3C85A 4HNRA 3FVVA 4PICA 3O1HB 5F1KA 3B3AA 4W8OA 3KEOA 4JLVA 4B6JA 1YE5A 5I9TA 3PVSA 1SVKA 8AT1A 5KOIA 1PT6A 4FGZA 4X71A 1D0VA 1ZRNA 3RYTC 4F93B 3HHEA 4OP1A 4EJSB 2ES4A 1Z4JA 4HX5A 1J8DA 1IXZA 3VOTA 4PAWA 4RO0A 3ETHA 1KTVA 2O0MA 3H2KA 3OWXA 1EK2A 4J9UE 3A8TA 1E7YA 1HH4A 3MJRA 4LFCB 3WKBA 1DKOA 1X15A 3ONNA 2GD2A 4TWAA 5THXA 3K0BA 4ARAA 3VKFA 1BEZA 3CLUD 1QIMA 4IRUB 3LCUA 3HVUA 4PS1A 3CZAA 2O6LA 3BX1A 3Q2KA 1J06A 3V7YA 4ZQHA 2CUZA 1J09A 3A6KA 4W5QA 3AI2A 1QR6A 1RXVA 4UVHA 5DT2A 1SU6A 5TGDA 5T8KC 2QT0A 4Q39A 2OM6A 2BOVA 3LUJA 4YR9A 4Q3DA 2ZJOA 4WOPA 1QIDA 3P52A 4JH0A 4MWBA 4EB0A 1HLGA 4TQAA 2I3DA 4QHYA 3C15C 1CJBA 2XX3A 3FNGA 2AXQA 4G0QA 5BRAA 1G8KA 4OBXA 3BJEA 4EPYA 2X5NA 1RD4A 4MV9A 4BXOB 4PC1A 2X42A 1ONBA 3EXHB 2YWXA 1R4AA 3T8YA 3L1JA 2XMQA 1JS1X 3BM5A 1VSTA 3GEDA 4C4OA 4IRMA 1GT6A 3QYPA 4I5GA 4DK0A 2R79A 5A2QA 1TQ8A 1D07A 3GDHA 3CS3A 3E7XA 2FZWA 3UJ3X 1PR0A 3H6GA 3UAWA 1JA9A 1W4BA 2AH5A 1XU4A 4EA7A 1QQAA 2I55A 2CLLB 4KO8A 2Z58A 4UEJA 1RM5A 2OLEA 3R7LA 1PBTA 1VE7A 1KQ3A 4ARUA 3JVUA 3LI2A 4NR0A 4IVNA 5EHZA 5HDQA 4LMPA 4CM1A 1UDXA 3OQIB 5IHXA 1W85B 5EWJA 2IYVA 2VWHA 4U8GA 3WGNA 2PVPA 2WLSA 2EFDB 1L8XA 2VHEA 4Z8XA 5J2UF 2JH3A 1NXXA 3MBIA 4X7RA 4QYIA 3DOFA 1F0KA 2A1UA 2GERA 4N6OA 3TQOA 2Y8EA 4D57A 5K0ZA 1TVKB 1A77A 4EGCB 4MDYA 2NSLA 2J3LA 4A0FA 3HRIA 2Y1FA 2QUKA 1SIBE 4XIFA 5J4HA 3RUHA 3QU9A 3I9KA 3UMYA 3L8YA 3NGMA 4A9AA 1VL2A 1I2DA 1ODIA 3OAAD 5TARA 1QHFA 1PRYA 3EGVA 1SIUA 1YS4A 1LJUA 4KXYA 1NU6A 4YCBA 4NYJR 2RK4A 2QDXA 2PYZA 2GDJA 2PSDA 3BMQA 1C29B 4C5BA 5I51A 1C5KA 4AJHA 2E1RA 1V1RB 1KC8D 2IYWA 1WNFA 2LR0A 1E1KA 2JAPA 1Y98A 3RYHB 3T9CA 4GOND 5JEEA 1W4AA 3O38A 3M6WA 3FOEC 1DIAA 5CB4F 3Q7TA 3DEYX 1EINA 1TMYA 1H8HA 2P7HA 3LPMA 4Z3DA 2R7KA 3T15A 1YU9A 4DKJA 4X7FA 3AVQA 5AM2A 2AFHB 4UBKA 3HDYA 1EESA 5KOHA 3GPCA 4XJXA 2J7PD 3ZWDA 4FWBA 1DOHA 1IY1A 2Q0SA 5JDIA 4E88A 2RH9B 3W8FA 1DPFA 3V76A 1PF7E 1QDLB 4LZLA 2DPHA 4DR7B 4ZYLA 3GH3A 2V4UA 1VM6A 2PUHA 3EF3A 3A6FA 4FKBA 3RYFA 3BF7A 5AJHA 3THWB 4YAEA 2Q8NA 3T4PA 3ELUA 3VZDA 4M0EA 1HZZA 2FZEA 1ZOLA 3D43A 4I55F 3K71B 3U4MA 2PGJA 3Q40A 4ZZ2A 5HOEA 3UXEA 2P4SA 4BGDA 4KEAA 4EO7A 1S72B 1YR6A 4IHJF 5FPPA 5KNBH 1EBBA 2CMGA 2BHTA 2GI4A 3CKKA 4HQOA 1XWIA 4U2GA 4DRXB 3U39A 2D13A 2PS1A 4F9EA 3C6MA 3QOFA 2GM5A 1CRQA 2Q46A 3SEAA 2BV3A 2JHCA 2Q5FA 3E5MA 4G5RA 1QS0A 3E81A 3RREA 5M34A 2R65A 1STOA 3EAQA 1TJYA 2YIMA 2C5GA 4DQVA 2O2CA 1C7ZA 1G0NA 1JQ3A 3F9CA 3GEGA 3PTZA 4HDKB 4KMOA 1XVLA 3VU0A 3UN1A 1J9ZA 3EZXA 1IOWA 2NPIA 1YZKA 3MBOA 4L27A 4Z9FA 3ZBPA 2UUCB 2JN9A 2VEOA 5IJ9A 2W93A 1R50A 4L9RA 3OLQA 1YGYA 4TKUA 5KNDD 2XKKA 3M6MD 5I9IA 2Z2XA 1O0BA 3AB8A 3BTUA 3CKLA 4NPAA 3TVTA 3KDAA 3GLIB 3H9BA 2HU2A 1L9XA 2GXQA 2EZ9A 3P97A 1JFFB 1CV2A 2IT1A 3A14A 2NADA 4FB5A 4BJ6A 3A11A 1MGPA 1IM5A 3A3KA 1UAGA 3DNFA 1FS5A 2WFZA 4A0HA 1M34B 1RC8A 1A7UA 4PLTA 1NJFA 2HHHB 4J7XA 1ZNQO 4RIFA 5B58C 4CL2A 2JJ1D 1NVWQ 2Q9AA 1ISRA 4QV2A 3RUIA 1O57A 3PE6A 2VF5X 2W2XA 1SBHA 4UVGA 3TEFA 2W0MA 4XLHA 3AEZA 2JATA 4HDOB 4AO6A 3BFPA 1NB0A 2OP0A 1YH3A 2P78A 4QTTB 1NN1A 2NV2B 4RZQA 4HYYA 4C4ZA 4H0FA 5DTJA 1WHTA 4E46A 5DW0A 4WDQA 4B43A 3V48A 5LQCA 2FUCA 2WE7A 3U19A 3BTSA 1GCOA 4BY9E 1Y1KE 3OLYA 5EEGA 3SEQA 4R81A 3A1TA 5ALLA 4UASA 4KQGA 1DZ3A 4CLDA 1T9AA 3KTDA 4KSYA 2JEZA 5I8ZA 2FJUA 3U7EB 4QDTA 1HWYA 3DHEA 4BLSA 4XNFA 1PDVA 4BLTA 5JNRA 2HA6A 3FTEA 1L4LA 2UZ1B 3OA2A 3CR8A 4C08A 4EGJA 1IBMB 4Z4UA 5ALYA 1KOLA 5JSFA 3WDLA 2JGFA 3U61B 4LC0A 1UOEA 2I7DA 4QG7A 5BQPA 3V2UA 3IQIX 1H5QA 3G0DA 3LW7A 4KHZA 5ADHA 2X1VA 3JS5A 3PC8C 4N7RA 2R60A 2YRFA 1Z28A 3UKDA 3IKTA 1NAIA 3AM5A 4Q3LA 3S8MA 5LXTF 3A4LA 5CTJA 1XVUA 1H5NA 2XY4A 3N1UA 1GDHA 1M6EX 3QP9A 5CNIA 5JDCC 4WRRA 4NBWA 2DSTA 4F4CA 2FG6C 3JZFA 4DHWA 1O96B 3GGGA 2VOEA 4MAAA 4FNMA 1KE1A 3AKZA 3O47A 1HDEA 2DKNA 1JJFA 1NQUA 3D02A 3GVIA 3ENKA 3B3QA 3ZCVA 2NP7A 5FBLB 4X07A 4IXMA 4LPSA 3HUDA 4HGZA 1EAYA 3LCRA 1GDTA 4EH1A 4JZKA 4OG2A 1WCIA 2JAHA 2MSDB 3BXEA 4GUDA 5GV8A 2EATA 3I6QA 5T57A 1LVUA 5EGNA 4NJOA 2NTVA 3H19A 1FDWA 1W75A 3GFFA 4L4XA 4TYQA 4RX1A 3D64A 4NDAA 3PFKA 1JI0A 3M49A 3D3JA 4RVCA 1XP8A 4DCJA 4EKDA 1UXGA 1OTXA 1Z7GA 2BFAA 3K0AA 4QOGA 3CNQS 4LS3A 1JBEA 4OBWA 4AUKA 1IM2A 3OF5A 4F3TA 1MC5A 2Z30A 2I6GA 2JCVA 5K20A 3L4JA 2R68A 3HU1A 3O4RA 4LXIA 1EHCA 3JSAA 1A27A 2QRJA 4C06A 2LNDA 1CYEA 4LE1A 4RVHA 4V3CA 4YXWA 4AMZA 3ANMA 1XKLA 4X54A 3V1KA 3CO5A 3GEBA 5BNFA 5TQ0B 4D44A 1ZC3A 4R6XA 1YQUA 3JQ8A 3BT7A 1UD2A 4P83A 1F2VA 4IX1A 1U7WA 1XN4A 4RL4A 2APJA 2IFTA 3TOSA 4DDMA 5JDIC 3V7AA 2YWBA 1DBPA 3EC7A 4ZI7A 2ETVA 2OCXA 3JAWA 3CH5A 4A8JB 4YROA 3AC0A 2MINA 3B7GA 4HLUA 3JQ7A 3JY6A 4DWOA 1DUIA 2PUGA 1E2HA 5INTA 1YB4A 5AW1A 3B36A 3RSLA 5LXTB 3E9QA 3I2FA 1V3QE 3VOBA 3JVVA 2HPAA 4RJTA 1OLUA 4IIJB 3AF4A 2XYQA 3D6FA 1L1RA 4AX4A 2UXDB 5FL3A 1JDZA 3GQVA 1TB4A 2JDIA 1NI5A 4TV9A 4UE6A 4EG0A 5EIEA 4KWIA 1ZL0A 3PUJA 5IHPA 3RARA 4A91A 4YI3A 5J59A 5KVSA 1QIEA 1SVMA 1YLOA 4NP6A 1AQLA 4DTCA 3T1NA 5A7HA 5ICGA 2Y68A 5EHNA 1T35A 3IHKA 5CCXA 4IDBA 4JOBA 5IZ4A 3SPXA 4MPRA 1VCHA 3AKYA 4M0LA 2PCJA 4MPJA 2D5LA 3RYIB 1QE5A 4NI5A 4H35A 3MIIA 4B46A 3EUFA 1TYAE 2QTCA 2Y27A 1WDWB 2RGCA 4ARZA 2XTJA 1YT5A 4YDSA 1RAIA 2CNBA 3W7BA 5JS6A 1CY2A 4LG1A 4CMKA 3ZE6A 4BB9A 3GJ6A 5HUQA 1HRDA 2EVWX 2RKWA 5TT0A 2FR1A 1ZM4A 2FFJA 3U3MA 1MCZA 4JUIA 4K9QA 4MV6A 5CYPA 4Q3CA 4R8MA 2JLCA 3VVBA 3UAOA 2OC9A 3FX2A 2ACKA 1AUVA 3IHWA 3KOMA 4QSMA 5FT9A 1K5GA 4JBXA 1KPHA 3IP1A 1V5WA 4RK5A 1RZRA 4O2BF 1A5AB 1EGQA 2GGSA 3GEMA 3PQ3A 4J0HA 4BJ5A 4DMUB 3HEMA 2C7RA 1SGWA 1DADA 2W8ZA 3CNEA 3NC4A 2EKPA 2WJYA 3H65A 2HJ9A 3GD7A 3VR4H 4N5NA 3NANA 3TGPA 4X8HA 3EPKA 3DAYA 3IBFA 3CCMB 3PNOA 5TQ2B 1D4AA 2X0FA 3V4OA 3BH0A 4XW2A 3I9LA 2JARA 2QR3A 1V11A 2J0QA 1RHMA 1YX2A 1G8YA 4KO1S 4I1VA 4BCBA 1HZJA 1UT6A 2H1CA 1MB9A 2JFGA 4EP1A 4JVNA 2VHYA 2VHCA 2WM2A 3B2EA 3LBYA 4QM6A 1TAUA 1XVTA 5F5XA 1X7ZA 5DXFA 1E6KA 2CNNA 2IEZA 2Q5OA 3OT1A 3HKDB 3MYYA 3DMHA 4ZWNA 4IHJB 3RSZA 2ZUTA 3IAM1 2B2CA 2Z6UA 2WWFA 3PQEA 3QVUA 1FRQA 4B3CA 3OKCA 4LBWA 5TY0A 3MUFA 4CM3A 2VXOA 3UFBA 1ZHHA 3IEMA 1BKSB 2J0UB 5K3EA 2VPTA 2C59A 1DCTA 4TWBA 5DN9A 3URKA 4WNYA 1KI3A 4NATA 3BGVA 2VC2B 3SHVA 5D01A 1H2FA 3L7KA 4FWTA 3PUNA 3NBZC 1ZN9A 2EYUA 1JQ5A 1Q16A 3BVPA 4V2IA 3RQIA 2IIBA 3DWFA 2ATXA 3A70A 1U8TA 2V7VA 3FDIA 4Y2JA 3NIBA 4MYDA 4PYKA 1SD2A 4BWGA 2FFQA 3A32A 1IBKB 3PLAE 3DDWA 4Q7QA 2PLWA 1QKIA 2BGKA 2ZPTX 2WHPB 3MBKA 4FGLA 4R2KA 4DSTA 3EC2A 2Q5LA 3HB1A 3QWFA 5AK3A 4A6XA 5LDDC 4LGCA 2A5JA 2A3NA 3JAWB 4WKGA 1H2AS 2G5CA 4DJJA 4DBLC 1RRPA 1TM1E 1P4MA 3QITA 2JFNA 1I9CA 3D4BA 2LV8A 2VZLA 1K08A 3RVLA 4CDRA 2DQZA 1QYIA 2XUQA 1WB4A 3PGKA 2GHQA 1CVLA 2HBRA 4I1IA 4NBVA 1NN5A 1Z8NA 1C1DA 1RRGA 2VHTA 4Q82A 1P3DA 4EDFA 4ZJPA 3RKSA 4IEFB 3UUEA 1U0LA 1DRWA 3DVAA 4Z4IA 2LE0A 3B3FA 1ESMA 1NAHA 2P0YA 4L8FA 1YOVB 3SEJA 4RE5A 4YPVA 1L8QA 4KFCA 1CRZA 4FNAA 4QREA 1SKUA 4KKUA 1EX1A 3WO0A 2X0JA 1SG9A 3GLGA 5DGXA 3RFVA 3G2QA 2C4UA 1K8XB 2Q3FA 2NSHA 3EJWA 4W99A 1FTQA 4V02A 1MW8X 2YXNA 1VLHA 4Y2YA 1MD9A 3VFDA 4A03A 1EVJA 2C4NA 1Q1QA 2M98A 4GG1A 1O94D 2ESRA 4PV7A 2YNMA 3L8DA 4ZAZA 5L4LA 2F62A 1ZD2P 1O6ZA 3EUEA 4KI0A 4QQKA 1QV6A 4GRDA 1ISMA 2QZJA 1Z73A 3NVDA 3NFRA 3MZ0A 1C7QA 4R1OA 2LPMA 4V2UA 4B3BA 3O82A 4Z1MD 4YRDA 2IYXA 2FA9A 1S4QA 1GTL1 2OHXA 4QSHA 5FOWA 3VUFA 1Z88A 2G7ZA 4H3SA 2JVJA 4KMMA 5HKOA 4M9UA 5HTKA 4ESEA 2R8PA 2FOXA 2G63A 2NNWB 3BQNB 4N40A 4J1NA 4Q6WA 4D4KA 2SECE 3TOCA 4YNBA 4DM7A 3T5AA 2Q3DA 3KYIB 5KU1A 2IYEA 2O8EA 4ZO4A 1GL3A 4EMSA 5A04A 1S6YA 3EDOA 3Q8WA 4AVYA 1SCUA 3LUPA 2P30A 3N0WA 1FLAA 1LCIA 3MT9A 4YH1A 3FNBA 3GGPA 1FUIA 4LJ5A 3GJ5A 4P1ZA 4RL6A 3R7SA 4EUKA 2ORYA 4L22A 5JHHB 1ORVA 2R6JA 4FFBA 2B1QA 5IYRA 4EBBA 4FGJA 2XZLA 3OP1A 1LLFA 2ZITA 1X8XA 2H5JA 3NWEA 3SIXA 4ZRMA 3MN1A 2CSXA 3OT5A 2E2WA 3QUBA 5J5AA 4K9PA 5CITA 2Q6VA 5IFLA 2A33A 2CL6X 5LWQA 2ZIZA 1EJ0A 1VP3A 2WHRA 2Y1DA 2ZJ5A 2V7PA 4LUCA 3O26A 5AOCA 2L17A 2D3LA 5T3UA 3K15A 5K0FA 4P4GA 1KC1A 2WQZA 4AROA 4HVLA 3PNPA 5J5CA 1OV6A 4FZVA 2ISQA 1GNQA 3KYCA 1SG6A 2ZJ2A 5A4MS 4FCTA 4AKIA 4IKPA 4TTRA 3DMGA 2BFWA 2CLEB 1P4JA 1Z38A 3LA8A 3ZZMA 3A6PC 1LBSA 4O02B 4DIDA 3EPLA 4J03A 1NG1A 4JKOA 3S1LA 4P93A 5DNDA 1DB3A 1VCNA 3VSCA 1JMYA 1BNCA 2XIQA 3GV0A 3OWOA 3G5MA 4IOKA 2ZYHA 5CTAA 3IEKA 4JI7B 1JHZA 2RHOA 4HNHA 5AO9A 3R7NA 1EIZA 3WK9A 5CG2A 1F7VA 5COQA 4Z1MA 1BEUB 3RFTA 3REQA 3W90A 2C8VA 3AEKA 1XTQA 1F3OA 2VR1A 1XJQA 2WF5A 4BE7B 1ZOIA 2HNBA 1IY8A 1I3OA 4P8RA 4M2LA 3TW0A 3U37A 3VKUA 3IP7A 3DH0A 1RWXA 2ORWA 3PXUA 2QQGA 2XNSA 1CWUA 2HDWA 3OCZA 2YR0A 4GEGA 3AETB 4B3HA 4RV5A 1U7HA 1E5XA 2GF9A 4XSVA 3DBLB 1AQJA 1PO7A 1JKIA 3GNQA 4JASB 3ACCA 4ZGGA 5JLJA 5ELXA 3BBLA 5FF9A 2GAJA 4C0XA 4HX9A 4GPAA 2H1FA 2XECA 3V4LA 1S8AA 3SXUB 5EEHA 1JFFA 4J4HA 4JXXA 3C3EA 3NOOA 4J6EA 2C3MA 2ZIXA 1UPFA 3K9NA 3NH9A 2NXWA 5E7MA 1QBGA 3LM8A 4C6RA 3KCQA