4UAMA

1.8 angstrom crystal structure of imp-1 metallo-beta-lactamase with a mixed iron-zinc center in the active site
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron(III) Located in the Dinuclear Metallo-beta-Lactamase IMP-1 by Pseudocontact Shifts.
pubmed doi rcsb
source organism Pseudomonas aeruginosa ncgm2.s1
molecule tags Hydrolase
molecule keywords IMP-1 metallo-beta-lactamase
total genus 65
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4uamA00
4B87A 3F9OA 3KNRA 4RM5A 4TZEA 5K0WA 2M5DA 5AHOA 2Y8AA 4UA4A 3VQZA 4Z7RA 1X8IA 2YNTB 2Q9UA 5EW0A 4AD9A 2FU6A 1KR3A 2P4ZA 3FCZA 3IOGA 4PVTA 4D1UA 5K4KA 1QH3A 1JJEA 5A0TA 4XWTA 3PG4A 4BZ3A 1HLKA 5HIQA 1WRAA 4UAMA 1L9YA 3KNSA 4EYFA 3SW3A 3LVZA 3VPEA 4RL0A 3I14A 3SPUA 4EXSA 1XM8A 4YSLA 2BG8B 3SD9A 1YCGA 1X8GA 2WHGA 5FQAA 3S0ZA 4ZO3A 4NQ4A 3SRXA 1VMEA 2H6AA 4KEQA 4LE6A 3A4YA 3T9MA 5ACVA 5AXOA 4U4LA 3JXPA 4C1HA 2CBNA 2QDSA 4FR7A 4XWWA 3QH8A 1JT1A 1YCFA 3IELA 1K07A 4GCWA 2FU8A 5EHTA 3ZR9A 4KEPA 2I7VA 5EVBA 4CHLA 2BG2A 5ACPA 1XTOA 1M2XA 5KIKA 2VW8A 2NXAA 3I13A 1E5DA 4P62A 2GCUA 2BFZA 2XF4A 1A8TA 2Q42A 5EVDA 2ZO4A 2YNVB 2BG7A 3IE1A 2OHHA 4JO0A 4TZ9A 4AWYB 4UWSB 1JJTA 1VGNA 2DKFA 1KO3A 5DPXA 5K4MA 2Q0JA 4EFZA 3I15A 5A0VA 4AX1B 2QINA 2BG6A 3I0VA 4Z67A 2Y8BA 4RL2A 4YSBA 2FU9A 1X8HA 5LCAA 2QEDA 2P97A 3X2ZA 5AEBA 1ZKPA 2A7MA 5ACTA 2FK6A 2BMIA 4TZBA 2P18A 4J5FA 2QJSA 4F6ZA 3FAIA 4ZO2A 3ZWFA 3X30A 5KILA 3T3NA 3BK2A 4HKYA 3DH8A 1BVTA 4V0HA 4EXYA 4GYQA 4Z60A 1VJNA 5HIPA 2GFKA 3PY5A 5LMCA 2AZ4A 2YNVA 4NQ6A 2UYXA 2E7YA 3G1PA 4C1FA 5EH9A 4F6HA 2DOOA 4H0DA 3SFPA 5LLDA 4C1GA 3IDZA 5A5ZA 2GFJA 2BG8A 2ZWRA 5LM6A 3BC2A 2AIOA 3ADRA 3AJ3A 4UWPB 2Q0IA 5HIOA 2WYLA 4C1DA 2WYMC 5LE1A 3IEMA 3PY6A 1A7TA 2NZFA 1DD6A 1WUOA 3L6NA 3RPCA 2NZEA 2BFLA 4PVOA 4AWZA 5IQKA 1WUPA 5LSCA 1DXKA 3DHBA 1MQOA 4RAWA 3ZNBA 3IE2A 5ACSA 1SMLA 2QDTA 3X2XA 1QH5A 3SBLA 2FHXB 3WXCA 2YZ3A 2BFKA 1ZTCA 4D1TA 2OHJA 4FEKA 2OHIA 4AX0B 3DHAA 4TZFA 5B1UA 3IE0A 5EWAA 1ZNBA 5LCFA 4C1EA 5ACRA 5K4NA 3ZQ4A 5AHRA 3T3OA 4RBSA 2P1EA 1DDKA 3IEKA 2Y87A 2BC2A 5HH6A 5ACXA 4UWOB 4D1VA 5ACUA 5A87A 5HH4A 2BFZB 4C1CA 5LCHA 4EY2A 3MD7A 2XR1A 4J5HA 2FM6A 3DHCA 4Z6XA 2ZZIA 3BV6A 3IOFA 2BTNA 3AF5A 5AYAA 4DIKA 5ACWA 4EYBA 4EYLA 1KO2A 4BP0A 1Y44A 2ZNBA 4Z5YA 1BMCA 1YCHA 2GKLA 5FQBA 5HH5A 1BC2A 3P2UA 4HL2A 4Z5ZA 1P9EA 2BGAA 2FHXA 2FU7A 5ACQA 4ZEJA 2BIBA 2WRSA 4TYTA 5FQCA 2I7XA 3TP9A 3AF6A 5HISA 3KL7A 3Q6VA 3R2UA 2WYMA 5EV8A 5AXRA 3I11A 3ESHA 4ZNBA 4UBQA 3RKKA 2GMNA 4O98A 5B15A 4NQ5A 4RAMA 2HB9A 2YCBA 2I7TA 2YNWA 4FSBA 4TYFA 2R2DA 3X2YA 4XUKA 5EVKA 4YSKA 4DILA 2M5CA 1WW1A 2YNUA 3H3EA 4WD6A 5LS3A 5EV6A 4D02A 4NQ2A 2NYPA 4GYUA 4UWRB 3BK1A 4C09A 5B3RA 3RKJA 2YNTA 4D1WA 2BR6A 4HL1A
chains in the Genus database with same CATH superfamily
4B87A 3F9OA 3KNRA 4RM5A 4TZEA 5K0WA 2M5DA 5AHOA 2Y8AA 4UA4A 3VQZA 4Z7RA 1X8IA 2YNTB 2Q9UA 5EW0A 4AD9A 2FU6A 1KR3A 2P4ZA 3FCZA 3IOGA 4PVTA 4D1UA 5K4KA 1QH3A 1JJEA 5A0TA 4XWTA 3PG4A 4BZ3A 1HLKA 5HIQA 1WRAA 4UAMA 1L9YA 3KNSA 4EYFA 3SW3A 3LVZA 3VPEA 4RL0A 3I14A 3SPUA 4EXSA 1XM8A 2CG2A 4YSLA 2BG8B 3SD9A 1YCGA 1X8GA 2WHGA 5FQAA 3S0ZA 4ZO3A 4NQ4A 3SRXA 1VMEA 2H6AA 4KEQA 2CFZA 4LE6A 3A4YA 3T9MA 5ACVA 5AXOA 4U4LA 3JXPA 4C1HA 2CBNA 2QDSA 4FR7A 4XWWA 3QH8A 1JT1A 4NURA 1YCFA 3IELA 5A23A 1K07A 4GCWA 2FU8A 5EHTA 3ZR9A 4KEPA 2I7VA 5EVBA 4CHLA 2BG2A 5ACPA 1XTOA 1M2XA 5KIKA 2VW8A 2NXAA 3I13A 1E5DA 4P62A 2GCUA 2BFZA 2XF4A 1A8TA 2Q42A 5EVDA 2ZO4A 2YNVB 2BG7A 3IE1A 2OHHA 4JO0A 4TZ9A 4AWYB 2CFUA 4UWSB 1JJTA 1VGNA 2DKFA 1KO3A 5DPXA 5K4MA 2Q0JA 4EFZA 3I15A 5A0VA 4AX1B 2QINA 2BG6A 4AXHA 3I0VA 4Z67A 2Y8BA 4RL2A 4YSBA 2FU9A 2YHEA 1X8HA 5LCAA 2QEDA 2P97A 3X2ZA 5AEBA 1ZKPA 2A7MA 5ACTA 2FK6A 2BMIA 4TZBA 2P18A 4J5FA 2QJSA 4F6ZA 3FAIA 4ZO2A 3ZWFA 3X30A 5KILA 3T3NA 3BK2A 4HKYA 3DH8A 1BVTA 4V0HA 4EXYA 4GYQA 4Z60A 1VJNA 5HIPA 2GFKA 3PY5A 5LMCA 2AZ4A 2YNVA 4NQ6A 2UYXA 2E7YA 3G1PA 4C1FA 5EH9A 4F6HA 2DOOA 4H0DA 3SFPA 4PDXA 5LLDA 4C1GA 3IDZA 5AJLA 5A5ZA 2GFJA 2BG8A 2ZWRA 5LM6A 3BC2A 2AIOA 3ADRA 3AJ3A 4UWPB 2Q0IA 5HIOA 2WYLA 4C1DA 2WYMC 5LE1A 3IEMA 3PY6A 1A7TA 2NZFA 1DD6A 1WUOA 3L6NA 3RPCA 2NZEA 5AIJA 2BFLA 4PVOA 4AWZA 5IQKA 1WUPA 5LSCA 1DXKA 3DHBA 1MQOA 4RAWA 3ZNBA 5ACSA 3IE2A 1SMLA 2QDTA 3X2XA 1QH5A 3SBLA 2FHXB 3WXCA 2YZ3A 2BFKA 1ZTCA 4D1TA 2OHJA 4FEKA 2OHIA 2CG3A 4AX0B 3DHAA 4TZFA 5B1UA 3IE0A 5EWAA 1ZNBA 5LCFA 4C1EA 5ACRA 5K4NA 3ZQ4A 5AHRA 3T3OA 4RBSA 2P1EA 1DDKA 3IEKA 2Y87A 2BC2A 5HH6A 5ACXA 4UWOB 4D1VA 5ACUA 5A87A 5HH4A 2BFZB 4C1CA 5LCHA 4EY2A 3MD7A 2XR1A 4J5HA 2FM6A 3DHCA 4Z6XA 2ZZIA 3BV6A 3IOFA 2BTNA 3AF5A 5AYAA 4DIKA 5ACWA 4EYBA 4EYLA 1KO2A 4BP0A 1Y44A 2ZNBA 4Z5YA 1BMCA 1YCHA 2GKLA 5FQBA 5HH5A 1BC2A 3P2UA 4HL2A 4Z5ZA 1P9EA 2BGAA 2FHXA 2FU7A 5ACQA 4ZEJA 2BIBA 2WRSA 4TYTA 5FQCA 2I7XA 3TP9A 3AF6A 5HISA 3KL7A 3Q6VA 3R2UA 2WYMA 5EV8A 5AXRA 3I11A 3ESHA 4ZNBA 4UBQA 3RKKA 2GMNA 4O98A 5B15A 4NQ5A 4RAMA 2HB9A 2YCBA 2I7TA 2YNWA 4FSBA 4TYFA 2R2DA 3X2YA 4XUKA 5EVKA 4YSKA 4DILA 2M5CA 1WW1A 2YNUA 3H3EA 4WD6A 4AV7A 5LS3A 5EV6A 4D02A 4NQ2A 2NYPA 4GYUA 4UWRB 3BK1A 4C09A 5B3RA 3RKJA 2YNTA 4D1WA 2BR6A 4HL1A
chains in the Genus database with same CATH topology
4B87A 3F9OA 3KNRA 4RM5A 4TZEA 5K0WA 2M5DA 5AHOA 2Y8AA 4UA4A 3VQZA 4Z7RA 1X8IA 2YNTB 2Q9UA 5EW0A 4AD9A 2FU6A 1KR3A 2P4ZA 3FCZA 3IOGA 4PVTA 4D1UA 5K4KA 1QH3A 1JJEA 5A0TA 4XWTA 3PG4A 4BZ3A 1HLKA 5HIQA 1WRAA 4UAMA 1L9YA 3KNSA 4EYFA 3SW3A 3LVZA 3VPEA 4RL0A 3I14A 3SPUA 4EXSA 1XM8A 4YSLA 2BG8B 3SD9A 1YCGA 1X8GA 2WHGA 5FQAA 3S0ZA 4ZO3A 4NQ4A 3SRXA 1VMEA 2H6AA 4KEQA 4LE6A 3A4YA 3T9MA 5ACVA 5AXOA 4U4LA 3JXPA 4C1HA 2CBNA 2QDSA 4FR7A 4XWWA 3QH8A 1JT1A 1YCFA 3IELA 1K07A 4GCWA 2FU8A 5EHTA 3ZR9A 4KEPA 2I7VA 5EVBA 4CHLA 2BG2A 5ACPA 1XTOA 1M2XA 5KIKA 2VW8A 2NXAA 3I13A 1E5DA 4P62A 2GCUA 2BFZA 2XF4A 1A8TA 2Q42A 5EVDA 2ZO4A 2YNVB 2BG7A 3IE1A 2OHHA 4JO0A 4TZ9A 4AWYB 4UWSB 1JJTA 1VGNA 2DKFA 1KO3A 5DPXA 5K4MA 2Q0JA 4EFZA 3I15A 5A0VA 4AX1B 2QINA 2BG6A 3I0VA 4Z67A 2Y8BA 4RL2A 4YSBA 2FU9A 1X8HA 5LCAA 2QEDA 2P97A 3X2ZA 5AEBA 1ZKPA 2A7MA 5ACTA 2FK6A 2BMIA 4TZBA 2P18A 4J5FA 2QJSA 4F6ZA 3FAIA 4ZO2A 3ZWFA 3X30A 5KILA 3T3NA 3BK2A 4HKYA 3DH8A 1BVTA 4V0HA 4EXYA 4GYQA 4Z60A 1VJNA 5HIPA 2GFKA 3PY5A 5LMCA 2AZ4A 2YNVA 4NQ6A 2UYXA 2E7YA 3G1PA 4C1FA 5EH9A 4F6HA 2DOOA 4H0DA 3SFPA 5LLDA 4C1GA 3IDZA 5A5ZA 2GFJA 2BG8A 2ZWRA 5LM6A 3BC2A 2AIOA 3ADRA 3AJ3A 4UWPB 2Q0IA 5HIOA 2WYLA 4C1DA 2WYMC 5LE1A 3IEMA 3PY6A 1A7TA 2NZFA 1DD6A 1WUOA 3L6NA 3RPCA 2NZEA 2BFLA 4PVOA 4AWZA 5IQKA 1WUPA 5LSCA 1DXKA 3DHBA 1MQOA 4RAWA 3ZNBA 3IE2A 5ACSA 1SMLA 2QDTA 3X2XA 1QH5A 3SBLA 2FHXB 3WXCA 2YZ3A 2BFKA 1ZTCA 4D1TA 2OHJA 4FEKA 2OHIA 4AX0B 3DHAA 4TZFA 5B1UA 3IE0A 5EWAA 1ZNBA 5LCFA 4C1EA 5ACRA 5K4NA 3ZQ4A 5AHRA 3T3OA 4RBSA 2P1EA 1DDKA 3IEKA 2Y87A 2BC2A 5HH6A 5ACXA 4UWOB 4D1VA 5ACUA 5A87A 5HH4A 2BFZB 4C1CA 5LCHA 4EY2A 3MD7A 2XR1A 4J5HA 2FM6A 3DHCA 4Z6XA 2ZZIA 3BV6A 3IOFA 2BTNA 3AF5A 5AYAA 4DIKA 5ACWA 4EYBA 4EYLA 1KO2A 4BP0A 1Y44A 2ZNBA 4Z5YA 1BMCA 1YCHA 2GKLA 5FQBA 5HH5A 1BC2A 3P2UA 4HL2A 4Z5ZA 1P9EA 2BGAA 2FHXA 2FU7A 5ACQA 4ZEJA 2BIBA 2WRSA 4TYTA 5FQCA 2I7XA 3TP9A 3AF6A 5HISA 3KL7A 3Q6VA 3R2UA 2WYMA 5EV8A 5AXRA 3I11A 3ESHA 4ZNBA 4UBQA 3RKKA 2GMNA 4O98A 5B15A 4NQ5A 4RAMA 2HB9A 2YCBA 2I7TA 2YNWA 4FSBA 4TYFA 2R2DA 3X2YA 4XUKA 5EVKA 4YSKA 4DILA 2M5CA 1WW1A 2YNUA 3H3EA 4WD6A 5LS3A 5EV6A 4D02A 4NQ2A 2NYPA 4GYUA 4UWRB 3BK1A 4C09A 5B3RA 3RKJA 2YNTA 4D1WA 2BR6A 4HL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B87 A;  3F9O A;  3KNR A;  4RM5 A;  4TZE A;  5K0W A;  2M5D A;  5AHO A;  2Y8A A;  4UA4 A;  3VQZ A;  4Z7R A;  1X8I A;  2YNT B;  2Q9U A;  5EW0 A;  4AD9 A;  2FU6 A;  1KR3 A;  2P4Z A;  3FCZ A;  3IOG A;  4PVT A;  4D1U A;  5K4K A;  1QH3 A;  1JJE A;  5A0T A;  4XWT A;  3PG4 A;  4BZ3 A;  1HLK A;  5HIQ A;  1WRA A;  4UAM A;  1L9Y A;  3KNS A;  4EYF A;  3SW3 A;  3LVZ A;  3VPE A;  4RL0 A;  3I14 A;  3SPU A;  4EXS A;  1XM8 A;  4YSL A;  2BG8 B;  3SD9 A;  1YCG A;  1X8G A;  2WHG A;  5FQA A;  3S0Z A;  4ZO3 A;  4NQ4 A;  3SRX A;  1VME A;  2H6A A;  4KEQ A;  4LE6 A;  3A4Y A;  3T9M A;  5ACV A;  5AXO A;  4U4L A;  3JXP A;  4C1H A;  2CBN A;  2QDS A;  4FR7 A;  4XWW A;  3QH8 A;  1JT1 A;  1YCF A;  3IEL A;  1K07 A;  4GCW A;  2FU8 A;  5EHT A;  3ZR9 A;  4KEP A;  2I7V A;  5EVB A;  4CHL A;  2BG2 A;  5ACP A;  1XTO A;  1M2X A;  5KIK A;  2VW8 A;  2NXA A;  3I13 A;  1E5D A;  4P62 A;  2GCU A;  2BFZ A;  2XF4 A;  1A8T A;  2Q42 A;  5EVD A;  2ZO4 A;  2YNV B;  2BG7 A;  3IE1 A;  2OHH A;  4JO0 A;  4TZ9 A;  4AWY B;  4UWS B;  1JJT A;  1VGN A;  2DKF A;  1KO3 A;  5DPX A;  5K4M A;  2Q0J A;  4EFZ A;  3I15 A;  5A0V A;  4AX1 B;  2QIN A;  2BG6 A;  3I0V A;  4Z67 A;  2Y8B A;  4RL2 A;  4YSB A;  2FU9 A;  1X8H A;  5LCA A;  2QED A;  2P97 A;  3X2Z A;  5AEB A;  1ZKP A;  2A7M A;  5ACT A;  2FK6 A;  2BMI A;  4TZB A;  2P18 A;  4J5F A;  2QJS A;  4F6Z A;  3FAI A;  4ZO2 A;  3ZWF A;  3X30 A;  5KIL A;  3T3N A;  3BK2 A;  4HKY A;  3DH8 A;  1BVT A;  4V0H A;  4EXY A;  4GYQ A;  4Z60 A;  1VJN A;  5HIP A;  2GFK A;  3PY5 A;  5LMC A;  2AZ4 A;  2YNV A;  4NQ6 A;  2UYX A;  2E7Y A;  3G1P A;  4C1F A;  5EH9 A;  4F6H A;  2DOO A;  4H0D A;  3SFP A;  5LLD A;  4C1G A;  3IDZ A;  5A5Z A;  2GFJ A;  2BG8 A;  2ZWR A;  5LM6 A;  3BC2 A;  2AIO A;  3ADR A;  3AJ3 A;  4UWP B;  2Q0I A;  5HIO A;  2WYL A;  4C1D A;  2WYM C;  5LE1 A;  3IEM A;  3PY6 A;  1A7T A;  2NZF A;  1DD6 A;  1WUO A;  3L6N A;  3RPC A;  2NZE A;  2BFL A;  4PVO A;  4AWZ A;  5IQK A;  1WUP A;  5LSC A;  1DXK A;  3DHB A;  1MQO A;  4RAW A;  3ZNB A;  3IE2 A;  5ACS A;  1SML A;  2QDT A;  3X2X A;  1QH5 A;  3SBL A;  2FHX B;  3WXC A;  2YZ3 A;  2BFK A;  1ZTC A;  4D1T A;  2OHJ A;  4FEK A;  2OHI A;  4AX0 B;  3DHA A;  4TZF A;  5B1U A;  3IE0 A;  5EWA A;  1ZNB A;  5LCF A;  4C1E A;  5ACR A;  5K4N A;  3ZQ4 A;  5AHR A;  3T3O A;  4RBS A;  2P1E A;  1DDK A;  3IEK A;  2Y87 A;  2BC2 A;  5HH6 A;  5ACX A;  4UWO B;  4D1V A;  5ACU A;  5A87 A;  5HH4 A;  2BFZ B;  4C1C A;  5LCH A;  4EY2 A;  3MD7 A;  2XR1 A;  4J5H A;  2FM6 A;  3DHC A;  4Z6X A;  2ZZI A;  3BV6 A;  3IOF A;  2BTN A;  3AF5 A;  5AYA A;  4DIK A;  5ACW A;  4EYB A;  4EYL A;  1KO2 A;  4BP0 A;  1Y44 A;  2ZNB A;  4Z5Y A;  1BMC A;  1YCH A;  2GKL A;  5FQB A;  5HH5 A;  1BC2 A;  3P2U A;  4HL2 A;  4Z5Z A;  1P9E A;  2BGA A;  2FHX A;  2FU7 A;  5ACQ A;  4ZEJ A;  2BIB A;  2WRS A;  4TYT A;  5FQC A;  2I7X A;  3TP9 A;  3AF6 A;  5HIS A;  3KL7 A;  3Q6V A;  3R2U A;  2WYM A;  5EV8 A;  5AXR A;  3I11 A;  3ESH A;  4ZNB A;  4UBQ A;  3RKK A;  2GMN A;  4O98 A;  5B15 A;  4NQ5 A;  4RAM A;  2HB9 A;  2YCB A;  2I7T A;  2YNW A;  4FSB A;  4TYF A;  2R2D A;  3X2Y A;  4XUK A;  5EVK A;  4YSK A;  4DIL A;  2M5C A;  1WW1 A;  2YNU A;  3H3E A;  4WD6 A;  5LS3 A;  5EV6 A;  4D02 A;  4NQ2 A;  2NYP A;  4GYU A;  4UWR B;  3BK1 A;  4C09 A;  5B3R A;  3RKJ A;  2YNT A;  4D1W A;  2BR6 A;  4HL1 A; 
#chains in the Genus database with same CATH topology
 4B87 A;  3F9O A;  3KNR A;  4RM5 A;  4TZE A;  5K0W A;  2M5D A;  5AHO A;  2Y8A A;  4UA4 A;  3VQZ A;  4Z7R A;  1X8I A;  2YNT B;  2Q9U A;  5EW0 A;  4AD9 A;  2FU6 A;  1KR3 A;  2P4Z A;  3FCZ A;  3IOG A;  4PVT A;  4D1U A;  5K4K A;  1QH3 A;  1JJE A;  5A0T A;  4XWT A;  3PG4 A;  4BZ3 A;  1HLK A;  5HIQ A;  1WRA A;  4UAM A;  1L9Y A;  3KNS A;  4EYF A;  3SW3 A;  3LVZ A;  3VPE A;  4RL0 A;  3I14 A;  3SPU A;  4EXS A;  1XM8 A;  2CG2 A;  4YSL A;  2BG8 B;  3SD9 A;  1YCG A;  1X8G A;  2WHG A;  5FQA A;  3S0Z A;  4ZO3 A;  4NQ4 A;  3SRX A;  1VME A;  2H6A A;  4KEQ A;  2CFZ A;  4LE6 A;  3A4Y A;  3T9M A;  5ACV A;  5AXO A;  4U4L A;  3JXP A;  4C1H A;  2CBN A;  2QDS A;  4FR7 A;  4XWW A;  3QH8 A;  1JT1 A;  4NUR A;  1YCF A;  3IEL A;  5A23 A;  1K07 A;  4GCW A;  2FU8 A;  5EHT A;  3ZR9 A;  4KEP A;  2I7V A;  5EVB A;  4CHL A;  2BG2 A;  5ACP A;  1XTO A;  1M2X A;  5KIK A;  2VW8 A;  2NXA A;  3I13 A;  1E5D A;  4P62 A;  2GCU A;  2BFZ A;  2XF4 A;  1A8T A;  2Q42 A;  5EVD A;  2ZO4 A;  2YNV B;  2BG7 A;  3IE1 A;  2OHH A;  4JO0 A;  4TZ9 A;  4AWY B;  2CFU A;  4UWS B;  1JJT A;  1VGN A;  2DKF A;  1KO3 A;  5DPX A;  5K4M A;  2Q0J A;  4EFZ A;  3I15 A;  5A0V A;  4AX1 B;  2QIN A;  2BG6 A;  4AXH A;  3I0V A;  4Z67 A;  2Y8B A;  4RL2 A;  4YSB A;  2FU9 A;  2YHE A;  1X8H A;  5LCA A;  2QED A;  2P97 A;  3X2Z A;  5AEB A;  1ZKP A;  2A7M A;  5ACT A;  2FK6 A;  2BMI A;  4TZB A;  2P18 A;  4J5F A;  2QJS A;  4F6Z A;  3FAI A;  4ZO2 A;  3ZWF A;  3X30 A;  5KIL A;  3T3N A;  3BK2 A;  4HKY A;  3DH8 A;  1BVT A;  4V0H A;  4EXY A;  4GYQ A;  4Z60 A;  1VJN A;  5HIP A;  2GFK A;  3PY5 A;  5LMC A;  2AZ4 A;  2YNV A;  4NQ6 A;  2UYX A;  2E7Y A;  3G1P A;  4C1F A;  5EH9 A;  4F6H A;  2DOO A;  4H0D A;  3SFP A;  4PDX A;  5LLD A;  4C1G A;  3IDZ A;  5AJL A;  5A5Z A;  2GFJ A;  2BG8 A;  2ZWR A;  5LM6 A;  3BC2 A;  2AIO A;  3ADR A;  3AJ3 A;  4UWP B;  2Q0I A;  5HIO A;  2WYL A;  4C1D A;  2WYM C;  5LE1 A;  3IEM A;  3PY6 A;  1A7T A;  2NZF A;  1DD6 A;  1WUO A;  3L6N A;  3RPC A;  2NZE A;  5AIJ A;  2BFL A;  4PVO A;  4AWZ A;  5IQK A;  1WUP A;  5LSC A;  1DXK A;  3DHB A;  1MQO A;  4RAW A;  3ZNB A;  5ACS A;  3IE2 A;  1SML A;  2QDT A;  3X2X A;  1QH5 A;  3SBL A;  2FHX B;  3WXC A;  2YZ3 A;  2BFK A;  1ZTC A;  4D1T A;  2OHJ A;  4FEK A;  2OHI A;  2CG3 A;  4AX0 B;  3DHA A;  4TZF A;  5B1U A;  3IE0 A;  5EWA A;  1ZNB A;  5LCF A;  4C1E A;  5ACR A;  5K4N A;  3ZQ4 A;  5AHR A;  3T3O A;  4RBS A;  2P1E A;  1DDK A;  3IEK A;  2Y87 A;  2BC2 A;  5HH6 A;  5ACX A;  4UWO B;  4D1V A;  5ACU A;  5A87 A;  5HH4 A;  2BFZ B;  4C1C A;  5LCH A;  4EY2 A;  3MD7 A;  2XR1 A;  4J5H A;  2FM6 A;  3DHC A;  4Z6X A;  2ZZI A;  3BV6 A;  3IOF A;  2BTN A;  3AF5 A;  5AYA A;  4DIK A;  5ACW A;  4EYB A;  4EYL A;  1KO2 A;  4BP0 A;  1Y44 A;  2ZNB A;  4Z5Y A;  1BMC A;  1YCH A;  2GKL A;  5FQB A;  5HH5 A;  1BC2 A;  3P2U A;  4HL2 A;  4Z5Z A;  1P9E A;  2BGA A;  2FHX A;  2FU7 A;  5ACQ A;  4ZEJ A;  2BIB A;  2WRS A;  4TYT A;  5FQC A;  2I7X A;  3TP9 A;  3AF6 A;  5HIS A;  3KL7 A;  3Q6V A;  3R2U A;  2WYM A;  5EV8 A;  5AXR A;  3I11 A;  3ESH A;  4ZNB A;  4UBQ A;  3RKK A;  2GMN A;  4O98 A;  5B15 A;  4NQ5 A;  4RAM A;  2HB9 A;  2YCB A;  2I7T A;  2YNW A;  4FSB A;  4TYF A;  2R2D A;  3X2Y A;  4XUK A;  5EVK A;  4YSK A;  4DIL A;  2M5C A;  1WW1 A;  2YNU A;  3H3E A;  4WD6 A;  4AV7 A;  5LS3 A;  5EV6 A;  4D02 A;  4NQ2 A;  2NYP A;  4GYU A;  4UWR B;  3BK1 A;  4C09 A;  5B3R A;  3RKJ A;  2YNT A;  4D1W A;  2BR6 A;  4HL1 A; 
#chains in the Genus database with same CATH homology
 4B87 A;  3F9O A;  3KNR A;  4RM5 A;  4TZE A;  5K0W A;  2M5D A;  5AHO A;  2Y8A A;  4UA4 A;  3VQZ A;  4Z7R A;  1X8I A;  2YNT B;  2Q9U A;  5EW0 A;  4AD9 A;  2FU6 A;  1KR3 A;  2P4Z A;  3FCZ A;  3IOG A;  4PVT A;  4D1U A;  5K4K A;  1QH3 A;  1JJE A;  5A0T A;  4XWT A;  3PG4 A;  4BZ3 A;  1HLK A;  5HIQ A;  1WRA A;  4UAM A;  1L9Y A;  3KNS A;  4EYF A;  3SW3 A;  3LVZ A;  3VPE A;  4RL0 A;  3I14 A;  3SPU A;  4EXS A;  1XM8 A;  4YSL A;  2BG8 B;  3SD9 A;  1YCG A;  1X8G A;  2WHG A;  5FQA A;  3S0Z A;  4ZO3 A;  4NQ4 A;  3SRX A;  1VME A;  2H6A A;  4KEQ A;  4LE6 A;  3A4Y A;  3T9M A;  5ACV A;  5AXO A;  4U4L A;  3JXP A;  4C1H A;  2CBN A;  2QDS A;  4FR7 A;  4XWW A;  3QH8 A;  1JT1 A;  1YCF A;  3IEL A;  1K07 A;  4GCW A;  2FU8 A;  5EHT A;  3ZR9 A;  4KEP A;  2I7V A;  5EVB A;  4CHL A;  2BG2 A;  5ACP A;  1XTO A;  1M2X A;  5KIK A;  2VW8 A;  2NXA A;  3I13 A;  1E5D A;  4P62 A;  2GCU A;  2BFZ A;  2XF4 A;  1A8T A;  2Q42 A;  5EVD A;  2ZO4 A;  2YNV B;  2BG7 A;  3IE1 A;  2OHH A;  4JO0 A;  4TZ9 A;  4AWY B;  4UWS B;  1JJT A;  1VGN A;  2DKF A;  1KO3 A;  5DPX A;  5K4M A;  2Q0J A;  4EFZ A;  3I15 A;  5A0V A;  4AX1 B;  2QIN A;  2BG6 A;  3I0V A;  4Z67 A;  2Y8B A;  4RL2 A;  4YSB A;  2FU9 A;  1X8H A;  5LCA A;  2QED A;  2P97 A;  3X2Z A;  5AEB A;  1ZKP A;  2A7M A;  5ACT A;  2FK6 A;  2BMI A;  4TZB A;  2P18 A;  4J5F A;  2QJS A;  4F6Z A;  3FAI A;  4ZO2 A;  3ZWF A;  3X30 A;  5KIL A;  3T3N A;  3BK2 A;  4HKY A;  3DH8 A;  1BVT A;  4V0H A;  4EXY A;  4GYQ A;  4Z60 A;  1VJN A;  5HIP A;  2GFK A;  3PY5 A;  5LMC A;  2AZ4 A;  2YNV A;  4NQ6 A;  2UYX A;  2E7Y A;  3G1P A;  4C1F A;  5EH9 A;  4F6H A;  2DOO A;  4H0D A;  3SFP A;  5LLD A;  4C1G A;  3IDZ A;  5A5Z A;  2GFJ A;  2BG8 A;  2ZWR A;  5LM6 A;  3BC2 A;  2AIO A;  3ADR A;  3AJ3 A;  4UWP B;  2Q0I A;  5HIO A;  2WYL A;  4C1D A;  2WYM C;  5LE1 A;  3IEM A;  3PY6 A;  1A7T A;  2NZF A;  1DD6 A;  1WUO A;  3L6N A;  3RPC A;  2NZE A;  2BFL A;  4PVO A;  4AWZ A;  5IQK A;  1WUP A;  5LSC A;  1DXK A;  3DHB A;  1MQO A;  4RAW A;  3ZNB A;  3IE2 A;  5ACS A;  1SML A;  2QDT A;  3X2X A;  1QH5 A;  3SBL A;  2FHX B;  3WXC A;  2YZ3 A;  2BFK A;  1ZTC A;  4D1T A;  2OHJ A;  4FEK A;  2OHI A;  4AX0 B;  3DHA A;  4TZF A;  5B1U A;  3IE0 A;  5EWA A;  1ZNB A;  5LCF A;  4C1E A;  5ACR A;  5K4N A;  3ZQ4 A;  5AHR A;  3T3O A;  4RBS A;  2P1E A;  1DDK A;  3IEK A;  2Y87 A;  2BC2 A;  5HH6 A;  5ACX A;  4UWO B;  4D1V A;  5ACU A;  5A87 A;  5HH4 A;  2BFZ B;  4C1C A;  5LCH A;  4EY2 A;  3MD7 A;  2XR1 A;  4J5H A;  2FM6 A;  3DHC A;  4Z6X A;  2ZZI A;  3BV6 A;  3IOF A;  2BTN A;  3AF5 A;  5AYA A;  4DIK A;  5ACW A;  4EYB A;  4EYL A;  1KO2 A;  4BP0 A;  1Y44 A;  2ZNB A;  4Z5Y A;  1BMC A;  1YCH A;  2GKL A;  5FQB A;  5HH5 A;  1BC2 A;  3P2U A;  4HL2 A;  4Z5Z A;  1P9E A;  2BGA A;  2FHX A;  2FU7 A;  5ACQ A;  4ZEJ A;  2BIB A;  2WRS A;  4TYT A;  5FQC A;  2I7X A;  3TP9 A;  3AF6 A;  5HIS A;  3KL7 A;  3Q6V A;  3R2U A;  2WYM A;  5EV8 A;  5AXR A;  3I11 A;  3ESH A;  4ZNB A;  4UBQ A;  3RKK A;  2GMN A;  4O98 A;  5B15 A;  4NQ5 A;  4RAM A;  2HB9 A;  2YCB A;  2I7T A;  2YNW A;  4FSB A;  4TYF A;  2R2D A;  3X2Y A;  4XUK A;  5EVK A;  4YSK A;  4DIL A;  2M5C A;  1WW1 A;  2YNU A;  3H3E A;  4WD6 A;  5LS3 A;  5EV6 A;  4D02 A;  4NQ2 A;  2NYP A;  4GYU A;  4UWR B;  3BK1 A;  4C09 A;  5B3R A;  3RKJ A;  2YNT A;  4D1W A;  2BR6 A;  4HL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...