4UAOB

Crystal structure of apical membrane antigen 1 from plasmodium knowlesi in complex with an invasion inhibitory antibody
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPSSMSASLGDRVTITCQASQDIGNNLIWFQQKPGKSPRRMIYYATKLANGVPSRFSGSRSGSDYSLTIISLESEDMADYHCLQYKQFPLTFGSGTRLEIKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Plasmodium knowlesi Apical Membrane Antigen 1 and Its Complex with an Invasion-Inhibitory Monoclonal Antibody.
pubmed doi rcsb
source organism Plasmodium knowlesi
molecule tags Cell invasion
molecule keywords Apical merozoite antigen 1
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uaoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uaoB01
5AAWA 3P2TA 4AEIL 3NFPA 4I5BB 3X11A 1OGAD 2X4TB 2EO1A 5LKNA 4JPIB 4X8XA 5J1TC 1IKNA 5I1HH 4JFYA 3CFJB 1J8HA 1HEZA 3T1WA 4F15B 1NFDB 1OGTA 3K74B 4D0BA 2H32H 5A43C 1W72H 5K59F 4WU7A 4WJ5A 4OGAD 3UYPA 3IFPA 4H5SB 1J8HB 1HEZB 2EDBA 3BD4A 3L7FA 1UZ8A 3EFDL 1XF2B 5BJTA 4LARH 1VCAA 2LE9A 1B0GA 4PIRF 2DI7A 2IQAA 3REVB 1HINL 2XTJB 5HVFB 4J3UA 2WSKA 4MNHA 3D3VB 3WHXA 4XMPL 3PV6A 5TPWL 4H8WC 2CDFA 3NIDF 2R4SL 5F7YC 1SJXA 3ZDXF 3SKOA 4QXTA 4OM1H 3M17B 3PL6D 3SPVA 1ZS8A 5IMMB 3AFLA 3GMNA 2Q7NA 2XYCA 3BRGC 1KFAH 1MLBA 4LHUA 1I1AA 2BY3A 1RZJH 4CVXB 3V5HA 5IVZB 3OZ9H 4LNVA 1QTYT 4BELD 5GJTL 4NC2B 1AO7D 2E8ZA 4C59B 3ZMRA 5JXAH 4A2MA 4PB9H 3QP3A 2OI9C 5EO9A 1KCSH 1V7NL 3O9WD 5IVXB 2IPTL 2HFEA 1EH9A 4GQ9H 1NFDA 2I26N 1T1YB 4NC1C 3TVMA 2GJ6A 5C9JA 4JFQA 2AXHA 3PP3K 3FAXA 4FQLH 4OCNC 4PYGA 1X5GA 1U6AH 3T8XB 3HPJA 3F7PC 1VEPA 4O9HL 4EZMA 1DLHB 3GKWH 5DHVA 1P5UA 4TUJB 4QHNA 4NQUA 1Q9LA 1QLRB 3OR7B 4MAYB 1A14L 5JZ7D 4ZOEA 5FYKD 3ZKXC 2CRMA 5DD3H 5E7BA 5IROA 3QCTH 1Q0YH 1XGTB 4XRCA 1PG7H 1I3UA 4YAQB 3OKMB 2A83B 3QIBD 4JFEA 3ZE1E 5D7KE 2EE9A 4JFXA 5EUOE 4OLZH 1B0GB 3BT2L 4KK6C 1LQSR 1ZLVK 4MNQD 4X83A 1EVUA 3KPRA 2E9WA 3EJZD 3VWJD 3S36L 1RVFL 2ZNWA 2R1XA 2HJKA 5DWUL 1FGNL 1QFWI 2MNUA 4HMCA 4HKZA 2GTWA 4RGND 5FYKH 3SJVB 2VLRB 3CSYA 3QQ9C 5F9DC 3TA3C 3L3KA 5D6CB 4NN7C 3MR9A 1NLDL 4PJEA 5DK0B 5JNYB 4NRYB 4XWOD 3LN9A 2DM7A 5DHYB 2VZ1A 5BMFH 4Y4FA 1JF5A 3RWGB 1YN6B 2W0PA 4LLYB 3QO0A 4XWOC 1OAYL 3QIWA 2AEWA 1OTUD 3NA4A 4P2CG 1FO0H 4XPAL 1QBML 4J3WA 4A2LA 4NQDA 1KJ2H 1QSZA 4M00A 4HQQL 2BVOA 1HE7A 2V9QA 2NY4B 4KROC 3L6FA 3TJEH 4X4XA 1MCCA 4N0FB 5GGTH 2PO6B 4LPYA 1Q9OA 2G2RB 4ODVH 3SKUD 1IC7H 1LVEA 2X4RB 1OD9A 3AXLB 4KI5C 4PR5A 3ULUE 2PR4H 4KUZH 1A4JA 4QNPE 4K71B 4KRPC 4ELMF 5E08L 4MS8C 3T3PF 4DGVH 3LEXA 2DQUH 3IU3A 1DQJB 1WFOA 3NTCH 5IBUB 5IP4A 3BDXA 3EO1A 1ERNA 1HHJA 4ZXBC 3MREB 4KVNH 5LXGL 1LO4L 1NDMB 2EDHA 2WWMC 1J9CT 3FT3B 4Z7WE 1HYRC 4BSVA 3MFGB 5D1XB 1MFBL 4RDQG 4XCFL 2W65A 1KCKA 3EYVA 2C9AA 5JHLH 2F9BT 2OL3H 3PQYD 3QFJE 3E3QE 2FH8A 2APVA 4F33A 1YEHH 3ROLB 3W9DA 1CYGA 5D2NB 1X4ZA 5L88L 1JP5A 2MSPA 1SBSL 4PLJC 3MLXL 2VN7A 2F5BH 4PV9A 5BRZD 1XR9A 4HC1L 3KYOB 1IEAB 3RKDC 1RZ7H 2YMXL 1XR8B 1GXEA 1TETH 2CIIB 5KVDL 1WLHA 1EHLL 2DLFL 3RPKA 3MCKA 4MQSB 4Y5XC 3JV4B 5BJTB 1CCZA 4N9GA 1NCDL 1F45A 4X6CE 4Z9KB 1KB5B 4XXCA 2Z8RA 3ILPB 3VGFA 4FQHA 3WFBH 1WSST 2D7TH 2E9BA 4AYFA 1KLUA 5MEQB 3SGDI 3BKCH 4MNQE 3DPBA 3Q0HA 1UXSA 5F3BA 1BREA 3CK0H 3QQ4A 1R5IA 4I5BA 4Z7NE 2XFXA 3K8KA 3T0BA 3P30H 3BPLC 1BBJB 3UO1L 1FV1B 5A3IC 1E27B 1BLNA 4HUVB 4UQ3B 3MRMA 1CT8B 3MRHA 1MWAH 3MA9H 5GSVB 4ZD3H 1VKXA 1JPST 3GDBA 3DECA 1FV1A 1LK2A 1WZ1H 5JQ6L 4JANA 4P4KD 2V9RA 4ZUSB 2ATKB 1ZHBA 2A74B 3VFNB 1V7NH 3ARXA 2ESVA 1LWRA 2E27L 4OZFA 4I1NB 2GTZB 1G6RH 2X4OA 4NFBA 5TGBA 2GSGA 1V7ML 5A2FA 4GSDH 4ENED 4KHXH 4U0QB 3E8UH 1YECL 3BEWB 4MHHI 2Y5TB 5FYJL 1MJ7L 2AJ3B 2EIBA 3P11H 2NZ9C 4OFYD 1AXSA 3O11B 4MD0A 3BWUC 1WICA 1S7TA 4PJCB 1T0NB 1ACYL 1D5XA 5DYOB 2X7LB 1HK6A 3R8BB 3JWDL 5K9OB 2CIIA 4LLVB 3EYFA 2PKDA 2HLAA 5D6DC 4DW2L 1KYOK 4GMSH 1FNEA 4GRMB 1GZPB 3LIZH 2BSRA 4TUKH 4KUCF 3BVNA 1NJ9B 2B1HH 3RU8H 3LS5L 5I8EA 4YEFA 3BT2H 1LD9B 4UQ3A 5GS0H 5IV2A 5FM4A 2NY4D 2P8PB 3K4ZA 4KGJA 3ZO0A 4LASH 2QQQA 4M48H 4K2UL 2OX5A 1II4E 1JNLH 2DTSA 1AH1A 1N0LA 5T5NG 4GG6A 1FRGL 1DP0A 1QUNA 1R6VA 3QZWB 1IAMA 3VD7A 4ONGL 5HHVL 3V6FB 1I9RH 3JUZA 4GBXC 4BZ2L 2W9EH 3DYMA 2HJKB 2PYFA 4OGYH 2J1KA 3QIUA 4MD5B 4QXWA 4PJHF 1DVFB 3MLWH 3MV9E 2XQBL 1NGPL 4L1DA 1IM9D 3VCLA 32C2A 3EJZC 3WLBB 4JO1L 1CFTB 4OZFB 4YHIA 2NY1D 4RZCA 3NH7L 5JO5A 3VGAC 3SO5A 1S7VB 3MA7B 3PWVB 4IJ3B 3QNXB 5DJXB 5HYEA 4NWUH 4M1DH 4X6EB 1J1OH 2H6PA 2VDPL 3NN8B 4KAQL 5DJZB 3EFFB 5C0ND 3IRZA 3S9DB 1MAJA 1OF2B 4RISL 3WEXB 4YXKH 4PD4K 1LGVA 3WIIL 1JRHL 4F33B 5KSBA 1DANU 3ZE0F 3BZEB 2ORBH 1U2CA 4QYOA 1T5WA 3PHQA 4EEEA 3RWGA 3LQAC 4LLVA 5LQBL 4UTBH 4DOHB 1F42A 4I0KA 4R7DB 4K9EL 1MFNA 3CU1A 4LU5L 2XNAA 4X6DA 3SGKA 4N90D 3QFDB 3PL6B 3X3GH 3OKKA 2GKIA 5IFJB 1YDPA 1AJ7L 2GTWB 4UB0H 1MCPH 1S9XA 5FECA 2EDDA 3GBNH 3GI9H 1U3HA 4Y4HA 2XQYG 4LLDA 2IANE 1NUGA 3MGTA 2HT4C 5D1QD 2XPGB 1U8OA 3DXAE 1JHTA 4K71C 4KTDH 3VU2A 1D9KC 5I1HL 2G9HB 4HH8A 2X4QA 5BV7L 1D5MB 4OZIF 1BWWA 4PGEB 4ZFFB 1J0ZA 4GRLA 3KAAA 3WCYA 5C0CE 2ZUQB 3O3UN 3OV6A 1K6QH 1KPUA 3P9WB 2P5ED 3I50L 1J7VR 3SDDD 1WBXB 4JVWA 5D7IB 3WN5B 4DUWA 5GRJH 2VH5L 2AABL 4I2XA 1R24A 3ULVL 4P9ML 2EIZA 1IM3A 3VXUE 4OKVB 4PYHA 5DMIH 1ZGLA 5DQJA 4NQDD 2XKNA 4O2FA 3V0VB 2BRRH 4XPTL 3M8OH 3WFDL 2VB5A 5FEBA 2Q8AL 1OTTC 1F5WA 4R26H 5C1MB 5BZDB 4M6OL 5FYJH 1HXMB 5EO9B 3MLZH 1EHNA 4KVNL 4PJFB 4M7ZB 2D03L 3MBED 5AEAA 3N50A 3CFKA 3FFDA 3AMKA 3RGVB 2J12B 3FOMA 2DI8A 3X11B 4YFLF 4UDTB 4ETYA 1PSKH 3MROB 1S7UA 1YEFH 3QHZL 4LDOB 2D9CA 2DJUA 1A3RH 4TTGA 4P5MB 1QRKA 2C3WA 1UB5A 5E9DD 1A1MB 5D7LA 4QY8B 1HKLH 3ARPA 3C5JB 4P46B 5HD8D 2ED9A 3S3SA 1CN4A 1KJMA 5MENB 1NKOA 1DQQA 2OTWA 5HI3D 1SJHB 4MQXC 2W91A 1R3HA 5I1IH 1CG9A 3KNBA 3SO3B 1RD6A 1LO2H 3FQWB 3HG1E 5I75C 4LVNC 4QRPB 4TVPL 4X99B 3FOMB 5EBGA 5BS0E 1CFNA 1F3DH 2Y06H 3O4LD 4H88L 2Z9TA 1S7XA 3PHOA 1CFQA 1E4XL 1HSAA 2BJMH 3GIVA 4FXKA 4WFGE 2VDRH 3QHFH 3EOBA 4EBQH 3P4LA 1VFAA 2XWJB 4FFWC 2Y72A 4S2SA 4WRLA 4J7RA 4LGRB 5FKPB 2P8MA 5CKAA 5LVEA 2OK0L 2M1KA 2XOTA 5DUBA 5M95B 5T1MB 3RUGE 4G8GA 3QUZB 4LSVH 3ZT5A 3MXWL 2VLRD 4TSAL 3VG0L 2HJFB 1RVFH 3P73A 5HGDB 1FO0B 5HBBA 1C1EL 3F65A 1NGZB 2Y6SC 3TO2B 1D5IH 4Q9BA 4UIKL 3VFVA 3M17A 1ZT4A 4ZAKD 4Y19E 1BBDL 3T0VA 1A02N 3BPNC 1OAUH 3QIUD 3QXDB 4NUGH 3X13B 2DLFH 2E9JA 3LQAL 1KIPA 5C2BH 3EO0A 5DMGD 3PWVA 1YEIL 4GKNA 1CGWA 3K80A 3BQUD 2ZUTA 1RJLB 3WFEL 4PG2A 4MQ7B 3U7WL 4BQ6A 2HVKA 3P4MA 2FO4A 1Z3GH 1J12A 1MUJA 2QQKH 4ZFGL 3RWHB 4LHJB 5DFVD 4X4MA 2VXSL 3F6IA 4G3YL 3HPLA 3W2DL 3V6FA 3EOBB 3O3AB 4H0GA 3BZDA 4KKBC 5E94B 3QB7C 3RTQA 5C09E 1MREH 3U9UB 2XNAB 4X6DB 1M71A 5ITBL 4R6UA 1UWEH 4KKBD 1JPGA 2CO7B 3K2MC 3VXMA 4P5TB 8FABB 3MJ9A 2FL5B 3A6OA 1V5JA 4RFNC 4ORGB 5IIEB 3TA3B 4ZYKA 1A7PH 3ZSTA 4DN4H 1JGVH 3IKCA 5FUZH 2ZCHL 3VXSD 2P7TB 4GRLC 1K3IA 5CD5C 3B2VH 4BZYA 4M03A 1KELH 3DBXA 3DVFA 3S98A 5LAXB 4G42A 4F7CA 3VXTA 1WIPA 2VXTL 1OQXA 1YYMH 3V52H 4RRPG 5TQ0H 5AWNL 4BZ1H 3OR7A 2HLAB 1XF1A 4L3ED 2VO5A 3D0VB 4X4ME 1XF3A 1UVQA 2ZOLB 3QUZA 2CH8A 1A4KA 3FO2A 5SWZA 4JRXE 4LSRH 2LVEA 4WWID 5IMOA 1ONQA 4QTIH 1ACYH 1F3JA 4HX1B 3GGWB 3VI3F 3WDIA 4TQEL 2GT9B 5C6PB 5K93A 2NQCA 1ORQB 3BYTA 5C0BE 2EKSB 4RX4A 2BFVH 3VFSB 4YHLL 4TRPL 4YGVB 4CAGA 3GSOA 5KS9F 5I16A 2E7LC 3IJHB 3CU7A 1P7QA 3WD5L 3VXQB 2BDNH 2ZJSL 1INEL 4RBPH 4XH2B 3KG5A 1KLGA 3RKPA 4TUKL 3RNKB 3ZKMD 4MB5A 2P46B 4H20H 1JUFB 4C56D 4UNVA 5H8DA 5I19L 2XZAL 4HIEA 1JGUH 1LILA 1CK0H 2VL4A 5CD3A 2OTWB 1HILA 3QBTB 5AZEL 3WS3A 2VR4A 1IGJB 4MJIA 2J6EH 3T0EA 1E27A 1T66C 4JRXA 5F3HA 3OAZK 3IFNL 1C16A 1OAKH 3V2AR 4UQ2B 3BN3B 4NQEB 2XG4A 4HS6A 5C0BA 1FFNA 5D7IE 3REVA 4B41A 3SE4C 1A0QH 2BVPA 2FIRT 4FABH 5DD5H 1A6TB 3CFEA 3DO3A 3OGOE 5IB3B 1AR1D 2JJSC 3SKNA 1K8IA 3C5ZB 1EO5A 3NCBB 3IDMA 1HSBA 1ZT7B 5FGRA 1RZIB 2X09A 3IDGB 1UWGL 1MIEH 4NUJB 5T5FL 3RDTA 2W9DH 5GISH 3ALWA 3TM6A 4CVZA 1T7XA 1MVFA 3RVTC 2BVTA 1A6ZB 4HUUB 1EAPB 1J8HD 1KIQB 2OLDA 3H9SA 1B0WA 3MXWH 1LEKB 1JRHH 4L5FH 1W0YT 2GUOA 5EZIH 2YWZA 2IANB 5D7IA 2W0FB 1XIWA 4F7EA 1B9ZA 4DQOL 4UTBL 3PGDA 4JLRB 1DDHB 1PFCA 3TVMC 3IU4L 5D1ZD 5ANME 3FRUB 3WSQH 2ITCA 1RZGB 1YEIH 3JTTA 2A38A 2BHYA 3HLAB 4UV4H 5EWIL 3KYNA 3FT3A 3W0WB 4FXGB 4PRPD 3UC0L 5L2KE 5C71A 3DV6A 1WEJL 3QEGL 3QDAA 4FQXD 1IC5H 4YHOH 1QA9B 3V7AE 5BXFA 2UVEA 4TSAH 3MLXH 4I9WD 3H9SE 5IBTL 1QSED 5FGSA 1U8IB 1GHFL 4PJ5B 1RMFH 2R1WA 4UBDD 2DDQH 2XXMB 4XPGH 4CNIB 3VWKB 4URTB 4QCIA 1BP3B 5DQDH 2WP3O 5T1LA 3NPSB 4X7EC 4C4KT 4NKQB 5GRJL 3ECBB 1BIIB 2AXFB 5TE6L 4APQC 4Q0XL 1RIVL 1I9JL 1VKXB 4OCRL 1YY9D 3QG6B 3L6FB 2R0WL 5TH2B 1L7TL 3CMOH 4OQ1A 1H0DB 2KH2B 2JCCF 3E2HC 4N1HB 4LAJH 1NMCB 3UJTL 1D9KD 4UOJA 1YYML 4PJIA 5HHMB 2C4FU 5AWNH 4BZ1L 3KYKH 4TYUA 4H8WL 3TT1L 2GY5A 1IAKB 4G8FB 3Q6GH 1LE5A 4Z7OF 2OQJA 3AC0A 4NP4L 3CZFB 3LV3B 1CFVH 3ZE1F 3RUGF 1ZKAA 4HK0B 3WIHL 2HJLA 3RIAF 3T4YA 3Q5TA 1J8KA 3GJEA 2QSTA 3FT2B 4XHJD 5CGYC 2ZP0T 3HLAA 3MRQB 3U36B 1IGTB 4LLQB 4YAQA 4LVHC 1LP9B 3EJJX 4JRXB 4CRPA 4MMZC 1MJ7H 3CX5K 2P4AB 5IV2B 5K9JL 5GGQL 1RULH 2X1WL 4J3SA 5I15H 2M2DA 3KLAB 3BPCA 4FFZL 3BJ91 2HKHL 2DQDL 1UC6A 3HNTH 3CFCL 2MQ0A 1IJ9A 2WINA 1BZ9A 3HUJB 3BD3A 5CEZL 1VHPA 4OLXH 5HHPB 2DOCA 1X5LA 4L9DA 5EORL 3L5XL 1NCCH 2HT3C 4XH2A 5C2UB 3QEUB 3ZT7A 3G04A 4PJXF 4ZSOA 4CDHA 4GW4B 2OMBA 4S1DC 4PRIA 4UI2A 5FYLL 3V9FA 5GQBA 1U3JA 4I4WB 4LSVL 3TNMA 5FA4B 2EDTA 4ZFOL 4S1QL 3GNML 5AAMA 4OF7A 3B9AA 4X9FA 3BW9A 1DLFL 1UWXK 3AMLA 5J06A 3D0VA 1DCLA 1S9KC 1HOCB 2CLVA 1BECA 5F8RC 1SJHA 4RFOL 1CLYH 2BC4B 4HK3J 5HHVH 2R56H 2ZCLL 5E70A 4V1DB 1YEKL 1YNLL 2B4CL 2Y23A 3QUZD 2ITDA 5I74B 1ZLWK 3MRHB 5D7LB 4FABL 4MHHG 2AJXH 3C6LD 4IMLB 4XI5C 1HQ4B 2DIAA 2VLJE 1R5WA 2O5ZL 4Y5VA 3F12A 4QO1A 4M7JH 1DLHA 4M7LL 1A7OL 2EXWD 4LCYB 2F53A 4MXVF 2FX9L 4WEBL 1YPZB 5T5FH 2YHGA 3RNQB 4OLWH 4PP2B 1ZE3C 5GRVL 1P84K 4ZDHA 4OT1H 4Y4HC 5DEFB 2VQ1B 5JW5B 2YBRB 3CFJA 3VDCA 4PY8J 2RFXA 2K3TA 5FA3B 4JO3H 3CLFL 1OW0A 1D5IL 3T77A 5IHUL 4Z0XA 1QNZH 1MSPA 4Y5VB 5HDLA 2QEJA 1J0KA 2X70B 5LBSH 2VLJA 3FONA 3TCLB 3V52L 3SE8L 2MFNA 1J05A 3VXTB 5C0BD 3QHTC 2Y7QB 3TV3L 4KJPC 3EFDH 3MRDB 2V5TA 2XZAH 3LN4B 1RUKH 3EBAA 2F53E 3ZKNC 1J5OH 2ZUUA 4PJFE 1VADB 1I9IH 3EDFA 4HF5L 4BQBA 1SY6A 3KPLB 5E08H 2HH0L 3MFFA 3B9KC 2D7MA 1T20B 4GAGL 2O5XH 3CNKA 4FOMA 5FA3A 3F6LA 5ICZA 1U3HB 3KPMA 1N0XH 3MUJA 1P53A 5I9QB 2JB6A 3IT8D 5IMKB 4POZD 5C70A 3SO3C 3WL9A 2FBOJ 4PRIB 4N0CC 4CADA 3SCMA 4RDQF 5C0FA 3L5WB 1G9NH 3KHOA 1QSFA 2DL2A 1QRNE 4PJFF 3HZKB 4M6MH 4LBEB 4Y2DC 1BQUA 3NIFE 3RX8A 3UTTE 3NCYS 1D9KA 3BP4B 1MFAH 5MEOB 4GOSA 1U8MA 2AJSH 3NPZB 1WVZA 4XVTL 4LPVA 4TNVF 4BA8A 3JV6A 1A7QL 3KXFD 4GQ9L 4KROD 4KXZH 1YQVL 4X80L 1N8ZB 3U30B 5HHQB 3OKMA 4OBSA 3ARBA 3CLEH 3QRGL 4ZOCA 4F57L 2Y7QA 5ALBL 2CDFB 1OP3H 3HMXL 4CW1B 8CGTA 3C6SA 1XCQB 2J4WL 4DQOH 4PRPB 1JYXA 2VL5B 5GZNC 3MRBB 1E4KC 2AK1H 5F9OH 1RPQA 3QT2A 2V5RA 4PJ8B 2NZ9D 3T8XA 4IJ3C 5DK2B 1YJDL 2BP3A 1HKLL 5D6CA 4EKXA 5F21B 2EYSB 1JBJA 1FC2D 1T66D 4NHUB 1XCTB 5HHOB 1RZJC 4D0BB 5D7JD 3EZ8A 4KJWD 3UBXA 1FVDA 3RZCB 1NBVL 4BKLB 1ES0A 5F71A 5DMGC 1G84A 1T5WB 3UJJL 4GG6F 4PJIB 4X5WB 3SDDB 4M1CD 2EDNA 2DWDA 1K4DA 2HKHH 2VLKA 4P46C 3RWIA 1MCOL 4IMLA 1TZGH 2A6JB 2EDOA 4JR9H 3S36X 5I8KH 3PV7A 4NNYB 3WMSA 4G8EA 3KPOA 4U2ZA 3SGEI 1KIUA 5EFIA 3FO9B 1VGKB 1M05A 4LPXA 4EUPG 2D31A 3O81A 3B9DA 3IDIB 3RJQB 4P99A 4OSUL 3GSNH 1HIML 4I0PB 4IBLT 3BHBA 3UJTH 1CLZH 1AFVL 2BVEA 4BM7A 4HG4K 2F54B 2OR9H 1I1YA 1WT5C 3VMOA 3QIUB 4MD5A 5DTFA 1M7DB 2GJZA 3BZFA 3IFPB 3DGCR 5GS2H 1NCAH 2I25N 2DKUA 4FG6D 4Q9QH 5DFWH 3MV9B 1AGDA 5GGSY 4R3SB 3WFHA 3B5TA 1L0YA 5HD8C 3H9YA 3EYUL 1PEWA 2YRLA 4FQPA 5JR1H 3OQ3B 4PJAB 4W68A 1T0PB 2HN7B 4G9FD 3OJVC 5EZIL 2Z0BA 1LE9A 1X4YA 4U1KB 5CILH 1VDGA 5HGAA 3RP1A 5J0BA 1RZ7L 1DDHA 2YMXH 3F12B 5IJKC 1RIHL 3QDMD 3LZFH 3RDTC 4KQ3L 1V3KA 3GBML 4OCMC 5CBAA 1B4RA 1OL0A 4V1DD 5D96C 5HYFA 3P0VL 1NJ9A 1KOAA 5GRUL 1PJ9A 5E8OA 2XICA 2ZSVA 4X98B 1BEYL 3S35X 4JQXA 1YEDA 3PXJA 3C6LB 5D2NC 5ESQA 1IRAY 1R5IB 3TT1H 2EE2A 1R3LA 3SGEH 1XF5A 5FYKU 4M1GL 5BRZA 3O41A 1BQLL 3IETB 1IC5L 4P9HC 4DFIA 3IXAA 2XACC 1D6VL 3SDXF 4NN5C 1F6AA 5CJXC 2ZCHH 1A6VL 5IBTH 2UYLA 4HXAH 4JHBA 4P2OB 1T03L 2P5EE 3AY4A 2ADFH 3V8CA 1R3IH 3DMMD 2P5WB 2FGZA 2I9TB 2UY6A 5DSCB 1CXFA 1KCVL 2FHBA 5JHDE 4ZAKC 1YEEH 4MJ6B 1ULVA 3MLWL 4FNLL 1C12A 5EPMA 5CJXA 4S1QH 3TIDB 5IK3B 3C6LA 5ESQB 1RUKL 3KYOA 3C87A 4JG0H 2CO6B 5T1DH 2AS5M 5DJ6A 3UBXG 1DEEB 4XNXH 2PW2A 1YMHB 1A7RL 4RWYH 5SWZE 3CFDB 1G7IB 3IXTB 3O8XA 4M9OA 4KRPB 3MRLB 5DMKA 5JW4R 5CFHA 2ZJSH 4HS3B 5DJ6B 5EU6D 2XN9E 3MLVL 2F54D 1UH3A 2DF3A 2QKIA 3BP6B 4Q2ZB 4CL7A 1A6ZA 4HUUA 1MEXH 3NBNA 3ARED 5E2TH 1S78C 1WZMA 1D5XB 3X3GL 5A2LH 3FO1B 3HG1B 4HIHB 3RZWA 2KKQA 4U1MA 4TSBL 1RZFL 1OAKL 5EBLA 4DK3A 2NXYC 3VRJB 5L6YH 2YC1B 4PJ7E 2IBGA 4U0RB 3IU3B 3AY4C 1S5HB 3QQ9D 4ZODA 1QVOB 3IETA 1Q38A 4HH9B 5TDOB 2ICWJ 4FQ2L 1MJUH 2AQ3A 4LCWD 5INCA 1CBVH 2F53D 4HC1H 5CLTA 3TPUA 2WBJA 5LCVH 1PQZA 1Q9OB 5ACZA 1FLTX 3MV7D 1FAKT 5J1AB 4JM4L 4H1LA 1MCIA 5IT2L 5FIEA 4KI5E 3LEVH 2VAAA 1BLNB 5DURB 5IVXF 1TFHA 5I1CH 1K4DB 1CGVA 2WBJB 1TCMA 2EE3A 2OL3L 4GAJH 4HWEL 3EYVB 3ILQD 2X41A 8FABA 4NDMB 5DEGB 5F3BB 1RK1A 4OV5B 2IC2A 3GMMB 1T0MA 4NOFA 3V4VH 3WIFB 3BYYA 3EDDA 5DYOA 2IQ9L 3J7HA 4B53A 1FPTL 5D7LD 1A3QA 1IKFH 2V2WA 2I9TA 3OR6B 4GXUN 1ZWIB 4KDTC 2RCSL 4PTTB 5ISZE 1KENH 2PO6C 4M6OH 2FLRT 2FGWH 2R8SH 5C0CD 4TUOB 4Z78B 3GMOA 3KXFB 4KROB 1PYWB 2APTA 3HB3C 2F19H 4OCSH 5SX5H 1MHPH 2DWEB 1OGAE 4KTYA 5IESL 1A6AB 4JAMA 4IRJC 3P0GB 3R1GH 5JPMB 3DBXB 5DS8B 1AO7A 2LV4A 5TDPA 5HYQA 3BKML 3IJYB 1AR1C 4NYLB 4JB9L 1P7QD 3NZHL 2XT1B 2ICEA 3BI9X 3OJDA 4J3OC 3AS2A 3W11D 5KBNC 1IAIH 5D71H 3G6JE 3O9WB 2CR6A 2HP4A 4MNGB 4CVZB 2PYEE 5JDSB 3MA9L 2Y06L 2VKWA 4CVUA 1OW0C 1I75A 3GSNB 1HHKA 2OR7A 3PQYA 1NFDF 1CXKA 4HKZB 1FYHB 1CXIA 3SKNB 5F9WC 5AZ2L 3P9MA 2DQHH 1P4LA 3SDCA 1CR9H 2YR3A 4MA8H 4M7JL 1U3HD 5SWZB 5BVJB 2VL5A 4GSDL 3RJDA 4XVJL 1GAFL 3IDYC 1VFMA 1YEEL 3SGJA 5HHOE 3CVIL 4DWHA 4ELMB 5FF6A 4OKDA 5EC1B 4U0RC 4FG6C 2VE6A 3SPVB 2GHWB 4F2MB 1TJIL 4XX1E 4MJIB 2OZ4L 1PD6A 1VFOA 4OZFG 4PLKD 1HCFX 2B2XL 4NC0B 3L9RA 5D2NA 1JMZA 5F9OL 4OCXH 3ROOB 4RGMB 4JPWH 1TITA 4R4BA 1A9BB 3UDWC 4WO4D 3DVNA 3KPQA 4L9LB 1U91B 3TFKD 2CKBA 3DRQB 3R4DA 3DVGB 3FB8A 4EOWL 5IEHA 4MDIA 1XF2A 4ZUWB 3LKSA 1R5VB 1I8LC 1NGPH 3RGVC 1B0RA 1UACH 3SJVA 4YDIH 1NEZB 3VFUB 5C6WH 2DBJA 3QDHA 4IOFC 3GGWA 4IDLA 1U58A 3QUYC 4HZLB 4NIKB 3T2NH 4JVUA 2CMRH 4GG8A 4L3EE 1BX2B 1HWHB 5EIQA 3NFPB 4HWNA 5HGHA 1BQHA 1J0HA 1X9QA 4P2RA 3KPLA 2ZKHL 4OQTL 2W07A 4O2CA 3C6SB 4JQIL 2F58H 5D7JC 4NQCA 1KJMB 3ARGD 1FJ1A 2G2RA 2HKFL 1UJTA 3MRDA 5ERWB 2BY0A 5CS7A 4Q9RL 3X14B 3S5LA 1W72L 2CIKA 4HUKB 2AEPL 4M7KH 2IBZX 4NNXA 1MCPL 1XAUA 3ZTJG 4AIXA 3ARGB 1XGYL 3MNVA 4BKLA 2BNQB 4HPYL 2R69L 4JHWL 4CMHB 2RB8A 4Y5YA 1I8IA 1UA6H 2EDYA 5ENWB 4MCZB 1A6VH 2Z93B 1HI6B 4NCC2 4C54A 4JJHA 1LEGA 1LNUB 3NMEA 3IDYB 2DBLL 4MVBC 1CF8L 1L7IL 2FGWL 1NUDA 3WNLA 3EJYC 5FUCC 3RWFA 4XCYA 1MLCB 2AJYH 3WNPA 1I7UA 3RWDB 4H25A 3PWUB 2P1YA 3HKFA 3EO0B 4EQ2A 1IARB 4PB9L 3LCYA 5I0DA 3H9ZA 4X6FA 5AYQA 1T3FB 4N0CD 5FO7B 2WUBH 5DD6A 3QA3A 1BGXL 1A6AA 1TNNA 3DX8A 1HKFA 3NABL 2H41A 2R9HC 3ZYJA 4XPBL 1H3XA 2DI9A 2HTKC 3S37H 1FNHA 4UDTA 5B22A 2EDQA 3GKWL 1ROWA 2G5BA 2R0LH 2HTKD 2I07B 4KKLD 4C83A 1N6QL 3VGDA 1FVEB 4HAGA 3MLTB 3DLQR 2VH5H 2QL1A 4HWBL 3O4LE 3T09A 3V5KA 3OKNA 3QFJD 2CGRH 1MIEL 1KELL 2A0LD 2JKXA 4KMTL 4GKOA 2EECA 2H26A 1LK3L 3K4AA 1F2XK 3SGJC 4LCIL 3HZYB 4U4BA 2ICEB 1KJ2B 2R4RL 1FBIL 1MCRA 3MLVH 4PJ9A 3LH2H 1IQWH 3KLAA 4PREA 4YHML 1IC4L 2FECL 5IFAH 4UINL 5E5UB 1MJJB 3GHBH 3TBTB 2YZ8A 1XIWC 4XB8A 4B0MM 1MQKH 3BSZL 3KDMA 1AP2B 4MCYA 3LHPH 1F00I 4UNTA 2ZOKA 2VXQH 4OFIA 2WNGA 4WHDA 1VENA 4QRUB 2KQNA 3TZVB 1N26A 3O4LA 2FWOA 2CK2A 1H15A 5ACMA 1JFQH 4F37F 3G5ZA 5E1HB 3D6GA 4Y16C 3VRLF 2Z8WC 4GH7B 2YD3A 2NY4C 3OPZL 4JRYE 4X7TA 3VXOA 5IBLC 1L6XA 4D0CA 3WE6A 4E0RA 2J5LB 3HMXH 5M94B 2CSPA 1F58H 5IW1A 3B3IB 4GG6B 2DS4A 3JTTB 4DGVL 3TPKA 2H2SD 1VSCA 5ADOL 1A9BA 1LK2B 1RUML 1T80A 3U0WL 4LKXA 3U4BH 4X6CB 3EDJA 3H0TB 5F1IA 4HXBH 4XCCH 3A67L 1SHMA 1W0WB 1NGXA 4Z7QF 3SKMA 3HZMA 2PW2B 3MBEA 4Z7VA 1MVUB 2HKFH 3BXNB 1KSRA 1DQLL 3OMZA 4M5ZH 4IOIA 5HYJA 4D9RE 5B3JF 1H3WM 5HYSB 3U9PH 1VERA 1CZ8H 4BQ8A 3GSRA 1OP3K 1KBGL 3KYKL 2H3NB 3ZYOA 3DO7A 3TC9A 3T2NL 5KSAB 3U7YL 1BFVL 4LDEB 1FZJB 1JNHA 4PRAB 4NKMA 1JHLH 4R96B 2X10A 1MPAL 1C5BL 4EN3B 4D94A 2CR3A 3DX9B 3P9LB 4FQ2H 4K94C 4RMSA 2HTLC 3DX6A 5GGRA 3HUJF 1BJ8A 4LSUL 4MNGA 4ZS7H 3QJFB 1CDBA 1S7WA 3NPSC 3V4PL 4Z7VE 1RQ5A 1ZHBB 2A74A 3JWNC 1DBKL 12E8H 4OLZL 2FJFA 2YD4A 2P8PA 3D69A 1JI2A 5DF0A 3RFZC 1HYSD 4UU9B 1A5FL 5ID0A 2GQHA 1EXUA 5DJAB 3BGMA 4APQA 4DZ8A 3CGTA 4JZJA 5CD3B 2J3SA 4NQXB 3S4SG 4LRNL 2VITB 3E6FB 2DL9A 4X8JB 5DRNA 5HGAB 2D7TL 4JAMB 3ZE2E 3HR5B 2WUBL 5HDQL 3CSPA 3B5HA 3WUWB 3RX7A 3IGAB 1XIWD 5DD3L 1TPXB 3RNKA 5IB5B 4O02L 4CMMB 3L5JA 4R2GC 3IDGA 5LCVL 4QXGH 4CGTA 1UM5H 3MXVH 4JY4A 4RWHA 4DKAA 2NY2B 2CKNA 2UWEA 4ACPA 5F7UA 2VJXA 1J0JA 4Y8DC 3LPWA 3RY5A 3E2HB 4KK9C 2G5RA 9CGTA 4XT1C 2YEZB 4XBGB 2DQJH 4KH2A 5IWLA 3LPFA 3PABB 1LP9E 4DUXA 4OFVA 3QNZB 2ARWA 4F9PA 1LK3H 5HI4C 4MWFA 2ADFL 3D85D 2XA3A 3DHJA 5LGJA 4K3HA 1RU9H 2ID5A 3VD3A 2C1PB 2V17L 3TBWB 4H1LB 3H8NA 5BCAA 5I8EB 1RIUL 1C5CL 4EUPA 3OWEA 2VOTA 1GOHA 4M62L 4WI7A 4XNMB 4JRYB 5KAQF 1QBLL 3TVMD 1YN6A 3ET9F 3EYFB 1QSFD 4HPOL 2UZIH 4X6CF 3JWDH 5IFHL 2Q7YB 2X44D 2PW1A 4HWUA 2R1WB 2IAND 4GRWB 2OXHA 1FFOA 4IHOA 4K3JH 1TIUA 1TNMA 2P48B 4RFNB 5GHWL 1ZA3A 5BZWB 3MV8B 2R69H 1JHKH 1FVEA 4JHWH 5CHNA 4YFEA 4HK3N 5IMOB 4N90E 2VN4A 4JFHE 1IAIM 5FOBB 4RAUB 1K5NA 4OB5L 5K33A 1DBML 3UTZB 4P57A 4EXPX 5EZJA 3LRSA 3GKZA 1RZ8A 4FZEL 1RURL 4LRIA 4HBCH 4M7KL 1YNTA 2C5DC 3TV3H 5CJOH 4FQCL 4APQB 1U9KA 2W0FA 4TN9A 3OX8A 4HSQA 1EGJH 4YBQD 5C8JB 1YMHA 4CN1A 5JMOC 1RFDL 4YFLI 4Z5RA 1UEMA 3VG9C 2YA2A 1OARH 4U05A 4OBRA 3EYSH 4G6AC 4NJAH 2UUDH 5DWUH 1WCBB 4XP5L 1GHFH 1QEWB 1FVDB 4ZPTB 3DX9A 1KACB 5FYKL 1I3GH 5HHME 4JFFE 4O51A 1NMAH 5JORB 4FXLA 3QCUL 3T3PE 4U1LA 1CGXA 4ZOBA 1DANT 1L0QA 4IRSB 4NSKB 2GT9A 4ISVA 1JPSL 2CRYA 1I85C 4XCNB 5DK2A 5E03A 2VUOA 5J13B 3SJVD 3DETC 3UXFA 5I6XC 3CDFA 2FCBA 3UZQA 4JQXC 2QLVB 3P4MB 2NCMA 3L3HA 5JQ6H 1FORH 3MX0A 1NLBH 1CL7H 2X2YA 3LQMA 4WWKD 2L4OA 3WFBL 5J9PA 2X9XA 4S1RL 3FO9A 3QDJB 1KTDB 1G0YR 2VDKH 3EIFA 4MB4A 2J88L 2P8LB 4FRWA 4YWGH 3RKDD 4YDJA 2DDQL 1C5DA 1WFUA 1MAMH 1WWAX 3GSVA 2JJVA 3ARFC 1N64H 1I7ZB 1HXYB 5HI5D 2W60A 5ISZA 1IKNC 5K9QG 2R56L 4NN6C 2VSDA 5CGTA 1UH2A 4WY7L 2ARJQ 4GG8B 3ZDYF 3H9HA 1FNGB 2QHRH 3KYMB 3D2UA 3R1GL 5E6ZA 2NY6B 3WFHB 4WU7B 4HKJA 1Z9MA 2ZUWA 1TZIA 3VFSA 2P45B 2BCKB 1KXVC 1V7MH 3EOTL 3GSWA 2F53B 1HHJB 4AT6A 2R2BA 1PKQA 4Y5YC 1P4IH 2NY5C 1RUQL 3TZVA 4LK4A 2AJZA 1YY8B 5I2IA 4JFXB 4P4KC 4UAOC 1R3HB 1TTGA 1R5WB 3O4OB 1A4JB 4GRWH 1CDIA 1MQ8A 4KPHL 1WBXA 2PYEA 2VUYA 3N9GL 4P5KA 4Y16A 2VXQL 4PRPE 4LKCB 1KPRA 4RFEA 5SWZD 3MRIA 3THMH 1U36A 2X70A 3UAJD 1OTSC 1BZ7A 4L8CB 1UYWH 4C58B 3GMPA 3H42L 4TUJA 3B6SB 3MOAL 4X9IA 5EH1A 2HT4D 1J0IA 2K9UA 5DJ2B 3SDAD 2RFXB 2F8XC 1TXKA 3HMWH 4IMKA 4OUUA 3L3GB 3U9PL 5T3ZE 5F44A 1PKQE 3TVMB 1KN2H 2DQDH 4KKAD 1AKJB 4LCWA 1IGCL 4OJFH 5ENWA 3O2WL 4HWZB 2I27N 1EEYB 3U7YH 2K1MA 3T1FA 3L3GA 4ONGH 3KPMB 5H94B 5HTSA 1J8HE 3LKSB 1NAML 1ZGLB 3B2UD 3RA7H 3JVGA 1IAOB 2EEBA 5C0DA 1PX3A 5FM5O 3K8LA 4QRPA 5F7KC 2BSSA 3ULUD 4CVWA 3TBVA 3NVQA 1FG2B 2H9GB 3C09B 4M5ZL 2X1QA 4JO4H 3LS4H 4XRCB 3VWKD 3X14A 1KTRL 3O2DH 4YDJB 4DJMA 3WNKA 2BVQB 3GJFH 4LVOC 3B9VA 2FIKA 5GXBB 3B5GA 4HBCL 4EI5A 1CZ8L 2AK4A 5FB8A 2EIEA 3QI9C 4JFPB 5F7NC 3SE9H 4ZFFA 3LIZL 1N8ZA 5EU5A 2BVUA 3AROA 2DTMH 3L3DB 2DQIH 1YZZA 1X5IA 2ICCA 4LCWE 4PJ9D 2R0ZL 1MAKA 5FKAB 5DLML 5B39G 3EGSA 2B4CH 3U7AA 5ITFB 1QOKA 3BP7A 4PTTA 1HH9B 5KAQG 1QNZL 2W9LA 2QSQA 5D1ZC 5B3NA 1C7SA 3G08B 4XCEA 3OAUL 3V0VA 1CGYA 3TN0A 1CTNA 5T1KD 1BJ1J 5J89A 3OGCA 1CFNB 1U93B 1X6LA 2J8OA 5JOEA 3D85B 1FL5B 5JIHA 3R06B 4MSWB 4JY6B 3U7WH 3DVNB 4FQXC 3K1KC 4FQQA 4MMXC 2A6IB 3ARBC 4W4OA 1L9NA 4TSCL 5CEYA 3BRFA 2PXYB 2J8UA 3L1OH 5FHBL 2GITA 4U6HA 4KTDL 3STLB 4WI6A 5DD0H 1IEHA 4UAOB 2VABA 3RBSA 4RWYL 3PIQA 1KF9B 3G6JF 3O3DB 3RRQA 3EAKA 5ESVB 3PWJB 4NJAL 4X0KB 1RHHA 2YOCA 5ETUB 3TPUB 4GRMA 1FE8L 4Z76A 1RUAL 1MCKA 5E2VH 5ITBH 1B6DA 2XZCH 1X5HA 3I50H 2YS4A 4RAUA 1DQDL 4ZUTB 2YC1A 1BX2A 5EBWB 4DAGL 3ULSB 2CUHA 4J3TA 1XGPB 2VQ1A 1CS6A 4JQVC 3DJ9A 5SX5K 5CILL 3TYFA 1FORL 5EUOA 4YDKH 4KQ4L 3O45A 4ZS7L 3NCYP 1CD0A 4G7VL 2OBGA 4Y1AD 5DRXA 1GRWA 5IQ7L 3GMLA 3O6LL 1FZOB 3PHSA 5E4EB 4JGMA 2O5XL 2JELH 4QOKA 2DQTH 3F7VA 4L9LC 1CD1A 3W9EB 5B4MC 5I74C 2EEAA 4N1CA 5TE4L 5D72H 4OKVA 4LPCA 3DMMA 3QNYB 2YZ1A 4YXLH 3O6MH 4KXZI 1INDH 3GRWA 5I1LB 1V3MA 4PUBH 4NYLA 1BQLH 4IDJL 4HHAB 5D2LB 1I3RB 3OAZH 5TH2A 2PCPA 1KJ3L 1CT8A 4JPVL 2GW5A 4V1DA 3QUKB 4WI8A 4OCYH 3O8XC 3QNXA 1OTTD 3I02A 5F72S 2PTUA 4EI6B 1EGJL 3LB6D 1UM5L 4U6XB 4HWEH 3G6DH 1H9VA 4KI5F 5ICYA 3L3HB 1MH5B 1YECH 3F8UB 1OVZA 2DM3A 3FN9A 4LASL 2VTFA 4D9QD 3RIAK 1I7RA 2A6DB 4YJZL 5EOQL 3HAEA 4MAYC 4QTIL 5FAAA 4PJ7F 2XI9A 4UOW0 4PJCE 5KOVC 4ZFOA 3S3JA 4FTVD 4FQXB 4OLVH 2P24B 1DQML 3UJIL 2R0KL 5BQ7A 1QFWH 3BZEA 1ACZA 3B4NA 3AU1B 2VLMD 5SX4I 5L2JA 5ID1B 1Z3GL 5C8JA 1EERB 2JJUA 1R0AL 4XNYH 1CLZL 1QBLH 1OARL 3VH8G 5DS8A 5GS2D 4PPTA 2DAVA 4AM0A 2UZIL 4J8RA 4WU5B 1BIIA 5CCKH 3MRJB 5GSRA 1MIMH 3QULA 4UIKH 1KTKE 1MRCL 2NY3D 1OLLA 4JO2H 1K2DA 4NUGL 2A77H 5MEPA 3C2AL 1OTSD 2DJSA 4LLMA 3M8OL 4DTGL 5AUMB 3RGHA 5D1XD 5C0EA 1M6OA 3IJHA 2MCPH 3C8KB 4PJCA 4NBZB 2PO6D 3QUMA 2BMKA 2ORBL 5IEKA 3OKDB 3ARQA 5FOJA 1C5CH 3EYOB 1YQ2A 4OB5H 1I7RB 3MODH 4AY0A 4R7NA 4ZFGH 3D39E 1IAKA 1KCRL 3C8KA 1X5FA 1GSMA 2V2XA 4WUKL 4ONFH 4LRIC 4PRNA 1AFVH 4PGDB 1NEZG 1T0MB 2EDLA 3JWOH 2Y6SD 5FK9A 1GZQA 5KSAD 4JGUA 4U1NB 4XNMA 1WFTA 4K3JL 4E5XB 1P9MA 4OF5A 4YX2H 5F3HB 5I1DB 4G6JL 1UWEL 4NQXA 4P4RA 4F7EB 3ZHLA 2E7HA 2OZ4H 2R0ZH 2NTFA 3VGAB 2BHUA 2HYMA 1MF2H 3ARYA 2FZ3A 4FQQB 4GUPA 5I1DA 5DXWA 2DWDB 3SDAB 4YHYC 3P4NB 3QR2A 5FUOL 4OCWH 5KSVA 1MCSA 5KSUB 3TNNB 2H26B 1OM3H 4OFPA 1WAAE 4JDVA 4R0LA 4QRPD 1J87A 3L3KB 5FGCB 5HDBE 1JZ3A 1HSBB 4ODWA 1KJVB 2V7NB 3HAEG 1JGUL 4LCWB 5IB1A 3T0EC 1BAFH 4D3CH 3TCXA 2BNUA 5T3XL 4MVBD 1AGBB 1CL7L 1HINH 5E2WH 4W6XB 4LLAA 4DUVA 5KSAA 5EBWA 3QUXD 1ZTXL 3L3JB 4HGWA 4X4ZA 3SHSA 3VXSB 3C5SB 5CJQL 4U1HA 1AIFA 5C0RH 2M8XA 4XP6H 1JK8B 3LKRA 4HIIB 3W5MA 1PG7W 4OV6F 1I3GL 1OQOA 5DD6B 3FFCB 1KIPB 4JLRA 5DD5L 5J6GA 5E8OB 1SJEB 1SYVB 3W39B 2NX5D 1IEBB 1WAAA 1VACA 3MTRA 4KZDL 2BX5A 4Z77A 2AEQH 5GGUB 1U8JA 4Q9RH 4XZUB 5E8EB 2UWEE 5TE6H 1NGQL 3LN5A 1ZEAH 4O5LL 2MJWA 3HI6H 2CK0L 3S7GA 2CRIA 3JBG7 5IK3A 4XX1G 4OCYL 3CX2A 4KHTL 2COQA 4YXHH 3MBXL 5DHYA 2P8MB 2NY2C 1XMWA 43C9B 1WAAF 2M26A 1I3VA 3V5KB 1TVBB 4LFHD 3I2CL 1H3UA 4HIXL 4R26L 4HUWB 1K8DA 1CIUA 4K23H 3SEPA 3OXSB 3T4AB 1JGLL 2D03H 2DKMA 1OAZL 1CD8A 1A6WL 2GJZB 4C83B 4JG1H 2C4XA 2ADGB 2V5SA 5E9DE 3LS4L 4OZ4B 5IT2H 1KJ3H 1X7QB 3DYPA 1U8PA 3MV9D 3V6OA 3CDCA 4L8CA 2I60H 5L7XH 1YEDB 1GGCH 4KRLB 1XR9B 4XGZA 3KS0J 1NGXB 3C5JA 3O3DA 4X5XB 3QWRD 2W0LA 5CEZE 4P23B 3OJ2C 2EDRA 3BPNB 5F9WB 4PJGA 5D1QA 2RJMA 1T4KB 2C3GA 1MJUL 3CDYA 3P77B 5JOFA 4EN3C 5F7DB 5KW9L 1S8DA 1JF1B 3H7LA 3U1SL 2OS7A 1Y18A 3C8DA 5CGYD 1E4XH 3LQAH 5H94A 5CZXD 1DJSA 1Q94A 2BOBB 4ZNCD 4WWKC 3OAUH 1DQDH 1HXMA 3LMJL 2C1OB 1QSEE 5FHAH 5GZOC 3DTXA 3MC0A 1HI6A 5HHNB 5J6HA 3U2SB 3ZDZE 2ZCKH 5ALCH 4WW2A 1P7KA 1PZ5B 3P4OA 4RGOL 3T0ED 1R5VA 2XTLA 5CP3H 1QR1B 3FQUA 2XWTB 1VGEH 3ARFD 4YEEA 2BSTB 3ESVF 1KNOB 2R4SH 3DX7A 4NZRH 4NZUH 1GOFA 1FH5H 4L3AA 4U3XA 5EU5B 4X7SH 3B9KA 3DI2B 1AXIB 3SQOL 1IBGH 4NRXB 2VRAA 4HLJA 3WIHA 1CE6B 2G60L 3GO1H 4JQVA 4F37K 1WIUA 3I6LE 3W0WD 1P2CB 1J1PH 1MQKL 3BSZH 3DV4A 2A6IA 1C08B 3N85L 4YO0A 1I7UB 3QCTL 3T77B 2XPGA 2NTSP 2I9LA 25C8H 4OI9A 3FTGB 4YNYB 2XN9D 7FABL 4R97B 3I85A 5E24E 3QUYA 4LLUA 3H2WA 1PDKA 2BCKA 5GJSL 1CXHA 4K7PL 3E1F1 3CJJA 2YK1L 5DQ9B 1BQSA 3HPLB 1AKJA 4F7MA 4CADB 1FNAA 4PJ8C 3D87B 2HWZH 3KJ4C 5GRWA 4HKXB 3H9HB 5DA4A 3VFOB 4NQVA 3VFRA 3PHQB 2FATH 2VNCA 3RWCB 4CJ1A 5L88H 5ADPH 4APQD 5C0AB 5C7XH 4YO0B 1G7LA 4L1HA 3QFJB 3D9AH 3TN0C 4EDWL 1A9EB 2DQCL 4U1GC 1E0OB 3I75A 2IWGA 3OF6A 2N56A 1RY7B 4JEGB 3LN4A 2A1WH 2AV1B 5EUKB 1L7IH 4PJDB 2IFFH 4HAFA 2HRPL 2APWA 3ARDC 3QDJA 5SWQB 3I75B 5BO1H 3O0RL 1RIVH 5D7LE 5I1KH 3RVXC 3ZHDA 5CCKL 1ZEAL 3FT2A 4HT1H 4C56E 1VPOH 1FYTA 3AAZA 1H8OA 2XWBB 1AQDB 4XXDB 3VE0A 5IQ7H 4H5SA 3UMTA 1QSFB 2DQEL 5T1LD 3OB0K 4NM4L 2B8OT 3E8UL 1DQMH 3F62A 3QDME 2PTTA 4Y5YB 1MCBA 1YNLH 3THML 1X4XA 3Q1SH 4U3HA 1XZ0B 1NC4D 5KVFL 1PX4A 4WV1B 5IEHB 4TTDD 3QDGD 3WXWH 3I6KB 5E8PA 1UACL 4JM2A 4GRLD 5K9QI 2IH3B 4QHUB 1BZ7B 5I1JH 1A7BA 1EPFA 3OX8B 4FTVB 3FQXB 3TT3L 5CSZA 4KC3B 4GQPH 1SJEA 2AGJH 1A1OA 3V7MA 3UZVB 4GW1B 3VXSA 5DEZA 4Z18A 4IS6B 3HC0B 5IFAL 5DZNA 3FL7A 2Z35A 4PB0L 2CJUH 2MKWA 2NY3B 4YIQB 3IDUA 4NKMB 5GGRY 4OQTA 2J8UF 4I3SL 3LHPL 3RIFK 3KPNB 2HTLD 1EEQA 2WBWB 3PGCB 5HY9A 5I1EH 3QQNA 1SM3L 1JNNH 1ODAA 2EH8L 2GSGB 3GSRB 4Y19B 2YPLB 2VDOL 2AK4E 5IBUG 1YYLH 5FO9B 1RJYB 1OHQA 3LS5H 2ITCB 2HFGL 1AQKH 3TYGH 1H3VA 4OZIB 3MBEB 3WLWD 4OD1H 2F5BL 5AD0A 1G7JB 3C6LC 2Y5EA 2NLJA 1BOGB 4FZ8H 1IEBA 2DBLH 4LLWB 1MHHA 3RVUD 5GGVL 3VXSE 1NCNA 5KVDH 2IAMC 3HNTL 1ADQH 1CLOH 4JDTL 3BFOA 4GS7B 4LLQA 3GRWL 5KG9A 2MCPL 5KSAC 5DJYB 1MPAH 5DC0A 2DLGA 5L8KB 5F96L 3F58L 3BQUC 1U8QA 2FEDC 5HPMA 1J11A 1BD2E 1L7TH 2CGRL 2V2XB 1FFRA 4HQQH 1Q72H 4QTHB 4ZFZB 1PW3A 1R0AH 3O45B 3ZTNL 3SGKC 1YQVH 1LO0H 5A16B 1QA9A 4N5UA 1YDPB 3FN0L 1NANI 4K7PH 5F1NB 1LE5B 2DRUA 3N1QC 5MP6L 5E6ID 1N0XL 4ZPTA 5FGBA 5CIPA 5TQ2L 1A5FH 4WFFD 5DGRA 2CLZA 3ZLQC 5I1AB 3NTCL 3VFPB 4ZUSA 2LVCA 4NKIH 3UTPE 1KB5H 2GSIA 1TVHB 2X4NA 4F8TA 4PTUA 4W4NA 1IGIH 1KCUH 4R4NC 1ZA6A 1YEJH 3EFFA 4NNPL 1N3NB 4D9LL 2X4UA 3QH3B 1U8NB 1I8MA 5T3ZD 4M3KB 1G6RL 1BD2A 1KEGH 1N6VA 1RFDH 3DMMB 1FFPA 2HG5B 5BO1L 1B2WL 4NZDA 3TBYB 1GYAA 2GJ6E 2FX9H 3WYRA 1KLGB 4FFYL 1X3DA 4L8SB 3T0EE 4ZXBA 2ILLA 5F9AC 5H2BA 1I1FA 1RZIA 3L3JA 1JNLL 2O93L 1F4YL 5DMIL 1PGRB 4PBWD 2VAJA 4LCCA 1PKOA 4Y2DD 2ESVD 4A6YH 3U6RA 1EFXB 5CJQH 3B8SA 3TLRA 3VA2C 3TFKC 1XGPA 1Z0NA 2ICES 5ESAA 4PJDF 3RY4A 4UDUA 4POUB 4FQJL 4EVNA 3P0YH 4RGOH 3HI1A 4UZGA 1NL0L 5I71C 3I3BA 5D93B 4NQEA 3VXUD 4JFEE 4IRSD 2AEQL 2HG5A 3MJ8A 3AXLA 3NIGE 1V05A 4NCDA 3QUXB 4RBPK 3MUZ1 5IQ9B 1FN4B 4DZBB 3MRLA 4HEPG 1NSNL 4HIJB 5C0JB 5DMKB 3GEWB 3KPRE 2BVOB 2V5YA 4UV7L 5D2LA 1A7QH 3UTSD 2XN9B 3TA3A 1N64L 3L3IA 2NX5A 3IDNB 1U8KB 5H35B 4IRJD 3D39D 2UUDK 3PDDA 4EVNB 3ZZ1A 2LU4A 3WJLC 4GRWF 4NZJA 4OAWB 4NCC1 2ZUXA 4MD0B 2R1YA 2NXZC 4BFBD 5F9JB 5GJSH 3TJHD 3WXVH 5HSFA 4NQED 4F9PC 2EH7L 1NBZB 3PJSA 4M1CC 3HI5H 5I1JL 4FQCH 5I1EL 2WBJC 1KBGH 1OWRM 1FSKC 1HZHL 4I8DA 1BVKB 3CH1B 3C2AH 4X80H 3WUZA 3VXPB 4D8PA 4ZAKB 3IGAA 1NCUA 4M1GH 2HLFD 1ZLWH 1CICB 5CAYB 4S1SL 4F57H 1MVUA 3MOBH 2NX5E 4P2YA 4YPGB 3SY0A 4F9LC 4HFWB 4X4XB 3RBGA 4WDIB 4DKDC 3CPLA 3EJYD 1DEEA 3LZFL 1JV5A 4WI2A 1FGVL 4NQSB 2EDKA 4OIIH 5C07E 5C6TH 3VGHA 2BJML 1U95A 4R97C 3QIWB 1EAPA 1G7HB 4DW2H 5DT1L 1SYSA 3CCHA 1EK3A 3ARWA 3BESR 2EKJA 5I1KL 3KJ6L 3VXQA 3GZKA 4HF5H 1H5BB 4PJIE 2A6DA 2Z4QB 3VJ6A 4W81A 1FDLH 2I5YL 2YA1A 4S1DD 1K4CB 4JO3L 3Q6FA 4Y1AB 3QI9A 4JFDA 4X99A 5EA0H 5J4MA 2FEEI 4NHCH 3FMGH 4NJ9H 4P3DA 1FYTB 2XKSA 4U1GB 3ARBD 4KKLC 4YC2C 1KENL 1UJ3A 1X5XA 1G7PB 4FHBD 1CLOL 1JGDB 1HNFA 4LGSB 5DDHB 3KWWA 2AABH 5C0AD 4R8WH 5IHLB 5E56A 3LKPA 1N5AB 4MGXA 1QKZL 3S88H 4X6CA 1CXEA 4FQIH 2PXYA 4JG0L 2Q86B 3GSNL 3PGFH 5C07B 4J2XA 1AD0A 4MX7A 2ADIB 1G9EA 1U92B 1J10A 5E8PB 4XP4H 1JWMB 2BNRD 4UT6L 3BP4A 2VDMH 2X6MA 3FO0H 3Q6FB 4Y1AA 3OB0H 2N7AA 2P43B 3ARFB 3M07A 4WUUA 3V5DA 1GGUA 5DJDA 3ISWA 1E6OL 5IVOA 2PTTB 1ZHLB 5EN2B 3G5YA 1ZHKB 5EUOF 5F6HJ 5HHNA 3KPNA 4M62H 1UKTA 1HH9A 2GFBA 4XNQB 5EOCL 4YDLB 1IGML 5I76A 5C09B 4OZGB 2MHAA 1AKJD 2VZVA 4IS6A 3DRQA 3DVGA 2OP4H 1UWXH 2ENYA 1J1XH 4F7PA 2VDLL 4PRIE 2IMNA 1AD0B 3VFTA 1EAJA 1B90A 3NCFB 5GHWH 3IJYA 2LAGB 5I8CA 1XFPA 2AV7A 2HFGH 4UMGA 1FCGA 3A6BH 2D0GA 3BP5A 3VFWA 2SEBA 4QY8A 1WTGT 4QKXB 4JG1L 3EHBD 1UFUA 2QR0A 1FO0A 4RRPA 4XMKL 4WI5A 4AEFA 5HVGB 1KJ2A 2R29H 2G9HA 3KR3H 2QV2A 3GBLA 4LP4A 4OTXH 1UB6B 4L8DA 4MSWA 5I8KL 1A21A 1Q1JH 4P59L 4G6KL 3NA9H 5H37G 2DYPB 5E9DA 4HV8B 2ED7A 3L7FB 1JE6A 2EEDA 3VGBA 5IESH 3RY6C 4NO0A 4KZEH 4D9QE 5EO0A 1I1AD 2QADB 3OKOB 1LO4H 4WHTA 4U33A 1TVBA 1TJGH 1MFEL 2YD2A 2Q7YA 5H37H 4QT5B 4KY1H 1NAMA 4ZUWA 1CL7I 3EGSB 1NCBH 5ICXA 1BZ9B 3HUJA 2H1PH 4HCRL 1T21A 4OFKA 3RTQC 5FDYA 5T1KB 2DQFB 1ZS8B 5JR1L 3SBWA 4WNQB 1IGYB 4K3EL 5EUKA 5IQ9A 1IGIL 3OKEB 4K7FB 1DVFD 2NY0C 4NNPH 1YMMA 1RIHH 3STZA 4U1NA 1AY1H 4XP1H 3L3OA 3ULUH 4HJJL 4WEUD 4U1HB 2VXUL 1NBYB 1YEFL 3QHZH 3RWFB 4MAUL 2WQRA 4G8GB 2OR9L 3O2DL 3MNWB 4IRJB 1NEUA 3QIBB 5MP6H 4NO0D 5GIRA 3SQOH 4PJFA 1WV7T 4L3CB 4GAJL 3VMPA 2EH8H 4I4WA 3WHE0 4Y8AA 4AEEA 3NZ8A 1BF8A 3UPCA 4LF3A 1Q9KB 1K8DB 4QF1A 3UC0H 3FCTB 1U8HB 2A9MH 3U0PB 2ARJB 4BH7B 3QXTA 3MUGB 4YHKH 1FDLL 3OKYA 1UCTA 3MNVB 3OXRA 3T2PA 4WFHE 3GIZH 4JHAH 3B6SA 3QULB 3WO4C 1RUAH 5TF0A 2FRGP 1HN1A 1L4IA 1CDCA 5IBLD 1UGNA 3UTTA 1BVLA 4GAFB 5IGXL 1OOAA 4AENB 4LVOB 2HWZL 4HWBH 3MQIA 1OCWL 2BSED 2R39A 1EMTH 1UB5B 4CDGC 1I85A 3LKRB 4HIIA 1IGCH 4FS0A 4YHIB 5L8LB 1MCHA 2FSEB 5D70L 2IQ9H 5FOBA 1MWAA 1DSFL 3ARRA 2UZYB 2IBZY 4ZQKB 3IYLW 3UPRA 4K8RC 3CVHH 1I9EA 2D2OA 2PYFB 4Q6IC 2IPKA 4POYA 2R1YB 3QEQE 3K4DA 1QFUL 1U3HC 4Z95H 5F89B 4QLRA 2F19L 4OCSL 2BNRA 5B38G 2GI7A 4OIAA 1B4JL 3FHAA 2DLEA 3LVEA 3UROR 4O2EA 3G9AB 4U6YA 4K7PX 5DJYA 2KUTA 3WKMH 5E2UL 5C09D 2ADIA 2VITA 5CWSA 1FG9C 1DE4B 4C55A 5D93C 3F7YA 4NKOA 1JFQL 5EU6B 1GAFH 1U8LA 1GC1L 4NT6B 3CFDA 3JUYA 2XY1A 4OGZA 4P4RB 1TVDA 3C08L 4PTUB 3D5OF 5CWSB 4AK1A 3HNVL 4H26B 6FABH 4MLSA 3EKCA 2DJ4A 4G8IB 5FO9A 4WFED 1XGUA 3QDMA 3PL6C 3UTZA 1TCRB 1I8KB 3FRPA 3QEQA 5IOPB 2JIXD 5E2TL 5CKGA 4Q97A 3D1MC 1DBAL 4G9DB 3GMOB 3WS6C 4PRHE 3HE7D 3VI4F 1G6RB 2R2EB 3IAGC 2XZQL 3K8MA 4X7TB 4UOW1 4BFEA 1LDPL 4M43H 3EYOA 5HYJD 3P0YL 2QHLA 4U1LB 4ODHH 4K55A 1TENA 5EC2B 3W0WA 3CFBA 2ZG3A 4P2OD 4FMKA 1T89C 4OFYA 1SYSB 1UADC 4N8VB 2VLRE 4WHCA 5TFSH 1A1OB 1MJJA 5KSBB 4ETQB 3DOSA 4WW2C 3MLUH 4NO3B 2G75A 2VABB 4UU9A 3F7YB 2AJUH 3FHQA 3AS1A 4NKOB 4QRTA 5F8QC 4AJ0A 4QHUA 4XC1H 4RIRB 3TZVC 5JXEA 2FO1A 4MXQD 1IZKA 4YDKL 1KJ2L 4O2EB 3W9EA 1GGBL 4QHMB 3G5XB 3VCLB 4PRHB 3I6LD 3W0WE 1GPOL 4M7LH 3KPSA 3PG2A 2E7BA 2HJLB 3VXUB 5B21A 1T5XA 2DIBA 4BJLA 3DIFB 3SOBL 1JWSB 3MREA 4C57C 1PZUB 4JVPA 4YXLL 1JN6B 5E00B 2YD6A 4P2OA 4G6ML 4MA1C 4AH2A 4PS4H 1H5BC 4IRJA 1FFOB 1OY3B 2XTJC 5C0EB 5TF1H 1CDHA 4UINH 1MWAB 2P5EA 3VMNA 1KB9J 3U4EB 4OV5A 4Q0XH 5L0QC 3ULVE 4KK8D 1UQSA 4XB7A 5FM5M 1ZSDA 3GMRA 1E6JH 1XR8A 1YMMB 3O6FB 4WW2F 2JCCA 3T65B 4U1IA 4X9HA 4MA8L 5HI3C 3CZJA 1UXWA 4HDIB 3I3DA 1DBBL 2DQTL 2QADC 1H3PL 3HHRB 2IADA 4RA3A 4G5ZH 4JN1L 1S9VB 1MLCA 1KIQA 3K81A 3NOIA 2P5WE 3I6KA 4BFIA 4PJGF 3MACH 3EDEA 4Z7OE 2Y4SA 3PUCA 1BFOA 3ILQC 2LFGA 4MA3B 3SE3C 1QP1A 3VXME 3RZCA 1T7WA 1IL1B 3G6JB 3CSYB 5DVOA 3P9LA 1GGYA 3UX9B 3RVWD 4ESKA 2OYPA 2DLTA 3MLYH 4PBXA 2BRQA 1IE5A 4L3CA 1HHIA 3QG7H 2E7CA 1S7SA 4JFFD 4OLUL 4GKZB 4HJ0C 3KPRB 5AG9A 2RBLA 1P9MC 3AAZB 5H2BB 4IIQB 4L8DB 3C09C 1Q8MA 4GW1A 1JGEA 2W38A 2V2TB 3DV4B 1SJVA 2WLZA 2OR8A 3HRZB 4M61A 4FFZH 5DK3A 3MLRL 1DLFH 4KKCC 1O5DT 1V8HA 1I9IL 2B2XH 3C60B 4NM8L 2XXCB 1IGYA 1IM9A 4QRTB 1P84J 4PRHD 1DFBH 4K94L 3MRMB 3UTTB 1QO3B 1HILB 4H25B 5A2IH 4FP8L 4QNPF 2HJFA 5KN5A 4JM2B 4YPJA 1QFWL 2W9EL 4M93B 1GGIH 3TIDA 1RJYA 5KVGH 4S0TD 3DETD 5TE7L 1U93A 4X4YA 5EU6E 1XGRA 5JNYA 3RDTB 3TJEL 7FABH 4HJGB 5EOCJ 2P44B 1DBJL 3IFOB 3ILPA 4EBQL 2E7LA 3NH7H 1YC7A 2XZQH 4LSQL 2IPKB 5TJWK 3BAEH 5LWYL 1D5BB 1TQBB 4QHLA 2DYPA 4KTEH 1MUJB 4FA8A 3ULVC 2B1HL 3RU8L 4UT6H 3FB8B 4ZTPH 3FO0L 3Q3GB 3JTSA 2EDJA 4K8RH 4NNXB 1U92A 3ULVD 1HXYA 4HS6B 4K23L 5C0BB 1EFQA 5CD5D 5SWSE 2YRPA 3VWJA 5FUOH 4N0YL 4XC3H 1MRFH 2UZXB 3TBTA 1MI5B 1UCBH 2QQNL 1CF8H 2K7QA 2XZZA 4XVUD 4YHPA 3FB5B 4L3EB 15C8L 3QPQD 5DHVH 3LPGA 1OGAA 5EU6A 1AI1H 1MFDL 4L4TD 1WBZB 2Y07L 3MRFA 1FG2A 5HGBB 4ODUA 3L7EA 1BQHB 4O00A 2ZNXA 3GK8L 4LLYA 4OZGA 5CZVH 4BSVB 1ZTXH 4YK4B 4OSUH 1M71B 2JJSA 5E8NA 2GJ6B 5C9JB 5F7EL 5T3XE 5BZDA 4PJ8D 2DB8A 1GPOH 4L4TB 3IFOA 5TDNB 1F6FB 4U1JB 2A0LC 4JRXD 5SWSA 3RWHA 3QCVL 4HCRH 5FYJU 1BWMA 4OLEA 1MREL 3C60D 1DR9A 3MXVL 1MCOH 2C3VA 4X7CC 1DEDA 1F8TH 3BHBB 1QLFB 3LEXB 3U4BL 3U0WH 1HQRA 4PP1C 5E6IB 4QRRB 5EOTB 3WIIH 1WIOA 2YD9A 3STZB 1WZ1L 5C86A 3BPCB 5MI0C 3S5LB 4KZEL 4OZHA 4PJCF 4TPRH 1NLBL 4KMTH 3E6HB 4LHUD 1HIMH 5CEXB 1KTLA 3MJ9H 4ZO8A 4ZTOL 3FQXA 5MERB 3INUH 5J8OA 4GRLB 2WP3T 1E4XI 4XPHH 4U2YA 1FIGH 4O2CB 1QPXA 4U31A 4ALAH 4YGAB 3BZ4B 1W72A 3HN3A 3IB4A 3Q5YA 3IF1B 3VH8A 5ECJE 3ARUA 1REIA 1PG7X 1U58B 1K4CA 2BNQE 3MUGA 3ZYZA 2A9ML 4WFFE 2QSVA 1S7SB 4ISVB 4DCQB 3HC3H 1J1PL 2L7UA 1SY6L 3DSFL 2NYYD 2BXZA 1HHKB 2NMSA 3ABZA 3PQYB 5BW7C 4CU7A 3WL9B 2C1OA 4GW5B 3UDWA 4FFVC 4MA3A 4MXWL 4DVRL 5D1ZA 3ZKSD 3GMMA 4PJ9C 3MGAA 5HJ3B 1FQ9C 4OLUH 4MAUH 2OK0H 4X7DC 2Q76B 1HHGA 1F4XH 3MFFB 3KPQB 4L9LA 5HI5C 4RQQB 1R24B 3KGRA 3WFZA 4L4VB 2FZ3B 4GUPB 1C08A 2GIYA 1CWVA 1B88A 1Z2KA 3GSVB 4YHMH 5EDXA 4E41E 1NDGA 2XTJE 4IOSD 5FO7A 2ICWA 4L3EA 2XTJD 2YWYA 5C0IB 1M7IA 5DJ8A 4O4YH 4U1IB 5JA9A 3CXHJ 2XG5A 5FHAL 2DN7A 2VDRL 3QHFL 3V6ZA 3PWUA 4NQCE 4EDWH 4OGAC 3FN3A 1S9YB 4Y5XB 2VXVL 3BUYA 5E99H 4MA7L 3ARDB 3LAFA 4U1SA 2X05A 2XRAH 4DGYH 1AXTH 3QWOA 4WJ5B 5IJKA 4WHTB 2AW2A 1S9XB 4EQ3A 5C0FB 3DURB 2VWEE 3FN0H 3BDYL 4MS8D 2CQVA 4PJAE 4FXKB 5FV2A 1P1ZB 5TQ2H 5L2KD 43CAA 4E41A 4M1DL 1S8DB 3CC5B 4LQFH 3V5HB 1EBAA 3GHEH 3IF1A 1FFPB 2OJEA 4X8JA 3KNBB 3PGDB 3C9NB 4XC1L 5F6HI 4F3FB 3WEXA 1KC5L 3GUTB 4P23A 5EU7E 4NKDB 2JB5L 5DUML 4HLZH 4P2QE 2H2PC 3MLSL 4AQOA 1NGWB 1LEKA 5KANI 3O3EB 4ERSH 1I4FA 5HHXL 1AGCB 4ZSOE 4NZRL 1W0VB 5TQ0L 1KXQE 1UQSB 4DN3H 3DROB 3MRNB 4Z6AT 4P2RB 1KN4L 4MJID 3KLSA 5EWIH 2MHAB 3OKLB 1UZ8B 1JN6A 5I30L 3TJHC 3P4OB 4I3GA 2Z4QA 1JL8A 5A2KH 2IAMB 3VXNB 4OZFH 1G6RA 2R2EA 4HKJB 4MXQC 4PP2A 5ACLA 5EIIB 2HRLA 2FYYA 3FZUC 4WTXA 4AQ1B 1K6QL 1F4HA 4JDVB 4P2QA 5LGKA 2AK1L 3I02B 5DQDL 1D6EA 4YR6A 2IBBA 3RWJA 5HGBA 4P23D 3UTTD 1AJ7H 3HE6A 1Q0XH 1W0WA 4WHYG 4Z7VB 2NTFB 2E3VA 3QUXC 2PCPB 3W39A 4JFOB 4JKKA 1AO7B 4XNXL 5CBEA 3AU1A 4XGZB 3L1OL 3O6FA 1YN7B 5JPNB 2OM5A 1Z9SA 2VXSH 3QQ3A 3N0PB 1S3KH 4HD9A 1JGEB 2V2TA 5C07D 1HOCA 2HN7A 4ZS6D 2DWEA 1RU9L 5IHZA 3Q3GA 2GAZB 1TTUA 2WAHA 3S6CA 5BVJA 5J12C 1BBDH 2YPLD 5F7HA 2X89A 4ZPVB 2R8SL 2P42B 3J8F7 5IM7B 4WVRA 5FA4A 5DUPH 1PVHA 4HUMB 4J12A 3OXSA 4OAWA 5DRWB 4PJ7B 5BW7A 1P4BL 1T1ZA 1NC4A 3ZKXB 4ZUTA 3WFCL 5F88A 2R23A 4G80B 4JRYA 4WFHD 3INUL 1JHKL 2PF6A 4JANB 4JREC 4PJXE 3CVHL 4KDVA 1UH4A 1EHXA 4NNYA 4M6NL 3SOBH 1XEDA 3KS0H 4WI3A 3CSBA 1BVZA 3H3BC 5TE4H 5CSZB 4M8VA 4PREB 5DJZA 2X1XR 2P7TA 1T22B 1G7JA 3O6FD 1ORSA 5CEYB 4MJ5A 1SEQH 2VISB 2JJWA 2XY2A 4RZCB 4TRPH 5JO5B 5MENE 5EU7C 1QRNA 1QHOA 1C12B 2ERJB 3CH1A 2QSCL 4TULL 2BNRE 3ZDYE 5GRZA 1LO3H 3HE7A 2BDNL 2NZIA 3MRCA 3RL2B 2KZWA 3MRPB 1EO8L 3QXAB 1XH3A 4AEIH 1ZA3B 4BUGA 1AXTL 3BP7B 2BMKB 4YHOL 4K8RL 2FJHA 5D4QA 3CD4A 4YDIL 2F54A 2XWBA 3HMWL 4TNWK 4OGXL 3K1DA 1FGNH 4L8BA 4TVPH 3IXAB 5I1GH 2QQNH 4HMDA 1XF3B 1YC8A 3VRIA 4L4TE 3LB6C 1RURH 4MA1B 4Z76B 5KSVB 2VDNL 4JKMA 5I66A 4KK6D 4EUPB 1CQKA 2QQLL 3O8XB 4P23C 1INEH 3AM8A 4HDIA 4KMLB 4ODHL 2GITB 5TE7H 5GRVK 5HHMD 1DE4A 4XWGH 3P73B 1QBMH 3CDGB 3C9NA 1BFTA 4PRBA 4G7VH 5IIEA 2A6KA 2YPKB 5I9QC 1CD9B 3I9GH 3DWTA 3QQ4B 5BVPL 4UTAH 3TA3D 2A9NL 3D85A 4NQVB 2CLZB 2QTEA 2WUCH 3HI5L 1MHEA 4L8BB 1ZVHA 2RCSH 4G8GD 5AZEH 1UWGH 4GBXA 3H3PL 4UT7H 5BV7C 4XAKD 4LNRA 4Q9CA 4D0CB 4QF1B 1N7MH 1IAII 4LL9A 4LHUG 4U1MB 4I18C 1FZJA 4PRAA 1EO7A 1NBQA 2VLKE 1T1XA 5A1AA 3LEYL 4KUCD 3K3QA 3OG4B 2F74B 1GGIL 2L0DA 5C08D 1KCSL 4P48A 3TO4B 3SE3A 1MEXL 3BDBA 1GJIA 3LKNA 3WUWA 1VFBB 3MV11 3F5WA 2AJYL 1U6AL 3SKMB 3DUUB 2Q1EA 1M7IB 1T22A 4IOFD 1EJOH 1UJ3C 1U8LB 2HFFB 3GK8H 5JTWA 4NQTA 5C0GB 3AGVA 5IHBA 4QHNB 1S7UB 1SEBB 2MPAH 2NY6D 2EXWC 3QO0B 1S7WB 1SBSH 5D1XA 1EVTC 2DIJA 1LDSA 1MRFL 2ZG2A 3RHWF 2E6PA 1E28B 1P7QB 3G08A 4XCEB 1T1ZB 3WS6A 4U7SA 5F70A 2E5EA 4QRQB 5D2LF 2OL3B 4P4KA 2L7JA 3V7AG 1Z5LB 4DK6A 1MI5D 1EJ6A 3QIBA 5C08A 3IVKA 1YMMD 5GJTH 3EYQD 3RIFF 4ZPVA 4PJ8A 1RULL 2RQ8A 3BUYB 2KBGA 5FV1L 1JZ5A 1KV3A 3WNOA 2DMBA 4XMPH 4UV7H 3GMNB 4EN3D 5DVNA 4KJPD 5F7EH 2BFVL 2BY2A 2A83A 1N5AA 4IOIB 2ITDB 2FBJL 4G8EB 2GK0A 3BP5B 1CGSL 4OLVL 3KVQA 3E3QC 4LVEA 4LGPB 5HVWA 5JOPD 3UJIH 2DM2A 3O6ML 1NL0H 5B3JE 3UEZA 3MOAH 1A7NL 1OP5K 4DGYL 4NP4H 3ULUL 4GAYB 4ONFL 1U8OB 4NBXB 4P2QB 3FQUB 3OSKA 3B3IA 4ZNEA 1MCJA 2QSCH 4TULH 4JFZH 3MR9B 2YSSB 3BISA 1AGDB 3DHMA 1X5AA 5EO0B 5IFJA 3VXNA 1BOYA 3Q48A 4LQFL 2DMKA 4I77H 3HCVA 5HPOA 3GM0A 5CP7A 2GYSA 1FNGA 3ULSA 3BIBX 4Q6YA 2EDFA 5D71L 3RX5A 3VFGL 4M9PA 3DRTA 2EIZB 1UVQB 2ZOLA 2LAAA 4IDJH 4X7FC 5EU4A 5SX4H 1FZKA 5E2JA 4JPVH 4KU1A 5AG8A 2IALA 2FX7H 1F97A 2OI9B 4QXTB 1Q0YL 3LMJH 1YNTB 2D9QB 1AHWB 3NA9L 2NNAA 5DA0B 3AS0A 3GMQB 2ZCKL 2B5IB 2R0KH 5ALCL 3UPAA 2A6JA 2DQHL 4ZNEE 5I18H 4WGVB 4RNRB 4DKEL 4TSCH 2X9WA 2NPLX 1VESA 3VXPA 4D8PB 1WEJH 2H32A 3QEGH 5I30H 5FYLH 1QLFA 1Z0MA 3TN0D 1AD9B 1G0DA 1TZHB 3BH9B 4TUOA 3LOWA 5I76B 1BMGA 3D0LA 2YBRA 3LSOA 2H2PD 4G6AD 1QSVA 3MV8A 1EEYA 4U1JA 2EYRA 3HR6A 4U6TA 3ULVF 5E2VL 4P2OC 4U6VL 3G04B 3IU4H 2RHEA 1I8IB 4RCAA 4RFOH 3B2UC 3QWOB 4RMRA 3LSOB 1ZANH 5JDSA 2V9TA 4F8QA 3UYOD 1A47A 1KYOJ 5IVZA 1T1WA 1WC7A 3DVIA 2QQLH 4ODXA 5KSUA 3EYQC 2X4PB 3MODL 4PGBA 3OBAA 3ALXA 4XWGL 3LD8B 1TDQA 1OT1A 4I0CC 3TO4D 3U79A 1BGXH 5MERA 4YBHA 1GC1H 4P46A 2P8LA 4RAHA 4BSWA 3FMGL 5GRXG 3P0VH 5GRUH 1C8PA 2WUCL 3PWNA 1VEOA 4L29B 3N1PC 3TCLA 3PV6B 4U7MA 5EC1A 4YX2L 1D5MA 3NCJH 3GMRB 2ATPA 1GZQB 3MV8E 5K9OA 4H1LG 1S78D 2OMNA 2VDQH 4R90H 3DUHA 3OZ9L 4BSJA 3QDJD 3FRPG 1P4LB 5IR1A 1NAMB 4R7NB 4O5LH 4E42A 3IS0X 4XBEH 1HH6A 4FQIL 1TETL 1J1XL 4Y4FD 3FT4B 3OR6A 4LCCB 4ZO6A 4ZUUB 1EO8H 1BM3H 4HUWA 1M1SA 4ONHA 3RWEB 5E8NB 2IFFL 2LABA 1U41A 4Q6IA 5SV3A 5HHPA 4JM2C 4YNYA 3MO1A 4E9LA 5L9DL 3S4SA 2D3VA 2NX5B 1T4KA 4XMKH 3VI4E 4OT1L 3KLDA 3KPTA 4LSTL 4NN6B 1QYGL 4HZAA 1UM4H 1CLCA 3MLUL 4YHKL 1FSKB 1T83C 1JTTA 3WUWG 4XMLL 1MY7A 5J11B 2JCCB 3D3VD 3ELAT 4E5XA 2PN5A 2YUVA 3B9KB 3PQYE 1JPFB 1VA9A 3QUML 1KG0B 1WCQA 1JK8A 1KIRB 4GT7A 3DSNA 2QBWA 3KLHD 3TH3T 1DQLH 3KPPA 4Z0XB 4HULB 1MWAL 4M6ML 3WV0A 1JHTB 4FTVE 3NCMA 1PLGL 2A9NH 4GKZA 1MCWM 2B7DT 3AREB 4KK5D 4RAVA 4YDVB 1JTPA 4M48L 3T4AA 5KS9B 4RGNE 1NCAL 1BF2A 3EW3B 4M8QA 1K85A 3DTXB 3I3EA 1B0RB 3RVUC 3DO7B 4XNZB 1IL1A 4E41D 1A6TA 3WIFA 1XGRB 5GS1C 5EORH 5GGTA 2Y25A 1CGSH 3MJGX 5DJCB 5H35A 2VC2H 4K9EC 5D7KD 1U95B 3V8OA 1IMHC 3RZCD 4W6YB 3G5VA 1HQ4A 4WUKH 2UV3A 3RUGB 1ZXQA 1OGAB 2N1KA 5GGTL 1A7OH 5CZXC 1P4BH 1KPUB 3GNMH 2FX7L 2N4IA 2AERT 2B0SH 4GXVH 5DDHA 2I60L 5L7XL 5I1CL 3RVTD 2Z91B 3MJ8B 5KVMC 4G5ZL 4JN1H 3QI9D 4JFDD 4BUHA 2CXGA 4ZMAT 3SDXB 4ODSH 5CLWA 4JN2A 3MACL 2X7LA 5GGRB 2E8YA 1WF5A 3GMLB 4R3SA 3BPLB 5JA8B 3LEYH 3LH2L 5BV7H 4O02H 1GC1C 2EKSA 3GIZL 4JHAL 5IEKB 2OL3A 1ED3B 2J4WH 4WHYH 4RAVB 1LHZA 1JRHI 2O5ZH 1JCKA 5D9SB 5GGVH 5I8OH 3V4PH 2NXZB 4HKBA 3G5XA 2AP2A 2E9IA 5MEPB 5C0CB 2H45A 2J6EA 1BAFL 5EBMB 4BFIB 4D3CL 4R2GB 1WBYA 4CUCA 3IDJB 3QUKA 1J5OL 2JJTA 1Q9WA 2VDOH 5C0GA 1RZKL 4V2CB 3RTQD 5DRZB 5JW3L 4KV5F 1MHCA 3MUY1 4I48A 2Q6WA 5BVPH 1ZA6B 4UTAL 4GAGH 2VLLA 1DL7L 3C60A 1OB1B 3I6GA 2UY7A 1Q9WB 3R8QA 4ZYKB 3OXRB 1RZ8B 4QXGL 5DI8B 3R06A 1N7ML 1NMAL 1FP5A 4Y4FB 5DJCA 2ZPKH 43CAB 3C5SA 4B7LA 4OZGF 5KANG 3HG1D 3OKNB 5IGXH 1G9ML 3H3KA 3RTQB 3U9UA 2FYYB 1ZANL 3FCTA 4K7PY 4AH2B 4HG4J 2APXA 3MJ7B 5T3XH 3IKKA 4P9MH 3N06B 4R96A 5F96H 4M7LT 2UYLB 5IR1B 2BHZA 4KDTA 3I9GL 2J7LA 1DSFH 4PJHE 4KTEL 5HPMB 5F7MC 2J2ZA 5L6YL 2FBJH 2IF7A 4NM4H 1AGFB 1RZGA 1EZVY 1UKQA 5JW4M 4NO5A 4JFPA 1CBVL 4Q9QL 5HGGS 1NMCC 4YUEL 2AV1A 4F58L 1S7RA 4Y4KD 3BGMB 1ZT4B 2VDQL 4QHKJ 5C0JA 4DN4L 1Q9LB 1QLRA 1TTFA 3T65A 4RA0C 2FB4L 4MJ4A 4RGNB 1A64A 1T04A 3WDHA 5KJRL 2FHCA 4KJQD 3VWKC 2O5YL 4BYHA 1NMBH 4CNIA 1OAXL 3UTSB 3V4VL 1CFSA 3O0RH 2HT2D 1S5IL 3ZKND 2ADJB 4OD1L 3GBNL 1IILE 4PFEA 4YIQA 1T5XB 3QYCA 1A3LH 3JXAA 4LEXH 4ZQKA 3CFEB 2YUXA 4N0UB 4L8SA 1GOGA 4I3SH 4JDZA 1FL3A 2VMFA 3D9AL 3BJLA 4NPYA 3L3OB 1CQYA 1WQVT 3QQ3B 4GKSA 3JWOC 3BP6A 1JPFA 4JFEB 2ATKA 5MENA 2FR4B 2VISA 1QSEB 3VFWB 4P5KB 4Y16B 3RPIA 4M6AA 4X6DF 4LOUD 4OZHB 4HFUL 5A3ID 3O6KH 2NLJB 4NQCB 1E4WH 2J8UB 2VLKB 3QFJA 2WK2A 2X4NB 4G3YH 5T3XD 2J88H 3VFTB 2FJFB 3D69B 4XPHL 4OLYH 4G7YH 3QNYA 5IB2B 2W1NA 4KVCL 2X4SB 2FL5A 1MAML 1RK0B 4N8VG 4PRID 1TZGL 3OGCB 1JZ6A 3U48A 3TIEB 4J1UA 4TOYH 3N85H 2Y36H 4L4TA 1SY6H 3DSFH 4XI5D 3CSGA 5AYUL 1K9TA 3G6AB 2YSSA 3ZKMC 4YDVA 5A16A 1L0XA 3D2UB 4LCYA 3WN5C 2EC9T 3V6OC 1LEIA 3HC0A 3WJJA 3GBMH 2IAMD 3LD8C 1RZKC 4DEPC 4MX7B 5MI0B 5DT1H 3GFUA 4PR5B 1I4FB 3QEQD 2ZSVB 3PWNB 2FD6L 4MNQA 5LAXA 3ARZA 4NRXA 3OB8A 5TF1L 2FATL 4AENA 4JJ5A 4ZTPL 4Y5VC 2ICWB 5ILTH 4Z0BL 1UM4L 4F3FA 2IH3A 1C7TA 4HBQA 3WHXB 1E6JL 3TBVB 1D6EB 1NUFA 4YR6B 3VFGH 5KOMC 1NUNB 2D4FA 2A1WL 1N59A 4MDJA 4Q7DA 3VFRB 5INDA 1A1NB 2YD7A 1KCVH 4AT6B 1MJ8H 3F7VB 3QJHA 1H8SA 3U30C 15C8H 2B4CC 4LPTA 3HZKA 1FLRH 1T1YA 4E0RB 1PEZA 3FB7B