4UAOB

Crystal structure of apical membrane antigen 1 from plasmodium knowlesi in complex with an invasion inhibitory antibody
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPSSMSASLGDRVTITCQASQDIGNNLIWFQQKPGKSPRRMIYYATKLANGVPSRFSGSRSGSDYSLTIISLESEDMADYHCLQYKQFPLTFGSGTRLEIKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Apical merozoite antigen 1
publication title Crystal Structure of Plasmodium knowlesi Apical Membrane Antigen 1 and Its Complex with an Invasion-Inhibitory Monoclonal Antibody.
pubmed doi rcsb
source organism Plasmodium knowlesi
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uaoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uaoB01
4TUJB 4P2OA 3MR9B 4UT9L 4F57H 2HJLA 4LCCC 4OJFL 5I1GH 4IJ3B 5JIHA 1GOGA 4K3DL 3WO3B 1GZQA 5IVXE 5IB5A 3QQ9D 1QNZL 4CVZB 3QIUC 3A67L 1T21A 4FQIL 1KC5L 3KPQA 4M48L 1UA6L 2WM0A 4LKXA 3W2DL 1BFOA 1T5WA 1F4XL 3WIHA 4WI3A 4MMZC 5BVJB 4PY8J 1G7MA 4W68A 4D2NA 1H0DA 4M7ZB 1NFDE 4ODVL 4Y4FC 5SX4H 4M7KL 1T1YB 3VFSB 2YD5A 3V5KB 43C9B 4P49A 2YD7A 3PL6D 1BX2B 4ZS7L 3UC0H 1SHMA 1SEBB 4KK9C 4J3SA 3TM6A 3I6LE 3QQ3B 1WGOA 3FQXB 4OM1L 2B1AL 2BNRB 3S34L 5J13C 1JYXA 1NDMA 3E0GA 4WO4A 1DN0A 5BV7L 3ALWA 5HHXH 5HGHB 5IFHL 4JFEB 5F6HI 5DEFA 3IVKA 2VLRA 4JPVL 5HYJB 1NCNA 3TLRA 3OJ2C 5BO1L 2JK5B 1I7UB 3QUZB 3E8UH 3MO1A 1BFVL 4BFEA 4XB7A 1FVDA 3UTTA 1CF8L 1VFMA 2ZP0T 3H9HB 1OP5K 3CFDB 5E8PB 4XNYH 1KCUH 3OAUH 2OL3L 1U95B 4FXGA 4G8FA 1S9KC 2UWEE 1YQVH 4FQJL 1U8JB 3TBWA 2Z93A 2GAZB 5DEGA 4EN3D 3GJFK 5TQ2L 4HLJA 4B7LA 4OZIE 3KXFD 1T6VN 4JFFB 3E3QC 2C3XA 2G2RA 3CFBA 3KPRA 4KRPD 3EYUL 3FB6A 1CFSA 2H6PB 5E95B 5HDOA 5GHWH 3E6FB 4PJHE 3RUGE 2DKUA 2DWEB 1JI1A 4KJYA 3MRRB 1ZLSH 3UAJD 3VFGL 3ABZA 2NY3D 4XVJH 4Y2OA 2O5YL 1J0ZA 4G6JH 4M43L 1JGEA 1M6OA 1D6VH 3WYRA 3HC0B 2I9LA 2CKBB 3RPKA 4LCWB 5IVNA 1NCBL 1T0PB 2Q7YB 3FONA 1T2JA 1H15A 5I1IH 3OKEA 1QLEL 3C6LB 3U7AA 4YFLF 3MOBL 1C7TA 2IMMA 2HRPL 4OGYL 3G6DH 1VEPA 4XXCA 3R0MA 1OAZH 3W9DB 4PJ7F 4Z7OE 4UTAH 5DD0H 3QUXC 2Q8BH 4HQQL 1J05A 4NJ9H 3VU2A 3GUTB 1J10A 1J7VR 3QUML 2EKSA 3PWPA 5F7EL 3GB7A 1U93A 2RCSL 4MZ2A 2Z31C 3FCTA 2AJ3A 3RY4A 2ZG3A 2HT3C 3TYFA 3VRLF 3L9RB 2W0KA 2ESVB 4G43B 2X4OA 2QKIB 1AQKL 1F97A 2NW3A 3MYJB 4OLYL 2XZAL 2HVKA 2YD3A 3FQUB 4D8PA 5F7WC 3PDGA 4YJZL 3FTGA 3LPWA 5TJWK 4WTZG 3MJ8B 4NQVB 3QHFH 4H1LG 3CXHK 5MENA 5E7BA 3EFDH 2DQTL 4YHKH 1VSCA 1FRGH 1IC5H 1Q9KA 3GJEA 5DRNB 1VERA 2OR9L 3RZWA 3QEQD 5HHQB 2V2TB 5B39G 1MREL 3SGEH 4OFVA 5J3HC 1XGTB 4HKBB 3B9VA 4LHUA 1I1AC 2QADB 4AZ8A 3O6LL 3UJIL 4JRXA 4N8VG 3T65B 4CW1A 4JJHA 3T0XA 3OJVC 4WI2A 4NBXB 4PJXB 2IBGA 3EO9H 4KROD 3WDHA 4RAVA 1F90L 2XN9D 3LRHA 3VFNB 4FNLL 1JNHB 1MCLA 1JNNH 1GOHA 5EIIA 3BYTA 4NWTH 5JHLH 1MRCL 3L3JA 3JVGC 1KF9B 4GAYB 1VB9A 3TO4B 3P4MB 2APVA 4LEXL 2B1HH 4JQIH 4RGOL 1KN4L 3O4OB 1ZXQA 2W0FA 2AXHA 3FB8B 4Z0XA 5H8DA 3MLTA 5FO7B 1FYHB 3LKOA 3LS4L 4EVNA 3FMGH 4ZXBB 2D0GA 4U1MA 2GK0A 5CJXC 3PHSA 3QH3B 5IIEB 2J8UB 2VR4A 4L8SC 2FJFB 3C8KA 4N90E 3A6BL 4XVUD 1G7PA 4BKLA 4HS6A 4XAWL 1JE6A 4B5EA 2LTQB 5LGHL 1Q9WB 4J7RA 2FJHA 2VH5L 5IHZA 1A0QL 2EDLA 5GS0L 1A6TA 3C5ZD 3ZE0F 2OJZL 3EDFA 3T0WA 1D6EB 4J1UB 3T4AB 4POYA 4HIJA 5GSRB 1UM4H 1FE8H 1LO3L 4Q6IC 3QFJA 3RVXD 3S37H 1HWHB 1RSFA 4ZTPH 4LPVA 5EO1B 4NKOA 5HYSG 3J8F7 4RDQF 1MVFA 3F58L 2FJGA 1Q0YH 4PJ5E 2Q3AA 4XP1L 5B22A 5JQ6L 4OI9A 4I0PC 4JHBA 5AYQA 4Y7MA 1XCQA 1FZOA 1MWAH 4NOFA 1KCSH 1D9KC 1VESA 4MA8H 5CZVL 4EDXA 3MODH 3S3JA 1JFQL 3RZCD 4UIMA 2DQUH 3P4NB 3TCLB 2G75B 4J3TA 4U7SA 2VLKA 4DTGL 2EC8A 3BP6A 1EO7A 2GJZA 3BVNB 1FVCA 1Q9LA 4U1GB 3U2SA 3VMOA 1NLBL 2EXWC 1AKJA 3KPOA 4JO1H 3VXQB 5I75C 1T1ZB 2PW1B 2H3NA 2ZUTA 5JOFA 5K59E 4D0CA 2UYLA 1E4JA 2BNQA 2ADIB 2XXCB 3NFSL 5GPRA 1BLNB 3WJLA 3WO4B 4OI8A 3VXNA 4R7DA 5BRZE 2DI8A 5DUBA 3WJJC 4HFWB 2A77H 2YUZA 2JCCB 1HIMH 3C9NA 3J7HA 4S2SA 1HINL 3BPCB 4KKAC 3L7EB 4U33A 2X4SB 3CSBA 4QRPB 3CZJA 2GCYB 2Q6WA 3DX9B 4P3CH 3SE3C 1NAKL 1X5LA 2HT2C 2ICWI 3REVB 5I8EA 5FOBB 4YH6A 5ESAB 2Y36H 4IRJC 1NAMB 3AM8C 1DQQA 2HTKD 3DVNB 4K9EH 4XVSH 3O8XB 4P2RA 4QCIA 1P6FA 4LFHD 5GGSY 1UB6A 4Z7WE 2VE6A 1E6JL 2BSTB 1MF2H 4RSVA 4YIQB 5D1ZB 2EDBA 2C26A 3KYAA 3SDAA 3QWOB 1HYSC 2DQHL 2R0KH 4MLSA 4PPTA 1QP1A 1KB5H 5E1HB 3VXRD 4JR9H 1ORQB 2HT4C 5ACZB 5E5MB 4X6EA 3SQOH 3OKYA 1C5DA 4JFOB 1IQWL 2X4TB 4KVCH 3I3DA 3BSZH 3T77A 4AEIH 3WCYA 4S1SH 4L4TA 2R0WH 3RVWC 4G9DB 4XHJC 1LP9E 4LSUL 4GT7A 1ZT7A 5L2KD 4PG2C 1Q1JL 1SVZA 3PV6A 5A40E 2A73A 1U8NA 3OHXA 4RNRB 5TGBB 5A2JH 1FL5A 3IDIB 4QNPF 1YY8B 4CL7A 2EDTA 3LKNB 4HIIA 3K74B 3VMNA 1K85A 1CG9A 4O2FA 4IMLB 5H37G 5JOEA 1FHGA 5CJOL 5DRWB 4YX2L 4ZFZB 4YHLL 3ROOA 4XMPL 3B2UC 4LASH 1SJXA 4JQVA 1E4XI 4NT6B 1I8IB 3F8UB 3NABH 4ZOCA 1IEBA 3TV3H 3HC3L 2AJUH 4L5FL 4YBLB 4NN7C 3UZEA 1T03L 4PJFF 2P44B 2X44D 5GS2D 1T0NA 5DUPL 1RZGB 3MRNB 4J3WA 1GGUA 3V0AC 2F58L 1TCRB 1N59B 3QXWA 3T2QA 2X4QA 1ADQL 5D5MB 4KUZH 1GOFA 2ADGA 1NCCH 3HZYA 4LPYA 3MRJA 2YZ1A 3D85D 4K7PX 3ZL4L 4XP6L 4TUKL 2IANE 4LK4A 4OCWL 1E6OH 4AG4L 5KZCD 1EJ6A 2ICWB 5F9DC 5HTSA 2NQCA 1A7PL 4AENB 4ZUUB 5HHOE 2G9HB 2P7TB 4FFZH 2VZUA 4YC2B 4N1HB 4D0BB 1JPST 4C55A 1MWAA 4KK8C 2HA1A 3ZLQC 2IMNA 5IVZB 2N1KA 1O7SA 5K9KB 4G6AD 2DQFA 5J1SC 1P84J 2JIXD 3U1SL 1IBGH 3CFJB 4BUHA 1K5NA 1WCBA 2QQKH 2XA8L 5DI8A 5FF6B 3STZA 3QNYB 3SGJA 5FM8A 4WHCA 1IFHH 5IWLA 1OCWH 4FG6C 2W92A 3F5WA 5BS0B 1KN2H 1JNLH 2DD8H 1W72L 2AEPL 5D70L 3WMSA 4Y5YC 5FYLE 4LVNB 2AXFB 4F7MB 1LE9B 1CE1H 5AZ2L 5C07A 5AZEH 4OUUB 4HV8B 1A1NA 3SJVA 2VC2H 5IMKA 3O45A 3RGVC 3LAFA 1WZLA 4JO4H 3ILQD 1G6RA 1KIRA 1J88A 4HK0B 4QO1A 1SVCP 2DMBA 1QG3A 3WFDL 3O3DA 3VGGA 4MCYB 3QIWC 3OKDB 1I7ZA 5DLMH 4IRZL 5I76A 4FQ1H 4LVHB 1KFAH 2RR3A 5FGCB 2F5BL 1GYAA 5EOQL 3MLSL 2C4FU 4KHXH 5FKAA 2A1WH 4O4YH 3FO9A 5CUSL 4M7LL 4HC1H 3QAZB 3QUKB 5I17B 5EU6E 2LU7A 1F6LL 1K4DB 2EYRB 2X09A 5C0AA 4XNXH 1D5XB 3O81A 2X10A 4NQEB 3PP4L 2NY0C 4XCEA 4R0LB 1XZ0A 1DANU 2X40A 2WWKO 5DHYB 1LO5B 4IMKA 4JHZA 3V4UL 5C0BA 1V7NL 4MJIA 1RU9H 4AEHH 1XGQB 2XNAA 1XCTA 4URTB 4N0YH 1FAIH 3BD3A 4R4ND 3TPUB 3QCVL 4XAKD 2VMFA 2YA1A 2PO6B 2GQHA 1DZBA 1C16A 4HDIA 3HAEH 3T4YA 2R23A 3I3EA 4QWWD 5IBLD 4APQB 1FFOB 2DB8A 3T1FB 2VXVL 1YPZF 5KG9A 4GQPH 1TJHH 1YYMH 5AUMA 3GMMB 2PTTA 2AXGA 4WU5B 4GW5A 4AY0A 3MBED 4TUOB 5E2TH 5D7SL 1W0WB 4XPFL 4X7EC 3TJHD 4PGEA 2K7PA 3C60A 1ZLWH 1UACH 4DEPC 1QSFE 4YHOL 2PTVA 3EDKA 4UQ2B 4BQ6A 4GRLD 4X7FC 2XRAH 3WSQL 5DK0A 4EKXA 5K9QG 1UZ8A 5A2IH 4FFVD 4FQPA 3VWKC 2APTA 5EZJA 4KJQD 5ANMA 4NZRL 3MV8B 4U1LB 2Y07H 3KNBB 2ZCKL 3C2SA 3QSKB 4PRAA 5I16B 4RA3A 4QXTB 1RJLA 2XTJE 4K55A 1F4WH 3O6FB 3C2AH 3O2VL 3MX0A 1Z2KA 1GC1H 4JKMA 3UYRL 5IB3A 1TJIH 3PP3H 2E3VA 3NPSC 4N5EC 1KSRA 4HT1L 3B2VL 1UJ3B 3Q3GB 2VDLL 4U6VH 2Z91B 4X80L 1T89A 1VADB 1V3LA 5HHPB 5F9OH 3DX8B 4JRYA 4M8QB 4G80B 4PS4L 4EI6B 4FZEL 5EDXA 4ETQA 1W0VA 4XPHL 1FGVL 3CVHB 4MVBD 1MAML 1QA9B 2R39A 1XGYH 1JWUB 5E94A 3RIAF 3SDDD 2WSKA 3D0VA 1ZSDA 4PJDA 5D1XC 4O9HL 2CD0A 4U1IB 3R06B 4UAOC 1I9JL 4WHDA 2ZG2A 3OX8A 2IQAB 4WUKH 5EZLA 4Q9RL 2CO6B 4FXKA 4MXVF 1TETH 4OCMC 4U05A 4WY7H 5TQ0L 4HIEB 2MCPL 3FOMA 2IPTH 2JJTA 4E5XB 5ILTL 1BIIB 1IAOA 1VGEL 1W8NA 3QR2A 2XQYG 5DQJA 3RBGA 3O3EB 1M71A 4KH2A 4M5YL 4X7CC 5BXFA 3CH1A 1FDLL 2D4FA 4PJEE 4PJ8A 1SY6H 1QRKA 3DURB 4P59H 2X70A 1AHWC 3GSUB 1A7NL 3K7UA 5GS2H 4RAHA 1NCAH 3U0PA 5AG9A 4ZPTA 5EA0H 5D96C 3NH7L 3JSSA 3UTSE 3JTTB 3BW9A 4U2ZA 5E1AA 4XP5H 1ZLVH 5DC4B 1XIWB 3WLBB 5LXGH 3BD4A 4Z0BH 1QVOB 1Z9LA 5E08L 3F6LA 4IJ3C 4TSAL 5IHBA 4OT1L 5D71H 4RMUA 3RWIB 2VWEC 3KJ6H 4I3SH 4PJAB 4O51A 5GGUB 2QHLA 3ULUE 3CIQA 4OF6A 2XI9A 4XX1G 3QRGH 3HCVB 2VLJB 4NNPH 4QRRB 2JKXA 4GG6F 2VAAB 1AE6L 1WZ1H 1QFWH 2RHEA 1ZHLA 3Q5YA 3MXWL 4M7ZC 4QHUB 4HCRA 4Y5VA 2B0SH 4OLVH 4F9LA 1NL0L 2B39A 1OWRM 5DD6A 4JY5L 4N68A 3ARGB 4Z78B 3ZZ1A 1OTUD 1SJHA 4YHIB 4V1DE 3BH9B 4LBEB 2QTEA 3X3GL 2DTSA 3Q5OA 4XMLH 2DYPA 3QEGH 5CILL 5C0IB 8FABA 1P4LA 1YECL 2L7UA 3DRQA 3MA7A 5J6GA 1N4XH 4P2OB 3GSNA 4K8RD 5T1LB 3UP1A 2HJLB 3M45A 1HDMA 3DHJA 2ZUSA 3QUZC 2VXSL 1GZQB 3QDGA 5IB5B 1T7WA 3MACH 3PIQA 5ERWA 5BVPL 4JFZL 1AJ7L 4M5ZL 4KTDH 3BZEA 3KPQB 3H3PH 5HHME 2VZ3A 2IAND 5IOPA 3GO1L 4LKXB 1BFOB 2VZTA 1T5WB 3NZHL 3O0RL 1IJ9A 5IF0A 2JE8A 1G7MB 1TPXB 3KPLA 1H0DB 3SBWA 5JA8B 5C71A 2W0LA 4XNMA 4D3CL 1MIEH 2UY6A 3IT8D 4WENB 4KZDL 4Y4FD 4POZD 4OZHE 1ZLUK 4QOKA 4NZUH 3S37X 1OAUH 2YPKA 4MD5A 5FYJD 1B4JH 4KK9D 5I74C 3ZYOA 1NDMB 4WO4B 4UTBL 1DN0B 1UM6L 3GBMH 2B2XL 1FH5L 5DEFB 3OAYH 2VLRB 1A5FH 2VN7A 1NEZG 4Q58C 1RZJC 3MO1B 1FVDB 3UTTB 3QCTL 1QBBA 3C6LC 1HH9A 1KCVL 3WKML 4RFNB 5FEBA 5T1KD 5JW3L 1JPSH 3H7BA 2IH1A 3WD5H 3M17B 2XWJA 5JXEC 4FXGB 4G8FB 4Z7VE 1P7HL 1HHGA 3EOAB 1GPOH 3TBWB 2Z93B 4C4KT 2HG5A 3STBA 4P2YA 2CXGA 5DEGB 2KDGA 4UNUA 1PKOA 2GJ6D 3RWDA 2Z4QA 2G2RB 3CFBB 5IGXH 3ET9F 3FB6B 3KPSA 4AM0B 1CFSB 4HZLA 5IQ7L 2M1KA 4OSUH 3RTQC 3WHXA 1GGCL 1MI5A 3QDMA 2KUTA 2DLTA 5L88H 3DOSA 3HZMA 5SX4I 1D5IL 4KJYB 4L3ED 2PYEE 1SYVA 4K3DH 2YD2A 1WWCA 5F71A 2MOVA 1JGEB 1M6OB 2Q7NA 2A9NH 1TJGL 1ND0A 5D2LE 1UA6H 3FRPG 4ZNEA 3FONB 3OKEB 4HUNB 5JUEL 2BOCA 3D39E 3U46A 1CD9B 1FCGA 2Y1VA 3RA7H 3GNML 4XCCH 4MJ4A 1EMTL 4ODVH 1UM5H 4PJBF 4DVRL 2WBJA 4M7KH 5INDA 4PBWD 2QADC 5IV2A 4D9LH 5IW1A 5E8EA 4LLWA 1J05B 3CFCH 2EKSB 3PWPB 5D7IA 3THMH 3GB7B 1U93B 3H7LA 3QUXD 3AXLA 3OGOE 4YHNA 2CXKA 4OBSA 2AJ3B 3FO0H 3C5JA 2H2PC 2C1OA 2Z31D 4OFIA 2VITA 1V05A 2X4OB 2HT3D 4PD4K 2NW3B 4OCYL 4YDKH 2CLZA 2HVKB 4D8PB 1DJSA 4OBRA 5EG6C 3H9SE 3KYMA 1IVLA 4ZXBC 2FO4A 4TSCH 3MLYH 2ZWLT 1OGAA 5MENB 3RY6C 2DKMA 1IKNC 1JZ3A 3K8MA 1Q9KB 2LTQC 3GGWA 4GUPA 3MV7A 3GJEB 3D6GA 1EZVY 5I8OL 2HKFL 2Z35A 3OF6A 4WGWB 5I1CL 1T7VA 3WBDA 4LHUB 4Y5XA 1WT5A 4A2MA 4JRXB 5E8DL 2IBZY 3NCYP 4CW1B 4UV7L 5BZDA 4UZGA 1YC8A 1RZFH 2HP4A 4RAVB 4L1HA 1NDGA 5DGQA 1J0KA 1K3IA 1PJ9A 5DD5L 5C2BH 5EIIB 1F6AA 3L3JB 1CGTA 2O5YH 4PB0L 1MCHA 3JWOL 3SE8L 2P5WA 5GJTL 4NFBA 1HHJA 1KYOK 3QHZL 2H1PL 3TIDA 1EAPA 2V17L 2OR7A 2W0FB 4Z0XB 1I85C 5HYQA 3VI3F 4BQCA 5EORH 1G9NC 3DSFL 3MLTB 2D7QA 4PRIA 1NUDA 4Y16A 3LKOB 4JCMA 1OARH 5SV4A 4EVNB 5C0RL 5A43C 5T1MA 2XZQL 4MXQC 4XPAL 2VNCA 3U30B 4U1MB 2W9EH 3MOBH 5D7LA 3WL9A 4GAGL 2E7CA 4DQOL 3C8KB 4U1GC 4NCDA 1G7PB 4BKLB 4HS6B 2OI9B 4YHZL 3UTSD 3EYSL 4K8RH 5JHDA 5KSBA 2FJHB 3OPZH 5IHZB 3G04A 2CK0H 1BAFL 1KJ2A 3WO4C 1S9WA 4HIJB 4Q0XH 1IT9L 4WTWA 2RCSH 4RISH 3QFJB 4XNQA 1P4IL 4WHTA 3U36A 4O02L 1H3XA 4JVPA 3SGEI 4BH8A 4NRXA 4HBCL 3HE6A 4NKOB 4U4BA 1DQTA 1H5BC 1SJVA 3U0TA 4BA8A 4D9QE 3BP5A 5DFWH 2FJGB 1A6VL 4N1CA 3VW3H 2Y4SA 4OLYH 5FOJA 3ARBA 4NQDA 1IGIH 4FFYH 3ZKMC 3MRBA 1YEIH 25C8L 1NCTA 1G7LA 4EZMA 1KTLA 1XCQB 4I0PD 1FZOB 1NLDL 4PV8A 4QRUA 4JPWL 1IQDA 4EDXB 2DQTH 3OKLA 3HG1D 3MREA 3HI5H 1D9KD 1HNGA 1UXWA 2FD6L 4FN0A 4UIMB 1CYGA 4HGKC 3SO3B 4ALAH 2VLKB 4M4RA 5FYJH 3BP6B 2GJZB 5DD3L 3O8XC 1FVCB 1Q9LB 1IEAA 5T33L 3DV4B 1QSED 3U2SB 2E9WA 2YSSA 4H1LH 1UEMA 5FUOH 5D1ZC 1AKJB 1BQSA 5HHVL 3MUGA 2H3NB 3ZDYE 3LVEA 5JOFB 2EH8H 2EXWD 5EC2A 4D0CB 4NZDA 5DMIH 2BNQB 1LNUA 1VFOA 2UUDH 4GXUM 1PKQE 4R9HA 4X9HA 5E2WH 4M00A 3EDJA 4R7DB 3H42L 4HJGA 1JGVL 5DUBB 3K0WA 5HGDA 4Z7UB 4LEXH 4RGOH 4MNHA 1KN4H 1SQ2N 4YEEA 1CLZH 3C9NB 4S2SB 3W0WE 4JANA 1HYRC 2F5AL 2EXYC 1ZHKA 4UOW0 3VXUA 3IU4H 4KKAD 1KB9J 3V5HA 1MJ7L 2Q6WB 3GKWL 4JKWA 4JHWL 3IS1X 2OL3A 5I8EB 3QI9A 2GI7A 5TE7L 4M3KB 4GO6B 4DFHA 1P4BL 3O9WA 3MLVL 1DQQB 3I02A 1JHKH 4YBLC 5LGHH 4IRJD 3KHQA 1MCPH 4P2RB 4QYOA 4C56D 1MCOL 2OQJA 1UB6B 4EBQL 2OJZH 1KPVA 2XZZA 1RFDL 2VE6B 3OXRA 4J6RH 1RHHA 3M07A 3NCBB 3SDAB 2AI0L 5I9QB 3M1BA 4NKDA 4PGCA 3VFMB 4L1DA 3LKPA 3RU8L 4ODHL 2JJSC 1TFHA 3DETC 3MOAH 1MQKL 1C5DB 3LRSA 2P49B 4A6YL 5FDYA 3NTCL 4Y19A 1IL1A 4K3EH 5JLZA 3T77B 1INDH 2YPLE 1JYVA 3G6JE 1LGVA 2ZPKH 3HNTL 2VDOL 1QYGL 3EJZC 1ZT7B 3RWFB 5I73B 4ZS6D 4ZUVA 1S3KL 3PV6B 4N9OB 4PY8I 2E7MA 4YHPA 4YC2C 2A73B 3WFHA 3OHXB 4LIQL 4HF5L 1FL5B 5DURB 5EOCH 5CGYC 4WW2F 5BMFH 2J5LB 4HIIB 1CG9B 4M1CC 4O2FB 2YD8A 4JO2H 1A22B 4JB9L 3ROOB 3R1GL 1Q9OA 4NO3B 1NBVL 5EU5A 1TMCB 1ITBB 2CDGB 1IEBB 4P48A 3BKCH 2HFTA 5BCAA 3OV6A 3RUGF 3RIAK 5ECJE 4X4YA 1T0NB 4NO0A 4LVNC 3BT2L 2FNBA 4HK3J 5T5FL 3QUMA 4XBGA 4OD1L 4JFEE 2PYED 2WQRA 4OLUL 3ZYIA 1IAMA 1I8LC 2X4QB 5JA9A 3V52H 2ADGB 3ARWA 5C6WH 3PWLB 4MS8C 3MRJB 1DLFL 4BZ2L 2OK0H 5JIIA 1RUAH 5DJ6A 3OKOA 1CDUA 1U8HA 4X4MA 3BEVA 3LB6D 2FGZA 1ZWIB 5B4MD 4LVHC 3F7PC 3ULSB 3BWAA 3MLWL 5DTFA 1MWAB 2DQEL 2PW2A 3CK0L 3CH8A 4X4ZA 5HPMA 4JDTL 1VFAB 4F7EB 4WFGD 3GI8L 4WWID 4KK8D 2UVEA 2DQFB 5K93A 1DUYA 3P4OA 1C12A 2MNUA 1H8SA 1K5NB 1WCBB 2IFFL 2R4RL 5E4EB 3NFPA 4NWUH 3STZB 1QEWA 4KAQL 1ZKAA 4R0LC 5GGTL 3F5WB 5FYLL 4M9OA 5LG1A 4FG6D 2O5ZH 3INUL 4HFUH 4L9DA 1JUFA 4D9RE 2BVPA 4G8GD 3MSPA 4PB9H 1YNLH 5C07B 4WI7A 1A1NB 3SJVB 4MNQA 1KIPA 5IMKB 3O45B 2UZXB 4NYLA 1AQDA 3FB7A 4JFDA 1YY9C 1YNKH 3GMQA 3RGVD 1G6RB 1KIRB 3D3VD 5DJYA 4APQC 3O3DB 2OZ4L 3DX7B 2G5BA 1YMMD 1ORSA 3UO1H 5D2NE 3MRIA 3PQYD 3TWCL 1M7DA 1RIUL 5I76B 5EC1A 5KS9F 3QCUH 1NUGA 3QIWD 3BKYL 2VXTL 2DDQH 4LRIA 2IBBA 1AGDA 1HZHL 3BZFA 4Z6AT 3FO9B 1UCTA 3BKMH 3ZTNH 1OSPL 1YPZA 4L5FH 2K9UA 5JOPE 2DWDA 2ZUXA 4GQ9L 3RFZC 1ROWA 1SMAA 5C0AB 4O2CA 3MXVH 3SPVA 5H37H 5DUPH 5HI3C 4QXUL 4XCEB 1XZ0B 1JRHH 5IB1A 3RBSA 2NY0D 2VDRH 3LS5H 4Y1AE 4BZ1L 3LH2H 5C0BB 2VDQL 3L5IA 5IHUL 1G7QA 2G5RA 4MJIB 3BUYA 2XNAB 1XCTB 1XF4A 3T04D 3O6FC 4H8WC 5HI4C 4ZO9A 2GEEA 3DI3B 1ZMYA 3NCJL 3VXTA 1MCWW 5TE4H 4DZ8A 1L6ZA 1C16B 4HDIB 5MEOA 3NIGE 4RWYH 5EUOA 3CXDL 4ELMA 2XWTA 1UJ3C 4K71B 5FCUL 1SEQL 5FGBA 1S7UA 5KG9B 4KI5F 5AUMB 4RX4A 1FNEA 2AXGB 4GW5B 5AAMA 4P3DA 4X7SH 4QT5A 4B53A 5DGRA 2HJKA 3C60B 1U2HA 3NN8B 1RZIA 2A0LC 1P7KA 2DJ4A 1DLHA 1MJJA 1N0LA 3BP4A 1QRNE 4H88L 15C8L 2D7TH 1R5IA 4TVPE 5D70H 3Q2CA 5DK0B 1RZKL 3BPNB 3TPKA 1YN7B 2P24A 4LGPB 5TFSL 2OMNA 1AO7E 1UZ8B 3FAWA 3P9MA 2FHBA 3GK8H 5MI0B 4JO3L 5EZJB 2HFFB 5ANMB 4PRAB 3VWKD 2YRPA 1Z3GH 1CGYA 1RJLB 4LOUC 4M61A 1WSST 5IB3B 2COQA 3BJ91 2WUCH 2XA3A 2ZOLB 3MOQA 2LFGA 1JHTA 3S96B 4JKPL 1LO2H 2CSPA 5EOQH 3BXNA 2AERT 3MLSH 4A2LA 1UH4A 2FYYA 2OMBA 4X6BA 4E41E 1XIWC 1T83C 1I1AA 4OTXL 4ETQB 1W0VB 5D1QA 1U8PA 3LMJH 3HKFA 2X5PA 5AYUH 5EFIA 3MGTA 3EDEA 1W8OA 1YZZA 5L9DL 3PP4H 3D0VB 5DMKA 2ZSVA 4PJDB 5FUZL 2FECI 2B4CL 4FQLL 3Q6FA 2VTFA 3QXUA 1SM3L 3OX8B 3BUTA 3PJSA 4TRPL 1DSFL 3LRGA 4FXKB 1ZA6B 3V4UH 5IP4A 2QQLH 3FOMB 3O4LE 1ACZA 1IAOB 4XCNA 4NO5A 1P6AB 4HXAL 3W0WD 2NY7L 5DQJB 5L7XH 1M71B 2QEJA 3VXMB 4WHYG 5BXFB 3CH1B 3GMNA 4PP1D 2YA0A 4PJ8B 5J1TC 1OF2A 4N0UA 3VRIA 2X70B 4L8SA 2AJVH 12E8L 1UVQA 1KPRA 3MRMA 3U0PB 4ZPTB 2NY2B 2FBOJ 5CGTA 1WAAF 1B88A 2DMCA 4PUBH 3TA3D 4Z7WF 1RUPL 3O6KL 5E1AB 3U48A 3ZT7A 3WHE0 1UCBL 2J88L 4LVEA 7FABL 2FX7H 2KKQA 3TZVD 2V6HA 4P2OC 4Q6IA 2I5YH 4LSQL 2V9RA 3HUJF 4P2QA 1O7VA 4YHOH 3BDXA 3ZHLA 5ITBH 2CR3A 1ZVHA 2J8HA 1HCVA 2FX9L 1IARB 3TT3H 1UKTA 3V0WL 3ULUL 2YPLD 4FMKA 4O51B 1ADQA 1O5DT 2NTSP 2VXQH 4LLQA 3V4PL 1P69B 5ADOH 3O2VH 1TPXC 1MFBL 1BMGA 1ULVA 1ZHLB 1CVRA 3UEZA 4UT7L 4JFQA 3I6GA 1EO5A 1R3LA 1T2QL 4JY4A 1CDHA 3VMPA 5DD6B 1WBZA 3IF1A 2EIBA 1HXMA 1SJHB 1U8QA 1GAFL 2V2WA 4PJGA 2Z92A 5GGVY 3KAAA 5TPWL 4PS4H 2AGJH 4FZEH 2DYPB 4XPHH 4JPKH 1MAMH 3NA9H 3GI9H 4WO4C 3V9FA 2PCPA 8FABB 1P4LB 4KTEL 3OKMB 3P9WB 5J6GB 3GSNB 1UWEL 2VIRA 1XF3B 2PR4H 3VA2C 4FRWA 4JFED 1KEML 1W72A 2B7DT 4F2MA 2W0PA 2YD1A 5FKPA 1U8MA 4I4WA 2YKLL 2AJSH 3QDGB 2MCPH 3PIQB 5ERWB 5EZIH 5I1HH 3QUZD 5DJ8A 3HTLX 5FHBH 3BZEB 4RFNC 5IOPB 3FRUA 5CINL 4C57C 3FFCA 4M5YH 3SE3A 5I19H 4OKDA 4UT6L 5F7DA 5IF0B 4YXLL 3CVIH 3WNMA 2VERN 1A7NH 1UC6A 5I1EH 2MMXA 3QYCA 4HS3A 1VDGA 2E9JA 4I48A 3DO7B 1LEGA 4XNMB 2C3HA 2R0ZL 1CGVA 4EJ1C 4JFFD 3V8OA 4AH2A 1F4HA 2EE6A 3ZYJA 1OAKH 4QOKB 4X6DE 3B5GA 4OIIL 3HB3C 2YPKB 5KAQG 4MD5B 3RKDC 1VKXA 5KVEL 1JYWA 4W81A 5E08H 2F53A 3GRWH 2BDNH 4IOIA 1DQLH 1QPXA 3AU1A 4WUUA 3VI4E 1KIUA 3MNZB 5K33A 4W70A 1I1CA 2Y06H 5E99L 1AGBA 4HUMB 4RA0C 1MCCA 2V5SA 2L0DA 1IC7H 2ERJB 3HZKB 3LKQA 4LCWD 4P99A 2HKHH 1HH9B 5GQBA 2DLFL 3WS6A 3C08H 3C6LD 2IH1B 3H7BB 1J8HA 4IDJL 2XWJB 4Z8FL 4KVNL 1HHGB 1NL0H 3GZKA 4TNVF 4FQ2H 3U7WL 1SBSH 5JXED 4XXCC 4V2BA 1INEL 3ETBF 5B8CA 1LMKA 3BPLB 3S4SA 4ZUSA 1KJMA 2Y23A 1JHLL 2NYYC 4YQXH 3RWDB 1FYTE 1JPTL 3TH4T 1IC4H 3KPSB 4J23A 5JOPD 4OAWA 4HZLB 3WHXB 1N64L 1W2KT 1MI5B 3QDMB 2RFXA 1PEZA 2IPUG 2P5EE 3HZMB 4M1DH 2DJSA 2FX8L 3OB0H 3EYVA 4JG1L 4Y1AD 1IGCH 4MNGB 4AL8H 2KH2B 2ESVD 3VD5A 4HG4J 4KHTL 5BVPH 4KPHH 1DBJH 1U3YA 4M5ZH 4KQ3L 4N9GA 5BZWA 1ND0B 4AIOA 3RPIA 1BM3L 4LHQB 5SWZE 1NMBL 1KBGL 1IAIM 2D7NA 3DMMA 3SDXF 2EDNA 4U0QB 5E9DA 3ZKND 1TQBB 1BD2A 4IOFC 3PP3K 2WBJB 2WQ8A 5INDB 4EIZC 7CGTA 1S9YA 2RQ8A 4WCYH 4XCFL 5IV2B 2OTUA 5IW1B 3Q6GL 4R4FH 5E8EB 3L6FA 4XMKL 4B41A 4LLWB 3T2NH 3U4BH 5D7IB 3JUZA 3X12A 5GRYA 3AXLB 4Y5YA 5EIQA 4YHNB 4W4OA 4UI2A 3L95A 1OP5H 2W91A 4NFCA 4PYGA 3C5JB 1M4KA 3TFKC 3LSOA 1FH5H 3TO4D 5C92A 5HVFB 1H3PL 1V5JA 3G9AB 1WEJL 1KLFA 3AUVA 2CLZB 4D0DA 2CLRA 1PX4A 5E00A 4XWOC 2I60L 2NMSA 2Z8VC 3WKMH 4PJIA 1YEKH 4MJ6A 2D4DA 2BRRL 2FO4B 3U30C 3LKRA 3QDJE 1X5KA 4HEME 1RK0A 4G9FE 4ONFH 5C6TH 4EXKA 4Q9QL 1OGAB 3P0YL 1H3UA 1YA5A 2OI9C 3CLFL 1UGNA 3GGWB 3MLZL 5E7FA 3MV7B 4JREB 1F58H 3HR6A 3VE0A 3VWJA 4FTVE 3MUY1 2GSIA 2Z35B 1I3GL 2EZ0C 5DWUL 4E41D 1HKLH 4TVSa 4I2XE 2IC2A 1KLUA 4W6YB 4Y5XB 5D9SA 3BKJH 4G6ML 3CDYA 1URLA 3HE7A 2XICA 2J6EH 4DUVA 5BZDB 5F9JA 1ZLVK 4MWFB 1CLCA 4HWZA 1XR8A 4K7FA 1NDGB 3VRLE 4HPYL 4LQ1A 4RGNB 1KELL 2P5WB 4LSDA 1DN2A 1HHJB 1GGBL 4CMMA 5L8KB 4OLZL 3GMRA 4YPGA 3GMPA 3TIDB 1R5WA 1UKQA 1J12A 3UJTL 5HYQB 1KGCE 4PRIB 3O3AA 4LSSL 4Y16B 3NAAH 4JGUA 5C09A 3SO3C 5MP6L 5T1MB 5GRUL 1NSNH 1R3KA 3WL9B 4MXQD 1PVHA 1EMTH 3WNLA 2CRYA 5FHAH 1N6VA 1PG7L 2YWYA 3O3BA 5JHDB 5KSBB 3D25A 5E6ID 3G04B 1KJ2B 4S1QH 4YUEL 4KK6D 5EO0A 4U7MA 3BAEH 4XWGL 4JVWA 3WJLC 1F2XK 1S9WB 2C7UA 2YD6A 3G5VA 1KENL 1YJDC 1CZ8H 3EJYC 5F89A 1AI1H 1RVFH 3EYOA 3DYOA 4WHTB 3ZYZA 3U36B 1RPQA 4Z7NF 1REIA 4BH8B 2WIIA 3O2DH 4QRQA 3IFLH 4NRXB 3AS0A 3HE6B 3U0TB 4OCNC 3RAJH 3MMEA 4LHUG 2OSLB 3BP5B 4PV9A 5IVXA 5DUMH 4O2EA 1D3CA 5JW4Q 4NQDB 3Q1SH 3LQZA 3P11L 3FOLA 2Q8AL 1GGIL 2F9BT 3MRBB 4Q7DA 1KTLB 4P4KA 4QRPD 3QG7L 5T3ZE 2AP2A 1N0XL 4YWGH 4PV8B 4QRUB 1IQDB 3OKLB 1EHXA 3MREB 1UXWB 2MFNA 1CR9H 2QSCL 3A6OA 3EOTL 2MPAH 4R26L 3LOWA 5C0GA 1NFDA 1EEYA 4WU7A 4G3YH 1YEHH 2PYFA 5ALCL 3V8CA 4R8WL 3ZE0E 5I1CH 1IEAB 1L0QA 1FAKT 2YSSB 2Y72A 3SDAC 5I9QC 3HNVL 3MUGB 3ARRA 1V7ML 2IBZX 5D1XA 5D1ZD 5EC2B 4HWEL 4LSPH 2OTPA 4UV7H 3PWVA 1LNUB 3WNOA 2CKBH 1K4CA 1RZJH 4F9PA 4DN3L 5CP3A 1F11A 1SMOA 4HJGB 4MJ5A 5HGDB 5BV7B 4PGJA 5I73C 4MNHB 4PFEA 2EH7L 5TE6H 1INQA 4GSDH 3TNMA 1H3VA 3U82B 4JANB 2NY4B 4AMKH 3OAYK 2JLLA 4UINH 3QA3A 3TC9A 3BISA 1ZHKB 3TVMC 1T5XA 2J5LC 3VXUB 3VXSA 5HBBA 1FGNH 3V5HB 3DSFH 3QIBD 4X6CF 3MJ7A 4HJJH 5A2FA 1MUJA 2UWEA 1A6WH 4QKXB 2GUOA 2ICWJ 2OL3B 4JQVC 1N6UA 1AD0A 2FB4H 4HWBH 4F58H 2OM5A 2ZUQB 1LDSA 3O9WB 4U3XA 4DKAA 4Y2DB 3G6AA 4TUJA 4OZIA 4QYOB 3MV9E 1KIQA 2OQJB 1DUZA 1BAFH 4FOMA 4PJCF 1KPVB 2R9HC 4PLJD 4R2GD 3U4AA 1KJVA 5JPMA 1MFDL 3OXRB 1RHHB 5GZOC 1Q72L 4ZTOL 4HPOL 4N0RA 4ONHA 3M1BB 5FYKE 5CD5D 1L7TH 4NKDB 4PGCB 3MCG1 2ENSA 3LKPB 4PJHA 4TQEL 3RUGA 2J2ZA 2XPGB 2ARJA 1NFIA 3LRSB 3VFPA 1JTPA 1XGUA 4Y19B 1IL1B 3CMOH 4U1JA 3DETD 2GSGA 5JLZB 2VKWA 3C5SA 4HWUA 5CSZA 1UYWL 3DUUA 3X14A 2FATL 1X5JA 4QRTA 2J4WH 2N7BA 1EXUA 4ZUVB 2X7LB 1A9EA 4YHPB 3WFHB 2C3WA 5EUKA 1B6DA 3VG9B 1Q94B 5F3HA 4QXGL 1BBJA 4WFEE 5CGYD 3MV11 1QSZA 5FB8B 5E4EC 4MQXC 4WVRA 1Q9OB 3FQXA 3WFCL 5EU5B 1DL7H 2AV7A 3SGJC 5IWLC 4O5LH 4Y89A 3TT1H 3FN9A 1JMXA 4X4YB 5KW9H 3K2UH 4NO0B 5BS0D 2IADA 1PSKL 5HYJA 5ABDE 5CJ5A 3BD5A 3MFFA 2JB5L 4JE4B 5IEHA 3QUMB 4WEBH 4XBGB 1WFUA 4JJ5B 2VZVA 2EIDA 3AY4A 4UMGA 4LNRA 1X5IA 2OLDA 1J1OL 3BDYH 1BQLL 1CDGA 4MS8D 4NQCE 3OKOB 4QNPE 5IJVA 2F5AH 1U8HB 2HLFD 3BEVB 5TF0A 4OD3H 3F7VA 5GRZA 1XFPA 1S9VA 3JUYA 4U2YA 3GKWH 1TZIA 2PW2B 1GVIA 4BK4A 1NCWL 1VEMA 4OCSL 3EOYG 3ZKSD 1R3IL 1P4BH 1DUYB 2EDRA 3P4OB 1C12B 3V79C 4OI7A 3DYPA 3UPCA 2WWMD 4NRZA 3OGCA 4PJFE 4L29A 3NFNA 3NFPB 3KPRE 4LCIH 1MCOH 3LQMA 1X44A 4EBQH 3ZMRA 3MJ6A 3P77A 4NQED 2AI0H 1VACB 2MJWA 1MFNA 4UB0H 3DXAB 3NZ8A 2IFGA 1MQKH 1JUFB 2BVPB 2Y6SC 3NIFF 1KT2B 2VKXA 3V5DA 5CEYA 4MNQB 1KIPB 5DD1L 3QUYA 1C7SA 4NYLB 2YD9A 1AQDB 1G9NH 1KXQE 4G8IA 3FB7B 2VDOH 1IGMH 4JFDB 5C2UB 3GMQB 2PXYB 5KJRL 2PO6D 4QHNA 1YY9D 3MZTA 3HI6H 4LIQH 4UV4L 5DJYB 4XH2A 3TO2A 4K71C 1U8OA 2IGFL 4YEFA 2G5BB 1WIPA 1ORSB 5JPNA 5FIEA 3MRIB 1M7DB 5EC1B 2G60L 5ISZE 4P9HL 3P4LA 5A2KH 5KTEL 1CBVL 5C0NC 1XF2A 3OB8A 3R1GH 1AGDB 3BZFB 5DJZA 3UX9B 4E9LA 3RTQA 3C60C 1CXIA 4ELKA 4LPXA 1YPZB 4XP4H 3FZUC 3CX5K 3ROLA 3MBEA 2DWDB 3ARSA 5KSAD 4YBQD 4O2CB 3SPVB 1FO0L 2BVYA 1KXVC 2YXMA 3BPNC 5MHSD 3NMEA 3BT2H 4D94A 4G43A 5IFAL 4LMQI 5DK2A 1CK0H 5IT2L 5HI3D 5IB1B 4KY1L 5MI0C 5C0CE 2HMIC 1ZVSA 5TF1H 3BUYB 4WWKA 1XF4B 4PJ5A 3MV8D 4OCXL 2XT1B 3B43A 5T3XD 3VXTB 1CXHA 1NAMH 4DZ8B 3O6FD 3WXWL 1B2WL 5MEOB 3LQAH 5MENE 5EUOB 4GOSA 3SCMA 4ELMB 5HHQA 5GISH 2XWTB 1A47A 5IHLB 2CH8A 3CK0H 1MLBA 1X5HA 4R4BA 3B8SA 5C7XH 1S7UB 1EAJA 2FHFA 1D5BA 3LEVL 1HQRA 4G7YH 1EEQA 2BP3A 5KSVA 2R1WA 3WDJA 2R4RH 4N0FB 1KACB 4P3DB 3MLUL 1CGSH 5F9WB 4QT5B 2HJKB 1MRDL 1MJ8H 3ZTJG 1RZIB 3AGVA 3T08A 1P7KB 4PYHA 4K23H 4TVPL 1MJJB 4L4VE 4DKEL 3BP4B 1R5IB 4EOWH 2O26U 5BRZA 2P24B 5GRJL 1E4WL 1IAKA 2JJTC 3OR7A 1XGRA 3P9MB 4H25A 2V5YA 4HJ0C 3V4VH 2VDNH 5FA4A 4CDHA 4PGZA 5DQDL 4ZXBA 3OZ9L 1C5CH 5D72H 4PJ8C 1BFTA 1YYLH 4M61B 3QH3A 4FMFA 5T3ZD 4XBEL 1I1FA 4MGXA 4LP4A 4MXWL 5C08E 4TNVK 2NY2C 5E4IA 1Q9WA 4XBPA 3VFVA 2VLME 1JHTB 1MRFH 4XNZB 5LCVL 3BXNB 3LZFH 5HYIA 2FYYB 4X6BB 2Z9TA 5D1QB 3ZDYF 1U8PB 4XPTH 1A7OH 3U79A 4GQ9H 5EFIB 4J4PA 1ZGLA 1JZ6A 5DMKB 2ZSVB 1J1XL 3Q6FB 2A6KA 3PJSB 2JELH 1QBLH 4XP9L 1RZ7H 2R2HA 1T3FA 4ODUB 1A7QL 4A6YA 3RX5A 4XCNB 2PTUA 4NO5B 2CJUL 4NN5B 1LP9A 1VFBB 3NCJH 1YC7A 2VLJD 4QRRD 4KJWC 4EDWL 4F9LC 5ADPL 2G75A 2V9QA 3GMNB 4L3CA 4N0UB 3VRIB 4L8SB 4X5WA 3LKSA 4NOBA 3PXHA 3MZGB 1UVQB 3ARGD 1KPRB 2BVQA 3MRMB 3O2WL 1JV5A 3O6ML 1IMHC 1ZHBA 4HUUA 4ZFFA 1FIGH 1RULH 2NXYB 1YEJH 3HNSL 1S7TA 1YEGH 4LSRH 2GY7B 4IHOA 4YXKL 1K3ZA 3FQTA 2QV2A 1EHLH 1CU4H 5SWSA 4LSTL 2C4FT 4P2OD 1NCDH 2F74A 1MCQA 4OZ4B 4FQCH 1H5BA 1JGDA 3QEUB 2XY1A 3G6JF 4K7PY 1G1YA 4OF0A 5DF0A 4X9FA 1E4XH 2HFGL 4JO3H 1GZPA 3WKNA 2FL5A 4JGJA 1CFBA 5E8OA 3DX9A 5IMOA 1DBBL 3N85H 1MNUL 4GKOA 1X5GA 4LLQB 4PD4J 2C3VA 2IANA 1ED3A 5KOVC 1EEZA 2MHAA 5ESAA 3SBWC 4ZSOE 5HHOA 3GFUA 3I6GB 1FVEA 3HMXH 1JZ8A 5FUCC 1Q0XL 4KMLB 5JMRA 1R3LB 2GJJA 2W38A 5DSCA 5IESL 4NBZB 5EU4A 1WBZB 3IF1B 4I77H 1HXMB 1U8QB 2V2WB 4PJGB 1ZANH 2Z92B 3T0EE 4KMTL 3MJ9H 3S35L 5IB2A 2EEDA 3K3QA 4JY6A 4IS6A 4KDTC 5T5NG 3WFEH 1BOGA 5DVOA 2PCPB 5E5MA 2KL6A 2NTFA 3DSNA 1AY1L 4ODXB 4WO4D 3CU1A 2M8XA 1EA9C 2WIMA 2CUMA 4WFFE 1DQDH 1R3HA 2VIRB 5GGTA 1DSFH 1QBAA 1W72B 4F2MB 2YRLA 3PDDA 5FKPB 4I4WB 2VLRD 2F54E 2ERJC 3K8LA 3KR3L 4L4TE 3OJMB 5DJ8B 3NBNA 3UTTD 1NC2A 4GG6E 2DQCH 3FRUB 5JR1H 1T2XA 5FECA 3FFCB 1F2QA 5F96H 4Y8DC 4KQ4L 4ZFZA 3ULVC 3JV6A 5CCKH 4OZGA 3PHOB 3SE4A 2X9YA 4OGZA 5F7DB 4B50A 1AC6A 1A21A 3KJ4B 3BPLC 2OZ4A 4HH8A 3BFOA 4HS3B 2VR9A 1C5BL 4HKZA 4I48B 1LEGB 3LHPL 3TYGL 1T1WA 2AJXL 1T22A 1RUPH 2BY3A 4AH2B 3HPLA 1RZGA 4WHYH 3NIDF 3KPRD 4CN1A 2ZCLL 2Y25A 3U7YH 1OT2A 4FFWC 5EU6A 1TCRA 1RUKL 2Z8WC 5D5MA 4N0CC 1VKXB 4OB5H 1EFXA 3HB3D 1BBDH 3V95A 3RKDD 4JZNB 4IOIB 3U4EA 5T3XH 2AV1A 2IF7A 4WUUB 4LVOB 4H8WH 3V6OC 5KVDH 4YGAB 4HIXL 1AGBB 2MKWA 4UILH 2X1WL 2G9HA 3LKQB 3TJEH 1CD8A 3DUHA 4ONGL 1RV6X 4KV5F 1TZGL 5HYFA 2WBKA 5J11B 1CTNA 1J8HB 3OG4B 1TQBC 5IG7A 3N1FC 5F1IA 2Q20A 2X42A 3GHBH 3CVHH 2P8LA 2WBJC 4LPCA 1WFTA 4K8RC 2CDEB 4NCC1 2CGRL 4FABH 5B8CB 1A14L 3S4SB 4ZUSB 1KJMB 5TPWH 2A9MH 2NYYD 4OAWB 3VDBA 3PWPD 4KTEH 2RFXB 4H20L 2YEZA 4LU5H 2EE2A 3UZVB 1QSFA 3N0PB 4XNUL 4I3RH 2Q87A 3TBVA 1RIVL 1I8LA 3VXPB 4OF3A 3EYVB 1KLGB 5HDBF 2ARWA 5B21A 5LJYH 2R29L 3L5XL 4NUGL 5HDQH 4XVTL 4N9GB 2DQDH 4MD0A 5BZWB 1IKFL 1EJOL 3RPIB 5I1AA 2HYMA 1A3RH 5CIPA 4ODSH 5LBSL 5MEND 3DMMB 2ADFH 4DUXA 4NJAL 5E9DB 1IAIL 1OGTA 4KKBC 3KXFE 1BD2B 3GEWB 5C0EA 4OQTL 2LU3A 4Y5XC 3KYKL 4IOFD 1S9YB 1CQYA 2YMXL 1WT5C 2DAVA 3GSQA 2OTUB 2F19L 3RVVC 4LHUD 4XZUB 1FNSH 3L6FB 1P7QA 1EHNA 4JRXD 4PJXF 3D69A 3JBG7 1LO5A 1GIGH 3X12B 4Y5YB 1ZGLP 4M7JH 3L95B 3MPCA 4RGNC 4NKIL 1XGQA 4M6MH 1N5YH 1KB9K 3LSOB 5IM7A 5EB9A 2QSTA 4NC1C 5ACMA 4WEMB 1HK6A 4WTXA 3BP7A 4UIKH 3S7GA 4D0DB 3D87B 2CLRB 5E00B 2APXA 3IDUA 4APQA 1DVFA 1RUML 4MJ6B 4XWOD 3CSGA 5KVGH 1MH5A 3LKRB 1RK0B 2ARJQ 2XQBL 3UTZA 4PJEA 2J8UF 3QDHA 4XXDA 1N7MH 4PJBE 2WINA 4N8PA 5DR5H 2UZYB 2PETA 1IGJA 2VR5A 1G7IA 3VE0B 3VWJB 2GSIB 2WW8A 1JHLH 3UTSA 1U58B 2DBLH 4IOSD 2VDPH 2EZ0D 3N1MC 1KLUB 5D9SB 3VGAB 2CKNA 4OCRL 4ORGB 3HE7B 2BVOB 3DNKA 1OAYH 3QFJD 1EO8H 1CDIA 3BN3B 5F9JB 1NGZA 1IILE 3HE6C 1XR8B 4HWZB 4K7FB 4M6NH 5KANG 2EDQA 2A83A 4U1LA 3MRPA 3KNBA 4OZFA 3SDCA 3WIHH 3EZ8A 4CMMB 1A64A 1CCZA 3K4ZA 3GMRB 4Z95L 3KPPA 5JDJA 4YPGB 3GMPB 1R5WB 3QPXL 1T7YA 1QTYT 4OV5A 4K3JL 2HTLC 5EN2B 3L1OL 2QHRL 5IVOA 5C09B 4RMQA 3V7AG 2MQ3A 3QEQE 4XC1H 4DGVL 4TOYH 1K6QH 5LQBL 1R3KB 1MFCL 2VLKD 4V1DA 3HFML 4JRYE 3O3BB 3D9AH 1H3WM 4XCFH 3D25B 5GIRB 1H3GA 1AKJD 4U1IA 1JMZA 3ARFA 5EO0B 2XN9E 1QFUL 4CUCA 2CMRL 2C7UB 3U9UA 3G5VB 1WWBX 3EYOB 2BY2A 4RAUA 2BNQD 5K9JH 5BV7C 3EJYD 2WIIB 3BX7C 5I1KH 4QRQB 1MJUL 1D5MA 2JCCF 1MFAH 1LDPH 4G42A 4MAUL 2HWZL 2NY4C 4AQOA 4JFPA 4PV9B 5FO8A 5IVXB 5L6YH 3RDTC 4O2EB 4UDTA 5EU7C 4K7PH 1GL4B 2P48B 3LQZB 3VI3E 3FOLB 3MBXL 4HBQA 5T3ZL 3N50A 4I18A 1CXKA 4P4KB 4ZD3H 1UEYA 1ZV5A 4Q9QH 1ZT1A 3TP4A 1GGYA 4X0KA 3B5TA 3BRGC 3N9GL 2ZUQC 2O61B 3G5XA 3CLFH 4Y2DC 5C0GB 3MLZH 4RDQG 1H9VA 1XIWA 2JB6A 1T83A 1NFDB 4WU7B 2PYFB 4ZAKC 1F13A 2CK2A 4RIRA 2NX5E 4GMSL 5GS3A 1J5OL 4P2RD 1QKZH 5GSVA 3HMWH 3EO1B 4OZHA 1RMFH 1FNAA 1QBMH 3T3MF 1T7XA 3SDAD 5CLTA 1BHGA 5KOMC 4DVBA 3PWVB 4WFFD 1K4CB 4ZO8A 5DZOA 4CVXA 3STLA 1F11B 2AKRA 3PE9A 3SOBL 3GHEL 4HHAA 4MJ5B 4MX7A 4F80A 1QHOA 4L4TD 2UZIH 2VDMH 1GGBH 3BGFB 5M95B 1QR1A 1INQB 4U1NB 1P9MC 1FZJA 1IGFL 3TNMB 1A6ZA 1E4KA 3S88H 1G0DA 3GIVA 3QA3B 3VG9C 2ZKHH 1IRAY 5J0BA 3VXSB 1MIMH 4OD2A 5DURD 2QQNL 2N56A 1EBAA 5KVFL 5MP6H 3MJ7B 4U3CA 4Z7VA 1MUJB 2UWEB 2GUOB 2NZ9C 1AD0B 5ETUA 1NFKA 3QJFA 1UADC 2BCKA 3H9ZA 5HD8C 1NGQL 3V0VA 4P23C 3DPBA 4OZIB 1KIQB 1DUZB 2WANA 5T1LA 1MAJA 1KJVB 5JPMB 2V5TA 5FYKL 3MCLL 4I5BA 4HKJA 3VH8A 4ONHB 3CGTA 5EU3B 3VI4F 1LO4H 2DM3A 5GZOD 4PJHB 5HXMA 3RUGB 2DQGL 2ATKA 3WXVL 2ARJB 3JWDH 1NFIB 2OS7A 3MA9L 3VFPB 3WN5A 1XGUB 4OQ1A 4U1JB 2GSGB 2VL5A 3TN0A 3C5SB 3CSYA 2DM2A 3OB0K 1Z0NA 5I30L 5CSZB 3DUUB 3X14B 4LARL 4EQ2A 4Q6YA 4QRTB 1FZKA 1EXUB 1BWMA 5D2LA 1UWGL 2QSVA 1A9EB 2Q8AH 4YXHL 1PLGH 1OTSC 2BFVL 5EUKB 1N0XH 5F3HB 1BBJB 3D39A 3JV4B 4DK6A 4K2UL 4F7CA 4EQ3A 1VPOL 3MLXH 2AV7B 3P73B 2YD4A 4MQXD 5GXBB 2WMPA 2DLGA 5GGQL 3VXRE 1UZ6F 5BOPA 3SKJH 4P57A 3GBNH 1OD7A 3GSVA 4OFPA 5MEPA 2IADB 3MFFB 5GJSH 3ECBA 1G1CA 5IEHB 3MC0A 1KJ3H 3LIZL 4R90H 5C07D 5L2KE 3SJVD 2AEQL 3IDXL 3BGAA 4LNRB 1L7IL 2PXYC 1U3HA 5EBMB 3X3FH 2A74A 5DMGC 3M17A 1JGLH 2DM4A 2H45A 5IJVB 3EOAA 3KPNB 3OQ3B 2CRMA 3L5JA 4P5TA 2XG5A 3F7VB 4G6KL 2H41A 1S9VB 1ITCA 4NHCH 3H9SA 3RHWK 1TNMA 1TZIB 4LRIC 4HUVA 5J4MA 2VZ1A 1KEGL 2FSEA 4MA7H 4BM7A 4AM0A 1E27A 3RVTC 3X11A 4XTRC 4M1GL 4JKKA 4LLDA 1F8TL 3OGCB 4NRZB 4ERSH 3KPTA 1RHFA 3C09C 4GAJL 2AK1H 4L29B 3NFNB 5GS0C 3BYYA 2HLAA 5I74B 1RAMA 1A7BA 5C0AD 2XZCL 4P46A 3P77B 2MQCA 2H9GA 4ZTOH 6FABH 3ARDC 4DK3A 3NZ8B 4C58B 4LAQL 1RIHL 1BPVA 5DVLA 3CAFA 3V5DB 2FR4A 5CEYB 3QUYB 2Y6SD 4MJID 2LVCA 4G8IB 2EDEA 5F88A 5F9AC 4WDIA 1BEYH 4QHNB 2YPVL 2XV6B 3TO2B 1UB5A 4XH2B 2R4SH 2Z8RA 2R69H 1U8OB 3EW3B 4X6FA 5JPNB 1FBIL 2BOBA 4BK5A 5FGBC 3BEWA 4GXVH 3UTPE 3VGHA 3K8KA 1M7IA 1OAQH 1XF2B 4WFHD 2D0HA 5I15L 5DJZB 1YJDH 5F9WC 3RTQB 2L7JA 1TCMA 4ELKB 5JXAL 3ARZA 3M8OL 3ROLB 3MBEB 5CEZD 4M62H 5I8KL 4Y4HA 3FZUD 4YAQA 1BGXL 4DGIH 1Z9OA 3MROA 4NSKA 1J0YA 5DK2B 2EIZA 4F57L 1MHPH 5EWIL 4AT6A 1X4ZA 5I1GL 1ZVSB 2VLLA 4WWKB 3MV01 4PJ5B 4OGXH 1ZA3A 4ZPVA 2BJML 2AJYH 1PY9A 4LCYA 3P9LA 4POUB 3UROR 2F15A 5KS9E 1OGAE 4XPBL 3SCMB 4XNZC 2IG2H 3I2CL 3AREA 3KDMA 1MLBB 3GMLA 3SKMA 5BOZG 4R4BB 3K81A 2DIAA 5D1QC 1D5BB 4JRYD 1HQRB 2X1PA 4ORZC 5KSVB 2R1WB 5DVNA 4LLYA 1LE5A 3UC0L 5A1AA 1FFPA 3FL7A 2R0LH 1GHFH 2CLVB 2YHGA 2OP4H 1X5YA 1PKQA 4L8DA 5HHXL 5BRZB 2HH0H 1IAKB 3OR7B 1XGRB 1S5HA 4XAKE 4NN5C 4PJ9C 4H25B 3E8UL 5F1KC 2UVFA 5LWYH 3L3OA 5FA4B 1K9TA 4OIAA 3UYPA 4HJ0D 1TVBA 5HGGS 1ES0A 1I1FB 3D1MC 1KCUL 4YDIH 1U36A 4PJ8D 2IGFH 2ZCHL 1YQVL 4MLIA 4XBPB 4P9ML 5D7LE 3VFVB 1QFPA 4KI5E 2NY2D 4DCQA 2NXYC 3HS0A 1FNFA 2NX5D 3TA3A 1J0JA 1WFNA 1ZGLB 3KPMA 2Y5TB 5GHWL 5CBAB 1DQMH 3L7FA 1ZLSL 5HI5C 5IR1A 4PJAF 2A6KB 2NY5C 1J1PH 3ARQA 1QACA 2R2HB 2X1XR 4NM8H 4XVJL 4CJ0A 1T3FB 4M9PA 4PLKC 5DA0B 1LEKA 5HVHB 4A6YB 4TYUA 3G6JA 1CIDA 3RNQA 2X4NA 1D6VL 1PW3A 1LP9B 4G5ZH 4R97B 3TESA 1DBAL 1X4XA 2DRUA 1WTLA 3I50H 5I18H 5I1IL 3PDOA 1MCFA 4BUGA 2NNAA 4L3CB 5CJQH 4KJWD 4NQSA 5IMMA 3TNNA 2FGWH 3KG5A 4X5WB 3LKSB 1Y6NR 1K8DA 2MTPA 3DV4A 1JYNA 2BVQB 4JHAH 2DL2A 1JV5B 2QJDA 1A6UH 3HC4H 3G6DL 3K80A 1ZHBB 3IS0X 4OFYA 1OAZL 4HUUB 4ZFFB 1ZT4A 3RRQA 2DYPD 1I3RA 1S7TB 4UTAL 3R8QA 4HG4K 5CMAA 2Q8BL 1MHCA 4IHOB 5DD0L 4AYFA 1S5IH 3FQTB 4NJ9L 3L3KA 3IAQA 1EHAA 3BE1H 4Z7UA 5SWSB 2F74B 1J86A 1OY3B 1EEUA 4YLQT 1H5BB 1JGDB 2DQIH 4OLXH 4PREA 1G6RH 4QF1A 3T0DA 2CIKA 2ZNWA 1I9IH 3QDGD 5TDPA 3T0VA 1MCDA 3UJJH 1GZPB 2FEEL 2FL5B 5E8OB 3ZTJH 3VG0H 4HUKB 5IMOB 4LLUA 3QZWA 4TPRH 4ODTH 2C3VB 2IANB 1ED3B 1EEZB 4YHMH 1EERB 2MHAB 3QHFL 2P46B 3KJ4C 5HHOB 2XIDA 5JIPA 3WEXA 3T1WA 1FVEB 3EFDL 1ZGLM 4HGWA 4YHKL 1S7VA 1WAAE 4JM2A 5DSCB 4IIQA 1NH6A 3CFEA 5EU4B 1FRGL 1IC5L 1JPGA 4PBXA 2Z0BA 5IB2B 5JW4N 4IRSA 1X5XA 4JY6B 4IS6B 5C0JA 4QOKD 5E6ZA 5D6CA 3VFMA 3HUJE 4AEEA 2X05A 1BOGB 1CDCA 3BN9D 3OAZK 2NTFB 5C9JA 5IROA 4KDVA 2DICA 1T6WA 2BSRA 4LVOC 3RX8A 3UAJC 1VHPA 5F1NA 1R3HB 3EO9L 2X4RB 4DOHE 5L0QB 1JNNL 5E2VH 3RWFA 4PR5A 4NWTL 1BZ7A 5JHLL 1RUQH 2A6IA 2B1HL 4JQIL 2P47B 1A3LH 2BNUA 4ISVA 5DO2D 3WS6C 1FL3A 3TVMA 1NC2B 5IMLA 1A6AA 4OLEA 5J11C 1OLLA 5FECB 3EHBC 2EDHA 4EDWH 1ZAGA 2APBA 5ADPH 3LN5B 3RWGA 1T0MA 3JV6B 4OZGB 3G5ZA 3BGMA 4NO3A 2CDGA 3FMGL 4HMDA 5DJDA 1YN6A 3ULVD 2OR8A 2R2BA 3MLRH 3MRCA 5D2NA 1OL0A 5B8CC 5CEZH 5CP7B 1EVTC 1CE6A 1OW0A 3O2WH 4RMVA 4HKZB 3O6MH 2DIJA 1T1WB 4YPJA 1I1RA 1T22B 1U8KA 3HPLB 3RWHA 5INCA 4WGVB 3KPSD 3FQWB 5GGRA 5IQ9A 4KK5C 5EU6B 2NY5L 1WZKA 1MI5D 2EYSA 1UM4L 4U6XA 1NGYA 1FE8L 2XTLA 4LSTH 4YDVA 5H35A 1EFXB 3PWLA 1F02I 3U4EB 4BSWA 1FO0A 2AV1B 4WI5A 4ZTPL 1ZE3C 3S5LA 2GTZA 3RKPA 4PY7A 2HFGH 1Q0YL 1ZWIA 3I6KA 2EDFA 1DCLA 5I8CB 3MLPA 4JCLA 4S0TD 3EAKA 1U41A 3ULSA 3DVGA 1BZ9A 5ENWA 1S78D 2EDJA 3DMMC 1VFAA 2ZNXA 4F7EA 3WLWC 1A8JH 5IG7B 1F00I 1X4YA 1KCSL 5EIVA 5DMYA 5F1IB 3QG6A 2VYRE 4MA8L 3MODL 2P8LB 4OKVB 5IBTH 4LEOA 1Q0XH 3UTPD 3W9EB 2DQUL 5C1MB 2EEAA 2WBJD 3JV5A 1WUNT 4KMTH 4LLVA 3KLDA 5FYJE 4PRPE 5D8JH 4ZOAA 3U0WL 1U8LA 3ELAT 5CWSA 4JO1L 1L0XA 4W4OC 1OAXH 2YEZB 4O58L 2J1KA 1QSFB 4G7VH 3SKNA 3TBVB 1CLYH 4KI1A 1P2CA 1QRNA 1AP2A 3PWJA 1A7RH 3O11B 4MNQE 1AO7A 2A77L 2AK4A 3KR3H 3MGOA 3L3IA 1HIML 1JP5A 2ITCA 1VGKA 2O5XL 4MD0B 3VJ6A 1XGPA 5AD0A 3DX7A 2YXFA 1C1EH 4ZYKA 2XTJB 5I1AB 5F7KC 5CIPB 4KQ4H 2YC1A 1OGAD 1RK1A 3DBXA 1WK0A 2GJ6E 1OGTB 3VWJC 3ZE2F 3BO8A 4WV1C 3MV7D 1NUNB 5C0EB 4X5LA 3PUCA 2Y36L 3E3QE 3OF6D 2AJXH 3C5ZC 4L8BB 2WZPD 3GSQB 1NJ9B 3VGAC 2FZ3A 4E41A 4K9EL 5IW3A 1CFQA 1QUNA 4XVSL 4ACPA 5IKCB 2PUQT 3HE7C 1P7QB 4DN4H 3RVVD 4L3EE 3D69B 1MF2L 1PD6A 2D9CA 3SY0A 2XXMB 2R0KL 4FQQA 3PGDA 1KB5L 3S4SG 4JR9L 1I4FA 3PG2A 4OM0H 3SQOL 4KVCL 5IM7B 1MLCA 2AEWA 4HIXH 2P5WD 4HCRH 3VD4A 4AEIL 3AB0B 3QNXA 4S1SL 2R0WL 3BP7B 1JNJA 1JZ7A 3O4LA 4BFGA 2LU4A 1DVFB 4JPIA 3SDXE 1MH5B 4PRID 4Y16D 2BC4B 3UTZB 3EGSA 1I9EA 4PJEB 5F7HA 4XXDB 5D7LD 2WINB 3QEHB 4YBHA 2J8OA 3IDYC 4KI5D 1IGJB 5K9OB 4YR6A 1FORH 1G7IB 2VDKH 4GLRI 3WNPA 1A14H 3GSNH 5JHDD 3NN8A 3UTSB 3NABL 1OTTD 2P8PA 3F65A 5AWNH 3TV3L 2WAHA 3IDJA 8CGTA 2AJUL 4RWHA 4RZCA 1YN7A 2DTMH 4H20H 1NGZB 1RIVH 3DIFA 2HFFA 4Y4KA 1R24A 2A83B 3HE6D 5IB4A 3MRPB 5ELIA 3SN6N 4KUZL 4OZFB 2IQ9H 3SDCB 3P30H 1NCCL 4DAGH 4CDGC 2NLJA 3ARBD 4YE4H 3KPPB 4P4KC 3S6CA 1WJ3A 1EJOH 2ZOLA 5ALBH 1E6OL 4NGHH 4OV5B 3ZKQD 3S96A 3KS0J 3LEYH 4NZTH 2HTLD 1IAIH 5H2BA 5F8RC 3DTXB 5FM5M 3BMVA 1WFOA 3NACH 3NCEB 4V1DB 1G9MC 1IBGL 2R56H 3DO3A 2K1MA 4LMQE 1GH7A 2QQKL 1K2DA 4JG0L 4WRLA 3ARFB 5D93C 1LHZA 1IFHL 1BECA 3U9UB 4RFEA 1OCWL 1ZA6A 4F9PC 2WP3O 4RAUB 4QRSA 3PV7A 1KN2L 1JNLL 2DD8L 2X9XA 1OLZA 1CLOH 1D5MB 4FP8H 1CE1L 2I9TA 3BGFC 1ZHNA 4G42B 3GM8A 3ALXA 2VC2L 3MYZA 4JFPB 5F3BA 3VXMA 1FPTH 5FO8B 2R8SL 4UDTB 2CUIA 3ULVH 4JZJA 4JO4L 5HHMB 3VXUD 4I18B 5JZ7C 3WFBH 3RWJA 3FJTA 3BH8A 5AEAA 4CGTA 4MB5A 1EUTA 2YN3A 1ZT1B 4X0KB 3QIBA 3B6SA 5DLML 4FQ1L 1KFAL 3G5XB 2WK2A 3QI9D 1GSMA 1JZ2A 2JB6B 4JM4H 4XPGH 3O9WD 4KHXL 2A1WL 4DFIA 4O4YL 4RIRB 1LO0H 5GSVB 4GKZA 4OZHB 4HC1L 3KHOA 4X6DA 1LD9A 2ZG1A 1MEXH 2AQ2A 4P2QE 4XNXL 5DZLA 4Z7NE 4I0CC 3CX5J 3TIEA 3T0BA 4DVBB 2E7LC 4CVXB 3STLB 2AKRB 1IEHA 4HHAB 4Y19D 4DW2H 3T09A 3S36H 4MX7B 4XT1C 4NNYA 1F5WA 4EIGB 2HVJA 3TBTA 1QR1B 4AEHL 1FZJB 4N0YL 1FAIL 5J8OA 1A6ZB 1B90A 3GIVB 3HG1E 3RWCB 4OD2B 1Y6KR 1F4YL 3OTTA 3IKCA 2QHRH 2E9IA 2Y9RT 1XF5A 4Z7VB 4G6AC 5LQBH 1QSEE 1TZHA 2GKIA 5DVKA 5ETUB 3KLAA 3QJFB 4WW1A 2NZ9D 9CGTA 2WLZA 2BCKB 3OKMA 1A1OA 3GIZH 3V0VB 1TJHL 4B7IA 1FYTA 5E2TL 4IM8A 3OR6B 1XF3A 3F7QA 3VH8B 2CMRH 4HKJB 4I5BB 3D2UA 4ZODA 4NO0D 1UACL 1Z5LA 4BFIA 3ZDXF 1AXTH 2P5EA 2LVEA 3AY4C 4I1NB 2ATKB 2XRAL 2VQ1A 1P5VA 3WN5B 1DP0A 1AGFA 2PYEB 3QIUD 2VL5B 3TN0B 3GSRB 3CSYB 3DARA 1CGXA 2ZJSH 5ESQA 5AAWA 3PHQA 3ALPA 1S9XA 3KLHC 4F37F 1FZKB 3H0TA 5D2LB 2Y07L 1YEEH 4PIRF 2EC9T 2WBWB 1LK3H 3FFCE 1LVEA 4X6CE 1F4WL 3C2AL 1A2YA 5SWZA 1GC1L 3DO7A 1L0YA 4HK3N 2VXUL 1XF1A 2AABL 1G9ML 1TJIL 4YO0A 1I9RH 3VCLA 5ITFA 3D39B 3MUZ1 4C56E 5HHNA 4LSVH 1UJTA 4QTIL 1B0WA 3HI1A 4F7CB 4KDTA 3LN9A 1FL6A 5F9OL 4PJCE 1PZ5A 4PRPD 4OQTA 5DHVA 4GMTL 4KU1A 5CJBA 2R1XA 5F97E 5JQHC 5DT1H 3WIIH 4P57B 3GSVB 4LCUA 5MEPB 1XGYL 5DRZA 3MNZA 4ZFGH 3CCHA 2F53E 3ECBB 3HLAA 4W6XB 4U7KA 3QUYC 4WUKL 4JN2A 3HZKA 1UWXH 1TNNA 3JWOC 4KGLA 2NZIA 4MNQD 4WY7L 5GRVL 3VA6A 1CDBA 1U3HB 2IPTL 4R4NC 4CJ1A 2A74B 3KYNA 3NPZB 4P0DA 5HJ3A 1KNOA 4P5TB 1N6QH 4HKXA 3H9SB 1S7RA 5KVFH 3QDJA 2CIIA 3V7MA 4G9FA 1SY6L 1NMAH 1KJ2H 2VABA 4HUVB 4HMCA 4P59L 5ACLA 3WIFB 3T3PF 2FSEB 3QQNA 4X8XA 3GSWA 1OP3H 1NCAL 3UPRA 1E27B 5EA0L 3X11B 4FTVA 4PJ7A 4PRHA 3MBEC 4LLDB 4TSBH 4WEUD 4XTRD 3IXTA 5HVWA 1BF2A 3MRFB 2ATPA 4I2XA 2HLAB 4UT9H 4XP5L 1I8KA 5IJKC 5F7FA 4OJFH 5FGRA 5GS0D 4P46B 1YNTA 4MNGA 2EDOA 2H9GB 4Z0BL 1HHIA 1QNZH 5TDNA 3V6OA 5D71L 4YNYA 3A67H 3U6RA 4FQIH 1KC5H 4M48H 3KJ6L 4WWKC 4RMWA 1MAKA 3AS1A 4QHMA 2FR4B 5FK9A 5BQ7A 4I3SL 4NDMB 3W2DH 3GM0A 4S1DC 1FC1A 5F88B 4GW4A 4WDIB 1F4XH 5DYOA 5HYEA 5C0DB 2DLIA 2ED8A 3QRGL 3SCMC 1UB5B 4NNPL 4MAYA 1V3KA 4WFGE 5CSBA 1WZ1L 1QFWL 2IPUK 4X6FB 4OLVL 2BOBB 2X4UA 3BEWB 4GKSA 4GRMB 4ZS7H 1M7IB 5I1LA 1JWMA 1TVDA 4OM1H 4RX4D 2B1AH 2B8OT 4MVBC 4XMLL 3S34H 3RI5K 1K8IA 3QEGL 5BV7H 3IRZA 3SDDC 1ODAA 5IFHH 4G8GE 3CX2A 3BQUA 3KS0H 4Y4HB 4YAQB 3MROB 2P42B 4NSKB 3A6CL 4HAGA 4OUOA 4JPVH 1N4XL 5DJCA 5J56B 3NIFE 2EIZB 3ZE1F 5BO1H 4BQ9A 2SEBA 1B0RA 1BFVH 4AT6B 5SX5K 5DHXB 1U92A 4YZFF 1CF8H 4Y8AA 3LEXA 3VFOA 2ICCA 2FEDC 2VLLB 3D3VE 3MACL 4U31A 3AVEA 1ZA3B 2OL3H 3H2WA 3H3PL 4ZPVB 1YMME 4FQJH 3PQYE 4PJIE 4ZFOL 4LCYB 3P9LB 1S7XA 5TQ2H 4ZOBA 2H32A 4XRCB 3AREB 3KDMB 2XKUA 4CBPA 4YFDB 3GMLB 3SKMB 3IRPX 3EYUH 4NKMB 4EI5A 2FRGP 5J3HD 3AFLA 3FQRA 1MIEL 2I24N 1I1AD 4LLYB 2XACC 5D1QD 4MWFA 1HKFA 1LE5B 4J4PC 1Z0MA 2AJZA 1FFPB 4PJDF 3VFGH 4NZUL 2XZCH 1Y6MR 1OAUL 2C5DC 1B4JL 1A4KA 4L4JA 4M43H 1PKQB 4L8DB 4LAQH 3GBML 5HVHC 3NCCB 2C3GA 1S5HB 3GKZA 1NCBH 1MCWM 2F8OA 1A5FL 4MD4B 2NR6C 3LD8B 2CRIA 1QLEH 4ODBD 4R97C 3MNVA 3VGFA 3QPQC 3L3OB 5E0QA 3W0WB 2X41A 4HWNA 4P4RA 2ZUYA 1RJYA 1RZ8A 1TVBB 2HRPH 1ES0B 1JPSL 4OGYH 1MELA 1BVKA 3WD5L 1UENA 2VAJA 4RMSA 1G7JA 3S35X 1GPOL 1QOKA 1WBYA 3GJFB 4DCQB 4M7LT 4HQQH 3OMZA 3HS0B 3I75A 1J11A 3QUMH 5I15H 3QFDA 5F7EH 2NXYD 3TA3B 2J7LA 3IGAA 4XX1E 5IGXL 3MV9A 2VISB 4X98A 5I8KH 4OSUL 4KJPC 4P2QD 3JXAA 3HA0A 3KPMB 5L88L 2CQVA 2OSLA 3L7FB 1PX3A 1AQKH 1JIBA 2YUXA 5IR1B 2XZAH 5EWIH 2RIKA 1OM3L 5MERA 3ARUA 4NQTA 5HI5D 1LEKB 1DQJA 2YPLB 2A9NL 3G6JB 3RNQB 4PLKD 2X4NB 1HNFA 2BJMH 2FH6A 4Q9CA 1F45A 3PDOB 1CICA 2NNAB 5F6IB 1OQOA 4NQSB 2OR9H 5IMMB 4XPBH 3TNNB 3I2CH 1MREH 1K8DB 3RA7L 4XCCL 5CKGA 1UM5L 3F12A 4POZC 3O6LH 3UJIH 4FQXA 1ZT4B 3FB5A 1ZTXL 1I3RB 3MRQA 4RQQB 1O0VA 4D9LL 2V5MA 4U49A 1F90H 5CMAB 1MHCB 4FNLH 3CFCL 3L3KB 3QHTC 1MRCH 4QY8A 3THML 43CAA 2MCG1 5L0QC 5I66A 1CD1A 4PREB 4QF1B 3FO0L 3GSOA 3L3DA 1R3JA 4LPTA 2CIKB 1N3NA 4LLAA 3RDTA 1FG2A 1TXKA 4J2XA 4HEPG 5TDPB 4YDKL 3VD9A 2DIBA 3LS4H 4LLUB 5DA4A 3QZWB 4NQCA 3SE4C 3VXSE 3FFCD 5LAXA 1JN6B 4TSCL 2HT2D 3MLYL 3A6BH 3WEXB 1JTTA 2ZCHH 4XAWH 4Y2DA 4PRNA 4HGWB 1S7VB 4P9MH 2JF1A 2VH5H 4JM2B 4IIQB 1A0QH 3CFEB 5GS0H 4ZAKA 1WIOA 1JPGB 3MRKA 4JVUA 3MRHB 2OCFD 4IRSB 1BJ1J 1LO3H 1MCSA 5C0JB 3AMLA 5D6CB 4PJFA 5D7KD 2YZ8A 5DXWA 2W9DL 1HYSD 2XPGA 1LK2A 5C9JB 2HT4D 5JTWA 1KTKE 5D7JA 2BSRB 2VWEE 3F58H 2F53D 2FIKA 5F1NB 1RZFL 1QLRA 4X4XA 4XP1H 3K4AA 3BHBA 4WUUD 4FA8A 1CGWA 1AGEB 2FLBT 3I84A 1OSZA 4UU9B 5EZOL 5C2BL 5JQ6H 4PR5B 2X7LA 1BZ7B 3RVWD 2A6IB 4XHJD 1P9MA 3B9KA 2BNUB 4ISVB 1XT5A 2P8MA 3G9VA 1FL3B 1Q94A 3TVMB 5IMLB 5CZVH 1A6AB 1JFQH 1FLRL 1DBAH 1U6AL 3ZSSA 5HGBA 1J8HD 1QZ1A 5FB8A 5EORL 3ULVF 4M6AA 3RWGB 1T0MB 4DTGH 1LQSR 4RRPA 3G5ZB 3EHBD 1OARL 3BGMB 4AEFA 5DJDB 5FO9A 1YN6B 2YWZA 2R2BB 3MRCB 5D2NB 2W9EL 4ODWB 3B2UD 1CE6B 5ISZA 1NLBH 3WUWA 5E6YA 1T1XA 2BVEA 2FLRT 4P23A 2BNRE 4K8RL 1R0AL 1U8IA 1U8KB 3RWHB 5INCB 3NFSH 3OPZL 5GGRB 5IQ9B 2CK0L 1TVHA 4MCZA 3VRJB 2BY1A 4JJ5A 2R2EA 4JZOA 2EYSB 4KK5D 4Q0XL 4U6XB 1NGYB 3W11C 5H35B 4YDVB 5JIKA 5HYJE 4RISL 4YHYB 3RL2A 1VFUA 4BSWB 1FO0B 3NGBB 1RZKC 4Y1AB 1HINH 3S5LB 2GTZB 1CT8A 5C0CA 5FA3A 3SGDI 4PY7B 1EBPA 1T04A 3I6KB 3VW3L 3CFKB 1IGTA 4OFKA 3RIFK 2XTJC 4GRWB 5E2UL 1IGIL 2H2SC 4FFYL 5B38A 3DVGB 4S1RL 1BZ9B 5ENWB 1NAKH 1YEIL 4YFEA 5EBWB 3UPAA 3DMMD 4BYHA 3QG6B 5E9DD 3WLWD 4L9LA 4LQFL 4GKNA 1EPFA 4MZ3A 4LEOB 2YUWA 3HI5L 4JFFE 5SV3A 1BD2D 5DRXA 1VCAA 1BQHA 1XAUA 4ALAL 4KZEL 5FYJL 1E6JH 1PQZA 3NIDE 4LLMA 4LLVB 1NC4A 1S7WA 1VACA 4ESKA 2DQHH 2P43B 4MA1B 1QHPA 3DXAA 5D7IF 3LPGA 1U8LB 5FUOL 3T2PA 5JORA 5CWSB 4AIXA 4J8RA 4ZO7A 1KT2A 1IQWH 3I9GL 2EH8L 5DMIL 3S36X 3SKNB 3RY5A 2OTWA 1P2CB 2RJMA 4L4VA 2W59A 5E2WL 1QRNB 2B4CC 1AP2B 2KQNA 3AC0A 3AB0C 3PWJB 4LSUH 3SDYL 2PXYA 1HSAA 4LCWE 4GBXA 1Q1JH 4MQTB 4KKCC 2MQ0A 1AO7B 2AK4B 3MGOB 1KULA 3L3IB 2GT9B 1VGKB 2ITCB 1CLZL 4FQHA 1XGPB 1NBYA 3VJ6B 1DVFC 4KV5E 5AD0B 1FZMA 3D0LA 2QBWA 4KKNA 4ZYKB 1OWWA 3IDGA 3ESUF 2EDXA 5CJOH 2YC1B 3IU4L 4YX2H 3MGAA 4YHLH 1AR1C 3EZJB 3JTSB 4XMPH 1RK1B 3DBXB 4HAFA 3VFUA 5C08A 1WISA 3MFGB 3HC3H 3BO8B 5J9PA 1OHQA 3WHE1 4JQXA 3VWJD 1T03H 1L4IA 1UQSA 3S97C 1JHKL 3W82A 2FZ3B 4OLWL 4E41B 1CFQB 3WNNA 1MCPL 2F58H 1Q8MA 2NY5H 1FCCA 3ARDA 5CEXA 1ADQH 4J6RL 3HE7D 4DKFL 3W39A 3SY0B 2V5RA 2C1PA 2ESVE 5HDBE 4JAMA 5CFHA 1M05A 3PGDB 1IZJA 4FQQB 1I4FB 4CRPA 2RBLA 3MOAL 3SDCC 4XI5C 4Z76A 3ZL4H 3F7RA 4XP6H 4TUKH 1MLCB 3MRDA 4OCWH 4K3EL 2DJUA 2WLYA 1INDL 3QXAA 4AG4H 5B3JE 3ULUC 3QNXB 1A7PH 4F37K 2VN4A 3O4LB 3REWA 2ZPKL 1EVUA 5DJ2A 1JGUL 5E5UB 4JPIB 2IAMA 5TDOA 5FDWA 5EOCL 5C09D 2RGSA 5BMFL 3EGSB 3W81A 3S8WA 3U1SH 4YDLB 4JO2L 2E8ZA 1WV7T 4N0FA 2XA8H 4ZUWA 5KSBF 4YR6B 3WDIA 5JDSA 3SGKA 4TN9A 1NBZA 3ARFC 5ID1A 2P8PB 4PJXE 4M03A 1W72H 3IDJB 2AEPH 5E6IB 3U0WH 4RZCB 5IEKA 3BOVA 4P5KA 3BKCL 3QJHA 5DMJB 5AZ2H 1H8OA 4O58H 3WNKA 3BZ4A 3DIFB 2YK1L 4Y4KB 1R24B 5IB4B 2H26A 2CPCA 1M7XA 3N1GC 3V52L 4HGMA 1HHHA 2NLJB 3WFDH 2O5XH 4I18C 2OK0L 4EUPB 1RUAL 2J3SA 4IRZH 4P4KD 3BDBA 2F5BH 4KMQA 2J8UE 4N5ED 4ZSOA 1YMHA 2W9LA 4K3GA 5IFJA 5CUSH 5H2BB 2N4IA 4M7LH 3CPLA 1IM9A 2LE9A 1AXIB 3T0EA 2NCMA 1I8MA 2X89A 1K2DB 4DUWA 4NWUL 2E6QA 3DLQR 2W60B 3I6LD 5D1XD 2D03L 4RFEB 3LV3A 4QRSB 2V7NA 1V7NH 1I3UA 4BSVA 4ODUA 2FO1A 2O5ZL 1BIHA 3LY6A 4HFUL 2I9TB 1B4RA 3QCVH 1DR9A 1ZHNB 4PJ9A 1JBJA 1VFBA 1YNLL 4PB9L 3OKNA 3TEUA 1OT1A 1CQKA 4QGTA 1KPUA 1E4KC 3OBAA 2F54A 4F33A 5F3BB 4ZS6C 1BJ1H 4CMHB 4JZJB 5IUSA 1YNKL 4GG6A 3VXSD 1JK8A 3RWJB 2VXVH 1R5VA 3BH8B 1TTUA 1BF8A 3Q48A 4PTUA 4OZFG 4LIQE 5FYKU 5JZ7D 1WF5A 3QIBB 3TF7C 1AIFA 3B6SB 3UO1L 1FC2D 3DECA 3QCUL 3K4DA 3DROA 1H3TA 1JTOA 5D7SH 4XPFH 2DDQL 2DLEA 1AD9A 3H9YA 4Q2ZA 2QL1A 35C8L 1WBXA 3BKML 3ZTNL 4GKZB 3ZKXB 4Z7QE 3B3IA 4OZ4A 4X6DB 1LD9B 1CXFA 3WSQH 4R2GB 1IAII 1X6NA 3IFOA 3QEUA 2EEBA 3MXVL 2EECA 2D0FA 5SWSE 3TIEB 2VQTA 3WN5C 1BP3B 2IPKA 2JCCE 3QQ4A 3V6FB 1JRHL 3TN0C 4NZRH 1PAMA 2VDRL 3LS5L 2ZCKH 3LH2L 1RURL 4NNYB 3IDNB 2HVJB 3X17A 3TBTB 4QRPE 3UYRH 5J89A 3LB6C 5B4MC 3QBTB 5TE4L 1MVUA 4HT1H 3B2VH 3IKCB 2VDLH 4X80H 1XF5B 2ED7A 4RWYL 1FIEA 1I1YA 2A6DA 1TZHB 5C70A 4BH7A 1DEEA 1HHKA 1HOCB 3NCFB 3PL6A 3GMOA 1FGVH 3QXTA 3KLAB 4LKCA 4WW1B 3FO2A 3R0NA 3FN0L 3MNWA 4YFLI 1G6VK 5KN5A 4ODXA 2BNRD 1A1OB 4NO2A 2BVTA 4LDLB 3T3ME 1IC1A 1FYTB