4UAVA

Crystal structure of cbby (at3g48420) from arabidobsis thaliana
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
b'TLPSALLFDCDGVLVDTEKDGHRISFNDTFKERDLNVTWDVDLYGELLKIGGGKERMTAYFNKVGWPEKAPKDEAERKEFIAGLHKQKTELFMVLIEKKLLPLRPGVAKLVDQALTNGVKVAVCSTSNEKAVSAIVSCLLGPERAEKIKIFAGDVVPKKKPDPAIYNLAAETLGVDPSKCVVVEDSAIGLAAAKAAGMTCIVTKSGYTADEDFENADAVFDCIGDPPEERFDLAFCGSLLRKQFVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
molecule tags Hydrolase
source organism Arabidopsis thaliana
publication title Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
pubmed doi rcsb
total genus 87
structure length 246
sequence length 246
ec nomenclature ec 3.1.3.-:
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4uavA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4uavA01
1U2TA 2ZOSA 3ESQA 2R8XA 3L8EA 1RMYA 3B9BA 3QU9A 2C8LA 3U7EB 2HI0A 5AM1A 4Y2QA 1QQ5A 3E84A 2P27A 1T9ZA 2NO5A 3NRJA 3AR9A 5AIBA 4Y2YA 5AI6A 3FPBA 3ZTWA 3QNMA 2BDUA 3DAOA 3NAMA 1TA0A 5ALOA 1ZD5A 2AUTA 3W5BA 5AM0A 4AS3A 5IS2A 2AH5A 2YJ4A 3SD7A 3UMGA 3E81A 3M9LA 5AKXA 3A1CA 5AKLA 2B0CA 3N1UA 4EENA 3A1EA 3FM9A 1S8OA 1RDFA 5ALJA 1Z4JA 3WKAA 2FEAA 5AK5A 3KDPA 2NO4A 2PR7A 3KBBA 3ET5A 2IOFA 3I1YA 3WGVA 4BEVA 2B1QA 5AKKA 5ALYA 3F9RA 3OCYA 5AKIA 1QH9A 5ALNA 1O03A 2FDRA 2FPWA 4BNDA 2OYCA 5A3RA 2MSNA 3L8GA 1YS9A 2JGAA 4RETA 5AM3A 1WVIA 3MPOA 3DDHA 1EK2A 3W5AA 4JB3A 3W5CA 1LVHA 4Y2UA 5ALRA 4YH1A 4UM5A 3A3YA 4MWOA 2O2XA 3WKBA 3ZI4A 2QLTA 2MU1A 3QUQA 1RLOA 2JAWA 1O08A 3PCTA 3WKCA 1SWWA 1SWVA 4J03A 4EX6A 1WPGA 3L0BA 4BX3A 3N28A 5AW3A 4QJBA 3U26A 2W11A 4KYTA 3WK4A 3EWIA 2G09A 1RLTA 2YMMA 4GXTA 1YV9A 4KX5A 3EF0A 1CQZA 2I54A 3U7FB 3ED5A 2I34A 2WF8A 2HF2A 3AR5A 4Y2VA 4BYGA 3S6JA 3QXGA 1VJRA 2RB5A 3OCXA 2PQ0A 4UMFA 5ALSA 3OCUA 1RKQA 3CNHA 4BBJA 1RKVA 2GMWA 5AI4A 4DWOA 2JARA 4UMEA 4ZEWA 4L6AA 4OFZA 4L6CA 4EELA 1NRWA 1Z4IA 2B8EA 4KX3A 3OTQA 2Q5EA 5ALWA 2Q4RA 1QYIA 3U13A 1ZD4A 3ZU6A 1TJ4A 1NF2A 1RLMA 3ZWKA 5AVVA 5AW1A 4UW9A 3PGVA 5AI9A 1S2OA 1YNSA 1XP5A 1TJ3A 4CF3A 4RESA 2MU2A 4KNVA 2EATA 2VKQA 3I76A 2FPRA 1X42A 2C88A 2G06A 2GFHA 4BX2A 3R4CA 1WR8A 1ZS9A 1NNLA 2CFRA 2FPSA 2FI1A 3AR8A 3L1UA 3WGUA 1U7PA 3QYPA 3BA6A 3SF0A 3J7TA 2WFAA 3AR7A 5AM4A 1Z4QA 4KNWA 1YDFA 4UU1A 4Y2PA 3ZX4A 4FYPA 4HGQA 2I7DA 2YJ5A 4C4RA 2ZBFA 1Z4OA 1YJ5A 2WM8A 4HYTA 3DNPA 2RBKA 1YMQA 4ZEVA 3N8GA 3ZVMA 1L8LA 3E8MA 2OM6A 1ZOLA 3I6BA 1U2SA 2CFTA 4XQ0A 2B8JA 1L7MA 2FPXA 2RAVA 4YCMA 4XOUA 3SMVA 1Z4LA 5ALIA 2W4MA 3RFUA 5ALKA 4HGRA 2ZBGA 4F71A 4Y3UA 5AW0A 3NIWA 2YJ6A 2BY4A 3TLMA 1ZD3A 1K1EA 4C4TA 4YIHA 3DV9A 1T5SA 3L0YA 5T41A 3ESRA 5AIAA 1VFPA 4FFDA 4OHFA 1ZJJA 5ALXA 5AW7A 1QQ7A 1L7NA 2P9JA 2EARA 1SU4A 4XE5A 2WHEA 3ZWDA 2G0AA 5ALVA 5AVZA 3SKYA 2P69A 1TE2A 4DFDA 3AR6A 4H1WA 2C8KA 3U7GA 1N8NA 2YFYA 5IT0A 4BNDB 1JUDA 1Z4MA 5E0OA 5AESA 1LTQA 2YBDA 5ALUA 3OCVA 1Z5UA 1Q92A 4Y2JA 4EZEA 3QU7A 5AKYA 4NAVA 3ZW7A 5AM2A 1RMQA 4UARA 3EF1A 3QUTA 3KD3A 3ONNA 3WKEA 5AK4A 4HGPA 5ALPA 1Z5GA 3L8FA 3UMCA 4UMDA 1Z4PX 3P96A 2WF6A 3L8HA 3WK7A 3L5KA 1N9KA 5AHXA 2ZXEA 1TJ5A 1L7OA 3E58A 3CZ4A 1U7OA 3N07A 1L8OA 3NANA 5AW4A 4CF5A 5AVQA 4HGNA 1XVIA 4L57A 4QQFA 5AW9A 2P11A 4UU0A 2EAUA 2IA5A 2ZG6A 3PGLA 4NWIA 2YMLA 3ZTYA 2PKEA 3NASA 4Y2RA 1EK1A 1PW5A 2JAOA 2IYEA 5ALZA 1ZRNA 1AQ6A 4HAIA 3W5DA 1VJ5A 3OCWA 4G9BA 4G63A 5AVRA 4Y2SA 4F72A 3SKXA 2HEGA 3OPXA 4ZEXA 4UATA 3M1YA 2RARA 4YGYA 5ALLA 3L7YA 3RF6A 2W43A 2G07A 4AP9A 2WF7A 5ALMA 2ODAA 5AVXA 1RPZA 2B1RA 4Y2XA 2IOFK 4CF4A 5AICA 5AK6A 2AMYA 4EEKA 4GIBA 4UASA 4HGOA 2GHQA 4NV0A 5AI0A 1RMTA 2HOQA 3NALA 3WKDA 2HX1A 3FGOA 4IFTA 3U19A 3QUCA 1L7PA 4BEWA 2G08A 1MH9A 3ET4A 5JJBA 1F5SA 5AKJA 4OCZA 5AW8A 5AVYA 1IWOA 2R8EA 1Z4KA 2ZBDA 4JDPA 3A1DA 2B82A 2HCFA 3OCZA 3HYCA 5ALHA 1Z4NA 5ALEA 4UMVA 5AKHA 2YMQA 4I9GA 3KOOA 3IB6A 4PNHA 5AK3A 2ZBEA 3BWVA 4UM7A 3FZQA 3KZXA 2C4NA 4Y2TA 5FP0A 3B9RA 4O8CA 4CE6A 2OA0A 1J97A 3QX7A 1RQNA 1RRCA 4BX0A 2IOHA 5A3QA 3L0CA 4DW8A 3B8EA 5AW5A 5AI5A 3R09A 4AS2A 3EPRA 5ALTA 4E88A 4UAUA 4I9FA 3QGMA 1RQLA 3FVVA 1T5TA 4MUMA 5IT4A 5ALGA 3FPSA 3L1VA 3IJ5A 3QU5A 1Y8AA 5ALDA 4YCNA 2X4DA 4BKMA 4YCLA 3MMZA 1XPJA 4CNQA 2B30A 2O9JA 3KC2A 3MN1A 3ZX5A 3WK6A 2G80A 4OD0A 5AVUA 2G1AA 3WK5A 2CN1A 5A3SA 2HSZA 2I55A 2YN4A 3N5KA 4UAVA 5ALFA 2AGVA 3ZVNA 2GHTA 5AVWA 3WK8A 4NFLA 4J2TA 2CFSA 3UM9A 2DQSA 3D6JA 1CR6A 2NYVA 1ZD2P 5ALQA 2D2VA 3MC1A 3QU4A 4FE3A 1WZCA 4YIKA 3UMBA 1QQ6A 2HHLA 2C9MA 2HF7A 1L6RA 2BDEA 2YJ3A 5AW6A 2I6XA 3QLEA 4DCCA 3PDWA 2FUCA 2QYHA 3ZVLA 3ZUPA 2R8YA 2YMPA 3AR2A 3SLRA 5AKEA 2OBBA 3R9KA 2JAUA 5AM5A 1RC8A 3K1ZA 1J8DA 3U7HB 4IG4A 3HLTA 4KN8A 3GYGA 1Q91A 1ZRMA 3SHQA 2I33A 2GO7A 3VAYA 3AR3A 4EX7A 3IRUA 5AVTA 1RKUA 3QUBA 4C4SA 4B6JA 2YY6A 2Q4TA 2WF9A 2WF5A 1FEZA 1KYTA 3QU2A 3I28A 3AR4A 2HDOA 4NABA 2FPUA 3NUQA 5AW2A 2FUEA 2HO4A 1U02A 2R8ZA 5AKGA 5AVSA 4XPZA 5AI8A 1Z88A 5AKZA 3WK9A
chains in the Genus database with same CATH superfamily
4KRYA 4KACA 3H0MB 1MOQA 5LMCA 3B51X 3VJRA 4PZDA 4G2NA 8ADHA 5HKAA 4D4KA 1WXIA 5LJIA 1JJIA 1GQSA 1XX6A 1I6WA 2V8BA 3A37A 1Q0RA 1YQTA 2Z9CA 4HB4A 5FTMA 1J8MF 2PQMA 3N2KA 3CUUA 3LSYA 5G4LA 3DOUA 2B34A 5AM1A 3QUAA 5NLLA 2L2QA 1SCQA 4WBNB 2I6TA 1A9RA 4WAUA 4YMHA 2HPAA 4KV7A 3OHPA 2J30A 2RH4A 3NRJA 5KYUA 2PMKA 3T9EA 3VO9A 1Y89A 3ZHOA 3AF2A 2H3QA 2ZWOA 4WBXC 3VTAA 4AP5A 1PO7A 2O6LA 3C70A 3I9KA 2Y9TA 3QNMA 2JGEA 1JIVA 1B74A 4FYVA 5SV2A 1OGJA 4BV2A 5K4GA 1ZN2A 1J8YF 3V42A 3WA6A 4WZBE 1MB0A 3H0LB 4MQMA 3PDIA 3M6LA 1PVOA 2LP4Y 3O8RA 5DSZA 1JFRA 4FYIA 3WFIA 2JLVA 2AC2A 3A1VA 2YRWA 3LK7A 1AZSC 1JPVA 4KAJA 5BSKA 5KVSA 3DULA 1GG5A 2HA7A 1JQJC 2YYYA 3ZDDA 3N8KA 4D92A 1PJCA 2P6MA 2KIWA 1BMTA 2J7PA 1P45A 2R25B 3KQYA 2IZOA 3KYDB 4YCCA 5K7SA 5J4LA 3GQCA 1EE9A 4XIIA 2LKDA 4ANFA 1A4UA 5HTKA 2KPOA 3FSEA 1XTBA 1ZM2A 3DT8A 4XB1A 5TF0A 1ZEJA 3G9XA 5G2OA 3LWBA 1R6TA 1PV4A 2ACKA 5KYYA 3AI2A 4KQIA 1JXAA 2AFRA 5IJXA 4DYHA 5AK5A 2KZMA 2Z1NA 3FC4A 5IARA 1H8EA 5IANA 1D8BA 2QV7A 2XUHA 1A71A 2PL9A 1NBIA 2I7VA 2IHTA 4ARIA 1LLFA 2OO7A 3AI7A 2H1OA 4JGGA 1U2GC 3EOBI 2IV3A 4KR7A 3BH7A 1U7WA 1YJXA 4R54A 5I8PA 3TS1A 1EM8B 2JBAA 2P2LA 4C6HA 3FN4A 2ASDA 3KSDO 2FPWA 4A0SA 4B3DA 5HOQA 3R8XA 2V6MA 2Q6KA 3ISTA 3VOTA 3PUHA 3WGTA 3KZKA 4P35A 5CA1F 5CDSA 4F9FA 3VKGA 1UM9B 1Z39A 2NYAA 3G3EA 3OZFA 3VR6A 2FKAA 3D1LA 4TYWA 3F6PA 4M0EA 2QTLA 2AOTB 1Q5PA 1LVHA 5KFOA 1XSNA 2QTNA 3GRKA 1YDHA 1XLTC 2QVCA 3F5FA 4AURA 3PMLA 2VDUE 4B73A 3IUNA 3KETA 5IM4A 3WKBA 1FQWA 3T5TA 2GGSA 2YCLA 1G38A 1IZ9A 3MWJA 3PCTA 2OLKA 1W36D 2J0QA 4E4TA 3OIYA 4KLRA 2BAGA 4L0DA 4C20A 4ENWA 1EWVA 1XU4A 3KALA 4R2KA 2XF2A 4BIIA 1SXPA 2BTEA 1RJWA 1S96A 3HA5A 3P9IA 3TG2A 5CFZA 3LBIA 3CINA 5B7QA 3B20A 1V7CA 4AQYB 1A5TA 2OTCA 3EARA 2BCQA 4W9NA 4CM9D 5JXJA 2QGZA 4QXQA 1NJXA 3KPYA 2QAJA 1JVNA 3G9QA 1B0UA 3TINA 5BSUA 4CTJA 4YNBA 2ZYRA 4KR0A 3CEMA 1TNDA 1QDUA 1Q95A 2AVNA 2Z95A 1N6HA 3DW1X 3HKZC 4FS8A 1R4MA 4F6RB 1JVSA 2CHEA 3TW6A 1YL7A 4KYUA 4RH0A 4C01A 5KFFA 2FF5A 1TUGA 7ICHA 1T3TA 3C7KA 1TF5A 4UMFA 4AX4A 5C7LO 4R8UA 2ASVA 3C5VA 3PX4A 5C5CA 2EX0A 2L42A 2GM3A 2E87A 1XDBA 3C15C 3ZCPA 4F86A 1W4AA 1BPYA 5A0FA 2HXYA 1GHTA 2IBMA 4GVXA 3AG6A 3H8MA 4ZEWA 4NCNA 2EKZA 1SCAA 4KX3A 2JA1A 1O94A 5KTPA 1NR1A 3RC9A 4YAUA 2J9RA 2Q6TA 2Z2XA 4F45A 3DCNA 3GIWA 1H65A 1X19A 2AW5A 2BKXA 5EKTA 5F78A 4D4MA 3O3MB 1IBLB 1Q7GA 3ETJA 1JWAB 1XXHE 5D85A 1D8TA 3G5AA 3PL5A 4JASB 3ZLTA 3SSAA 5E2IA 2FLKA 4Q3NA 5EIBD 4XM0A 3WMFA 1SIWA 4TQGA 5K8IA 1VL0A 2B5VA 3FWHA 3WNZA 5ES4B 5K51A 5MF6A 2PX0A 4YRSA 5C2JB 5CD9A 2WJAA 2OVBA 1DAFA 2RI6A 4LBVA 4YRRA 4IOLA 4EA9A 4NL9A 2FEMA 2M9MA 3BA6A 3PFWO 1BNCA 1O2DA 4MITA 4PINA 3SXPA 3MZ0A 2ZR7A 3HV0A 1L1QA 3AVXA 3WYCA 2J0UA 3E9EA 5CJ2A 5JC1A 3AI3A 5LOVB 2Y1IA 1A3CA 3H9QA 1NLMA 2WMDA 4XUDA 1YTUA 3ZX4A 3QJGA 2Q21A 3MJRA 4MVJF 5K2MA 1Z4OA 1D07A 3TW8A 1YVRA 3OJOA 4FYYA 3U80A 1WQ4A 1ZIOA 2Z08A 3O8BA 4MAFA 4BNTA 4NBVA 3UAVA 4GEKA 3BXFA 2PMEA 3JQ9A 1A8QA 4TMFA 4INJA 1BMQA 2WWHA 3O1HB 4EFDA 4R3NA 4L4ZA 3LXRA 2VTDA 1QG4A 2C97A 3N05A 1QDLB 2B8JA 2BM0A 1N62A 2LCIA 1C30A 4OQPA 1VE7A 5AJXA 2BJVA 2DR2A 1BVHA 4LWOA 3WQRA 5E9QA 4HN9A 1NYTA 3QF4B 4F84A 4BATA 4US2R 7ICRA 4OL9A 1NBEA 1YVPA 1PHPA 4IWXA 2XV1A 4RVSA 3E53A 3EVAA 5KFMA 3U4GA 1BEUB 3GL9A 4BIMA 4Y9UA 3KELA 1XNGA 1SXGA 4ZVNA 4C4TA 1N3YA 3W4KA 4KPYA 4K1XA 2RC5A 1K6EA 3LY8A 4FFDA 3LCRA 3PC7A 2VWHA 3Q1LA 4YAJA 1Z00A 5JCJD 5KWVA 2PT6A 2A1JB 3EDCA 2WHEA 5EVJA 2BGJA 1IY8A 2HL6A 4UHBA 1FTYA 3Q6NA 4NESA 2AFHB 2X8WA 4RDXA 4MR8A 2ZU6A 7ICFA 3CWZA 1KK3A 1OIWA 4K7JA 4R8UB 4J3NA 3E8SA 3PHGA 3R6LA 2P2YA 4OUDA 3FTNA 4Q3KA 3ZG6A 4R51A 5B55A 1F06A 2PTGA 4AICA 2UVUA 3LVWA 1S3FA 4KMMA 3D31A 3TYXA 4RWEA 1LTQA 4RMJA 4QJ5A 1OKKA 1YA4A 1WZEA 1GTZA 4DS4A 2A5JA 4IUYA 1LH0A 4CODB 2FFJA 3M33A 1NK5A 4NFHA 2WRZA 4QNNA 2QL9A 1P2FA 4MFCA 2Y1WA 5IC5A 2SNIE 4FDLA 1SXEA 4TTAA 3TCNA 3D59A 4R01A 4Z1MA 3UNXA 2WSSD 3CYMA 3WIBA 1J90A 3ONWA 5TGTA 4G0WA 4KFCA 5ALPA 5JJKA 1GFZA 4OL0A 1UXIA 5BWLA 2J0VA 4X64B 3CZMA 3FJYA 4YR3A 3U3RA 5H4HA 1TJ5A 3TANA 3QLUC 2GAAA 3BQ9A 4MVJM 5EHGA 4ADSG 1E3SA 2QRHA 2UVPB 1VG9B 3OJXA 5LDGA 5JZVA 5EE1A 3SE7A 5E4YA 1JIHA 2A30A 3RRYA 3L0ZA 5CX1A 5DBOA 2VSXA 4S12A 4C8OA 3SS8A 3RUHA 4JBGA 1L8QA 1A4IA 1J2JA 1N7IA 5HXAA 4IDAA 3W0LB 2P9TA 4AY6A 1ZBQA 4BCBA 1YBFA 1RQGA 4L57A 1T8PA 3QKSB 5DLFA 4R7ZA 1RAIA 3C1TA 3D3JA 4NBWA 4F5ZA 8ICAA 2ENWA 3N7SC 2QRZA 1VCHA 1VIMA 4F2WA 3L0PA 4LYHA 4ZHSA 2BFOA 3QH4A 2NG1A 1JRPA 2H3FA 3IBYA 3UK6A 2GN9A 3UKOA 3ZNPA 5JZMA 2DEUA 1CJVC 3SPXA 1CUAA 3OCWA 2FW0A 1W9MA 4G63A 3LDAA 3IMFA 3TLCA 1N3BA 2P3LA 1QHFA 3I32A 4I9NA 1ZGJA 2OAEA 2QX9A 3ZWXA 1ZQPA 4ZEXA 4EABA 3EXEB 2WUVA 1X92A 2RARA 2DHRA 2ZJOA 1HYHA 1O94D 1P6UA 2I7CA 4K5QA 4KGDA 2ZQ5A 2FLNA 4TPKA 4D9JA 2KSOA 5B4TA 3MMPA 2WUGA 3SGLA 3WDKA 2CB0A 3GVPA 4P2BA 3E2MA 1BHJA 5BN4A 4AG6A 3RTEA 4CM8A 2NVBA 3M4JA 1AK1A 1UFRA 1UBJS 2RHRA 2WAAA 5BP7A 4YMUA 4M1EA 1HSOA 5A4MS 2IH2A 4JOQA 8ICMA 4V24A 5KB3A 3BZCA 8ICGA 7ICLA 3T06B 3ZS9A 2R1TA 4WK6A 4BJ6A 3RFXA 2YJZA 1X3SA 4IVPA 4U7GA 4FLFA 3SR3A 5F35A 1JEQA 4GZMA 3MCWA 4QDXA 3PA8A 2WPNA 3H04A 4PX2A 3RI3A 4BQIA 4ECAA 3HNPA 3D4PA 1P0PA 2YRFA 3CO0S 2QD5A 2XTJA 3EMDA 3FYUA 3JVEA 5AVYA 1U9IC 2B5OA 2R8EA 4MHVA 3DCYA 3HU1A 2WWYA 4B47A 4TUPA 4OJOA 3PUXA 2F1KA 5D84A 1XTTA 3BQ1A 1X9XA 2KIVA 1M74A 4OSEA 1NQWA 4ACAA 2GJSA 5A6SB 2QSZA 1DB3A 1RYMA 1GZSA 4GGPA 3ID6C 2YHUA 1EFDN 4GHWA 4GPTA 2NAFA 3OKCA 1YCGA 1C0PA 2ICAA 1Z4NA 1SUWA 1X7GA 2B20A 3LLSA 1KVTA 2P4UA 2ZAMA 3V1TC 3VYUB 3E2EA 3CKMA 3M3PA 3PGMA 1WF3A 2B69A 2RH9B 3O5AA 4K9NA 3LD9A 1FYXA 4N0DA 3KZXA 1A97A 3C41J 5FP0A 3TMAA 1XD2A 3B9RA 3UUEA 4YRFA 1ST3A 4RPYA 1SVSA 2VP2A 4UQPA 4C7JA 4D6PA 5FV4A 1RQNA 5JRDS 3FHLA 4RZRA 2HU7A 4G1CA 4UBLA 2ZS9A 4BO6A 2VA8A 2VHVA 1MKYA 4MI1A 4UXHA 3DCIA 5AWFC 4FZMA 4F9TA 2C58A 1P7VA 2BHNA 1RCFA 1U1CA 3NVAA 4YRAA 2WUEA 4WD3A 1ODCA 2XITA 2DY1A 2SKEA 1VYHA 3JPRA 1QVAA 2K4MA 5T6BA 4IMRA 1DCFA 1VL2A 2MR6A 3DE0X 5ALGA 3DPSA 2ZE5A 1F1JA 2GJ9A 3L8DA 4HBZA 3ZGXA 3L1VA 3T1HB 3GPIA 1ZVVA 5K4HA 3TADA 4YD1A 1XD2B 1NKEA 1C9DB 3K6RA 4L76A 1S7GA 2QPOA 3EDRA 2XBUA 4TMYA 3OMXA 4UNSA 1QTQA 3TOVA 4DG9A 5BY2A 3MMZA 1E0SA 3EZYA 5F9NA 2B4KA 4S1WA 5T3YA 1L5FA 3QOXA 4CEJA 4I46A 2OCPA 3T5LA 2E4VA 2FEPA 3K5IA 3INYA 5CTAA 2IYAA 3HY4A 1NUHA 1GNSA 3I58A 4UQGA 3QM1A 5JYEA 1AV7A 1JQDA 4OHZA 1BE8A 1Z75A 3GAAA 4WADA 5D1HA 4N5DA 4Q7LA 5BORA 3FB4A 2HK9A 2JPDA 1P72A 2JI6A 5IT9A 2Q6VA 2H9IA 4UEWA 3WZLA 2FHPA 2I2XB 1H2ZA 1W47A 4F60A 3AM9A 3RK1A 2QQEA 3Q6MA 4MGHA 3PV0A 2PSSA 3JPQA 5GV8A 3SX0A 3F6RA 5L6LB 2ASEA 4C0KA 2R44A 2VEOA 5KTNA 6ADHA 2Y0SC 4PFJA 1NZJA 3N87A 2HJSA 2NV6A 1YVUA 3NAGA 3K16A 5JZSA 1T2NA 1N33B 2ABWA 1IU9A 2YJ3A 3EMVA 4Z9FA 2IY8A 1M2VA 1SUAA 1T9CA 2QYHA 4A9AA 4HY3A 2RSLA 5F1PA 4CLDA 1SOAA 4FBMA 1U0EA 1IY2A 2HKIA 1KEEB 2AJCA 2Z9BA 2IEYA 4B85A 4DEVA 4P3NA 3MBYA 4HTFA 4H7IA 2D7CA 1AGPA 2QN6A 3KEFA 3Q8PB 4MAMA 2PUFA 3FROA 5TEWA 2KKVA 1LPBB 5CB8A 1V9CA 3ML1A 5EIOA 1P81A 1EGVB 1TRKA 3E1GA 2I3ZA 2VHXA 1RAHA 3IP3A 3ICWA 3H8JA 4TQRA 1E79D 1FUKA 3VSBA 1XJQA 3EDOA 3GJ5A 4P80A 1U4OA 1E0KA 2OYYA 4GXRA 4KE6A 2GPSA 1ENYA 4RAQA 3ZY2A 3ONFA 2OCKA 4REOA 1WBDA 2YYZA 3BTSA 4Q05A 1UZNA 3V8MA 3V7JA 2I03A 1BH2A 4A6EA 1C7RA 5BR1A 1C0LA 3P2JA 3A26A 3ZH2A 1SEVA 4JLDA 4NMXB 1O6FA 2IRWA 4WVLA 4JI3B 3BILA 1L3BA 2O2GA 2XGOA 1AMOA 3L4JA 2I8LA 3G85A 2QUZA 3AR4A 2VHZA 5HJEA 1SCBA 4NCXA 3A0UA 4MUKA 4PC6A 1SBQA 3L07A 4LMAA 1HK7A 1K1QA 3UJ8A 3RB0A 5E3HA 1KEJA 3CZ9A 1KDRA 3TMKA 2Z7JA 4GO1A 4RLSA 1FFYA 2JFPA 3TI9A 4HKTA 2WVAA 5IVIA 4CMCA 1BQ4A 3ZHSA 3WK9A 4PL1A 3WQQA 1U2TA 5DBAA 5FWAA 3EXAA 4ED0A 2ZJBA 3C87A 4JA0A 4WJLA 1LFDB 3GZ4A 4L5CA 5DTMA 2M6RA 1H5UA 5JSFA 3PQ3A 1MX1A 2Q3FA 3MGBA 2E21A 1E3JA 1T36A 2PKYX 4J6FA 1SG6A 5H59A 4LOLA 5ICCA 3H9GA 4P92A 2PLNA 3DM9B 5D6NA 1AUXA 5IJ9A 2JIZD 1M83A 3OCCA 1EJBA 5A04A 1HT1E 1R1DA 1NW3A 1V0JA 3GLQA 4Q9JA 3ROKA 2WJIA 2WZQA 5C4IA 2JHAA 4IQ0A 3PHCA 1TU3A 4J94A 3DOEA 1YT5A 4D9NA 2FXIA 4H7HA 3OBIA 2R5WA 1GUDA 1WQ3A 3HN7A 1BA3A 4DFMA 2BDUA 2IE0A 3GJ0A 3LC0A 4I5IA 4M7OA 4KYIB 3AU9A 1N25A 4MWDA 4CKCA 2RHHA 3SWWA 2AFHE 2C5SA 2WEKA 3W5BA 3HY3A 4UBBA 4Y2HA 3W77A 3RVNA 2BPFA 1DEAA 3K8OE 1UC8A 1G7TA 2ZIFA 4P6VF 4PCVA 4LDNA 3DZDA 4BN0A 4D7AA 2G5CA 3IURA 1P39A 3VVMA 1QLHA 4QTYA 2A14A 1RWOA 1G5IA 1FPMA 1KO7A 5IVHA 2IZ6A 2FOIA 1NUUA 4ZKDA 2VXOA 3NRZA 1XVTA 4KXNA 4EFKA 3SQNA 5HRAA 8AT1A 2E82A 3NV9A 1NW6A 4KP7A 4FFBB 2O7NA 1YZYA 4NJEA 1IIBA 3WBJA 1EXVA 1AVTA 1CQJA 1POWA 3R6TA 3NOOA 4JL6A 2FX2A 4CKBB 2PM8A 2D5LA 5J29A 2CHQA 3V2UA 3LT2A 1NOJA 4URFA 2LIVA 3JSAA 1U5BA 4KWEA 5CFOA 3USES 2EVWX 4JMUA 1XKXA 1GLVA 2B1QA 2C57A 3FJ1A 3PNQA 1XJCA 4LJYA 8ICWA 1NRJB 1ULUA 1FX0A 4ZH4A 4EYIB 4FS1A 2HRBA 5HQTA 3VDQA 3DV0A 1VSBA 2VHCA 3OAAA 2MDTA 2H7CA 2W90A 1D5WA 4DSLA 2GBGA 1S0VA 3L8GA 1U2ZA 3UT5A 1WDTA 3G02A 3SSMA 4PZAA 1NDQA 2AFVA 3DDHA 1I4OA 2WFLA 4KQCA 3NGLA 4B6RA 5KVAA 3ACDA 3BXOA 1TECE 1TQ8A 2H06A 2ZYGA 1KPGA 1UPXA 4QO8A 1RAGA 5B1HA 5BWBA 4R0MA 5CA0F 2CLIB 1JPJA 3W3ZB 2MU1A 4Y0AA 3TIVA 1TM4E 2WZDA 1EDDA 2VTBB 1FVOA 4N5NA 4AFNA 2YXNA 5HCIA 3IVCA 4MEYA 2ONYA 3E82A 4QSMA 4POAA 1JQ5A 1EVLA 1K4MA 1LLUA 4GOOD 9ICCA 4MRSA 1RLTA 2EJTA 2JR5A 5DCUA 3SXUA 5KNCD 3QKUA 1W30A 3B5IA 1SUBA 3ROFA 1KVUA 1YQDA 2AG6A 4MS1A 4P3OA 2I54A 2J9XB 4BMSA 3ED5A 3PUKA 1SUEA 4WHMA 2RDJA 1H94A 1A4RA 1K5HA 4NOJA 5IWCA 4B44A 3CR3C 5DDMA 4P4OA 5IX8A 3EGDA 1JKFA 2ETVA 4BU0A 2EXXA 5C8VA 4AF8A 4MR9A 2BM1A 2W6OA 3STUA 1OBCA 3AU2A 1G291 3WB9A 5LFAA 1XZMA 7ICQA 3FSRA 2B2NA 1QHIA 1PJBA 4Q4LA 2UUPA 3VAAA 1KI3A 3PKJA 2WQ7A 1N2ZA 3PT5A 2JGIA 1CY7A 5GONF 5C46F 2A19A 4AU1A 3BWBA 3F3KA 3MJEA 1QSGA 4ND8B 5CVDA 1NUQA 3IUJA 2R6AA 2AC7A 1BCSB 2GMWA 1RBQA 1ZN7A 2NZXA 5JDIA 3UUWA 1T3SA 4P5DA 2JLUA 3WWZA 1EWQA 3A9TA 1L5OA 4FTWA 4Q1BA 1ENZA 3Q3JB 3HPQA 5IM4F 1G17A 1XC9A 1HE3A 1IJEA 1ADBA 1ZUNA 1O57A 2FN4A 4RSRA 4U02A 3LCCA 2ZRMA 2Q4EA 1C5KA 1YVDA 3IR5A 4QXRA 4RGVA 4C21A 1IJKA 1E9VA 5BR8B 4JROA 5IH3A 1OWLA 5J0WA 3AJ8A 2M6SA 2VUTA 3EEIA 4TUYF 3ZOKA 1JQKA 1R27A 1MO3A 4RNDB 2EBHX 4ZC1A 1AHPA 2QLLA 4MLCA 1SV0C 2YV5A 3TSZA 4D3XA 2KWIA 3PFFA 2O0JA 1HORA 2PMZF 1LVGA 3ZKWB 3PE6A 4WJ3B 4M0CA 2DPHA 4D8UA 1P4RA 3X43A 3R4CA 5HILA 3RREA 3SBOA 2Q7DA 4M1OA 5FJIA 1G8AA 4B8ZA 4QVIA 2Z04A 4LXYA 2A7XA 2Y1CA 4FFPA 2YX1A 1PLKA 3FIJA 3I92A 2VJKA 2FEWB 4I81A 3S1AB 3TLAA 1OOEA 3S2UA 3IGFA 3NU1A 3PDIB 4RHUA 3K0HA 3ZWBA 3AR7A 1RW4A 5K3FA 3GMSA 2WWXA 4EHDA 4M88A 1N0IA 1MEOA 2FUNB 4BRWA 1TDJA 1X9GA 4F06A 2DYKA 3HZOA 2CYAA 3EODA 5JSYA 5FWNA 5J2FA 2QYOA 4ICAA 3MQ4A 2CVOA 2PMFA 2GD1O 3AI1A 1Z7GA 2IIBA 2J48A 2UV8A 3DMPA 1Z3EB 4NYIR 3GMDA 4O5CA 1GLGA 2YWGA 3B1VA 3I01A 2BF7A 3NT4A 2LTAA 4HFNA 2HH9A 1B14A 2LIPA 4UM9D 5L4LA 3S81A 3BRQA 2HCTA 4BWVA 4EUEA 2P9BA 4O2LA 1FY2A 2JLZA 4GLXA 2EF1A 4KVZA 4GM4A 4EO9A 2WYWA 1CS0A 2ZJ3A 5FBWB 3ADPA 2CZCA 1C3XA 1CQWA 3DTNA 4PZ0A 4Y3UA 5KOJA 1UJ2A 2H18A 3HZZA 3LUDA 4QJFB 4G26A 3A0HU 4X1KA 3O26A 1KSGA 3LTNC 4N41A 4OHCA 3PXGA 5C32A 5MGNA 1TQHA 4O3SA 1R0XA 3FCUB 3FWZA 1NNSA 1G7RA 3QPWA 2NU6B 4KBGA 1E3LA 3ENVA 4K6KA 5C1BA 2NSHA 1L1FA 5AHKA 3IB3A 3ESRA 3RUFA 1CY1A 2G1UA 1XSPA 1DKMA 4LZAA 4I3GA 3NKLA 3CNBA 4WINA 2OO5C 1BS2A 5EIHA 4H3KB 2DUYA 4OAOA 1R5BA 3IQFA 1Q20A 4MZDA 3HBJA 4OXYA 4XAQA 1I4TD 3IMKA 3IMCA 1P18A 4HV4A 1ZYUA 3N2EA 2D5BA 3WLLA 3LBFA 1P9NA 3VR5H 1XRSB 1DO2A 1T4BA 2FPIB 3STXA 3Q8RB 2B7BA 3NHMA 3NVWA 2E3JA 2CBGA 3OTWA 1T1IA 4HCJA 4MARA 3GXOA 2B4AA 4HB0A 1WMSA 3Q87B 4Y2JA 4DNQA 2AOUA 3SCZA 2VATA 1CUSA 1XIVA 2NZJA 1TTPB 3SNKA 4D0LB 2V4QA 4DMHA 1EUDB 2PZFA 1EFHA 1FNDA 1GQYA 3FYHA 4UARA 1PP4A 1WXQA 2ADOA 3M6IA 4A8HA 5F2OA 1KJZA 1ONNA 3HCPA 2ODBA 4L78A 5FYQA 4PN7A 4H7FA 4KLNA 3GV7B 1L4MA 5KMGB 2AGQA 4PPFA 4KWIA 1TLTA 2NGRA 4B17A 1G20B 4IDBA 3I64A 4UMDA 1F4VA 3P96A 1WW2A 4AYTA 1W6RA 2P9HA 2H16A 3BIWA 3E9QA 3K7EA 1BQEA 3LIIA 1ZRHA 4E5YA 1T2VA 4V3CA 2R85A 2V7WA 3HCDA 3JQ6A 4QOHA 1JEDA 2V96A 2A57A 1P7ZA 1KMQA 2BR4A 2BRUC 4K3UA 3W6PA 4BFZA 7YASA 1RC1A 5I51A 5TNXA 3AM1A 3IPLA 4QUAA 1BGVA 1E1RD 1OFHA 4ILKA 1F6WA 2FEXA 4I99A 1X77A 1S9DA 4BU1A 3SOZA 3QYAA 5CDHA 1LDNA 4R84A 3O8CA 2VHQA 5AW9A 4B81A 3IR6A 3NZEA 5GTHU 3DL2A 4M8NE 3KL4A 3ECSA 2VH2A 2PPVA 4OP2A 2WIGA 3GFVA 3OHBA 4YT5A 4G6ZA 1LSUA 5F3XB 4A92A 2MOKA 4GXKA 3R44A 2GDJA 1U7ZA 2D1TA 1ORDA 3KJQA 3PQ8A 2AC4A 4RJIA 1W5BA 3H7AA 5THXA 3BFKA 4WTOA 3U17A 1FU7A 1ZQVA 1V6AA 2JHGA 4RFSA 2ZZMA 2GCGA 3UBTA 1KS9A 4ZYVA 1HTTA 3D6FA 9ICFA 1GTL1 3G0OA 4B6OA 1IWPB 2JB9A 2YICA 5F12A 1SELA 4B1FA 3WX0A 7ICTA 2PFSA 3BFXA 2R1ZA 2CPRA 1K9SA 1YS4A 2RGDA 2YHBA 3FGZA 4S2EA 1B22A 3FETA 1Z2OX 4JMLA 4LJSA 4PZPA 4P4GA 4PG8A 2JZOA 4NXNB 4G0XA 3IDOA 3QKIA 4NNJA 4CEHB 1QIHA 2YV1A 2ZJFA 4BNKA 3D4IA 3VU9B 4V1CI 1QTRA 2DWPA 4UAWA 1ZCZA 2VWQA 3MILA 2XUIA 4F5RA 3K9NA 5TJHA 4COKA 2PO5A 4BEVA 5JWHA 1XPUA 2GK6A 3HCNA 4C0BA 1Q57A 4IW3B 5B3KA 5AICA 1J39A 4UE3S 4NU6A 5H3HA 5EJIA 3IKTA 5EWMA 4UASA 2FP4A 3UCXA 2O7QA 2QX4A 3DAHA 2CKDA 2OLEA 4QTTB 5COBA 1FUYB 2VP5A 3NALA 3RSFA 4RU9A 5C7IO 4CCYB 2H17A 1JBEA 1H9BA 3A1FA 1TVKA 1RRKA 1ZJZA 2R7AA 1RXVA 3LPMA 5E6SB 3UT0A 4CETA 4EGSA 3KZMA 3ABZA 3USCS 4BEWA 4AJPA 5JC8A 1EEHA 2PDAA 2W4IA 4HVCA 5IXJA 1KAOA 4O2AA 5EHIA 4FWIB 1HDIA 2A0KA 4FR5A 4CUJA 1QFSA 1UZAA 4RQAA 2EBWA 3HHPA 4DMCA 5BSMA 2QRQA 2VNIA 3HDQA 3HSYA 3HU3A 3KZCA 3DE6X 3LPNA 4HEHA 3HR8A 3G49A 5LN1A 1WUJS 2B9EA 3QWAA 2I2WA 4R8SA 3ZZ1A 4B09A 2ZREA 5EWMB 1LA2A 2IBSA 2IEBA 1UWVA 2CEKA 4G5SA 1SD5A 5FRDA 5AXCA 2DSNA 1CFZA 3L84A 1VB3A 2H7YA 4L8FA 1DRVA 1FXWF 4NATA 1TPZA 1P17A 1PTJC 1RACA 2Q3MA 2QQ5A 5ALEA 3G82C 3L6DA 2BGWA 2P4HX 4DARA 5D5QA 5GZ3A 2NU6A 1B0AA 5EPOA 1PI3A 3R7AA 1Z6QA 2C5BA 1XMOB 4P5EA 5KQMA 3BWVA 3K2IA 3M70A 4MS4A 4JQYA 3I05A 2XXJA 2HC9A 3C6BA 5EMKA 1TW2A 3H5OA 4R8RA 1N36B 3D64A 1TL7C 2FPLA 2V6IA 4RZ3A 5E8JA 3A4YA 5BR4A 9ICMA 2KG5A 1R0CA 4YONB 3HVRA 2VQFB 4W99A 4KQXA 3NUGA 1IZYA 2R2GA 1TRHA 3FVQA 4IDPA 5KX5B 4LJ7A 4UHDA 4Y67A 2YNMD 3Q15C 4ABTA 5KKCA 3I5AA 3K9QO 2V4UA 2QLMA 2ZUCA 2X14A 1NVDA 1KAEA 3T7KA 1QG6A 1MDFA 5THKA 1MQ9A 3LECA 3U31A 4XWWA 4NLZA 1U0OC 1MLDA 1Y8AA 5ENDA 3VDRA 1I0ZA 3P2EA 4F5YA 4EK9A 3AH8A 1C0IA 2QG4A 3Q11A 2GZ2A 5FV7A 5KT5A 2UYHA 2HREA 2ATCA 2HMWA 3CNEA 3RJJA 5DE3A 3ZDCA 5IIIA 2H9AA 4TYQA 3V8RA 3JVUA 3RJGA 2C9YA 4IL6U 5F33A 4AN1A 2PRZA 3W6UA 3K0FB 4HAWA 1C1XA 1VL6A 2CN1A 1UQRA 4KQEA 5SZIA 1YR8A 4CCAA 5JOQA 4DEZA 2HSZA 1FMJA 4N0EA 1KRXA 2FMXA 1GSOA 2JCVA 4TXNA 4AL4A 1JDNA 1O97C 2ZDQA 4GBED 3A4VA 2IUFA 3DUFA 2ZTMA 3GRYA 3UM9A 1KDPA 2CDCA 2YB4A 1JXLA 4J9QA 1QQTA 2DFTA 2X5KO 3OE4A 4LRQA 3KKAA 4EKGA 1ZVJA 4ESEA 3K4QA 2D3TA 3EK2A 2IXFA 4GYKA 2P66A 2BGMA 1ZU4A 1IUKA 1Y3AA 1VSQA 1EVJA 5J58A 1A5ZA 1KJ8A 1H4QA 1YKGA 2X4IA 4D26A 7GPBA 1EX9A 2C9MA 1G41A 4BLVA 4P3PA 1JYEA 4X7MA 1QLNA 1KORA 5CNMA 4D9FA 2R00C 4DV4B 4TT3D 2BFBB 4C1NA 1XROA 4DB4A 1ZQLA 4CCSA 2AFHA 2ECOA 4W5JA 4LOKA 4X8LA 2FPGB 1DC8A 1LV5A 8ICRA 1KFEB 1MB9A 1RP1A 2YBEA 4RO0A 2YASA 3D5QA 3UTCA 1XB2A 1DVRA 2ZUSA 3BFPA 1J9ZA 1NLYA 3VFDA 4GL4A 1MA7A 4U2FA 1JKIA 1OMOA 4H31A 5DGHA 3JASA 4F85A 5JMOA 3OQPA 1Z17A 4KN8A 1P3DA 3OQNA 1NBAA 3FH0A 5CUQA 5T8KC 2CT8A 4R2JA 2GLEA 4TKZA 1ECGA 3B1XA 4HNSA 4L22A 5DGDA 5EJMA 2CFIA 2DF8A 4PZYA 1MB4A 5DT2A 3EWAA 1HYGA 3TNYA 4A27A 5J43A 4JZKA 1N0WA 3LXXA 4RQ5A 1JEQB 4WEOA 3V4RA 3G0GA 1QKJA 3IUPA 1ILWA 1FEZA 4KH1A 4JR1A 1N60A 5HHTA 5TPZA 7ICMA 1RZ3A 1I2MA 1K6XA 4FFOA 3AY3A 3MFHA 3O6VA 2OHOA 5SY4A 5JXWA 3NC0C 3MHPA 5GIPE 4JOCA 4BMNA 4Z49A 3CNOA 2IV2X 4YK7A 1O9GA 4NE2A 1HE4A 1UXOA 1XAIA 1TEXA 2AMVA 2QVGA 1DEKA 2JJMA 4OQYA 1EFVB 3BC1A 1QMPA 3D4LA 1W88A 1RABA 3KLPX 2QVZX 4HYQA 5ADWA 2VQ3A 2R8XA 3NTRA 5DNWA 2IY7A 2AXPA 1R3UA 3ZD8A 5DGBA 3F2DA 1GUYA 2H3EA 2Q2NA 3EVNA 4PX3A 4QHYA 4MUNA 2IX3A 2Z2KA 3U7EB 3FPEA 2NYUA 1W0JD 2G1PA 4FHGA 1X80A 2QMHA 1QUEA 3ETLA 1OFUX 1XEWY 4MB6A 5EYPB 2QPLA 1I3CA 1OXUA 4ZU1X 4EW6A 1IDOA 3UC5A 3LO5A 3G7NA 2ZYWX 4RTPA 4MS3A 5T14A 4HSEA 1DBQA 1UC9A 2G36A 3D7SA 4DEXA 2PS0A 4JT4A 3K0FA 4HEJA 3K0CC 3PYLA 5DM60 3Q8QB 1A2KC 2X6QA 2WKPA 3MT9A 1F8FA 1R9JA 1ZQBA 4II2A 4WLFA 4PQRA 2CNBA 1TUBB 1KAGA 2VN8A 2GHRA 1NP3A 3F53A 1YZGA 3KHHA 1VKJA 5KT6A 2EKQA 3NHWA 1UBMS 2GCIA 5FBQB 3VRHA 4HLCA 3VXKA 3MCUA 2X0DA 2QLNA 4GZ6A 3VH1A 4MQFB 3C45A 3L6EA 1QYWA 3E81A 3K0AA 4ID9A 3CNNA 3N2GB 2EFCB 1FW6A 3KQQA 4KLAA 3AX6A 4R8LA 5AKLA 1P9RA 5HM6A 3WB1A 5CXUA 3O90A 2H52A 4XRHA 5J0YA 1OVMA 1VKHA 3PNOA 4XIYA 4A6PA 4D96A 4ER5A 5IJZA 3HPOA 9ICQA 1XCJA 3VGPA 2HHTA 1JQ3A 1WA5A 3AW9A 4G89A 2V55B 3O2QB 4Q82A 2GXUA 3H1PA 3PGXA 4Q03A 3PNYA 1ZQWA 1RDFA 1UAGA 3BAZA 4OXKA 2VNJA 1GRVA 4Q4AB 5CXXA 1C3VA 2Y67A 1MV5A 4TVOA 2NT3A 1DC6A 1UKAA 1DU4A 1MDBA 2JVJA 1NYLA 4L9SA 4DA7A 2JK1A 2O20A 1KKMA 2R8GA 4TV9A 2H2IA 1EDZA 1QYRA 4E14A 2NW6A 3SX4A 3MJTA 3ZIDA 3PEFA 1DEHA 3L8YA 3PC8A 4ONEA 2OC4A 1F2TB 4EA7A 2XJ4A 1IXZA 3MINA 1QH9A 2W83A 5J2UA 3C3MA 4BC1A 1QP7A 1SUFA 2WBLC 3D54D 1WXDA 4BXOA 5EWLA 2H4FA 1CF4A 1X7YA 3MMNA 2GFQA 3WL6A 1AKNA 2C54A 3GEGA 3JYHA 1DFIA 3OLCX 1QHEA 4HDRA 4OHMA 4MHTA 3C2LA 3IVMA 4TV8B 2A6PA 1XCPA 2DE0X 5HHHA 1U98A 4JQOA 4YRMA 4GVLA 3LQKA 3W9BA 3IQHX 2WKWA 4BNHA 1F38A 4MIEA 1SD2A 3MR3A 1YZFA 4I3FA 4OH7A 4QJ4A 4XX1A 3TW4A 2Q28A 1X1DA 1QYDA 1SWWA 3B48A 4JOBA 4K9OA 1HQYE 4OGFA 4FR2A 1C7IA 4ZT7A 4QJBA 5IF9A 4P4SB 1F2DA 2IZ1A 3PX0A 1NWHA 4E5MA 1UC5B 4F56A 4S1OA 4TRJA 4MVYA 2V59A 4DXDA 1S9FA 2NZWA 5TPWB 4YO8A 3C5EA 3T3EA 1ZQYA 2C94A 1GZ3A 2OOKA 4ETMA 5EWJA 1PNTA 5IKMA 1ZUNB 2GEJA 5HS6A 1HDEA 1E5DA 1UKBA 3UKJA 3WAJA 3GOHA 3U61B 1WS6A 3HVKA 3VR4D 3MRSA 1U48A 1UBLS 2X9QA 4FOOA 5C34B 3S6JA 2F2TA 3IT0A 1NUAA 3B7GA 2HT6A 5HR7A 1BHQ1 3D2QA 1CZOA 4R1QA 2HBQA 2Q5HA 2WA1A 1K6IA 1LPNA 2W22A 4JGBA 3VPFA 2Z4TA 1GKIA 5K6RA 2ZM5A 1C1DB 1GEEA 3IE2A 1NVFA 2HA3A 2DKOA 1TVCA 3UQ0A 1BN7A 1WXHA 4PGMA 4CR7A 3KVYA 221PA 4WVFA 1P0IA 3A25A 3CF2A 2Q0HA 1GPWB 3OTGA 3CZRA 2CWWA 8ICCA 2BGUA 2EV9A 1FUIA 4IR7A 1KYYA 1T94A 2ZBVA 4EFMA 1O8BA 2RGNC 4CHGA 2H11A 4E5VA 2GWSA 1TJ4A 1W85B 2BHLA 2GN6A 4KL8S 1NQXA 2J6IA 4QNMA 4MHOA 5AW1A 3U4QB 1U11A 5EE3A 2KP7A 3QXJA 4KQ2A 1WXFA 3OH8A 5FPTA 2WY2D 3VHRA 4DQUA 2GAOA 2PZJA 1NJ5A 2XKAA 1UKCA 5FLYA 1QPBA 2ZTUA 3T94A 1E8NA 5G5GA 2ORWA 1E2PA 1J0CA 5FUYA 4DMFA 3HADA 3ZE6A 5L1IA 3M3HA 3JQFA 1NA5A 4IUBS 2BGGA 1WR8A 3L6OO 4CM4A 1DLIA 1EJ6A 1FNCA 1CIJA 1EU1A 3AFMA 5ISMA 3AR8A 1UXJA 5CGQB 2JG3A 3KKZA 2CSUA 1WHTA 4EHAA 3OG9A 4IDCA 3B9QA 4ND2A 2CK3A 1M6HA 4YLEA 2WFAA 1SU8A 4RZSA 5I9LA 1IXYA 3F2VA 5AM4A 2I91A 2Z30A 4G8BA 3U4DA 4J9LA 1P2UA 2JFZA 3PXAA 3TF5A 1QIIA 3AKZA 2HHHB 4YRTA 1AF7A 3GFOA 4BECA 2A9KA 4GXJA 5EOZA 1Z56C 2BN4A 3JQAA 3TFWA 4DCGA 2TMKA 1PL0A 4HJXA 3TXXA 5MFZA 4LQCA 4D4HA 2WNHA 4NCHA 2RHGB 1QB8A 2X7HA 2XMCA 4P34A 1SIBE 1NAHA 1PT5A 1J22A 3N7TA 1CY6A 4EG8A 8ABPA 4IFBA 1Z6TA 2Q5JA 5LQJA 1L5WA 2QN2A 1B0ZA 4EGAA 2J7KA 1LBIA 2VJQA 3FNEA 1F9AA 3I01M 4M0PA 2CFTA 3H2KA 1GXSA 4NKRA 2C3YA 4YV0A 3IBGA 3M5PA 4WFQA 3IAEA 5EIAA 2B1GA 5CD1A 4JUZA 2N3ZA 1PK1A 1I3OA 1Z4LA 1RQXA 2K8AA 4U7DA 1SV4A 3EXHA 4JKOA 3LGAA 1YZUA 1ACLA 2CZGA 2HU2A 1ZQHA 2J4CA 4KQHA 5AW0A 2QZZA 4OF4A 1IMOA 4R1LA 4YXJA 4D8WA 4DLPA 5EQFA 1LV8A 3DDSA 4UUPA 2OESA 3R0QA 3GFPA 3IAS6 2AT1A 4MI6A 2C5AA 3NBQA 3I5MA 3CN9A 3GCZA 4IINA 5ELMA 3STTA 2DQKA 3AVUA 3DFMA 1ZCFA 1TQ4A 2OD9A 1E5VA 2ILTA 5KC9A 3F6EX 1VE9A 3GEMA 5T8KA 1CY8A 1E2KA 1Z1VA 2G0AA 5ALVA 2PJZA 4H3VA 3RARA 5JARA 4G36A 4X1IB 3SKYA 2B3TA 2BMAA 3C3JA 4HX9A 5DBIA 3ADDA 2LV8A 3U4MA 1C3JA 2VDNB 5KQGA 3M1LA 4I55A 2PUDA 3IQGX 4JP1A 2NTEA 2YCBA 2P2SA 4PO3X 1EUZA 1JUDA 3CRZA 4JX9A 4QUKA 2FN3A 2WZCA 4XKJA 3WHKA 4K8OA 2XYPA 3IODA 3HL4A 4GG1A 3R75A 1YFZA 4TM8A 3ONDA 3B36A 3ADCA 1P4HA 4M4SA 1L5GB 1VG0B 2VDLB 3OX3A 4NAVA 5I9TA 5J1TB 3ZW7A 4J0JA 1VLJA 5JQGF 2OBLA 3PC4A 1AB5A 2DFVA 4KV9A 4FHZA 5DTIA 4BMXA 2NO0A 1UODA 2E48A 1C8LA 1WO8A 2WOOA 1HKHA 1SGWA 4ABYA 3NTQA 5AK4A 4MWTA 1NK9A 2XY5A 1JIJA 1NR7A 5T4BA 1MAWA 3UMCA 1TK9A 3C3DA 3HJCA 3I9LA 3IUQA 3L8FA 2KE7A 3NHLA 3NOVA 4DABA 1AGXA 3CV3A 2ZI3A 4NMMA 1AO3A 3GNTA 5KIAA 4XCVA 1A7UA 4Q3AA 2CXPA 1T5DX 4FHDA 5JAOA 2W70A 3LZDA 2JLYA 1OGIA 4K9SA 3G0BA 5LIPA 2JCGA 2VDVE 1QHXA 1Q0UA 3SYRA 2Y1DA 3INNA 4ARCA 3K5HA 3I9V6 1DFHA 2XLBA 3U44B 4BQFA 1N5DA 2BHRA 3SR0A 2QUAA 1K89A 2C5GA 4U63A 3CLUD 2FWMX 4MJXA 5E7QA 4D9IA 3JQCA 3BGIA 4CF5A 1N5OX 4YJGB 1XL0A 3X1MA 4B7ZA 4QQFA 3ZDFA 1I7NA 1MJGM 1ZQXA 2J41A 1XYGA 5DB6A 2PT7A 4LJAA 5AJVB 1QH8B 3BQ0A 1LNQA 4NWIA 2GAIA 2YXBA 4J7XA 3NX4A 1E2MA 3D6VA 3P52A 3O74A 3PS9A 4Z6EA 5L1JA 3T54A 4DL3A 1TIPA 1H0KA 2B21A 3SDZA 2A5LA 1JJAA 1LS1A 5IIKA 2MMGA 1AF4A 1LZLA 2VJYA 2Z1MA 1MU0A 4L73A 4NU5A 1GTG1 4JK1A 4H7PA 5ERXA 4INAA 3MRXA 4BP1A 1I9GA 1M2HA 2PIAA 4IZ6A 3S2FA 5CA1B 1LV7A 4BFUA 4OO3A 3T1NA 1W9HA 3KQTA 2PGJA 4JLSA 4XXHA 2QP9X 3S55A 5FX2A 2Y1KA 5HK9A 4I4NA 2C5FA 4PYQA 4L9AA 1NW8A 4D0NA 1I3KA 5J0TA 3WTBA 2BGNA 3IQXA 3WLOA 5JD5A 3D8BA 1O9HA 1XHFA 4MP6A 4TVKA 2PX6A 4XVUA 8ICEA 2MT9A 1QCZA 2BT4A 4IIBA 4E70A 1GDDA 3OA0A 3O4GA 4KBYA 5AVXA 5ADUS 5I9NA 1PK7A 4ZV9A 3BMOB 5CEJA 5AK6A 3M49A 2Q3HA 3R7WB 2AEJA 2F77X 2Y0EA 2EEPA 2GM5A 4M55A 4XX0B 1D6MA 3GUCA 3N9IA 4ZT6A 5FTNA 4C4XA 3N59A 4DUGA 1RMTA 4D2IA 1SKQA 4CIXA 3KPWA 4JH0A 1EFPB 2BM9A 4RKRA 5UKDA 3KKQA 2JH1A 5EKSA 1K7FB 4D82A 4F4JA 1QO7A 3QUCA 4MSUA 5K0CA 1TI7A 2ORVA 2QI9F 4HAXA 3GT0A 4UCWA 1KPHA 5DM4A 5DWVA 9ICIA 1VXOA 1NMEA 2H07A 3FAKA 1XDDA 5A3VA 1CEXA 1GCIA 4KDRA 1JB1A 2EZ8A 3NXSA 2ZRAA 2AJBA 3EOAI 4MA5A 2DXIA 1PCXA 3LM8A 3AUUA 4CFYA 3FOBA 1E9BA 4Q43A 1IRXA 4RQMA 2C2OA 2XKJE 4MQBA 4I28A 3RUCA 4AJOA 3GJSA 2R6HA 4Q7JB 5IVKA 1RHMA 3O94A 4TSRA 1V9SA 2XWBF 2WQZA 3F0TA 3AWDA 3HBNA 3N39C 4DF3A 3P1JA 3WL5A 4FCCA 2EYUA 5KMGA 1BS1A 2G63A 3E3LA 3B7PA 3AUTA 5CR0A 1FF9A 4P82A 5BRNA 1QR6A 3SC2A 1UKVY 2BIFA 2WSYB 4MUJA 3VV2A 4BFLA 3U81A 3DMYA 3T5HA 3OM1A 3ZBPA 4C2BA 3TOXA 4P4NA 3JPYA 3R3WA 2NRTA 2RHDA 1FDUA 2ISSD 4HUJA 1K5GA 3HA3A 2Z6UA 1UR5A 4R6XA 2C2MA 5KG1A 3HKDB 2KZ3A 4FFRA 5E7MA 3DE7X 4ASUD 1MD9A 2CEAA 2ZDGA 3K9BA 3PUYA 4ZI7F 3ICEA 4HAYA 1OZGA 5B64A 3HT3A 3ZDYB 3SX2A 3ONVA 5IWAB 1R8XA 2P8SA 3BB1A 1IG6A 5DCWA 16PKA 8ICLA 3ND8A 4EPTA 1ZQNA 2JS7A 1M7GA 1GGFA 2LD4A 2QM8A 2VJMA 2WIAA 3K73O 3NH9A 4E11A 5IN5A 3WJ2A 1RE0A 2XGQA 1H6AA 2GI4A 2Q49A 1ZSYA 5JJCA 5IU6A 2VPQA 3L7DA 2QIOA 1H5NA 3AHGA 3RJFA 3GCXA 1QYVA 5A0VA 2CXSA 2GT1A 3DJFA 2X15A 4GYYA 1NJWA 2X4DA 3TOCA 1EUYA 3FTEA 2ZQYA 2W6ID 2OXTA 1VG8A 3NONA 5KOHA 5KT3A 1P4JA 1TXGA 2WJPA 4MR7B 1V3QE 4HEA1 3FZYA 4CIBA 3TPFA 3NVKI 3TL2A 4ZVSA 1ZQAA 1AKTA 3TIIA 3NHBA 4M9CA 4N9QA 2FRXA 1FDIA 4PH5A 2NSJA 3HP7A 2IHZA 3NT5A 1QP0A 1SBCA 3I6ZA 4PQGA 2BP7B 2Z4RA 4MW5A 3BPSA 4Z0TA 1Z6PA 3HCEA 1Z8DA 4ESOA 4PU0A 3ZK9A 5FOQA 4YJHB 5BUSA 1OI3A 1GGNA 4XWTA 2MAXA 2BR5A 2ZRDA 2F2AB 3LNTA 8ICUA 2VSFA 5TDHA 4XVCA 1Y3CE 3ISBA 2LW7A 4J2TA 3X1WA 3CF4A 1IMJA 1N2CE 5ICSA 4LG1A 5C9ZA 3RDPA 2KZZA 4ZPXA 5JU6A 4IY1A 5KNLA 1YRLA 3JAKA 5GTDA 2IYOA 1N7HA 1YBVA 3D0KA 3QE3A 5A9TA 5KG7A 2OXRA 3AQ4A 3KAKA 5CBPB 4J16C 2ZKLA 4CCYA 1FYWA 4ECRA 1RHJA 3R7WA 3TRHA 4FE3A 4LJXA 3TD9A 4MJ3A 4BO3A 3DHEA 4HZIA 4L85A 2DKFA 4RZ2A 1J5XA 1U3TA 4ZVOA 1JX4A 1L5VA 4HSGA 4ZVQA 1ID1A 3AERA 621PA 4LBZA 3SAGA 3B12A 4FW9A 3A3OA 4JS0A 3GIKA 1SHLA 3STYA 5C18A 3ETGA 3OFSA 4EVRA 1G8SA 1UJNA 4L16A 4CMKA 4H6VA 4OJLA 1XZ8A 3M6XA 3K2EA 1WIWA 3HU2A 3M4YA 4BFTA 3RU7A 4L7QA 1PAUA 3DBRA 3IP7A 1MIOB 1W4LA 4DZTA 1RXUA 2YWEA 5IAOA 3KXKA 5G1OA 1MZVA 1Z74A 3D6NB 4NFSA 3GGPA 3WQBA 2L18A 2W58A 2Z2JA 1H38A 4XCQA 1FFEA 3WLKX 5DM2A 3AONB 1XEAA 9ATCA 2WAMA 1KJJA 1NI4A 1ZI6A 3Q4GA 1YB4A 4I6GA 2OHFA 1O9BA 5E4JA 4EG1A 1VRWA 4B8YA 1PYOA 4MW7A 2ISCA 1MT0A 1DOHA 4NU0A 5AVTA 1Y80A 5B3JC 2ZTSA 4E2XA 1OIVA 5ICGA 3BRWA 2QD1A 3U1VA 3FFBA 3BS7A 2LDXA 4RKFA 1LFAA 3U3OA 2EZUA 2JL1A 2YIJA 3LO8A 1GCOA 2CHGA 3TLGB 2PGXA 2MSKA 4JLBA 5K9ZA 3OSPA 2BWJA 2ZR9A 4P38A 2ZJ5A 1PJ4A 5KT2A 4ZOAA 5TPZD 3ZY3A 1O6BA 3CJRA 1UZMA 1PR6A 3A0RB 4FJ0A 3RYHB 3SNHA 3PX6A 4X93A 3ZKAA 2WM2A 4Q4DA 4PZZA 1KMCA 3T4UA 4DG8A 4FKBA 1ZJ6A 2JAPA 2VBIA 5F3RA 4EYHB 5GPBA 4ER0A 1XPRA 3U7QB 1SUPA 1SKYE 1W4RA 5DM0A 2O3QA 4F1KA 4I2CA 4KTTE 1AZTA 3H65A 2HXSA 4ICIA 4C2TA 5JPDA 4FI3F 3D2AA 4J8PA 3AIKA 3GFGA 3JATA 3R3UA 1K6MA 4WZ6A 4AZ0B 3HB1A 3QEBZ 4N1AA 3PFKA 5GGYA 1M1NA 3GHYA 2BKVA 4EMTA 4TQSA 5M29A 2WKSA 2NSYA 3QEMA 3AV0B 3D7RA 3WY9A 3RV4A 3WLJA 3SHTA 1YVEI 9LDBA 4GP7A 1W25A 3ORQA 1B8PA 1Q74A 1B3BA 1TU4A 2V6BA 3GP5A 3BXXA 1WD5A 3IDFA 1U81A 4PLPA 3W7BA 1DAEA 2ISPA 4Q34A 1GAXA 4HBGA 4IUCS 1BX0A 1IVNA 3ZJUA 4F5NA 1DBSA 1CY4A 1P33A 2FE9A 3AYZB 4I1OA 4KGVA 5FL7D 2X0EA 2IPLA 1WUTA 1E9FA 2KBFA 3ILYA 4WY2A 3OE7D 3HP1A 4J7AA 4MI3A 3OE7A 5BW5A 4FDTA 5CK5A 1JIQA 1PR1A 2K87A 2QX6A 2R1VA 2PAAA 4DY4A 1EHCA 2OAP1 1A9XB 1M76A 1XNJA 2XO7A 3INTA 3KAJA 4M0AA 4ZANA 2HK6A 1RG6A 4ZZ1A 2CMFA 3L4BA 5KFPA 2YJ4A 1WOMA 4PLCA 4PONA 4UUBA 4X3CA 4MGYR 4HFJA 4K4GA 1GUZA 4CM8B 2VHTA 5EWLB 3EDQA 3ROMA 2JGKA 3FHJA 4B6EA 4XIGS 3RM3A 3X44A 1OXKB 1BVSA 2VNSA 5LBTA 4D6XA 4PPXA 1GADO 1C3EA 2CW5A 1JXOA 1TK3A 5I01A 5K6AC 1JG7A 1SIJA 1X8KA 3MSCA 2FWPA 2H2DA 3SBXA 4LJ4A 4BQNA 1HG0A 5EJ9A 4N47A 3K71B 2TMGA 1INLA 5DT9A 3JWJA 4U0KA 3RHZA 5C8ZA 2QI9C 4A8TA 1JLSA 5ELXA 4NBNA 3V72A 1GR0A 4E3WA 2PN1A 4AUEA 3B0XA 2O07A 4JUFA 1TMKA 4N49A 3H9UA 3RV3A 3AQIA 5KYUB 2FWIA 2AQ0A 5C7OO 3MBOA 5JISA 1TZBA 4I9UA 3T5AA 3PHHA 4JVNA 3QPUA 2IOYA 2OR3A 4RLQA 1EWKA 1PX0A 2OGZA 1PWEA 3KHGA 4DYDA 4EH1A 5JCPA 2WTFA 4QU5A 1Z83A 2ZJYA 5K0TA 1HL7A 2ZSIA 1QIJA 4DR1B 1TKAA 1DIAA 2A5DA 2QQGA 5ARBA 3ZBQA 5KZMB 5E3JA 4UM5A 2JKYA 3VUEA 1ONPA 2I6GA 4B9UA 1ZNQO 1OUQA 2P6RA 1FSSA 3ZI4A 4C8LA 2NVOA 4X84A 1E0JA 2ZSKA 4MLPA 2V74B 4MICA 4HK4A 3KSZO 1FNSA 2GEBA 2OV1A 3VU1A 1K4YA 1L9KA 5E6UB 3WKCA 4EX6A 1F0KA 4BX3A 2FWRA 4X0EA 5LP6F 3NAZA 3DB1A 2WAQC 1CJKC 3LUGA 2J5RA 1X13A 3NH6A 4U2GA 3N0WA 5CH3A 2IWRA 4OLHA 1S3IA 1HEYA 2FSGA 4UTOA 4XEHA 4DIBA 1WB9A 1NV9A 3RJ9A 4AYBF 2FWJA 2ZB2A 1Z82A 1TA4A 4II3A 1YV9A 2I3DA 3EH2A 1MTZA 2D13A 1RZRD 3URMA 4RQ0A 2P5UA 3SJUA 5LMNB 5EFZA 5H5JA 1D7AA 2HM7A 2I34A 4REMA 1ES9A 5KWIA 1U3UA 4BB0A 1QIKA 1X80B 1E7RA 3NCTA 2TECE 2ZEJA 5EYPA 4P36A 2W6NA 2RB5A 3RO7A 4QIWF 5BNTA 1VXRA 2EDCA 1Y6FA 1HE1C 1ZA1A 3R7NA 4D74A 2IYFA 1AN0A 1E9DA 3EPHA 4DA0A 4TGLA 3WTCA 4P0PB 1B00A 2I4IA 2E8NA 1QVZA 2II6A 2F8SA 1E63A 1RYDA 2YWBA 3I42A 4A0RA 4GC7A 4DIEA 3L6UA 4PW0A 3V1YA 1GNPA 3CURA 4EQ6B 3KK0A 2P3QA 3EYAA 3EIFA 3RVMA 4NJEB 4FFLA 1K7YA 2X1MA 1Y5NA 4H27A 3TXYA 1VHTA 3Q85A 4JU9A 2ZJAA 2YL2A 3ZC3A 4CL3A 5CDYA 2LE0A 1E0AA 3KXIA 1JJ7A 1LUAA 1YASA 5G0WA 4BOYA 3IIIA 2ALZA 1Z18A 4CQLA 3IT2A 4V0KA 3J81k 4PVDA 1P1RA 2X1VA 2R47A 4LW8A 3KPVA 4CF3A 3S5JA 2MU2A 2H4HA 1OYOA 1BWSA 4RE6A 3GT7A 5DX0A 1U80A 1E3MA 4UCFA 4J9NA 2X9NA 1SK8A 5JO0A 3F8SA 3UQYS 3U3MA 1H0SA 3G6WA 1SXJB 5KT4A 1HIWA 1IAVA 3F4KA 3LFUA 3LXMA 1BPEA 2W5UA 4CIDA 1N1GA 2PFPA 2PA3A 2WV9A 3C29A 1ZG3A 3COPA 3KE9A 3CZPA 1YIDA 4GUDA 4MW9A 2VQ6A 2NP6A 4RQ2A 5JG7A 4DJDC 4IL5A 5K0SA 4RZXA 1NJSA 5KTSA 3IEVA 4GM0A 5DLGA 4MKGA 2FPGA 3SG0A 4KPEC 1YFLA 1E9CA 2X5NA 1Z4QA 4YWJA 3JARA 2OXEA 2IUSA 3WIDA 3PE3A 5H82A 4FYPA 1R5NA 1JIKA 1VMIA 1U0HC 4HDRB 2ZT5A 4LYAA 2ZBFA 3T38A 4DLAA 5E1BA 4EVQA 5K8UA 1YJ5A 5EHQA 1V16A 1ZMOA 2I1VB 3Q7EA 4XCXA 4Q45A 4ALMA 1NTOA 3PPWA 3TE6A 5B1EA 4C8KA 1NWCA 2DBRA 2SKCA 5EVCA 4PPQA 3NC4A 4YQFA 1AMUA 2H1IA 2O0LA 4M1WA 4O59O 4JJZA 3GR6A 4C3VA 3TSOA 1LDEA 1ZOLA 3L82B 2BEVA 3LL4A 1U2SA 4FGWA 5KYWB 5LWQA 1JTEA 1IM4A 3BERA 1DO8A 4DREA 4YCDA 4TMKA 3BXEA 4RK7A 2WSLA 2VJLA 3SMVA 3EIXA 2MYPA 4G4GA 3LWNA 1SKUA 4GWLA 3GZFA 5LZ7A 5J5AA 3NHPA 3HKZF 3U4IA 2CL0X 1KTQA 1CFJA 1VP3A 4RV5A 1TGVA 4KIWA 3VU8A 3CW2A 4QTZA 3UPUA 2WMNB 1QRSA 2YJ6A 4ALJA 2YHIB 1GTMA 4IR1A 3DNFA 2BQ3A 2E5SA 3ZBUA 4D5GA 2OFOA 4OHRA 2JANA 5HGXA 1MA0A 4F2SA 2O1WA 1QQ7A 1SU4A 3HEBA 3NHAA 4AQ7A 3QBDA 4K6CA 1W29A 3B3GA 3IDSA 3IV6A 3JS5A 4PQFA 3NVYA 2I6FA 3MLAA 4TMZA 5FH9A 1MJ5A 2MTBA 4DCPA 2IYLD 1MQSA 2B8WA 5EINA 2H65A 5AJYA 1QIFA 3ZCVA 3L7KA 4ZO7A 4B71A 5JSZB 1GA6A 4C6TB 4EO4A 3FXAA 2YQ5A 1NU8A 3HCBA 4DJAA 1M6YA 1XP8A 3ZK7A 1KI2A 4RQUA 4QUHA 4W8HA 2VAMA 1Q0QA 3T99A 3JQGB 3O4HA 3ZKWA 3R9WA 4YRDA 2WTUA 2QT1A 1DRKA 4IQFA 4ECTA 4PNEA 1QYXA 1PYGA 4LRSB 1HT2E 3F3MA 2V5VA 1DKNA 4R63A 1HTWA 3DLTA 3OZXA 4L28A 4WE3A 3OPVA 4R31A 1OQAA 1KEUA 2LYAA 3L5KA 3OFKA 4JUBA 3U7JA 3WGYA 3CX3A 3GVHA 5JQWA 4ESHA 1EDEA 4URYR 3DXFA 4CPDA 4D5EA 1DQNA 1UMCB 3C39A 4QPDA 4W8GA 2I1QA 4B46A 2FU5C 1RI2A 2V97A 3B82A 3O1LA 4MKFA 4TYMA 2XGSA 1MG5A 4LK3A 3REGA 2Z5LA 3BWEA 4FUTA 1DAOA 3AUYA 3JQPA 3NANA 1F0YA 3TTUA 1XLVA 2ZLBA 5AW4A 2VF5X 2YV2A 3EVDA 1OH6A 1UBEA 4K4HA 3PV8A 1KI9A 1NGSA 4Q18A 3E2PA 4HGNA 2IYQA 4TYPA 3P9PA 4Z7JA 3N2LA 4K81B 4GZ5A 2JJ1A 3LRXA 3IPAA 3PSIA 4HLUC 5FORA 4ZN6A 3PGLA 3MA0A 1P1FA 5FPHA 3VI4B 4A5SA 3DV0B 3OX2A 2E4UA 1L7RA 4PPNA 1FFSA 5J1SB 3PCXA 4OLBA 1P4AA 1TLFA 4M9RA 3UAXA 2MWMA 1FA9A 4LC0A 3B3JA 3ZWVA 3AEUB 4ZMBA 5B1YA 4H60A 4IOKA 3AJRA 5KG0A 3FR8A 1R15A 2OQIA 4UZEA 2A88A 1JS1X 4EUNA 2REOA 3TOZA 1TVEA 3FTPA 1NKSA 4MUBA 5K05A 2XDQA 3EIHA 4PAMA 1VJ5A 1AKQA 3LFHA 2PS3A 3ZWQA 3J7AC 1D2RA 4M1ZA 3GLFB 4XUSA 3C1UA 4NJMB 3REFA 3GX1A 4M0FA 4UZSA 2XLCA 4CL0A 1P8AA 4D46A 4MVJE 2V0CA 2R8HA 2PHZA 1OBOA 1ZGHA 1X9SA 1ZMXA 2WAYA 4LBWA 4U0JA 3R76A 1MAHA 3B8HA 4BVFA 5I3ZA 4O3RA 1ISIA 1Z13A 4RVNA 4HRXA 2W8KA 3A6LA 3ZDBA 3P45A 2VYCA 4LSGA 3SEQA 4KLMA 3VO1A 3HB5X 4NM1A 3HA7A 3I2JA 1ODJA 3L8MA 1V8FA 1I6LA 4G1UC 4H16A 1UAYA 2XMBA 2DR0A 3KXLA 2X4GA 3K15A 1X86B 3PHBE 4FLMA 3AEQB 5B3JA 1KK2A 2RHBA 3HG7A 4N18A 2NRVA 2P4QA 5KU7A 1T24A 2J6UA 5DW0A 3MWEB 2DP4E 4BNJA 1ZM9A 5FUVA 3ZHXA 2V6JA 5BXYA 1OFGA 1XO1A 3KHUA 4GR4A 1KIMA 2GEDA 3PEYA 1Y1RA 1S0NA 2G17A 4QL3A 2E85A 3WKDA 1H1TA 2XCQA 4C4PA 3D2SA 5HGJA 4Z3KA 1QR2A 4ECQA 1SL2A 1ZC3A 2IEIA 1HG1A 1S76D 3DFZA 3FI9A 1QAOA 2A86A 2VOJA 4QIWC 3E23A 3Q5DA 4HD8A 3VCBA 3WBKA 1HZZA 2E49A 1JAIA 1DWUA 3Q6IA 1IULA 2ACWA 3QENA 5J2TF 3MERA 3P9XA 2J3EA 3BMCB 3EMBA 3PPXA 1POXA 4NF2A 1Z4KA 5GZ6A 3O03A 1R0ZA 5EE9A 3H2SA 5CAEA 2QAIA 2WWWA 1WU7A 2A1TR 1QBGA 5E8RA 3DBHB 2WC1A 3C7CB 3WG9A 2WVJA 4WKNA 3QPDA 1VJCA 1U5AA 1U9LA 2GVZC 2J7PD 2F76X 2QMOA 2VYNA 1E98A 4DQQA 1EJ2A 2ENUA 3LLMA 4P0TA 5EJEA 1R10A 1FLNA 5BSFA 2V8OA 1LLDA 4UMVA 3UAZA 4J9UE 3M2TA 5AKHA 1HLFA 3HVHA 1FO4A 5IBRA 3UWMA 1TADA 3VR4A 1DSSG 4OAPA 1Q3UA 2FOXA 2VAXA 1IB6A 3O91A 2Y1LA 4IJKA 4P4LA 4AJEA 3U9SA 4WOKA 1C20A 5DGXA 4AM8A 4XZ3A 2I8AA 2C2KA 2IHVA 3GFRA 1U2QA 4H35A 4NPAA 1ZN8A 3RWMB 1KEZA 3DAYA 3G23A 2XUAA 4FSXA 4U6NA 5KTMA 1UWKA 1UZUA 3H6HA 1B6TA 1ADCA 3KUDA 5KWSA 1AA9A 1SXJD 3LY5A 1OZHA 1SM4A 2YZKA 2WG2A 5AW5A 5AI5A 3PO5A 2W9CA 4FP9A 1A0PA 4DFPA 3PXCX 4LVUA 2NV0A 1YS7A 2QR5A 3WICA 4JJGA 1Z00B 2QE6A 5BSHA 1J07A 1QE5A 4UFOA 1L3UA 3IJ5A 5KNCH 1P1JA 3JQ7B 3OAAD 3Q0EA 2DBVO 4R16A 5H0IA 4O4JB 2H29A 2VH5R 1Y6ZA 1FRNA 2C1XA 5ALDA 2PV0A 4B6GA 1E96A 4K3VA 1JDTA 1P1CA 1DOQA 1DKRA 2W0MA 4OOEA 1ATIA 2XDWA 4CL2A 1W73A 4CNQA 2WHXA 4B32A 3A1SA 2W9AA 4WW0A 3FKSD 4LGCA 2Q4BA 2XDQB 1BW9B 1MG0A 3HYRA 3KLNA 3UWKA 1JHMA 1RBZA 3CZCA 5AVUA 5KSWB 3WK5A 3L43A 3CE6A 2OG1A 1JECA 4OU4A 3GEHA 3MCZA 1E2IA 4I0WB 3RBEA 2AGVA 1IHUA 1MX9A 4AXXA 3F78A 1CS0B 1VLZA 1BHSA 2PBFA 4X3OA 5DYWA 4U2BA 4XJSA 5FA8A 1B41A 1GU0A 3UGJA 4KLGA 4DQIA 3KX2A 5ER9A 3OJLA 4P9NA 3O4RA 4ZO4A 4RTNA 1SHKA 3RH0A 3H2GA 3A10A 5MDHA 4U9HS 3MC1A 1K0UA 1UEIA 3QU4A 2X0NA 3QNUA 2QNBA 3EAGA 4MVJP 4OIMA 4U2KA 4CMGA 1E1DA 4C78A 1WZCA 3RUIA 4IXDA 3OQHA 2BLLA 1JL3A 4U8HA 1O89A 1SKBA 5KTQA 3AEXA 2X0JA 2FQWA 4ARUA 1WMDA 4EI2A 4JYPA 4ER6A 4YUWA 2EJVA 1A1SA 2OGUA 1IC6A 3IE1A 4F04A 3I5XA 1IM8A 1GQRA 2FUCA 1CRXA 4OU5A 3MWDA 2FSSA 2Z09A 2ZS7A 3X1JA 2VYQA 4ZRDA 4G0VA 1EQ2A 3G17A 4FNOA 4U7PB 4HH1A 4M8LA 1SXJC 3DV2A 3PTAA 3TPCA 4OUDB 2VDRB 4KVFA 2KHZA 3TLXA 1FJGB 2C3PA 2VCYA 1DBVO 4TMXA 4UBNA 5I7OA 1MC8A 1BX3A 4IHJA 3L4EA 4Q3BA 4B9NA 2GYUA 1MR3F 3ROXA 3U62A 3OM9A 3HLTA 1FS5A 3UOAB 4A7PA 2GD0A 4JP8A 3TEJA 4RGBA 1Q91A 2R6CA 2JVIA 3COYA 2EC5A 3FCSB 4I5EA 4EY4A 2A1TS 3ECAA 1X7WA 3OSZA 2W2XA 1SZJG 1B43A 3UWPA 1BSVA 4F3YA 4WCFA 2WD8A 3LCJA 3IRUA 4AG3A 1ONBA 2GKSA 3G5LA 2LI6A 3R6DA 4K87A 3K4PA 1IZ8A 3QUBA 3GDXA 1N5KA 5LXTB 1YZKA 1E1LA 3QWIA 3U5TA 2ZSHA 3OEWA 1ZJMA 1N6RA 1G20A 4GSYA 1P7PA 3SV4A 2AZXA 5KTOA 4B74A 4RKQA 3KLBA 2H2FA 1IN8A 3RFVA 4EY5A 3LHSA 4JV1A 1QV7A 4K86A 5FPQA 1XJ0A 3TAUA 3V2IA 1ZI8A 1VCOA 1XWLA 4CR6A 4L5JA 3RU2A 3AXSA 4ZO9A 3EVCA 3ZE7A 5KFBA 3SXJA 2L17A 1Q3HA 3TFOA 4ZGGA 2EZZA 4I4IA 4LOAA 4RA9B 2W8BA 3G6XA 4EY7A 3F7OA 4NE7A 5FBRB 4PL2A 3N7PD 4HWRA 1PUJA 1BJTA 5BYJA 2PH3A 2C2XA 3ES9A 1WDLA 1R66A 3H4MA 2DY0A 1PFYA 4JYMA 4DMKA 3IUBA 2R65A 3GFBA 2GPYA 3JRWA 2AG5A 3W79A 4C0WA 1D4AA 1KO5A 1VIAA 1FQOA 2CXUA 1RMYA 3SU8A 2ZIGA 3A9WA 3QFRA 4FOLA 4GKKB 2FSUA 1AHHA 1NJ1A 2HGSA 3B7WA 3TR5A 2CNNA 3S2SA 3A1UA 3WMRA 5IFKA 4OLAA 1CEEA 2QPTA 1QQ5A 3NXKA 1MABB 3RAXA 5AHRA 5HIJA 2VXCA 5JS2A 3NEJA 1L5QA 3QZ7A 3GT4A 2P5TB 4F4YA 4FDAA 1T8RA 3N8IA 1W8IA 1GPH1 1K08A 2BBSA 3LYSA 1O5TA 2I6UA 3FR7A 3L92A 1ZL0A 1CYDA 3OC6A 4PYKA 4XLLA 5ESXA 3T3IA 4UB4A 4AMUA 3I2KA 1TA0A 1KNXA 5ALOA 1NM5A 2Y1FA 1AS3A 3VR5D 1EEXB 2E89A 2W9CB 1Y4ZA 2OWEA 4FZ5A 1WUIS 2VR1A 4NMHA 2JI4A 4GKAA 2AH5A 5IS2A 2Z6QA 1T34A 5EZYB 4CMEA 4A23A 1J2NA 4LYJA 5CB6A 1DBPA 3HRDD 3MIZA 4ZP1A 3C7TA 2Y27A 2H5JA 5EKXA 2EFDB 3C85A 3R3HA 3AERB 3JYPA 4DSEA 5G5HA 3OSUA 4R2MA 4E0BA 1H5QA 3K9GA 4NLKA 1Z6ZA 1H2XA 2AS0A 2IF0A 1IQUA 1Z4JA 1ZK0A 1Z26A 3C24A 4RVFA 2OP0A 2QTTA 1BU5A 5IJ0B 4RY8A 1HFKA 1SQSA 1RPTA 2X9VA 4UB8U 2XNDA 3T95A 3TZCA 2H8KA 3KBBA 4OVKA 4Q8FA 5JTTA 5JANA 1OHHA 3MLBA 5MN5A 5F1KA 2ZI4A 3Q2KA 3F9RA 3FYUB 4JLOA 5AOBA 1QTNA 2V7VA 3V7UA 3WWCA 1N2OA 3ZV5A 1E59A 5HW0A 2E37A 3ICVA 2Z58A 4X8OA 5IVDA 2CVQA 2QVYX 4QW9A 3JRNA 4CEJB 3ABQB 4PYNA 2XKKA 4Q0MA 4KGZA 2X5XA 1FTSA 1EK2A 2GZ3A 3CW9A 4PEVA 5ILQA 2QXYA 2YHSA 3KQHA 3T3HA 4KN5A 3RVRA 1GG2A 1UM8A 2VUSA 1TPYA 4G67A 3BIFA 1KBZA 1DJLA 5H81A 3U7IA 4YXWD 3LFTA 2FRDC 1QAMA 5G02A 3ROTA 4B83A 2JAWA 4MW1A 3EFOA 3RIEA 3CLHA 1FDSA 1YK1A 1PEAA 3EIWA 3G89A 4DDMA 1QG2A 1KZ6A 2XUKA 4F3KA 4U3JB 5A1JA 4UBOA 1NMXA 3Q9SA 1OAOA 4PLGA 2BCRA 3ZJYA 2AGPA 1LCIA 2QW0X 4OJMX 1AMNA 1LB2B 3ISDA 3KQNA 2DX7A 2ZSEA 4OXIA 5AJUA 3TSAA 5KJEA 4UD2A 1GR1A 3GN1A 2AXEA 2P65A 1GPJA 1KY2A 2BKEA 4OATA 1PVQA 5K01A 1QS0A 3SF8B 5B1IA 4BNXA 4TTRA 4UAJA 3SHOA 2FCAA 2YINC 3B6ZA 2AUMA 3EFOB 4CQLB 5PGMA 1QHGA 2BKAA 4BWMA 4L2IB 4ZCLA 4C04A 2HNAA 1WZNA 2LR0A 2W9BB 2CMHA 4BO7A 4H0CA 4DJFC 4MQFA 2QM3A 3A7EA 2PUTA 2H3ZA 3G8YA 4FBLA 3D7NA 1YU9A 4K26A 1ZIYA 2O2DA 2PKQP 3KLMX 4LVNA 4DCTA 1NG9A 4RFLA 3KYCA 3GVIA 5F7XA 4J49A 3F98A 2JJYA 5C3MA 2NRWA 1CPYA 1GZUA 1XBTA 1N2XA 3LVVA 1U8XX 2V6FA 3D3WA 3KKNA 3T3FA 2HRZA 1QANA 4NH0A 1OT3A 1FSGA 2HR1A 4FX2A 1CB0A 1AX9A 1RYEA 1WHTB 3I6IA 2C77A 4IZHA 1GUFA 3WGNA 1R5OA 2XQJA 2GZMA 3FW1A 1R4AA 1H2RS 2O1XA 1DG9A 3D0OA 5L3QA 3EEYA 5D46A 3H2BA 4NBTA 3G0IA 3I62A 2EDUA 1CUVA 4GKJB 4XR4A 1U5CA 2RGNA 3NHSA 4INZA 1ZH4A 2Q1UA 2OQRA 3G8AA 5HWSA 4E6PA 2R7KA 4KNVA 4IJMA 5DJ5A 2X6TA 8ATCA 4MF2A 2FPRA 2LWIA 4ON9A 2VOEA 4TURA 8ICJA 1K1SA 5I6DA 2MRLA 4GP9A 4RHTA 1P5JA 4GPD1 3F3SA 4D6YA 1VPLA 1UOOA 2FI1A 2R8OA 3CPHA 4Q3DA 3QOFA 3WGUA 3UG6A 1QOZA 1IN5A 2CVPA 2PLRA 2WVGA 4G5YA 4HQ6A 3AESB 3SF0A 4FZLA 1A98A 4NLCA 1P75A 1TO2E 1Q1GA 1U8EA 2VK1A 1QSSA 4X1YB 1BXGA 4YACA 1Z0SA 3QVJA 2IV7A 3N7UA 4N01A 1N8TA 4UU1A 2NU8B 3RVLA 1KJ9A 1PR0A 4IRCA 3LLVA 1NUPA 1UWCA 2GFIA 1MSWD 1P0MA 1Z1BA 4PF1A 4HYTA 1HDZA 2GEVA 4PLWA 2RBKA 9ICEA 4H7EA 3UGTA 1AT1A 4S1TA 3AF6A 1FXWA 3S2IA 3H86A 4PYRA 3LA8A 1E7SA 3DBOB 3AUFA 2WD7A 3AOGA 3LLUA 4FW8A 4DMGA 6NULA 5KFGA 1V7ZA 4QYTA 4ITRC 5EWJB 3VU3A 4B5LA 4D9KA 4HT3B 4ODIA 2BBWA 3IJPA 3LDHA 3LGXA 3GJ8A 2FPXA 3OD1A 4RK4A 4YVFA 1P4SA 5JPIA 1XVAA 4JAVC 4OB7A 4MO9A 3VO8A 4AG5A 3JALA 4EPXA 1W4ZA 1XD8A 3RFUA 1YE8A 5JD4A 3PWSA 5C37A 1U0RA 3VKUA 4TZ6A 2PUJA 1CEQA 2IH4A 2RAPA 4PFKA 1Z0ZA 2OL4A 2GPJA 3IVGA 1NLZA 4FFBA 3TFSA 3N58A 4Z8YA 5J4KA 4TN1A 1ZD3A 5HUJA 4IIGA 1EVZA 3PSFA 4F4WA 1IHYA 2G5GX 3QNWA 4I50F 4YIHA 5JYCA 1E3TA 5ERGB 3OQOA 5E1OA 1VFPA 3PIIA 5KYGA 4OI0A 5GJBA 4XI9A 1YMUA 1PQUA 2ONZA 2XDYA 3AWIA 4K6MA 5T67A 2OYRA 4M54A 3UJNA 4ML3A 2WJGA 1KDYA 1U3DA 3BL8A 1K4KA 3G79A 1SHZA 2O3SA 3TBFA 1MPTA 3EG9A 3OLXA 2JLSA 5F1YA 4MV4A 2PVPA 4IMJB 1LTKA 2HJGA 4LRTB 1Y3HA 4H59A 3F9CA 3BXGA 4US9A 2XD4A 4OO1J 3PX3A 1N8KA 2YBDA 4GFDA 1H66A 1M2WA 3OCVA 3M4ZA 1Q92A 4Y98A 2YC4C 3RABA 4DLTA 4EZEA 1Z2PX 1XMXA 5KL1B 2FH5B <