4UAVA

Crystal structure of cbby (at3g48420) from arabidobsis thaliana
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
TLPSALLFDCDGVLVDTEKDGHRISFNDTFKERDLNVTWDVDLYGELLKIGGGKERMTAYFNKVGWPEKAPKDEAERKEFIAGLHKQKTELFMVLIEKKLLPLRPGVAKLVDQALTNGVKVAVCSTSNEKAVSAIVSCLLGPERAEKIKIFAGDVVPKKKPDPAIYNLAAETLGVDPSKCVVVEDSAIGLAAAKAAGMTCIVTKSGYTADEDFENADAVFDCIGDPPEERFDLAFCGSLLRKQFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
total genus 87
structure length 246
sequence length 246
ec nomenclature ec 3.1.3.-:
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4uavA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4uavA01
5AM3A 1J8DA 5A3RA 2AUTA 3A1EA 3WK6A 3ZX4A 1Q91A 1SU4A 2D2VA 4C4TA 4CE6A 3ZTYA 5ALZA 5JJBA 2RB5A 4DW8A 2FUEA 2CFTA 3W5AA 1QQ6A 1ZD5A 1SWVA 4HGOA 3ESRA 4ZEXA 1RC8A 2NYVA 2QLTA 3HLTA 2P9JA 2YMLA 2P27A 2ZXEA 3WK9A 1RMQA 2PR7A 1RQLA 3N1UA 5AVUA 1AQ6A 1ZRNA 2G08A 2I55A 2HSZA 3BWVA 4ZEWA 5ALOA 2GFHA 2FUCA 2HF7A 2AGVA 2IOFA 4EENA 5AVRA 4C4SA 3AR9A 1QH9A 3AR2A 5AM1A 1RMYA 1RLMA 2VKQA 4BYGA 5ALPA 3QXGA 3QNMA 3MPOA 2IA5A 5AVQA 1Z4MA 1T5SA 2I34A 2HOQA 2C8KA 5AKIA 1TJ4A 5AW4A 5AKGA 4FE3A 3B9BA 3F9RA 3ZTWA 4BX0A 5AI5A 3KOOA 3KBBA 5AKHA 3OTQA 3WGVA 1U2TA 2NO5A 1Q92A 2JAOA 1TJ3A 2GO7A 3FVVA 1Z5GA 2YJ5A 3WKCA 1YDFA 4QJBA 4L6AA 3U7EB 4RETA 4CF3A 3SD7A 4XE5A 5A3QA 4UATA 5AVXA 4BEWA 4OD0A 3KDPA 4EELA 4DCCA 3L8EA 3OPXA 5AI0A 2HDOA 5AI9A 4C4RA 4IG4A 5AW0A 2C8LA 3E84A 3B9RA 2Q5EA 3ZX5A 3OCUA 4BEVA 1L8LA 3J7TA 3KD3A 2YFYA 5IT4A 2JAWA 2JGAA 3UMBA 3IJ5A 4HYTA 5AKLA 4YCNA 4Y2TA 1L7MA 4F72A 4JDPA 4AS3A 2R8EA 1RDFA 3ZVNA 1LVHA 2PKEA 2ZBDA 1RLOA 2X4DA 4UAUA 5ALWA 5AKZA 4UMDA 3W5DA 1WVIA 3ZWDA 3WKBA 4YH1A 5T41A 3ZUPA 2I33A 3QUQA 4UM7A 1QYIA 2BDUA 3PGVA 1WZCA 3VAYA 5ALXA 5E0OA 2ZBGA 1JUDA 5ALNA 5AW7A 1U02A 4GIBA 2MU2A 1ZD2P 4HGRA 3L5KA 2HX1A 5ALTA 4XPZA 1EK1A 1Z4JA 3N5KA 3U7FB 2NO4A 5AW8A 1LTQA 3FGOA 4L6CA 2HF2A 4UMFA 3AR3A 4KX5A 2YJ6A 3EF0A 3B8EA 1Z5UA 4Y2VA 4UAVA 2HHLA 4Y2SA 5AI8A 3ZW7A 4J2TA 1YV9A 4Y2YA 3IRUA 3OCXA 1WPGA 4YCLA 2AMYA 1TA0A 1U7OA 5AKKA 3A1CA 2CFRA 2G09A 2BDEA 1RMTA 1T9ZA 5AVSA 3OCYA 3E58A 4EX6A 4I9GA 4O8CA 4UW9A 4XQ0A 1Z4NA 3ZI4A 2Q4TA 4FFDA 3R4CA 2HI0A 5AKEA 1WR8A 4GXTA 1Z88A 4HAIA 3I6BA 3SKYA 4Y2QA 2RBKA 4J03A 1NNLA 2HO4A 2YN4A 3A3YA 1SWWA 3QGMA 5AM0A 3K1ZA 5AICA 3NAMA 2O9JA 3CNHA 1RLTA 3NIWA 5ALVA 2WF8A 4BX3A 2JARA 4UU0A 4UARA 3WK8A 3L8HA 2WF9A 1Z4PX 4AS2A 2YJ4A 3TLMA 3QU2A 3U26A 2B82A 2YY6A 3SF0A 5AKXA 5A3SA 3ONNA 2FPSA 2EATA 5FP0A 1RRCA 4I9FA 3ZU6A 2RARA 3L8GA 3N07A 3QUTA 3NALA 4BX2A 4BBJA 4EX7A 5AVWA 4NAVA 5ALQA 4NABA 5ALLA 4MUMA 2ZG6A 3U19A 3AR6A 5ALIA 5AIAA 4Y2RA 3L7YA 5AIBA 1FEZA 3OCZA 2FEAA 2W43A 2ZBEA 1YJ5A 1VFPA 3AR8A 3QU5A 1NF2A 2GHQA 1CR6A 1VJ5A 4G63A 4RESA 4YIHA 2C9MA 2FPRA 5ALUA 3SLRA 3SMVA 2OA0A 3NASA 3WGUA 2P69A 1Z4IA 3FPSA 3R09A 3MMZA 2WFAA 1S2OA 1O03A 3IB6A 2B30A 2YMMA 3L0BA 2R8ZA 4UU1A 2FPXA 1L8OA 3E81A 4JB3A 5AKYA 4EZEA 3UM9A 1TJ5A 4IFTA 1ZD3A 4OCZA 4FYPA 1ZD4A 3U7HB 5AK4A 5ALEA 3WKEA 3L8FA 5AM5A 2YMQA 3I1YA 3U13A 4Y2XA 2EARA 2G0AA 2YJ3A 4Y2PA 2WM8A 3QUBA 4BNDB 4AP9A 2YMPA 2B8JA 5AW3A 2W4MA 4OFZA 3U7GA 5IS2A 4NFLA 3WK5A 3FZQA 1CQZA 2ZBFA 1QQ5A 1L7OA 4KNVA 5AESA 3HYCA 5AI4A 2ZOSA 4UM5A 2FI1A 5ALRA 1ZRMA 5AKJA 4KYTA 1RPZA 2OYCA 2IOFK 4UASA 3AR7A 2ODAA 2DQSA 4UMVA 2OBBA 3M1YA 4CF4A 4OHFA 3SKXA 5ALKA 4E88A 3WK4A 5AVZA 4YCMA 5AK5A 3QU9A 3NUQA 3AR4A 5AK6A 2IOHA 3WK7A 2OM6A 2JAUA 4EEKA 5AVTA 2EAUA 2G07A 2P11A 3M9LA 4XOUA 2HCFA 1ZJJA 1ZS9A 3BA6A 2B1QA 3ZVLA 5ALGA 2BY4A 1XPJA 1MH9A 4F71A 4B6JA 2R8XA 2C4NA 5AI6A 4HGPA 1EK2A 1Z4LA 1Z4OA 3D6JA 3QU4A 1L7NA 4MWOA 2C88A 4Y3UA 2I6XA 1NRWA 3W5CA 3NANA 4QQFA 2PQ0A 3OCWA 1Y8AA 1VJRA 1U2SA 3ZVMA 1PW5A 1KYTA 2CFSA 1F5SA 3DDHA 3KZXA 4UMEA 2FPUA 3KC2A 4Y2JA 3FM9A 2CN1A 4HGNA 3UMGA 2WF5A 4DWOA 3A1DA 4HGQA 2B1RA 1QQ7A 2GMWA 2WF7A 2G80A 2RAVA 2IYEA 1RKVA 4KNWA 1N9KA 2G1AA 2B0CA 5AW6A 3L0CA 2R8YA 3L1UA 3NRJA 4NWIA 3EF1A 5ALSA 3QUCA 3UMCA 1S8OA 4CF5A 4YGYA 5AW2A 4BNDA 5AVYA 2I54A 5ALJA 3QLEA 4DFDA 3ET4A 5AW1A 2WF6A 1XP5A 4NV0A 3ZWKA 1TE2A 2YBDA 3EPRA 1U7PA 2I7DA 3N8GA 3GYGA 4L57A 3DV9A 5AHXA 5ALYA 2FDRA 1J97A 3DAOA 2O2XA 3WKDA 4ZEVA 1L7PA 2Q4RA 5ALMA 3PDWA 1XVIA 3MC1A 3PCTA 4PNHA 5AM4A 4Y2UA 3FPBA 1RKQA 2AH5A 3QU7A 3RFUA 5ALFA 4CNQA 5AK3A 2WHEA 3N28A 2HEGA 1YMQA 3S6JA 1YS9A 3ED5A 2G06A 5ALHA 1L6RA 4BKMA 1Z4QA 4G9BA 1RKUA 2MU1A 3I28A 5AW5A 2GHTA 1ZOLA 3L0YA 1X42A 1IWOA 3ESQA 4KN8A 2QYHA 3I76A 5IT0A 3SHQA 3L1VA 3W5BA 2W11A 3R9KA 3PGLA 3P96A 5AW9A 3E8MA 5AVVA 5ALDA 1N8NA 2B8EA 1K1EA 3DNPA 1O08A 3OCVA 3MN1A 2MSNA 3ET5A 3CZ4A 5AM2A 1Z4KA 3QYPA 1T5TA 4KX3A 1YNSA 4H1WA 2FPWA 3EWIA 1RQNA 4YIKA 3WKAA 3QX7A 3AR5A 3RF6A
chains in the Genus database with same CATH superfamily
4V0NA 1J1UA 1UZUA 5J23A 1JKXA 4MRRA 5A4KA 5CB8A 1LBIA 4Z7OB 5KYUA 2R65A 2C3MA 1L5VA 3HYTA 5H59A 5KTSA 3K94A 5LZ8A 3AETA 3SFTA 3QFHA 4NARA 5EQFA 2DL0A 1BJTA 2GD6A 3CEHA 2JH1A 1PLLA 1E9SA 3AI2A 3PYXA 4MB2A 2WAXA 2H5EA 1HUOA 2ZM6B 4O5EA 3I4FA 1WSAA 3VTKA 4F4ZA 8ICYA 1UMCA 2F64A 1FNSA 3NHRA 1E5VA 1NVEA 1VLHA 2C5EA 2DJIA 1NR7A 2ZUUA 4XEHA 3RVLA 5J2DA 1UP6A 5BSFA 2XYQA 5CLGA 4G5RA 1M2FA 1AUOA 1EFAA 3CP8A 4HSGA 3ROTA 1EBBA 3SZUA 3THWB 3DMTC 2GBCA 3NIDB 3K5IA 1JAHA 4LWQA 2M1XA 3GRCA 3IKLA 1NMXA 4N7JA 4ZICA 2HHCA 4C4SA 5BWBA 4TTRA 5L4SA 1O58A 2CRXA 3H5OA 3OKAA 3D2QA 2CJWA 4Q3KA 1RYRA 2W54A 2HRCA 2QTRA 3ABQB 2PT6A 3KSUA 3O38A 4TSRA 1NBMD 1VSVA 3WV5A 1N2EA 3D0KA 3FTQA 3FNBA 4E6PA 3S29A 2XUPA 3MGIA 3SQLA 1FFBA 3M6LA 1KJWA 5CVEA 4V1CI 1A5AB 2QB0B 3CUUA 4G8BA 3HO8A 3JAWB 5AW4A 3AX6A 4D8VA 1IG3A 1PJ4A 7ICEA 2FPIA 4WW0A 3T94A 4MKZA 1ZH0A 4K6FA 1EG2A 2R96A 1Z39A 3R9IA 3W8NA 4E11A 3P71T 1IVNA 2FF7A 3AO0B 4JXJA 1V37A 2Q0HA 1JQEA 1LC3A 2QAJA 4TSKA 5HM8A 2O3QA 4XWOA 1E0AA 2VC2B 1C14A 3JW8A 4Q3NA 4NQRA 1Q92A 1Y4UA 2D1TA 3FBWA 2ZYAA 2C78A 3T35A 2HLDD 2PZEA 1VJCA 4AY2A 1QVZA 2VA2A 1JPNA 2PI5A 3DFFA 4U2CA 4YPFA 4DIMA 4LYGA 5K0EA 4YFVA 2ONYA 2AD1A 1M8KA 1SUEA 2EIHA 3MGCA 2CXNA 3UANA 1XIVA 3BZKA 1BMDA 1QUFA 4CF3A 3M83A 7ICOA 2GN6A 1VKRA 5AVXA 2MR5A 9ICEA 4J16A 3P4XA 3R3UA 3AKZA 3V4SA 2V7QD 2HHVA 4WCVA 4XIGS 4H60A 1N5KA 4IDDA 4N18A 5JLAA 3VR6H 2ROQA 3DLBA 4QGAA 4F0JA 3GNTA 2PHZA 2ZYGA 4LHXA 4ZVQA 4ED7A 4ENRA 4W5RA 3LOQA 1GNQA 2VQ6A 2O6HA 1BNCA 1EB9A 1USGA 2YXLA 3F98A 3L4EA 4DWWA 1CEZA 1L5GB 3A1NA 2EG5A 5IIIA 1VPWA 4PHGA 8GPBA 1NZBA 1RSZA 4YQFA 1WOYA 1XO0A 1AUQA 1EUDA 4TVBA 2I3DA 1G63A 3GFVA 1C7ZA 3SVZA 2DTEA 4P4NA 1NUQA 1PR9A 4YO7A 4G5YA 2DPHA 4JVSB 3AB7A 3ZW9A 1A50B 4LECA 4YCNA 1L7MA 2DQ4A 1GNSA 4JI6B 3VHQA 4AS3A 4RXUA 1K1QA 3ICQB 2R8EA 3LECA 5EC8A 3EGEA 2GJSA 3ORHA 3ZVNA 1A3CA 4YK7A 1LDGA 3NIGB 1RQXA 1Z45A 3L79A 3KUUA 4B3JA 4BE4A 2PG3A 4L0QA 4H6XA 2DFLA 4LRUA 2E18A 2PMZC 5IWAB 4GYKA 4BRUA 1FMCA 4RAQA 1BJRE 2WT4A 5B58C 3EUAA 3L43A 1N2HA 2Y1GA 4F2WA 4R8UA 4UM7A 2UXCB 1P5JA 4KXLA 1WXQA 1VE1A 3LDHA 3MCTA 5ES4B 2CXTA 4BVKA 5LOVF 1USVA 1NKTA 2VAWA 2PMCA 3FB4A 1A0OA 4IL5A 5G41A 3WVNA 3BIOA 1W2GA 4G24A 2QRUA 7MDHA 2WPNA 2BGMA 5B1HA 1T0UA 1O77A 2O2JA 3H2BA 3TRHA 2HX1A 4D8YA 3RTEA 5B30A 1KXJA 1MPXA 2WUEA 1PVQA 4HYQA 1UOOA 4XCXA 2QN6A 5IDVA 3STVA 2GASA 3BMNA 1NLFA 3ZY4A 5IT5A 1H69A 2CJFA 1LX6A 4IV0A 3GUUA 3UGJA 4RZRA 1N1GA 2FLWA 2LDXA 3KXKA 1FYEA 1VMIA 3A11A 1QAOA 1L5ZA 4MUGA 4XRHA 1JRLA 3EAFA 1QGAA 2J41A 1TMOA 4ED3A 1HC7A 4R5MA 3IOEA 1CR1A 3MLEA 4IO1A 5JSQA 5JD6A 2HNKA 1K0UA 3IQEA 1UMKA 4H15A 5D1HA 4B45A 1ZH8A 2Q1WA 3AIMA 2SNIE 5AI8A 4F86A 1U1IA 4Y2YA 1HTBA 3OGUA 2AE1A 2EP8A 2VSOA 4UCFA 4LDZA 1W1WA 1DJMA 3IP5A 2QRQA 4R65A 3LCCA 3VYTB 5GP1A 2J0SA 3WYNA 4NBNA 5DNWA 3CUEF 3WXMA 4Q18A 2VJ4A 3TACB 2JBHA 3SYZA 2WKWA 2OBMA 2IY9A 4PQFA 1Z4NA 2NWQA 1IOLA 1U3WA 3EA0A 2FU5C 3MAJA 4IO0A 2BZFA 2OXEA 3C8DA 4TYPA 2PXHA 1YA6A 4KIGA 5FXMA 1ZJ4A 1X80B 1OYWA 2PGAA 2AL7A 4ZODA 5GVRA 4BKQA 3RVPA 3MPUA 3OY7A 4C8MA 4FNOA 4X1YA 1EVJA 4FTWA 4I1IA 1I24A 3ZQJA 2Y1WA 3EGXB 2XOEA 2V9PA 4EJSC 621PA 1NQUA 2D1RA 5IKEA 2RHJA 1JE0A 3KOUA 1GTG1 4Q9LA 4YLYA 4IHJA 3EPIA 2C2EA 1NP6A 1GO2A 2A35A 4K0RA 4KTTE 5E0KB 3OJUA 3KKAC 3OVMA 2QTCA 5IKOA 1PNQA 5ALVA 3VC7A 5MN4A 1ECWA 1N61A 1C9KA 1VL1A 1JH8A 2LNDA 4IICA 3LPAA 1BU5A 1Y1KE 4PZZA 4CQLA 5JNLA 2J0UB 1A8UA 1XTBA 3FCOA 3L8HA 5ITZA 1M7BA 3ISBA 3GQBB 4XJTA 3IA2A 1UKVY 1E3TA 1M74A 2IL1A 2NPIA 1VXRA 4O63O 3OIGA 3AFMA 3QXCA 5AUQA 5D00A 1MVLA 3RE1A 4HX2A 3ROGA 1E2KA 4LZJA 5I9MA 1Q8KA 2KQUA 5DV9A 1AZLA 1Y1QA 4YR0A 4KN5A 4PS1A 1F14A 1MG0A 1VGQA 3AZQA 3QEKA 4EBBA 1KWKA 5H3HA 5A4IS 4K87A 2BEWB 3RB3A 1LVUA 1OV4A 1QVWA 2IHMA 3SJUA 4C04A 3E3LA 2VJAA 2H5LA 4A6DA 5KAPA 3OAAA 1D8AA 4NZOA 3TS1A 1XU7A 2F3TA 5K0GA 1T2AA 3PXBA 3RJ9A 1TQHA 4CPDA 3AVTA 1XP8A 2QPLA 2IHUA 3EXG1 4MJ7A 4MTCA 5ALIA 4R9SA 4RHUA 3PUXA 2VJYA 3PJFA 2UVRA 3FHCB 2CJPA 3RIYA 3VHRA 3AHDA 1MB4A 2O7QA 4I9HA 2O8VA 2P9BA 4LS3A 4RTJA 3IAS6 5KCZA 4DN6A 4P5EA 1BCSA 4C7OA 4PTZA 3U1BA 2F2TA 4KYVA 2XQIA 5A0FA 3KAQA 4WCFB 1LZKA 2R6ZA 2W48A 2IYFA 3PI7A 5IHXA 1KMHA 2FSVC 4AJHA 1FRNA 2HV8A 2AN4A 5BUQA 1E32A 4WJLA 2E48A 2EZ9A 3ICVA 4HQKA 2RLTA 3QYFA 2OBNA 4U63A 1T34A 1KVTA 3D4LA 2PR2A 2B94A 1J0DA 3CZQA 4BBZA 4TYNA 1HLGA 5EJAA 3CZCA 1UBUS 3U3RA 2ZYWX 5F12A 2R8ZA 4K6GA 3WGJA 2P9GA 2PX5A 1NM5A 3BCUA 4RENA 8ICOA 5F1KA 3A1TA 2XY4A 4BVBA 1M2JA 3IKJA 1ZONA 2VTBA 1D1TA 3SEIA 4CDGA 4QUHA 4B7ZA 5LZ9A 1TADA 3G5TA 1JE1A 2WVJA 3DCYA 3R7DA 2FPIB 5CWRA 2XGJA 1DZIA 1NFQA 1IRXA 3P4UA 4ALIA 4D02A 3RUCA 3E23A 3KK0A 1JLLB 2QB0A 1T8RA 4IIVA 3TTTA 1R4NA 2FP4B 2QMQA 4GAEA 1E6LA 2CNWD 1BVUA 5DYYA 3F73A 1GG2A 4RVHA 4Y2XA 1RWQA 2EARA 4JC8A 1Q74A 4A2PA 2HWWA 3R44A 1KO8A 3QLJA 4WY8A 4DJTA 4F5DA 4KDFA 4EUKA 1E99A 4DBZA 1YHZA 1QSLA 1FSFA 3EVTA 4YJKA 5GONF 4MIOA 4OGKA 1OWMA 3BYZA 2ZCJA 1EWYA 1TVMA 1TZJA 1PTJA 3CSUA 3D8RA 2J9FB 3H6GA 4I55A 4BRSA 5LQCA 3KHRA 1JEYA 1HE3A 2PPVA 2VJMB 4TKUA 3I2HA 2JIQA 2J3DA 1BEZA 1ZR4A 4D0SA 2A6PA 2ZUBA 4LMAA 5AKJA 3N6XA 4MHOA 3O4IA 1EJ2A 3G02A 1Q6YA 2GCIA 4A2CA 1SQFA 3S3TA 4HG2A 4Z1MD 4I2BA 3STUA 4Z7JA 3LLSA 2AXNA 2PI4A 1O6BA 1SURA 2OY0A 3MIZA 3OHBA 1Q0ZA 2LPEA 1OHHA 1RIIA 1X87A 3K9NA 4L27A 5C81A 3EDMA 4MKHA 4MVJG 3PUZA 3BXEA 5EP2A 1Z6YA 1SNYA 3COPA 4CFYA 4KQ1A 2AN5A 3QELA 4MW9A 4FFWA 1PX0A 4S3MA 2NN3C 1C1DA 4RQ0A 3TMKA 4GMDA 1U1FA 2P11A 1D4FA 4NL9C 4P4OA 1ZOPA 3IAM1 1F2TB 4UEKA 3VC3A 1EINA 2AJTA 3LMKA 4AZ0B 4RF5A 4DQVA 4KMOA 5FFNA 5CVUA 3RU7A 4C29A 4M9GA 1US8A 2PMEA 3U44A 5BXYA 3GL9A 3GW8A 3Q6NA 1BMTA 2JKZA 3HSSA 2EQBA 4C7BA 3LHFA 3ODPA 1YCGA 5TIIA 3L18A 3TECE 1IBLB 2XI9A 4QDKA 2JH3A 2DBQA 2E5FA 2NRZA 2I6GA 5IUNC 3WGHA 1ENPA 2D4AA 1T3LA 5TJHA 1GO3F 5HR7A 2VHUA 4D56A 1GR1A 5GTHU 3NANA 2JFQA 3RSOA 1VL5A 3I3SR 2BQ3A 3HNOA 5KFGA 4LDPA 1VJRA 4PHCA 4TRNA 2XRMA 3ZVMA 1RXUA 2IZ5A 3B1YA 3OJ0A 1NMEA 3V8MA 1T0BA 3EHDA 3UBTA 1SBTA 2WB4A 3MHPA 3U7RA 2ODBA 3UCEA 4ARSA 5HKKA 2QJOA 1UDBA 3F6SA 3JSXA 3OPVA 4KLCA 5K05A 1T6YA 5GTIU 3FWNA 3ZY5A 1OFUX 3T3NA 1RXCA 4TKVA 2EZTA 1A8IA 1ZIXA 4DWOA 1YAHA 2YUTA 1T1IA 2G83A 3LXXA 1ONPA 4MRAA 1Q7CA 3ZD7A 1DWQA 2I9KA 2RGEA 1BROA 1U7HA 1XN4A 2EOAA 3H1TA 4GLLA 4YASA 4YJ3A 1L3IA 1RKVA 4PXSA 7ADHA 4ZFNA 4LCBA 4I2EA 2J6IA 5BORA 3ANMA 2R18A 2V74B 1R0KA 3F7TA 4WNYA 3IO3A 5F23A 1JEQB 3M8SA 5J8YA 3TRIA 2A9VA 2GLTA 4XASA 1TU0A 1JJ7A 3A4IA 5ESRA 3E7XA 1T4CA 3FWPA 3WBJA 4EF6A 1GGMA 1SQ0A 1UWVA 2MSWA 4P34A 3H5VA 5FD8A 2DUWA 3FF4A 1PT5A 1YZ3A 2QR3A 2AFIB 3S81A 4DUYB 4QBKA 4JD5A 3NYWA 4CV2A 5JALA 3ER9A 4AKHA 4YGXB 1RPTA 3TZCA 4E2WA 1QUEA 2QWXA 4B84A 4B3SB 4QT0A 5CB4A 4P2HA 1KQOA 2YV1A 3AZPA 3NC4A 3SM3A 1QG4A 4EH1A 5KTTA 4KHPB 2BCGY 3Q8QB 3KYCA 3L77A 4IG9A 5DGXA 5K1ZA 3ZNNA 5GADl 4P4SB 2OCPA 5KUTA 1U2EA 2W7PA 1NJ5A 3JARB 1SCBA 2WG1A 3LE8A 2HAEA 2ZT6A 3E9EA 2ST1A 2C92A 2XDWA 4Q8EA 2WD9A 5CVVA 5J40A 4BCCA 1I8TA 4L5YA 4KLEA 3RJHA 1TCVA 2M2IA 1NMYA 2PBLA 2ZYRA 2IY7A 2ABWA 3RVMA 3S55A 5IUJC 1R10A 2BVNA 5KNBA 3PD7A 1JDBC 1UJNA 3QU7A 1GZ4A 1KBZA 3W8DA 5EP4A 4C6TA 3O47A 4G0WA 2FPGB 1C30A 2QTAA 1COWA 4XJVA 2BDTA 1FFSA 1OE0A 1X1QA 3N6RA 3UG7A 4E03A 5D5PA 2EBFX 1YMQA 4OV6B 4EYSA 1J7JA 3EBPA 2JR5A 4L4ZA 3G23A 3ECAA 5EVJA 5J4KA 4FJ0A 4XDYA 3NNDA 1T36B 4NYIR 1JAIA 2J7PD 3CCCA 4Z0PA 1CBUA 3TZLA 5LDHA 5CFZA 3E5RA 3ESQA 1T0HB 2C9BA 2FUNB 2XF2A 1P1BA 2O3UA 4RZ3A 2OAP1 1QOPB 1PU2A 1B00A 1AUPA 3BD7A 1CIVA 4FT4A 4PZCA 4RABA 3RIMA 3VYWA 3S5UA 4O4HB 2PD3A 1IWPB 2CHGA 3GEMA 1EVIA 1C8VB 16PKA 2PXCA 2VAPA 3OE5A 1FMJA 5HIKA 3BJYA 2VRNA 1JR3A 3CMCO 4M2LA 1XTJA 4IQ4A 4PH5A 1A2BA 1TK2A 4L0DA 5DWVA 4MAAA 3GJTA 5IVIA 3IQDB 4BUCA 1O2DA 2IEIA 1JHPA 1RS0A 9ICCA 4YACA 2EF0A 2V7GA 2VRBA 3KQVA 1OZFA 5AM2A 1ZITA 3N4MB 4UM9B 2D1SA 4DZZA 4E5DA 5BSWA 4QU8A 4XH9B 4EHIA 1UFRA 1QG0A 4PSUA 1ODIA 4AMYA 1I1HA 3BVPA 4JV5B 1E1CA 3GT4A 4RPKA 4BVGA 2VDOB 5LQJA 1TDJA 1EVYA 4XVQA 3U62A 3CVOA 4E1BA 1A6SA 5D5HA 1AKWA 3PUWA 1U9YA 1ZD1A 5ED0A 1GFWA 3EG9A 4TUPA 4LAFA 4ZRNA 3HUTA 4G09A 2Y99A 3KKEA 4OQZA 4HAWA 3KEGA 3IURA 4KJXA 4QSMA 1M6HA 3I8SA 4JKIA 1JMSA 3A0HU 4GVPA 3ORFA 4I4CA 4WECA 5FPSA 3WJAA 1ECLA 5LWQA 5KL1B 3WK6A 1FVOA 2RH4A 2D2VA 1MR3F 1LD3A 2F4NA 4IV8A 2A0FA 2BEKA 2FPPB 2FVYA 5FFFA 3ZTYA 4KQIA 3GRFA 3ETRA 1MUUA 2AUNA 1DS6A 3R3SA 4EF4A 4DW8A 1QX3A 1G0NA 1UJ6A 3AI7A 4UVDA 5AMXA 1G3MA 3MCWA 2LBOA 1GITA 4OY3A 2P66A 5IJAA 3I2YX 2IX9A 2W00A 3K8QA 4AJ2A 2Y66A 3B5EA 3UF0A 3GCXA 3DZKA 2WM9B 2IXGA 2PUCA 1KLNA 1Z3CA 2BFCA 2YMLA 2RBEA 2HA4A 3CWCA 4ECXA 3REFA 2BHNA 2A1JB 2QGFA 1XTQA 3LO8A 3N7SC 3EAGA 4PCLA 3ZD8A 5DYTA 1RRMA 4LRWA 2BHRA 1Y5NA 1IU9A 5HM6A 2YCBA 2HSZA 3PFKA 1U9IC 1O94C 4ETWA 4GZ5A 5M04A 4J9PA 5JW6A 2AYXA 3RM3A 3PW5A 3N58A 4Q0MA 4ECYA 3F90A 2C97A 4LC9A 4P3YA 1JDZA 5BYAA 1QJCA 2EFJA 3BZBA 2AGQA 4FK8A 4BGEA 4G0UA 4OFBA 4ZYLA 4ZVNA 3FKSD 5BOLA 1RD4A 3ORQA 3CNLA 5KTNA 4PZAA 1OUMA 3JQBC 3E3NA 4ZCTA 3SEAA 3IYLW 4ZI7A 3CNQS 5DGTA 1NTRA 1QVAA 4RMJA 4WZ6A 4LE0A 1QP8A 5AVQA 1IM5A 1BCRA 2QVGA 4JBNA 4DA8A 2HHHB 4COOA 2BFNA 1BVYF 3U61B 4LYAA 4DZRA 3GCDA 2O3SA 2VYCA 1XCPA 3RYCB 3OZXA 3F9RA 3IE1A 3NHYA 3V6HA 5AI5A 3I1IA 1ZA2A 3BGDA 2XF8A 4K46A 2VJKA 5LMUB 4D3ZA 4JJGA 4BX9A 2OSVA 4JCCA 2E21A 1A88A 1Y5LA 4YI3A 3IESA 5C1OA 2OQRA 3BJZA 4QQ8A 2ZYVX 5FR2A 5F73A 2UVDA 4X71A 3I12A 5FPPA 3IBCA 1F1JA 1PJBA 4FOLA 1CE8B 3I58A 3PUHA 3RKRA 4RULA 3SX2A 4R8LA 2YJ5A 3FUXA 5H83A 4BFLA 2GNPA 1YDFA 5CDUA 4MW2A 2GZ2A 4BB6A 1CQPA 2H1LA 2NTEA 1UODA 3KHLA 4Q03A 1CUZA 1JDTA 1H8HD 1KH2A 3PNVA 3ASUA 4GP9A 3ZDRA 3DONA 1QQTA 1RADA 4RETA 1KDYA 5KFHA 1ZQBA 1YIOA 5HBRA 3THRA 5KPJA 2QSUA 3SQMA 4BEWA 3LRTA 3SAGA 3G9XA 3DZ8A 5BUZA 4BP8A 5HGJA 4EECA 3DVAB 4WKCA 1DPFA 5LFAA 1HQKA 2FG7C 3D6AA 4D2IA 3BSWA 2KHZA 3BZCA 1UZLA 3GEEA 3UPDA 3UV6A 4HQ6A 1KU0A 1ZGZA 2ACKA 1FFDA 2FZ5A 3B9RA 2QRVB 3GOHA 4FILA 4TM7A 2FSGA 2JLVA 2E6UX 4NEHB 1EVKA 4BU1A 1JNYA 1QDLB 3GNSA 3I1JA 4ZT6A 4F6RB 1SJ9A 3WC4A 2R8KA 3BQ0A 3IDSA 3PQ6A 1T0PA 5JASA 3DDUA 1PI3A 1M34E 3OLYA 1VE9A 4Z9BA 1DB3A 1G4AE 4Z3DA 4YN3A 1HDZA 2WSLA 2P6NA 3O4FA 3EA5A 1WHTB 1BD4A 4G0PA 1Y1LA 4CMIA 4IS3A 4PLWA 2NVUB 2VNJA 1QHXA 4EKIA 4FN5A 1EUCB 4M0KA 3GJ0A 2IBKA 3V4PB 5A4FS 1JU4A 4ECUA 1SEVA 2YBEA 4HNAB 4RV4A 3D81A 1BG6A 4RNDB 3IAAA 2QN2A 1XTSA 4X1IA 1YMUA 1QV6A 3WKBA 2CBGA 2A3NA 5T4FA 4WKGA 4ZMRA 3GH1A 5LUAA 3TQIA 3PIRA 2R9VA 2HBQA 4PANA 2GYUA 3MJTA 5E9AA 3FJOA 4TPKA 5E4JA 3T06B 3AF3A 3PGVA 1LBSA 1QIJA 3HNPA 1BFDA 5A5GA 3BCHA 1Q17A 2VYND 1XYYA 3BWMA 1BE6A 1HT3A 2ENWA 2R60A 3GLHB 3OX3A 4GRAA 1NJGA 1QLJA 5B2FA 5CFMA 3SP1A 4MDEA 4OYLA 4X1OA 4QZVA 2GX6A 4NIMA 1GADO 2GJAA 1KI6B 1U90A 2OCAA 4FCTA 2V7PA 3AUJB 4EW6A 2GPTA 1TW3A 2DHEA 2QTHA 1L4BA 4KE9A 4O4JF 3HTXA 5L8VA 4Z7QB 4DPLA 2EZUA 3OEYA 1V95A 1D03A 1DBRA 4RZHA 3T1OA 4E7PA 2P4SA 1KZGB 4MITA 4RQ8A 1FU8A 1QSSA 2X9GA 3PF9A 4WXHA 2YZKA 5BUCA 1WUYA 1Y8QB 4Q39A 3UC5A 4G8CA 3B8EA 4MUJA 3Q1KA 4GOLD 2VNHA 1F9EA 2HA0A 2FX2A 4FXOA 4TXNA 1U2RA 4YX9A 5KFYA 2C57A 4Z54A 3KJHA 3O93A 1U9CA 4FZMA 9ICMA 1KDOA 3V4OA 5C37A 4KQCA 1AQLA 1EXWA 2QZZA 1Q44A 5L1JA 1LPMA 2C5GA 2FMKA 2QX7A 2ZP1A 1LDEA 3G85A 4NCKA 1DKRA 5BN5A 3PEWA 5FBQB 1DAEA 3DOFA 3WR5A 4D9MA 2K60A 4JT8A 4Y1RA 2X7HA 1KBOA 1UOPA 3KRTA 1CCWA 2G88A 2QUKA 2R86A 2WP8J 1P2VA 3NBQA 4LGVA 5IC5A 4XQ0A 3A2NA 5DB9A 2BQUA 3R8XA 3TEJA 3HFRA 4UKDA 1ZJMA 1BYIA 4GQIA 1I51A 2IYAA 3HN7A 4GR5A 2ZIUA 5IULC 2HI0A 1KYXA 1OR8A 3AF5A 5EWMA 4UUPA 1V16A 4BC1A 2CLDX 3FRIA 3O7MA 2HZ7A 4J0DA 1P72A 3RSFA 4M86A 4AYXA 4QXOA 2QTNA 5C7YA 3SKYA 2TMDA 1Y0BA 1D07A 4CLEA 2Z5VA 1XRJA 3BIJA 3N7AA 4Q5IA 3WWEA 5LIPA 4W5TA 3OKFA 2IBMA 1CEXA 2MINB 2CVHA 5D51S 2PRIA 1AZWA 4C4AA 5TGDA 1EXVA 4QXMA 3OJCA 2OHVA 4PX3A 3PNPA 3H42B 1QFMA 1SMKA 4CM4A 1PL6A 2VHWA 4OJKA 3S0JA 4GM1A 4MS3B 1NE2A 1CETA 4HDSA 4RVFA 4Z4IA 1IY1A 1XLVA 4QRIA 4LXGA 4RHYA 2QI9C 1N2JA 4GD3Q 3SN6A 3TLMA 1IEXA 4Z99A 1L7XA 2QB1A 2IZ6A 5G1OA 2J1LA 3CYFA 2RGNA 3H84A 3URKA 5FPTA 1CPYA 1V4NA 3ZGNA 4DCSA 3IV6A 4LRTB 1N2CE 3I23A 2ID4A 1BKSB 1ESNA 3Q3CA 4PLHA 3STXA 4EY6A 721PA 2HW3A 4DQSA 3SV4A 1EFPB 1Z0KA 3FX2A 5DHTA 2DBYA 3N97B 1ND6A 3L8GA 1SN7A 2WPDD 1Q6ZA 1M72A 3NDPA 1BW9B 2VP4A 4UB1A 1BDJA 2D6FC 1GFIA 1H5UA 2GD2A 3EUEA 4GI5A 4DCTA 5CDSA 4NAVA 1N6IA 1B6RA 1JFFA 2PT5A 1UPUA 3TSAA 1J5XA 3G2JA 2PQ2A 3KVNA 4DXAA 3L1KA 4MKGA 5C8ZA 3L4JA 1T8TA 5GZ3A 3C1YA 3V00A 4FI3F 4Y2RA 3MJVA 4OG2A 4RMGA 3EEQA 1X8KA 1UMCB 1K9VF 5IPFA 4XD7D 5E79U 3R76A 2RIPA 4CNBA 2R8IA 2COKA 4DMFA 1T5HX 4AS1A 4DG9A 2WWGA 3QU5A 1YRYE 4KQEA 5KNDH 2P4HX 4JUBA 1ZXLA 4KBFA 4GHWA 1XTPA 3CO5A 3AG5A 4F8YA 4KIWA 5LP6A 1P2GA 3C4VA 1R37A 4CL8A 4AO8A 3J80A 5JYBA 2FNAA 4RQ1A 2ZSBA 3OMWA 5F4ZA 2GPNA 3NIFB 5AHKA 3I64A 2WFAA 3RRHA 4RIIA 1S2OA 1V8PA 1RXYA 1LJLA 4B9UA 2OFWA 2V8BA 2W6PA 1UC5B 3BIWA 3HB4X 3SK0A 5JD3A 3TSYA 4FUQA 4PGAA 3OPQA 3VR0A 2YOFA 3HWTA 1JB1A 3SBXA 1E61A 1DGJA 5DE3A 1JQDA 1CNMA 4EFMA 4FYPA 1ZD4A 2VDWA 1TEVA 2W2VA 3G88A 4UDXX 1RCFA 1TB4A 3TCXB 5EFZA 5K6AC 3WKEA 1DXOA 5KFRA 4HFMA 3T3IA 5FDFA 3WB2A 1CR2A 3VAZA 1NC1A 3W6PA 3QBDA 3PHBE 3UJ8A 3MGHA 2VCEA 3WLEA 1TYEB 5EHXA 2CMGA 4R9RA 3A3PA 4IIFA 4QYMA 1O0BA 4E51A 3QUBA 2OVBA 2B8TA 3R5XA 4H0NA 1LDNA 1Y9DA 4YUXA 5DI3B 5AW3A 1ORTA 3D6FA 4GZLA 4M0MA 3WL6A 4RORA 1CW2B 3TB4A 1UDCA 3GLFB 2WHQA 2IEZA 2Z9DA 4JNCA 2GYWA 2V45A 4JYMA 1ZHOA 4OA5A 2AJCA 4GKJB 4C7ZA 4D4IA 1SHJA 4RTMA 5AI4A 2ZOSA 3EGDB 2EH9A 2PCLA 3BWBA 4JX9A 5CJPA 3S1AA 3TW8B 3G2NA 3ZNPA 1G7SA 1YGYA 2A0KA 2H7YA 4JYBA 4ODIA 2OYCA 1H2WA 5ER9A 1Z82A 3ROKA 1LS6A 1XD9A 3CC8A 3BS4A 1P7WA 4MNTA 4ROSA 5D84A 1ZK3A 4RUAA 2ZIEA 4LYDA 1L7DA 2LW7A 3M1YA 2NZYA 5H82A 4B5KA 2JGKA 3Q3VA 1ZQAA 4YAFA 3Q9LA 2Z5GA 2KS6A 3H2GA 4LJ7A 5HNKA 4GYJA 1DAHA 1FYDA 1HDOA 1IUKA 2Z08A 1J8YF 2P0YA 3JASB 2A0YA 3KFLA 4F9EA 1AE1A 3A2MA 4EMSA 2ZR0A 4JJKA 4OHBA 4LJSA 3VNAA 1L0BA 3FKJA 3HMQA 2ODNA 4RM3A 4LSGA 3G2LA 1MZPA 2HQOA 5L6MB 4AKIA 3E2EA 2R66A 2VTVA 4O3PA 3MCZA 4XOUA 2E8NA 4MQBA 3ENQA 3UATA 1I6KA 3K1TA 1ZJNA 3PGA1 4HTFA 4RS4A 5IN5A 3OHMA 4N0PA 4PX9A 3LY7A 1P4RA 4TRJA 4ASUA 1M7GA 1T9DA 4MS4B 5EZYA 1WQ3A 5DKFA 3T38A 3JQ6A 2VN8A 2PFNA 5DOZA 3GMDA 2VSFA 2P5YA 1SG0A 4CV0A 3EIWA 1ZICA 1DRKA 1DOHA 3AFOA 5IN4A 1O1YA 2NUPA 4M9UA 1J5EB 1ZI6A 4IXMA 1QP0A 3A1SA 1G5TA 2X8AA 1P74A 3AGPA 4GOKA 5FOTA 5K3EA 2E6KA 1OXXK 2D4HA 3RV4A 3H83A 2IF0A 5TPWA 1W581 4C22A 1NAIA 3BICA 1MX3A 1AKRA 3JQAD 1A95A 4G36A 1T4MA 3NTUA 5BN3B 5M29A 3V1LA 2BFFA 2KMDA 2R8PA 2JBWA 3GAAA 1V7PC 1N3LA 4G5HA 4IDBA 3ZDZB 4WKBA 3E35A 4XX0B 4P7BA 1UZNA 5IVKA 4NCAA 1VYUA 1ZK2A 1ISFA 2HUPA 3G3EA 3AM3A 2BZ1A 4KACA 3CLHA 1VGRA 1W7AA 2FZWA 1MHTA 3AN1A 3G0IA 4NDNE 4XLTA 1X74A 5CITA 5JBIA 2FMQA 3P9RA 4UCXA 1GPYA 2X3UA 4G8DA 4ZCMA 1JEJA 3T5BA 3Q6IA 1MIOA 3PVZA 3QUCA 3EXEB 1HKUA 1QAQA 1F2UB 1ZUWA 2XTZA 3KDAA 1JSCA 4I4TA 2HCTA 2VQFB 3EZLA 1TD9A 1WJGA 2R2AA 1RLJA 4DWVA 3G89A 5JAZA 1G8JA 4YP0A 4C07A 2RJOA 3ET4A 5I9SA 3HKDB 2JVKA 1NFRA 1XP5A 4EHDA 3ANTA 3HDGA 3LYUA 1KFKB 3PMNA 4PC2A 4YRIA 3GYGA 3UA4A 2WIBA 4NNJA 3PFHA 2J8ZA 3LFTA 2YTZA 3M9OB 5LP6C 1GL9B 3QG1A 2JDID 1ISJA 2A94A 2H18A 3A4YA 3DAOA 3H0KA 4NOKA 2X0IA 1N6LA 3DH0A 5I7OA 5T3YA 1M2HA 4BATA 4M1ZA 3T7CA 2D8MA 4D99A 1HQCA 4KKXB 3EDYA 4BMCA 3K8OE 2VF7A 2NG1A 1PW7A 4DEVA 2EWVA 3QLVA 4LZNA 3A04A 2FWIA 1I80A 4RAOA 1G2IA 2VZ8A 4IF6A 1AN9A 1N2IA 2WWXA 3D8SA 5JS2A 3C3CA 2J9GA 3RQSA 4C87A 2IYNA 5FNVB 1U0BB 3IOCA 3PR1A 4CIAA 1GM5A 1DAFA 4LJ8A 5IVPA 1L8XA 2O2YA 1R0YA 1Z4QA 3GD7A 3NTLA 1J7KA 1QF9A 1ULZA 4RPJA 4WESB 2XKJE 2FN3A 3N2NA 5H3CA 3RJMA 4D3YA 3OQNA 3KQUA 3THYB 2PZKA 1TMKA 4D1YA 2Y0CA 4AJPA 4MJXA 5T6BA 1QPGA 5BPFA 2UZ3A 4CMBA 3L1VA 4DSJA 3AJ9A 1MTOA 4PZEA 3RHTA 3ZIAD 5IU6A 2W11A 3C28A 1FJ2A 5B3LA 1EU1A 5BW8A 3G2QA 1UJ2A 3LA8A 3ODGA 3SU8A 4FGJA 3KYDA 2O0KA 1G20E 4FW9A 4QVGA 5CH3A 4DNPA 1F48A 3TZKA 1B8PA 5D87A 1XCGB 4A23A 3L06A 4IX9A 1E60A 4N6GA 2VQDA 3T3HA 5DHRA 4YVZA 5F64A 3UMYA 3AEVA 1CJSA 1SBNE 3W4JA 1E79D 1U3FA 5L7TA 1W5FA 7ICIA 1KMQA 4E0DA 2GZ1A 2WSMA 2OHFA 1WCXA 4EGJA 3R5TA 4TSFD 1NW7A 1TUIA 4LV8B 3HBFA 4AQ7A 4DAOA 2AG6A 2DUNA 2BTQB 2V7UA 4LZGA 1E4EB 3MJSA 2VYFA 5CT6A 3MXOA 4BQNA 4CUJA 1PK9A 5A6SB 3OH8A 3DLIA 1ST3A 4KLNA 1ZI8A 3KUKA 3JPSA 1E3IA 4LXQA 3WNQA 5COAA 4BRWA 1CJMA 2OBYA 3GG9A 1IAVA 3PE3A 5A1JA 2Y1FA 2VJCA 5DSTA 3CT4A 4P35A 2FLPA 2IJGX 2ODPA 1LPPA 5BNIA 4JLJA 1W2HA 4BCDA 3WZ2A 3TADA 4EGFA 5EWJA 2QNBA 4O0IA 3KEQA 2D7DA 1JLSA 1Z7GA 1ZJZA 2W4IA 2AGOA 1E64A 2REBA 4Q3CA 5FA6A 5U9CA 3A7DA 3PNCA 3DEZA 1TECE 2IXAA 3ESRA 3VZBA 5KAMA 3BTOA 5KJEA 2AT1A 3VPGA 1G9XA 3ENKA 5HZKA 2O8FA 2CCGA 1NDQA 3F6CA 4MVJM 4CM9A 4X6LA 3UNXA 4F60A 4I29A 1PL0A 4RHXA 2FQXA 5DMHA 1JG3A 2HA2A 4MROA 3NKLA 2HT1A 1BXGA 2Q21A 5DHSA 1YOVB 5KDLA 4PYRA 3GQVA 4JZYA 4M3NA 1WU8A 2AXEA 4RK0A 3IDWA 1JHOA 3SDBA 4WBNF 2K4PA 1SKYB 2FMXA 3PSAA 1JFLA 5D1NA 3RJGA 4BNHA 1OAOA 5IJ9B 5AM1A 1C8KA 1RMYA 5L45A 2FMIA 1RLMA 5KFMA 2QRGA 1BTOA 2LPMA 3VNRA 4BYGA 4IJVA 1JMKC 4NH0A 3VNBA 3O8BA 4KPFC 3UA3A 4GLXA 3DSRA 2I34A 3PC8C 2A1AA 3AU9A 3D2NA 3WIDA 1KL9A 3DE0X 3D8UA 4RJKA 4B43A 1KN5A 1MKYA 1EDEA 2HA7A 1J22A 1YJ8A 2M6RA 3PX3A 1UM9A 2AW5A 3KAKA 3H9CA 2VIXA 5JQWA 1KGSA 3ZE1B 2FG5A 3AESB 4U6QA 4YBRA 4COKA 3AKYA 1TK8A 3PDUA 1USIA 1NK4A 1A5SB 4L3OA 1SG6A 4A27A 2BKEA 1D1QA 1T8WA 2F59A 2ZREA 4EDHA 1TK0A 1N36B 4GXNA 2IH4A 4FQ7A 1M8PA 3RB6A 3HSKA 5LJLA 4AF8A 1X70A 2PUHA 4RLFA 2NO7A 1M1NB 4G4GA 4W9MC 2GRAA 4QQRA 4D4KA 1WMEA 4DARA 1AKNA 4DLAA 2JGDA 4YVFA 4L6AA 3IOBA 4LQDA 3CR7A 4IVQA 4X92A 1G1AA 3E3OA 1UF9A 2VBIA 3NNSA 4U00A 2HJGA 4B3GA 1DKUA 2HCRA 2R7MA 1UPBA 2XTJA 3G7SA 4ZQBA 1SL1A 3VR6D 2XY7A 3SXUB 3AHEA 1RZVA 5DI9A 8ICCA 3EIEA 4OU5A 5H5JA 3ROQA 1W93A 2F17A 4YMWA 1XHFA 4FFBA 1SA0A 3WSVA 4YV2A 4S2UA 4NPAA 3ZN2A 3JPPA 3AWDA 3R7LA 3UJ3X 1WE2A 3ZX5A 3OCUA 1E9AA 3NCTA 4BEVA 4L0CA 3JWJA 5KDDA 2Q9BA 2W93A 3I9FA 3W2GA 4OP1A 1AGXA 2O4UX 2LKCA 2Q1TA 5JTIA 4LF9B 3HCAA 2ZVPX 4C0JA 3FAHA 1XSNA 1YQQA 2ZS7A 4JSYA 3AKDA 4HYTA 3CLRD 1K5OA 2E1EA 1T8EA 4M4SA 4JDPA 5DVZA 3WLPA 2AOTA 5JNTA 1NNEA 2IS6A 3G6WA 2ZUEA 4N7MA 2ZRJA 2DERA 3OF2A 3V80A 1S76D 1FDRA 4GMHA 4ZO9A 2QD5A 8ICMA 2OHXA 2RAUA 4F11A 2H2DA 4YJFB 1YBFA 3QKUA 3UWOA 4BWGA 1RJWA 3K75D 1LPAB 4OXYA 3L5OA 4NCNA 3ZLUA 2Z6QA 3INYA 2HRRA 4RPXA 4Z7NB 2AV6A 1IG0A 3HPRA 3I6QA 2H48A 2OCBA 2O2DA 1GFSA 2VJPA 1UP7A 3OOHA 5KFCA 4ZVSA 5J2UF 3HI6A 2UZ1B 1GQOA 1L4NA 1P39A 1G17A 4YDSA 1Q2XA 3A3KA 4BE7B 1QQBA 1YCDA 1TKRA 1Z33A 3D3JA 4R31A 2DGZA 1ZCAA 1AV7A 1V8BA 1LKYB 1XPRA 3I9V1 3MT8A 2O2CA 1F0PA 3I9OA 1ZGCA 1VL8A 3HKZF 2AVDA 2OG2A 4UZEA 3DE6X 2CLEB 2FZGA 3FLBA 4UU8A 3ZGYA 1XGKA 1RI5A 2GTIA 2H4HA 2X5JO 3OUTA 5IJ0A 3DYIA 5T4HA 3RYFA 2JLYA 2P6OA 4F4HA 5H2FU 5L3SB 1C3EA 1NP7A 3ETJA 1Y6FA 8ICKA 1N6RA 2OR3A 3PE6A 4S24A 3SF8B 2X3FA 4MDHA 3RSGA 2PFKA 2LI6A 3FVWA 5CDTA 2XT9A 4HDMB 5BV2P 3ED1A 4V2UA 3RR7A 4BMNA 1N3BA 1TIKA 2CXQA 3B48A 1MRNA 2PZMA 3HBMA 3RRZA 3VR4H 4A2WA 2X40A 3BQ1A 4GLJA 5JYDA 1W59A 2O7SA 5HK9A 1TA0A 2E8MA 1U7OA 3NDRA 4AJOA 3TPCA 3E9QA 3MZ0A 2JJ1A 4IWXA 2H3EA 5HE8A 4N4AA 4JC0A 3K70C 221PA 3D7RA 1YZFA 5LUBA 2NLOA 1VBKA 2C4UA 2K2QB 4O8CA 4PW0A 3S70A 4DA7A 5B4TA 5F4BA 3GLUA 3RWMB 4C0WA 1QHYA 1GWNA 1GUYA 3O8LA 2Q4TA 421PA 1T5LA 2R3SA 4Y9SA 1XQ6A 5TY0A 1IUPA 3T61A 1KDTA 3C3JA 1OI3A 1L4MA 2Y1XA 3TTWA 4P4PA 1ENOA 1T13A 2B3DA 2EJWA 4N49A 4GXTA 3ZWWA 2Q0SA 1D9XA 1R2QA 2NXEA 1ESZA 1CUBA 1HYGA 2QW0X 4GX5A 3RJZA 5CCDA 1B7GO 3JPNA 4GPTA 3MD0A 4S12A 1U7UA 3OQJA 1O95A 4EYIB 2XGMA 3CONA 3QI2A 1Z3EB 1U0TA 4IH9A 4YCDA 5IG2A 4ZYXA 4BV9A 2ZIUB 2OL4A 1G6OA 3V6LA 1UDWA 3NIWA 4I99A 4ZQHA 3D8NA 1R18A 2H2HA 4BCBA 4EG7A 3H0RB 1XZBA 3GELA 1YDGA 2QNIA 1NRXA 4MA4A 1SKUA 3BQMB 4NYMQ 3N7UA 4DCGA 2HHTA 2YL2A 1Z4PX 1UBLS 2JFNA 4EHJA 3PDHA 4S04A 2YXEA 1I4LD 4AKSA 5DSXA 4KGZA 4NAHA 4CTMA 3H4TA 3ZHOA 3CX3A 1SCAA 1YZQA 1RYMA 5EHQA 3JZMA 3MWEB 1UBOS 1FS5A 2Z4SA 1QU2A 3GPLA 2AOTB 2FLLA 2Z1NA 1I3CA 2OV6A 4JV2A 3FCUB 3WLIA 2EL7A 4M1MA 2CXYA 4EX7A 4Z6DA 5DKWA 1WXWA 2PH7A 3DJFA 1X14A 3FBGA 4JJZA 2IT1A 2VJDA 1UBCA 5JNSA 4RA6A 3C98A 3W2TA 2IEGA 2FTKE 2ZG6A 1T3SA 3UK0A 4ED2A 3VR2A 4RADA 2ALJA 3VJRA 1G3IA 2O3JA 3P5SA 3HKDA 2GDZA 2HSWA 2RGDA 3D5EA 3HZOA 4JS0A 4EW2A 5K6RA 3NHZA 4RZQA 2YIDA 5L51A 4N0DA 1R16A 3DQPA 1C3OB 3FMOB 3HY3A 5MN6A 5IAEA 2PWAA 3K32A 3NIBA 1L3BA 2Z09A 5EUMA 1U5BA 4RCYA 1TZCA 4LYJA 4QU9A 3JWEA 3Q8SB 2P8SA 2WHPA 2VSXA 3ADPA 3Q41A 3LPNA 4FP9A 1QIEA 3I72A 5HMMA 5J5CA 2NVBA 1W0JA 5H0IA 1FPMA 4TLCA 3SLRA 2AU0A 1J2UA 2BUBA 1PR3A 3I9KA 2OA0A 3WLQA 4XM0A 1P9RA 4K05A 3X0DA 1H6DA 2HTFA 3GDFA 4XX0A 2Q5LA 1IK6A 2CZGA 4HR7A 4QBTA 4BZQA 5J58A 4J0QA 1CB7A 2QLLA 4EZEA 2JD0A 1JQJC 4UB3A 3U7IA 2PKCA 2CNOA 3MGVA 3N2GB 5DCYA 1JXEA 3K0EA 3L0DA 2WQ6A 1DG3A 3QXSA 4HH4A 3IIEA 2CDAA 3U6KA 2ZRPA 3JQEA 4O3NA 1E18A 2H9AA 3PHIA 2ET6A 1RU3A 2VPPA 2ZWMA 1NN3A 1B4FA 3A6HA 2FMSA 2BTOA 3C5HA 4II2A 4NOJA 1BE1A 1OIWA 3AJ8A 2FZKA 3QY9A 4CDNA 2PFSA 1U1GA 5KNCA 5CPFA 2G0AA 2ATLA 5ARBA 4QWCA 4NU5A 5TQ0A 4LDJA 3EYWA 1EVEA 3N8NA 4UUNA 4ECQA 1BE0A 2AR7A 2E4AA 1AS0A 3SI8A 4Q7JB 3STHA 1N0UA 2J9YB 1GL6A 2F90A 5FX2A 4BB9A 4TX1A 3QUAA 1EZ4A 1OY1A 1RHQA 2BMFA 4F4IA 1I7NA 1NYQA 3OJEA 4E5NA 3OSPA 3ISDA 3N0TA 3K70B 2AJLI 2JCYA 5IASA 3AVYA 1PSZA 4DMHA 4G5SA 1LI7A 4EUNA 4JP5A 2EV9A 3HVRA 2CB9A 3TOSA 5EE1A 1NN0A 4EJSA 4X8HA 2AC7A 3LT4A 2J5QA 1NVUQ 3Q7IA 4TKVB 3QTBA 3HGQA 4UMVA 5AH0A 5A6SA 3F53A 3ELUA 1IN4A 3H1FA 5H02A 3A1VA 4QUBA 2PWYA 2HHQA 2BR5A 3EPJA 4IMJB 3VKGA 2WYOA 5EWFA 1GFZA 5FPQA 3R0ZA 4HNGA 2GCEA 1TZKA 1Z8HA 5FWAA 1GTJ1 3SC4A 3VR2D 4XM2A 1UWLA 1UK8A 1DDOA 1UFQA 3ZWAA 4DYVA 1JEDA 3FI0A 1LTKA 2WDPA 1LCIA 4HO1X 4V0QA 3BL8A 5EYPA 1TPZA 4RHFA 3H1EA 2FW9A 3T54A 1ZJJA 4RDHA 7YASA 3MS4A 2YWHA 5CEFA 1D0VA 2ZCUA 5BR7A 1MH9A 2GBLC 4FE7A 1RCTE 1AD2A 1S3FA 4FZNA 5AI6A 2AG8A 5JARA 3PY8A 4YFKA 1E4EA 2WD7B 4GU5A 4KXYA 4C3ZA 1JPJA 3FYUB 4JBWA 2Q0XA 4UU7A 4G89A 4QQFA 3T4EA 6ADHA 4AUKA 2OOKA 1EDDA 5CEEA 1IY0A 4QAQA 4TWBA 3MJHA 2FRVA 2GPAA 4JQZA 4KVAA 1Z19A 1ZWLA 3ONFA 3DDHA 3MD9A 3UJBA 3IERA 3EXIA 4JV1A 4FFLA 3KC2A 4CL2A 3MQ4A 1TK5A 1XMSA 1RRPA 3JZDA 2HF8A 4IIXA 1A7UA 3SNKA 3IA7A 3O0FA 1LPBB 1ONSA 1ZY2A 3B3JA 3FOBA 4MR9B 2VUIB 2VXCA 3IAS1 1GAXA 2B1RA 4DV4B 4NULA 1YO6A 2JJ2A 3O0DA 4TWJA 4F97A 4AUMA 1SR8A 3AL0B 5EJ7A 5I9TA 3SBOA 2FOLA 3DE3X 3HKEB 5A9TA 5L4LA 2PKXA 3QI7A 1KRHA 1MEJA 4UAGA 4ZRMA 3IMCA 7REQB 4DDMA 4B4KA 4ALNA 1XLTA 4BPRA 3OZTA 4DF3A 7MHTA 2HM7A 5LXTA 2IW1A 1ONNA 4RNCA 3RAJA 3UK6A 5EUCA 3WQSB 3RRYA 2ZVJA 3UFXB 1FS4A 4I2VA 2H6EA 3DFIA 1Q46A 4L8LA 5IC4A 4YGYA 4G65A 2F48A 4XVRA 1OFHA 3H4BA 2H11A 4F93B 4DL5A 2YJZA 3BMQA 3OD1A 5SYAA 1X1CA 4Z4HA 5KJ1A 3P9QA 4UQPA 4LWPA 2ZB8A 2NRXA 4KLGA 1L8QA 2BZ0A 2EL9A 4DFDA 1FX0A 3EUB2 2WMDA 2AOUA 3IR5A 3PWSA 4DM4A 1UT5A 3OIWA 3SR4A 2JGNA 4MV6A 1EFRD 4LTDA 1PFYA 3FYSA 6YASA 4JUAA 5KTRA 3HWSA 4HXEB 4MA5A 3AERA 1JR3D 2WWFA 2YXPX 3CW2A 1OH5A 4PG6A 2B9EA 5F2OA 1O89A 5G0VA 4QZ9A 1K68A 4Q16A 5F9HA 1GY8A 3VU0A 4JJ7A 3L40A 2IS2A 2Z0MA 2BH9A 1F6DA 5TISU 1SXDA 3EBOA 3T8YA 1WETA 1WMFA 1NSTA 4RGQA 5JCPA 2AH5A 2A1UB 2CXSA 2H2IA 2I03A 2P90A 4W9NC 1LV8A 1DV2A 1K92A 3PVSA 1VPLA 4DC1A 4L4SA 2ILVA 3IJRA 4MI6A 2AWNA 5FEUA 1Z7BA 1R00A 4RTQA 3CUYA 4GPAA 2AMFA 2BFEA 2H54A 1T2VA 3KL4A 1E8DA 5ENVA 3SCZA 3UVEA 3VOTA 1TVAA 2UVPB 2GRJA 2YC2C 2W7OA 1JDPA 1PJSA 4NCXA 3ZKWA 2IE8A 2PFGA 4KGXA 4YJ2F 3GLGB 1QYXA 1Y8RB 3PL1A 3WYEA 1X9MA 3HLKA 3WMRA 4F3KA 4JQCA 1N2GA 1MIHA 5JXHA 5KYKA 4RLQA 3T79A 5EJ6A 2WTXA 3BGIA 1E0KA 3D6NB 5FA5A 3RVKA 5HX7A 3NBAA 5GV7A 1VCMA 2H31A 2REXB 1DKNA 1HLPA 3H0CA 3R9KA 3P96A 4IDEA 4YR2A 4INAA 3SDSA 3TQHA 1G5RA 4LVUA 3U4HA 4L50A 4ZYYA 2RKBA 4ANFA 4KLQA 4FMCF 4Q82A 2IH2A 4IXTA 2IXTA 3IS3A 5J8YC 1N57A 1N8NA 2HMUA 4R9VA 1N7HA 4V2IA 5ELMA 4MIYA 2F67A 4FFMA 3P0JA 2V59A 4G4JA 2Q5FA 4F5QA 2VCYA 1JYFA 1CSEE 2QPOA 3JVVA 5FWDA 2CJXA 4CI0B 5T8KA 4KI0A 3VHXA 2CVOA 1MNAA 4ZC8A 1YVDA 1R6DA 3WA6A 4AC9A 4QECA 2A88A 2XYRA 3ZIUA 5I7WA 3CYMA 2WIGA 1Y34E 2WTAA 4JLBA 2PKQO 2BV3A 2R4TA 3THOA 2I9PA 3MBYA 1DTSA 2RI6A 4RL4A 3NT2A 3FCYA 2XNDA 4ZJUA 1TQ4A 4JJEA 5CT8A 3KEOA 3EHEA 2ZTSA 3VR1A 4GQBA 3ZCQA 3AUSA 1KRWA 3UUWA 4B5LA 3QX7A 4WKNA 2CHQA 5C34B 2K6GA 1CRLA 4BMYA 5DLYA 1FDUA 3LYHA 1MC8A 4QLOA 3QLTA 2IF2A 4A26A 3F78A 1DIAA 4PS0A 1DBIA 2QXUA 3YASA 2Y1LA 2WA1A 2Z8ZA 1N75A 3GC6A 4MV4A 4B40A 4DRXB 1X9WA 2C2WA 4G3XA 4RY9A 3H9JA 4ZHSA 5JC8A 5DYGA 2ZYTX 2GSDA 4TKZA 5KVVA 3AVXA 1QIFA 3SDZA 3SZRA 1PWHA 5EE0A 2GZ3A 3GMIA 2ILTA 3C87A 4QPPA 1L5LA 5HYVA 5G4KB 1XE3A 5J2TA 4INZA 1XRNA 1J42A 4MCJA 4OXNA 4Q01A 3RJ5A 4BMZA 4JVOA 4C05A 4KBYA 3NVKI 1QB7A 1QFJA 2UV8A 4NKRA 1KOJA 2OOSA 4GE3A 4PBSA 5AFSA 2NSHA 3AL0C 3WK9A 1ZNQO 1GTZA 2Q5QA 1RMQA 3ICCA 2PSHA 3O21A 1XEXA 5FTMA 1VLBA 2LRHA 2ZSDA 3AKEA 4Q4LA 1GAJA 4H7JA 4DMMA 1MO4A 1GARA 4GOXA 4ZVPA 2WIKA 3DMHA 5KT4A 1F38A 3MWLA 4YP3A 3D6VA 1FNDA 2TSYB 3WV4A 3IOMA 4X1IB 2FWMX 2WINI 3E4DA 4ND3A 4C76A 2EIXA 3GLTA 3EW9A 2IOFA 4K4HA 2X2PA 3V48A 2WAQF 1SVLA 2D1YA 2YFQA 4IIEA 3TO5A 5BWNA 2GZAA 1DNPA 1P73A 2A5YB 4XFKA 5LSAA 5DULA 4IUBS 4TQRA 2G04A 2WJVA 3HKCA 3LVRE 2Z9CA 4NATA 4P92A 5E6RB 4PLCA 2OORC 4C2AA 2IA5A 1B73A 1QHFA 1RWBA 1U9ZA 2BCEA 2QYSA 4EATA 1U7DA 2FWBA 1C80A 2Y1IA 4R64A 3QJ5A 3H6HA 1TJ4A 2OCXA 4N5IX 4TL6A 5AKGA 3IUNA 3T7KA 1WCNA 2HMWA 2W6IA 1ZUNB 3B6IA 3R5KA 4UFNA 3ZTWA 2PH5A 1OXKB 4D3SA 5IAAA 1XF9A 4DLUA 2IHNA 1JVBA 1ZEMA 4EFLA 2BD0A 5G0SA 1NNUA 1MN6A 4D9GA 5HK8A 2B92A 4BQIA 3VR5A 5LXTB 1UT6A 3BXGA 5SZJA 2YWGA 3PFWO 3O4JA 2KEYA 2W2KA 1JXAA 1NLMA 4RKRA 4QDUA 2R84A 4M8SA 4GZ6A 3EGVA 2UYCA 4DVJA 4GKVA 1I7SB 4HYEA 2JEYA 2EF1A 2Z2KA 4NLZA 1YR1A 2FLVA 1Y8ZA 2FWNA 5CFLA 4X62B 1TTQB 1NVDA 1KYWA 1U28C 2CVQA 1NP3A 3DVRX 1ESMA 5C18A 1XKTA 3HXQA 1LPNA 1Z34A 3AQEA 3RJKA 4OD0A 4Z9XA 5KOHA 4KPEC 1JT9A 4XWTA 1ST2A 1ZW1A 2CNWA 4JP3A 1FP4B 1G4UR 3GDXA 5E4FA 3A4MA 3NH6A 3B13B 2RC5A 1TVCA 3HY4A 4UHHA 4BGUA 1WDWB 3FN4A 3QV1A 3KD2A 1GGFA 4FKMA 1PNOA 2V98A 1A8QA 4P7GA 2V9ZA 1JDNA 3EE6A 4CJXA 2GBLA 1G55A 1U9IA 4FR5A 3TE7A 2AQ8A 2QRMA 2WLSA 4EKDA 3FKQA 3NHPA 1I4TD 2ZXUA 4KIJA 2FSVA 3U4QA 5I51A 1T2CA 1DMSA 1SEPA 3R3ZA 1KS2A 3SF8A 1GGJA 2UKDA 2XMSA 3PX0A 2V6FA 3EJ6A 4MVJD 1HL7A 1RDFA 3X43A 4RKWA 2ZIVB 2SICE 3WGMA 3LX6A 5DCWA 5JAQA 1JAZA 4M9RA 3VDRA 4DHWA 3BQ9A 4EHAA 5CXUA 1JG1A 5EP1A 2QLBA 2QXYA 2FJ6A 4DBLE 3GIDA 1Z15A 3X1DA 1FFCA 3UUEA 3UCFA 2XE6A 1LQUA 2Y71A 4PZOA 4IDPA 1J8VA 4KQ9A 1HBJA 1XDWA 3VPDA 4MW4A 4TYMA 2G8LA 1IM4A 1K3FA 1JZTA 3T6KA 4F1KA 1CEQA 4IHJF 3RRBA 1U0FA 2HHJA 2PK3A 2ZDQA 4OHWA 3WO1A 5DEOA 3TG8A 4GIBA 1NATA 4FKBA 4KDEA 3EY4A 2VP6A 2EBWA 1LA2A 1KP3A 4G07A 3WFIA 1DWPA 4C7OB 4FCVA 4Z9FA 4GMXA 3TLXA 5KWSA 3CVWA 4ZTBA 2EX4A 3N7RC 1RPNA 2GJ4A 3HDYA 3IR7A 5DHFA 3ZHZA 3OEED 4I2FA 3HXKA 2X15A 5F2KA 5F1OA 5BN1A 1L5RA 3PLAE 5FI3A 1MAAA 1SVIA 1EK6A 2BMJA 2CVFA 3F2VA 4QXQA 2FN4A 2P91A 5DBBA 2W2NA 5TARA 1SK9A 4DSEA 4ZQGA 3FSJX 1T2DA 1N56A 1ZLYA 2GERA 4OHUA 2VTBB 4O0LA 1EE2A 2V7TA 1OIXA 2CL6X 1UDRA 1ZMRA 2V1XA 3A1UA 1T1RA 2ZRCA 3MRSA 4OBXA 3SYLA 2IS4A 4M7WA 4KXQA 5KWEA 3AJDA 5B6IA 2ZRIA 4YV0A 5AKKA 4FDMA 4B3CA 1HUZA 1HYQA 5JZ9A 5J2FA 1NBOA 1SA0B 1GKLA 2QV0A 3O2JA 1HXHA 4I81A 3DKKA 4B3DA 4IDOA 2LBPA 5AVSA 3E3MA 10MHA 3LPCA 2J0QA 4EX6A 4M60A 3OT4A 1N2OA 1LV7A 2Y05A 3E8XA 4WXEA 1I6WA 3A14A 1ZBDA 2OO5C 2DFTA 4FOPA 3I92A 4K81B 4LDRA 4TVSA 2GARA 4E70A 3OKPA 5KSYA 1TAGA 2QGNA 3H05A 4W4TA 5MGNA 4B9LA 1CQWA 2D59A 4W8OA 2NPFA 3TW0A 5JCXA 1QC5A 5FOVA 3ZV4A 4B4UA 3RF9A 1EIWA 1EFCA 4MZXA 5LL6P 5CP2A 1P8JA 3WYAA 2BGRA 4AP5A 1EA5A 3ESBA 1GXSA 1NNLA 4Q4CA 4PPYA 4RH3A 5EGSA 1ULBA 3QTLA 2VYQA 5BQPA 2AZXA 4ZJPA 3RR8A 1XZPA 5AICA 2F1RA 2PLNA 2FMFA 3HUDA 3ZPXA 1S5PA 1GR0A 1QIIA 2B5WA 2I7VA 3VDXA 1NNI1 1T5IA 4YUWA 3JVIA 4P84A 3SI7A 3L7IA 4OXQA 4ZCQA 3WAKA 5GJVC 2NTNA 3G2PA 5KFPA 2GBPA 3GUVA 4R16A 3OIDA 4TTTS 1U3GA 5LB4A 4BX3A 1H1TA 4TZ0A 1IZ8A 1AGPA 1AGNA 3AY3A 1YVEI 1EWVA 1DP4A 2A7QA 4AS2A 4PQEA 4ALLA 5CLHA 3UYKA 2DTDA 2RSLA 2B82A 3C23A 2ZI4A 5IEJA 2ZUFA 4P32A 1D2CA 3KHTA 1I14A 2X86A 3BZUA 4Q00A 3O03A 3IGFA 5EJ2A 3RUPA 2ZKLA 5J0RA 2RARA 3IEMA 3REQA 3ZWMA 3LBAA 5LCXA 3ZBPA 5JXWA 2P9EA 4L6IA 4YCCA 3KPUA 4ND2A 4PPGA 4UHCA 3TNFA 1JDJA 1XJ0A 1GA4A 3IBTA 3JARA 4JP8A 4TOIA 5AVWA 1OROA 1ZQXA 4RDIA 1P4GA 3UWMA 5FBVB 4YY3B 2BAGA 3THVA 2B36A 1V7QA 4ID9A 2RK4A 3V97A 3NWBA 5CR0A 1VMKA 2B4AA 1PJ3A 2WTEA 2I6SA 3AR6A 3DEIA 5HMLA 3IVAA 1QH0A 1M1UA 1U4SA 1DHTA 2JIOA 2GKOA 3C15C 3QVOA 4HDRA 1FLDA 5H7XA 1FQKA 2B61A 4O2BA 2X9VA 1FFYA 5JO0A 1X15A 1I1NA 2KZ3A 1OW3B 5A5VA 2IIVA 2E85A 3LBFA 1PZGA 1CUWA 1OIVA 1U2GC 1VFPA 5DNDA 3EOAI 2IUUA 4GX2A 5A6VA 2IXBA 1Z06A 4C6RA 3S2EA 5CEJA 2YYSA 4OF4A 2VP3A 4LW8A 4L75A 3FDFA 1PDVA 4G63A 4QELA 2Q7XA 5DWDA 5IYZF 1NQ5A 3TDNA 1UT8A 2HPHA 1VCIA 2FPRA 3O26A 1XZAA 1GG5A 5DLDA 3I0ZA 2XYVA 1YQUA 4I3FA 3HJHA 3QQ5A 5A7GA 3RQIA 4A3SA 4IGEA 1JFFB 4CKEA 5EXPA 1O9GA 5IXSA 3JAKA 3KALA 1K8YB 1DOZA 4M04A 4N01A 1MQSA 3ZR4B 1ID8A 1LNSA 3I32A 1IHDA 1ZR2A 1FW8A 2DU8A 3B89A 3AV3A 1L4YA 1FVFA 2LE0A 4QEZA 4RVGA 4YRCA 4QLAA 2EX1A 1HFKA 1ZFNA 3VO8A 2IYPA 2DPJA 1ATIA 1HE1C 4OPMA 2GWHA 3LXUX 3GP3A 2RB4A 3VZCA 3VR3A 4A0HA 1N5OX 1L1EA 3RJEA 2IUYA 1WS6A 2QKYA 3NAZA 4UTNA 3CSDA 3EEBA 3PT9A 4MIKA 4IH1A 4NZNA 4ZV9A 2EC5A 2QDXA 2Q4BA 4JROA 4KLFA 4AY5A 6GPBA 2XSZD 1QRUA 3L8FA 4X6YA 4CEHB 2NZVG 4D6PA 5J2BA 4EUSA 3IUQA 3ZJ4A 3Q9NA 2RJ3A 4LZOA 2VQEB 1NZDA 2P9YA 3LUGA 3SLKA 4KWIA 1JDBB 1ZGAA 4M9NA 5TT0A 3RANA 4H3SA 4DR3B 7ICFA 2PUJA 1IZ9A 1N6HA 1P5FA 2YJ3A 3FDXA 3MYYA 2BHSA 3AUTA 2H4JA 2BGUA 4IDHA 1Y1RA 2YMPA 4NC9A 4BVFA 4MS1B 5L3SA 5AK0A 1OLOA 4JLMA 2C2OA 5DM0A 5GPBA 3WQQA 5JMTA 3JQFC 4F7WA 4FFVA 1Y6ZA 1KR5A 2JFZA 3LXMA 4LGMA 3V6KA 4GZMA 5KC8A 1KY4A 3PX4A 5JAOA 1HG1A 1HYHA 2P65A 2NTJA 4GBED 3O0TA 5ALRA 1MV5A 1P7YA 4J7AA 4KYTA 4RD1A 1O87A 4BLRA 5BSTA 2DPMA 2IIPA 4ZD6A 1T43A 2HBZA 4MULA 4M46A 3CTMA 4JOCA 4KR2A 4WIAA 3V3KA 3AHGA 4LMBA 3WDSA 4D92A 3HVUA 2WJ6A 3UT0A 2UUOA 2QN3A 4RVCA 4DB4A 3OBIA 4XD7A 3ZBQA 3VC1A 2AEFA 1THZA 2O1XA 3FUWA 1ZQPA 2QQEA 4BJ1A 1OB2A 2G3YA 1YL6A 1WY5A 1DFIA 4MP6A 4PONA 3Q0IA 4LF6B 3WK7A 1I4WA 4OHZA 3HBLA 3AVVA 3GUCA 3KAJA 4PIVA 3ZCSA 2ZRFA 4I2AA 1W6UA 1AURA 1NBMA 3KJGA 4LVNA 3WGIA 4TQUS 1DOAA 5DX8A 4BWVA 1P2FA 2CDNA 2IYWA 1N9GB 3T12A 3T0GA 4BZWA 4QOGA 4X1KB 4C4XA 1WXFA 3RYHB 4B44A 2OECA 5FUQA 5JVDF 1R6BX 4C3OB 3BAFA 4Q4AB 3A6PC 2ISSD 2I0FA 3HCEA 3WLAA 3SOZA 2BT4A 2MOKA 1L5MA 3RB4A 1ZGGA 5CHGA 4IV5A 1A5TA 4OM7A 3RFTA 4G5XA 2EJCA 2QJTA 3ZGXA 1XXLA 4CM3A 4PYNA 3GLKA 1GCIA 2C88A 1TCCA 2DUMA 1PEKE 2VPZA 3TMAA 1G2QA 1CX9B 1SKQA 2K7FA 5LZ7A 4FS1A 3BXXA 2HC9A 3U16A 3SC2A 1G8GA 4P2GA 2HHUA 1GPDG 3COVA 4FR2A 4N54A 1TFUA 5TMEA 4CZ2A 3QKRA 4BGDA 1SIOA 5K0NA 1KZ4A 2CYBA 4UHBA 2WSBA 3CF2A 4C14A 3LTNC 2XWSA 4YFYA 5BV8A 2V96A 2E1FA 1MO6A 4E07A 4YPVA 2O8BB 1PUXA 1PTKA 1P9NA 2XGGA 4Q7EA 1ESCA 1WPRA 2O8DB 3VXKA 5JCOA 1PGPA 2N9UA 3FROA 1MW8X 2OQ2A 4CG1A 1M1NA 2COUA 2GRUA 2Q9UA 3GFSA 2EKLA 5KWJA 1NJ8A 2G9RA 2AJBA 8ICUA 1RYNA 2BFBB 2I3BA 2NUBA 3KT6A 2Q5IA 2KD1A 4M88A 1MABA 2PS0A 3EGCA 5THKA 1PP4A 4RLHA 5K0BA 2EBHX 1PS0A 1XZQA 4XVUA 1W8IA 5DN9A 2HMAA 1URPA 3NXKA 5EWLA 4OLJA 2GAIA 4ZAWA 5C5IA 5K5EA 4DV2B 4JWNA 2XWBF 4JYAB 1G20B 2D6FA 4BU0A 4BJ5A 1CUAA 1EVQA 2YZ7A 3HHPA 3URMA 1KQNA 3DGFC 1N5XA 1AS2A 4CUKA 1F0KA 3I42A 3SEQA 4AT1A 4QGSA 1PE0A 3CLVA 1QG2A 3HJAA 4Q24A 3QLEA 1IPEA 2YINC 4CMJA 1TJNA 2AZTA 1M2KA 1L7RA 2G5PA 7ICGA 1CQIB 1QV7A 1YR2A 3BFXA 1AB6A 1KYZA 9ICQA 2HK8A 1BN7A 2RKWA 3CLUC 3HBJA 4L57A 4BVEA 3ILHA 1NMZA 3RUHA 4WNAB 1F51E 3OHPA 1CD5A 3Q10A 4I1RA 4I4TF 1NI3A 4MLZA 4CCAA 2V9CA 4CCHA 1XMVA 2VBFA 1Q57A 1R5JA 3T5MA 3OM1A 5ALMA 1KSJA 2ONJA 1K8ZB 2ZIXA 1ORDA 1WPQA 2KZZA 1HYBA 4HI0E 4EL5A 4YRSA 2WUGA 1I1QB 4Q44A 3OSNA 1I3KA 3OQBA 4DCPA 5A2GA 2C59A 5AJVB 4OMDA 1G5IA 1PZNA 1C20A 5F3DA 1P1JA 3TM4A 4DILA 3A06A 4BTVA 2VK8A 4YC7A 5GTDA 4TT3D 3FYHA 1JEEA 2MIIA 1S8AA 4TZTA 1WLSA 3JVDA 2O7RA 2NW6A 4QYSA 3SQXA 1PR6A 4J9LA 2W8LA 1KDHA 2OZLA 2Q6VA 1X2IA 3C85A 1U3TA 1RHMA 1YBVA 3F6RA 3SAHA 4C4YA 4TMFA 3DUFB 1ACMA 1S1CA 4TV8A 2ZJ5A 3O4VA 1V3UA 5DXAA 5JEDA 4WD3A 1P33A 3AUAA 5E9WA 1V11A 3X2SA 3KELA 3PICA 3W5BA 1GRNA 5HSGA 4BC0A 3BGSA 3D2SA 5IINA 1YQDA 3PGLA 3F2DA 1KR2A 2RIRA 3HBAA 5DXFA 5FYQA 4AD8A 3B7WA 1CKEA 5KQRA 1C7IA 1GKYA 4F3RA 2J85A 3MSCA 4XSVA 1H8ED 1YR8A 3PFCA 1JHUA 3DKPA 3UMMA 5EZYF 1FNCA 4RTOA 3X1WA 3N7TA 4XJXA 3TQTA 1YS2X 1YQEA 4CKWB 1A9TA 2QLNA 3V7LA 1Z16A 4KE6A 4FYMA 4QZDA 2W3RA 3L3FX 5SICE 3ZXXA 5A4AA 4OJNA 4Q4HA 9ICOA 3WADA 5JSFA 3QNWA 2K4HA 2FKAA 1OFVA 3OLCX 4UCWA 2GPWA 4L4YA 1PV1A 4XYGA 3AKCA 4F12A 4TUYF 3BWDD 3C3BA 2OBLA 1J8QA 2WE7A 1Y4AE 1YKGA 4RA9A 4U4AA 4D9EA 1BX3A 1XFDA 2ZJFA 3N86A 2HDHA 1QZ3A 4DIFA 2P40A 2HIHA 3TF5A 2FEOA 4ER6A 4ZEMA 2PGLA 1T26A 4E4YA 3P2JA 2FR8C 5KTQA 3BJIC 3KL2A 3OJWA 1IZ0A 2F1OA 4IHQA 2AGPA 5AM3A 2OV4A 4TMXA 4FZRA 2X8WA 1FQJA 2GCOA 3PS9A 4U7FA 4Y9UA 3WRXC 1M6YA 4JGIA 3EOBI 2WWYA 3IRVA 1UL1X 3BB4A 3E61A 1LQTA 2J3IA 1QTRA 2IKSA 3C8UA 3K6KA 2G5TA 3OE7D 1MJ5A 2FHPA 4NNOA 2JJ8A 4UBNA 3PXGA 2MR6A 1SRQA 1NVVQ 3IDOA 4C5CA 3OEEA 3Q2OA 4PO9A 5M7EA 4EB6B 1U99A 4BUGA 5GVSA 3MOGA 3ILSA 1IK4A 2DY1A 1TF7A 5EEGA 4PZUA 2JL1A 5KCMA 5KVAA 3FOFC 4I7EA 4H0CA 3SJBA 2EKZA 2GBIA 2YZMA 2PR7A 3KJXA 4FJ2A 1L3UA 1U31A 4K4GA 1H93A 1VG1A 1AQ6A 4R2MA 1CJUC 2QOEA 5DGBA 2QD4A 3NVDA 3NT4A 4D79A 3QE0A 5I3ZA 4S05A 3GROA 4UUBA 1OLUB 4M98A 4WLNA 1U7TA 2AEMA 1YQ9A 1B0AA 2VP0A 2WQZA 3WMGA 3TXAA 4BTLA 4DA0A 4ER7A 2ATIA 2C7BA 1AMOA 3WNCA 4HWKA 1VLZA 2G36A 3M5DA 5AHWA 3TVTA 4XGQA 3ELDA 4D57A 3AR2A 1O5OA 1Z6AA 4X1KA 2PUEA 1WF6A 3LHSA 3BTUA 3GGCA 3RAFC 4RM2A 1XQVA 2JFHA 2PT9A 1VPDA 4U7JA 2J45A 1OX5A 3PQCA 5ARCA 3V1TC 4MHVA 4OKSA 2D5AA 3OPYI 1UZMA 9MHTA 2VTDA 5TMBA 4M38A 2H0RA 3W2FA 3AFHA 3RK1A 1U2DC 3BGOS 3MA0A 4C2UA 2GSWA 4LRSB 2INGX 4HVLA 1KKLA 3TAQA 3JQFA 3OO1A 4Q6BA 2IW3A 1U48A 5FI1B 3O95A 3UHAA 3L41A 4A1OA 1F60A 4WVFA 5JECA 1AT1A 4JEMA 4YMHA 1UADA 4ZOCA 5TEVA 4Z53A 1B8OA 3T7IA 2FFAA 1XMQB 3LU1A 1QVRA 4H1UA 3N76A 6Q21A 2DETA 4DABA 5CHYA 5D5QA 2JAOA 3CVJA 1EX6A 3DG9A 3PDIB 3FH0A 4YAOA 1QG6A 1V6AA 4H31A 3TQOA 2H00A 2DMRA 2Z57A 3RAEC 2O57A 9ICJA 1N7GA 3AB3A 2HD4A 1EA7A 1PV2A 2XKBA 1E5LA 1DDIA 1XMPA 4N0EA 3FOAA 1P19A 2BMAA 1XA3A 2Y3IA 4X7RA 1FFXB 4DJJA 4DV5B 2EQ5A 2D7JA 3JTEA 4OHMA 3PDIA 4WASA 3WU2U 3SX0A 3CE6A 3CNNA 3G9QA 1QSYA 5A03A 4JXXA 1ODCA 2OFXA 3HVJA 4UTOA 5CDYA 2YJGA 4EELA 1YL5A 5BQ5A 5I01A 4PHEA 1HYEA 3RR2A 3QITA 2PA3A 3D6TB 4CMHA 5AI0A 1NN5A 3N2IA 4O2AB 1ZNXA 3E84A 3O74A 4JKYA 2JK0A 2Y76A 8ICQA 4PGGA 1XKXA 4ZRDA 4ZALA 4CIVA 4AZ3B 5ER6A 3QF7A 1X7ZB 5D8DA 1S4QA 2JLQA 1Z6ZA 1A4IA 1NJYA 2JAWA 4HTFB 5PNTA 2H2FA 4O5CA 4WTOA 4ROTA 2X2FA 3F9IA 3ITKA 4B3BA 1YXMA 4AW9A 3UH0A 5TQVA 3H2KA 2W6NA 5F35A 2AHOB 3ANLA 2OLJA 3TQQA 5KOIA 1QFSA 1K6EA 1PT7A 1RLOA 2WAQC 2DFDA 3PLRA 3ITDA 1UC9A 4HB3A 4HMPA 4EJMA 4CI9A 4F3OA 2PZAA 3I09A 4LRQA 4AUNA 3THWA 1XAGA 3R9WA 4YH1A 4DNXA 3ZJVA 4R7GA 5B3AA 4P4UA 5T41A 3ZUPA 3DDNA 3PITA 4OMFG 1SKSA 3PCRB 5K8JB 3WLJA 2BDUA 3OBBA 1X38A 2II6A 4IRMA 1F7VA 5LVAA 4BO3A 1OTXA 3L9XA 1U02A 3FXAA 3R4VA 1FYFA 4FGZA 4UZSA 5AXDA 1Q2UA 1O4WA 1RWWA 3H0LB 1V45E 3GBPA 3U1TA 2YQEA 1R6AA 1WABA 8ICXA 2I22A 2H7XA 4E46A 5J4LA 5IARA 4F2HA 3M6IA 1XQWA 1JBEA 1SXHA 2P78A 2WYIA 521PA 3NKFA 1ZUNA 4XJSA 5JWRA 3ASZA 3WZLA 4FPXA 1JT2A 4KXXA 1IIPA 2ECPA 4MEAA 2V0CA 3ACBA 2O3TA 1V2GA 1X80A 2DF8A 1ZCFA 2GHIA 1XNGA 1D2NA 2HF2A 3LBHA 2ECKA 1FRFS 4I3GA 4OHCA 4X8MA 5TDHA 1F8UA 1NVKA 1XK7A 2VJLA 5JQGF 5ES3A 3EFOA 5I9BA 3PSTA 1FSSA 2XJ9A 3F3KA 2JANA 3C5FA 3OI7A 4X6UA 5FO0A 3ZWNA 1OZHA 5AVTA 1WW8A 1S97A 1Y9ZA 1PBNA 2JCSA 5UKDA 3I2IA 1FYXA 3B85A 1ISIA 3S27A 3UAVA 3ZW7A 2R7KA 4LJKA 3V6MA 3ZZUA 2JHAA 1YJBA 3PL5A 4QHTA 1P5HA 1LEHA 3DYVA 4J4HA 1HR0B 3LKVA 1NL3A 2OUIA 2VOJA 1T7PA 1OPRA 2J33A 3G2IA 2CFRA 2VYVA 4OQXA 4YP9A 2VT6A 4D6XA 2XDYA 4F5YA 5CFQA 1QGOA 4MQFB 3REGA 3RABA 4A0SA 1N2XA 2BBWA 3SZGA 3EMVA 4RQ2A 1ISHA 2IUFA 4RD4A 3MR6A 1U04A 4E4RA 3GB9A 3DJYA 3MMPA 1FDOA 4CKWA 3HH8A 5TQ2B 2C9OA 2PSDA 3IG5A 3B7PA 2OEPA 4Z0NA 2DPLA 2VZ9A 3ID6C 3D8TA 4CT4B 2AOXA 4QW8A 1Z88A 4YRQA 3BDVA 4MEBA 3TL6A 2I4MA 4I2HA 1E0SA 4R51A 3TLJA 5BSVA 4UD6A 1MB3A 4Y2QA 4U7CA 1KETA 4OBBA 4YV1A 4CMGA 3EMBA 5HHTA 4B17A 1SGGA 2YN4A 2J3EA 2X1HA 3EH1A 3A0BU 1CXZA 2WJJA 1VLMA 1DIHA 2GZRA 1UPCA 2QL5A 3EJWA 4W8GA 3VU9A 3BXFA 4A15A 1KFTA 1ZOOA 5F7ZA 1ZOSA 1H2HA 5SZHB 3UKOA 1I2DA 1KZYC 3VOAA 4MRNA 2IOQ<