4UAVA

Crystal structure of cbby (at3g48420) from arabidobsis thaliana
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
TLPSALLFDCDGVLVDTEKDGHRISFNDTFKERDLNVTWDVDLYGELLKIGGGKERMTAYFNKVGWPEKAPKDEAERKEFIAGLHKQKTELFMVLIEKKLLPLRPGVAKLVDQALTNGVKVAVCSTSNEKAVSAIVSCLLGPERAEKIKIFAGDVVPKKKPDPAIYNLAAETLGVDPSKCVVVEDSAIGLAAAKAAGMTCIVTKSGYTADEDFENADAVFDCIGDPPEERFDLAFCGSLLRKQFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
total genus 87
structure length 246
sequence length 246
ec nomenclature ec 3.1.3.-:
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4uavA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4uavA01
3E8MA 4IFTA 3FVVA 5AI8A 1YV9A 4YCLA 1AQ6A 3E58A 3AR4A 1RLTA 2EATA 3WK4A 3L1UA 4RETA 1QQ6A 4OD0A 3HYCA 4IG4A 2JAOA 3QXGA 2AGVA 5ALOA 2Q4RA 4AS2A 3ED5A 3QUTA 3L5KA 5ALYA 3WKAA 4Y2PA 4UAVA 3QGMA 3NALA 2WHEA 5ALDA 4FYPA 4Y2JA 5AIBA 2O2XA 3ET4A 3ZTWA 2YMQA 3E81A 4I9GA 4GXTA 3OCWA 4Y3UA 1O03A 4BNDA 2FPXA 3KDPA 3QUCA 3ZW7A 2YJ6A 4BX3A 1CR6A 4KNWA 2C88A 4XE5A 2OBBA 1L6RA 3SD7A 4OCZA 5ALTA 5ALHA 5AM4A 5AI4A 2YMMA 3PDWA 2Q5EA 2R8XA 4HGOA 2NO5A 3ESQA 3ZTYA 4UU0A 4BEWA 1U2TA 3QU5A 1SU4A 4L6AA 2RBKA 1TJ3A 4L6CA 2C9MA 5ALSA 5AVWA 5AI6A 5AIAA 3OPXA 4F71A 2HI0A 2WF9A 3UM9A 1T5TA 1WZCA 3ZI4A 2IYEA 5A3RA 2B30A 4CF5A 2R8EA 4BNDB 3AR9A 1FEZA 1O08A 4H1WA 3UMBA 3L8EA 2FUEA 3WK6A 2P27A 2QYHA 1T9ZA 3KZXA 1SWVA 5AKLA 3J7TA 1X42A 3U7FB 5AKKA 3ESRA 3IJ5A 5ALKA 5AVSA 2YJ5A 3CZ4A 2WF7A 3WK7A 2X4DA 5AW2A 5T41A 1VJRA 5AW9A 5AKXA 3N28A 1LTQA 3I6BA 1U7OA 3UMGA 2I55A 4GIBA 5AKHA 3IB6A 4YGYA 4KNVA 5AESA 5ALUA 4ZEXA 3EF1A 4HGQA 4F72A 3KC2A 4Y2YA 5AW8A 5AVXA 4L57A 4DFDA 2YN4A 1QH9A 1TJ5A 4DCCA 2RAVA 5AVVA 2G07A 3KOOA 5AVRA 3A1DA 2WF6A 4UM7A 2R8YA 3QYPA 3U26A 5AICA 1Z5UA 2IOHA 3WGVA 2HX1A 5JJBA 3M1YA 1WPGA 5AVYA 4OFZA 5ALEA 4RESA 4Y2QA 5AVQA 2CFTA 1K1EA 1WVIA 4NABA 3OTQA 4DWOA 2NO4A 1RQLA 3QUBA 2OM6A 1S2OA 3UMCA 1YDFA 2GHTA 5AW4A 1RKUA 1Q92A 1Z4LA 3PGLA 3K1ZA 2AH5A 5AI5A 4EEKA 1U7PA 4JDPA 2AUTA 3WKCA 2QLTA 1ZOLA 3MPOA 2C4NA 3PCTA 1NRWA 4BKMA 1TE2A 3OCZA 1YMQA 2MU1A 3R4CA 1PW5A 3L1VA 3L0BA 1Z4OA 5ALIA 3ZX4A 2ZBGA 2C8KA 2MSNA 1LVHA 3SF0A 2GO7A 1L8LA 3WKDA 4B6JA 3I28A 4ZEVA 2OYCA 1RC8A 4DW8A 4HGNA 1N9KA 4AP9A 4KYTA 3SHQA 3W5CA 5AKJA 4G9BA 2W43A 1Z4PX 3GYGA 5AW6A 1RMQA 2WM8A 3S6JA 3AR8A 3AR7A 2G80A 3ZWKA 4CF4A 2HOQA 3D6JA 3L0CA 3ZUPA 2YBDA 3U7GA 5AW5A 2I7DA 5AKEA 5AKGA 2G06A 2BDEA 2PKEA 4NWIA 3R09A 2EAUA 4EX6A 5AHXA 5IT4A 3ZX5A 3KBBA 5AW7A 2WF5A 1Z4KA 1L7PA 2D2VA 5AK3A 5A3QA 1RKVA 1RMTA 2C8LA 1Z4MA 2ZBFA 3FPSA 1RQNA 4XPZA 5AM2A 3EPRA 3F9RA 4EX7A 2FI1A 5ALFA 5AI9A 4UMVA 2B1RA 3FM9A 4KN8A 3QU7A 1VJ5A 4UATA 4Y2XA 4UMDA 3WGUA 3I76A 4BX2A 2P69A 2HCFA 3P96A 1Z88A 1MH9A 4YIHA 2HSZA 5IS2A 1VFPA 2ZBDA 2JAWA 3SKYA 4CE6A 1RRCA 2FDRA 2YFYA 3MC1A 2EARA 3A3YA 1U2SA 2JARA 5ALJA 5FP0A 2IOFK 4Y2RA 3U7HB 2HF7A 1T5SA 2YJ4A 5AK4A 5AM1A 4YCMA 2OA0A 3FGOA 2B1QA 1N8NA 2B82A 1ZD4A 3HLTA 3WK5A 4UU1A 4C4RA 2ZBEA 3NANA 5AM5A 5ALMA 3L7YA 3N1UA 2B8EA 3R9KA 1ZRNA 2HHLA 2G1AA 4JB3A 5E0OA 2GMWA 1Y8AA 4FFDA 1RLOA 4UASA 1ZRMA 2FPWA 4XQ0A 4E88A 4QQFA 5ALZA 2P9JA 5AM0A 5AK6A 5AW0A 2DQSA 5ALPA 4C4TA 3DDHA 1L7MA 4Y2VA 1Z4QA 1RLMA 2P11A 3FPBA 2JGAA 5ALVA 4NFLA 2W4MA 3MN1A 1J8DA 3CNHA 3ZVNA 1TJ4A 3WKBA 5ALNA 2I54A 1IWOA 2ZG6A 3E84A 3FZQA 2R8ZA 3WKEA 2FUCA 4UARA 3M9LA 1RPZA 2PQ0A 4YIKA 3QX7A 5AVUA 1SWWA 3NRJA 4YCNA 2IA5A 2YMPA 2GFHA 4AS3A 4Y2TA 1L7NA 3TLMA 3AR6A 3SLRA 5AK5A 2JAUA 3U19A 3IRUA 3U7EB 3W5BA 4J2TA 2G09A 1NNLA 4FE3A 3BWVA 2NYVA 1L8OA 3QLEA 2Q4TA 4HYTA 4XOUA 5AW1A 3ZU6A 2WF8A 2YMLA 4MWOA 4BBJA 1ZS9A 3N8GA 5AKIA 1QQ7A 4EELA 1WR8A 4MUMA 4PNHA 4NV0A 5ALRA 3VAYA 3L8HA 1EK2A 1ZD2P 1RDFA 3N5KA 4EZEA 3OCVA 4HGPA 1RKQA 4KX3A 5ALWA 2B8JA 3DV9A 2VKQA 2G08A 4KX5A 1NF2A 5AKZA 5AW3A 2I6XA 1YNSA 2FPUA 2I33A 5ALLA 3KD3A 2G0AA 3SKXA 4BEVA 3QU2A 3WK8A 2BY4A 3A1EA 5AM3A 2I34A 3NAMA 3NASA 3U13A 4HAIA 2CN1A 2ODAA 3L8FA 3WK9A 3A1CA 1QQ5A 1RMYA 3ONNA 2FEAA 1XP5A 4UW9A 3B8EA 4UMEA 2BDUA 4ZEWA 3NUQA 4Y2UA 4OHFA 1XPJA 1ZJJA 3L0YA 2AMYA 5AKYA 4EENA 4UM5A 3QU4A 3AR2A 3QUQA 3AR3A 4HGRA 4NAVA 1ZD3A 4CNQA 2HEGA 3RFUA 3OCUA 3OCYA 2HF2A 5ALGA 3B9BA 1J97A 4CF3A 3EF0A 2CFRA 1F5SA 1QYIA 3ET5A 4C4SA 1TA0A 1YJ5A 2CFSA 4O8CA 1ZD5A 4J03A 5ALQA 3DAOA 1JUDA 3ZWDA 3ZVLA 3W5AA 4Y2SA 4I9FA 2FPSA 1L7OA 4UMFA 1CQZA 4QJBA 4G63A 2PR7A 5AI0A 3I1YA 5AVZA 1Q91A 3DNPA 2GHQA 2WFAA 5AVTA 2YJ3A 2HDOA 2MU2A 3ZVMA 5IT0A 3N07A 4UAUA 2IOFA 5ALXA 2O9JA 1Z4NA 2RARA 3NIWA 1EK1A 1S8OA 5A3SA 2RB5A 3AR5A 2YY6A 3EWIA 3QU9A 3W5DA 3L8GA 3RF6A 3BA6A 1YS9A 1XVIA 1Z4JA 2W11A 3OCXA 2FPRA 3B9RA 2ZOSA 4BYGA 1U02A 4BX0A 1Z5GA 1Z4IA 4YH1A 1KYTA 3PGVA 2ZXEA 2B0CA 3SMVA 3QNMA 2HO4A 3MMZA
chains in the Genus database with same CATH superfamily
3EVTA 3ZG6A 3DDNA 4YCLA 1V4NA 3G8YA 3ONFA 3VR5D 5FT9A 4Q37A 3K09C 2P1ZA 2PMKA 4JASB 3ZHYA 5F23A 3PNVA 1QMPA 5FL7A 5IYZB 3HRHA 4Q03A 5KWIA 2E85A 2NV2B 3KOZA 1UJNA 1SGWA 3ZLTA 2YRWA 3QXGA 3OZDA 3JYLA 3O8NA 2Y1EA 4JI4B 1JMYA 1P3JA 1ZH0A 2D0DA 4TT3A 5HZHA 2JG3A 2DZDA 1SJ9A 2ZJYA 1YVUA 4CKWB 3JQEA 1XZEA 3V1KA 2WJJA 3LPDA 2L82A 3KKKA 4TV8F 4DL2A 1D9ZA 1JL3A 7GPBA 4A8PA 1HNWB 4TKUB 4FFMA 4AC9A 3FTEA 3D6AA 3CF6R 4MQFA 4ZANA 2WINI 4HRYA 4GXTA 3LFUA 4OJTA 3FNIA 2VDLB 3V7UA 1X9XA 3VI4B 2JRZA 3CPJB 3GYBA 4RHCA 4DSLA 2SCUA 3THWA 1YA4A 3SC6A 4PZCA 3KKPA 4BX3A 3HYNA 4FCTA 4F1WA 1NBEA 2ASLA 1RXWA 1VSTA 5CW2A 4O25A 1M10A 4YACA 1TU0A 1RYZA 1A8QA 4Q1FA 2IYTA 2V6MA 4G0NA 3NS1A 3K5IA 1PR3A 1KVUA 5DRTA 5L1MA 2IXFA 2QNBA 4P82A 1VCHA 3LWZA 5BVHB 1LTKA 2R6R1 3QU5A 3D4LA 3QE2A 1NPYA 4NM1A 3QPWA 4RJIA 3SHFA 4QYMA 4EZEA 3ZWNA 1G0OA 1IHYA 2QS9A 5BR1A 2W83A 3ZOKA 2G28A 3HN6A 4GMHA 4GVPA 4ILKA 2E3JA 3CR8A 1GTZA 3DPUA 1N3YA 2BM1A 5MDHA 3WL5A 2IITA 1E4VA 1UK7A 1E9AA 4BNDB 4IQ0A 2NADA 4NS1A 1NFQA 1WY5A 4LQDA 2KFNA 1HSZA 2AMVA 4JBLA 3VR0A 2JZBA 1ZNYA 4H1WA 4D9HA 2P27A 1EFPB 2E8OA 4PXSA 4N65A 1EWTA 3GK3A 5IYZF 3UV7A 1NM5C 1ZL0A 4I4IA 1CUVA 1ESDA 5IHXA 1B0AA 2O2YA 4U02A 3HJUA 4Z4CA 2CFIA 3GUUA 3LHFA 1ZCAA 3PL1A 3TTWA 2A5GA 1GL6A 1XWIA 1DOZA 2IP4A 2JNWA 3V8QA 3HCRA 2CMDA 3KSDO 3PXBA 4WCFA 2JD1A 1YZTA 4FJ0A 2QE6A 3A27A 3W6PA 5AW2A 1FUUA 3RFCA 4DMRA 1BHJA 3GZNA 2LE0A 3TR5A 2K4HA 2WJWA 1MEJA 3RS2A 4DJEC 5FUWA 1KYYA 4HYQA 5IH3A 1RWQA 3TL2A 4RK5A 2ILTA 1VKJA 1XB2A 4S35A 1TVKA 1T2VA 4X8HA 4EFKA 1CRZA 1I3LA 1OYWA 4Q9NA 5T4BA 1TZCA 2AG0A 3AYXB 4M22A 5HHTA 1XMPA 2R18A 1P1KA 3DWFA 4LXXA 3I4LA 4UOQA 4Z8XA 4YMVA 1KEKA 2A3NA 2P0YA 1JHRA 2YY7A 4FFOA 4IEEA 5HK8A 2JA2A 4QDOA 4J9MA 8ICEA 3X1XA 1C14A 1HQYE 3L77A 1MIHA 1CX9B 1PR2A 2XIQA 2QLMA 4S1WA 3UAWA 3W6NA 3PC4A 5B1IA 3ZHZA 1SCIA 2AD5A 4L57A 1Z6AA 2XCQA 2NU8A 5CB4B 1KYZA 3RT1A 5HF6A 3EA5A 4N7MA 1OCEA 1JJFA 1JHOA 1JQJC 2QARB 1DBPA 2ACKA 4J3FA 4QNMA 2WF6A 1Z6TA 1JLMA 3LDFA 1Z5UA 2YWEA 1CUCA 2W2OA 3WB1A 4Q9HA 4BAUA 1IY8A 3NHLA 3K9WA 4URYR 2MYUA 3KQPA 3TR0A 2EHJA 1E58A 3AKYA 3AIKA 1GPJA 1A50B 3OTQA 2ENWA 3C5WP 2YZ7A 3GP5A 4HMOA 2VJKA 4IP0A 3REOA 1NE7A 2V4RA 1HORA 1S01A 2NUTB 1HI9A 3NRCA 3V8RA 2J3LA 4DDWA 3MGIA 2XNSA 4JDPA 2NRZA 3IT0A 2Y93A 1W6UA 4R9NA 4U7GA 1XELA 3IXQA 1WXFA 3MLEA 2XGSA 1IDN1 3QVUA 4E13A 2IBTA 3UOAB 2QROA 3CX7A 3RD5A 5E79U 2OCKA 7AT1A 3GLGE 4ND8B 3THYB 4YRFA 2R2GA 3R3HA 3ROGA 3T9FA 2FYTA 5JXHA 1IY1A 3L1VA 1NXVA 3I61A 4HQFA 2ZROA 3K2EA 1DELA 1PX2A 4XVQA 3W1WA 2Z1MA 5B58T 3BERA 3DEJA 4V39A 4BQPA 3MBYA 1YI0A 3G2QA 2IH4A 2ZE5A 2ZETA 1TD9A 4RGVA 2W8BA 2AJDA 2WJZB 2F64A 4JJGA 4OMCA 2B2NA 3TYXA 1P75A 4DRZA 2CNWA 1WVMA 3UK7A 1AUQA 1A7JA 1UK6A 2OYCA 3RSFA 4OIFA 4B0OA 1H9CA 1UC5B 3FOFC 2GZ3A 3HO1A 1YZUA 1KXZA 4HWTA 4KYTA 1W0KD 1C0KA 1SXDA 4RUAA 1GV1A 2W43A 4I5EA 1J06A 5LA6A 1Y5IA 4YRQA 3GOQA 1IIBA 3FN4A 3JQ9C 1XR3A 3G7NA 4LIPD 3ZXSA 4TKLA 1KNXA 3DAGA 1H2YA 2Z2YA 3GF4A 1FLDA 2QTTA 4GXQA 4HUQA 4A5OA 4F06A 4DKJA 3HTXA 5F4BA 4DS4A 3IURA 3D3WB 1TK3A 4I14A 1K3FA 4OJ5A 4WH0A 3TVDA 4LAFA 1MQ2A 3DKIA 5JEEA 1T9DA 3ZUPA 4GM1A 1C9NA 2G06A 1IHUA 3CBGA 1LPMA 2AK2A 4OFWA 3RG8A 2J3QA 1ZGBA 2C1XA 3I64A 3VH2A 5LR6A 4PS0A 1KBQA 4EB3A 5B64A 621PA 1LJLA 5IT4A 2I7VA 3CLSC 1YR2A 2AN5A 2OOSA 1ZNWA 5FCDA 5LDDC 4FO6A 1NM5A 2C2YA 3ACBA 1L7PA 3JVEA 4UVEA 2Z9CA 3CWCA 1X9SA 4ZFNA 2GKGA 2I2WA 1MORA 1X7HA 1Y8CA 3GFQA 1GGMA 4IGIA 1P81A 2ZW9A 2XVYA 1RQNA 4NICA 4PLTA 2QD1A 1XZIA 3U2QA 4B81A 4D0RA 4BQFA 5BQXA 5DGDA 3BK2A 3LUDA 1MABA 1NMZA 2BHTA 3KRTA 1Y9DA 3R7DA 3EVAA 1VXOA 4A7PA 1B0ZA 1UL1X 4O3RA 1YT3A 3EY4A 5JS8A 1AJEA 3SHWA 4M0EA 2X1HA 2C9DA 4QT0A 1U6IA 4D3YA 1S8AA 3JQFA 4UMDA 2PKRA 2BJVA 1YB2A 3FSGA 1AXGA 1XLTA 1JNYA 1GL3A 4PPQA 3FAZA 4GWLA 4ND6A 2Q7DA 3STXA 1UADA 1E60A 3M33A 1M76A 4FIZA 4URXR 2YXPX 2C97A 1V38A 3JTEA 4V0RA 1RYUA 1T9HA 2N1BA 1N6NA 5BSRA 3LPLA 1NK0A 1W2GA 2FE4A 2FW9A 4OJLA 3L7AA 2VRCD 2WTMA 4G0OA 1N5RA 1DHTA 2Y0DA 1PR0A 1VPDA 3HH8A 1MQSA 1U2DA 1KDPA 2C2GA 2VDWB 3UH1A 3X43A 1T3QA 4DIOA 2WM9B 2RQ5A 4TV8B 3SR3A 3C3EA 4ZI7B 3CEMA 5B6IA 5AK4A 1OH7A 5M5BA 1HEUA 2XGMA 4JL5A 1IEWA 2J59A 2NAPA 1Y42X 2HJSA 1LK0A 4LNUA 4HLCA 1V6SA 1VG0B 2JEFA 1AN0A 2CLIB 2LBPA 3T38A 4M21A 2ZBEA 4AMVA 3LX6A 4W6QA 2XD4A 3PUJA 3BMCA 4ASUA 5KFIA 2BUBA 4I50B 4ZH4A 2UVPA 4MPPA 8ICAA 2B5OA 3NWPA 1FYEA 2ZVQX 3A0RB 3LP6A 1TAUA 1FP4B 2WAOA 1UWKA 4GGMX 2O3TA 3B1YA 1RLOA 2DWCA 2W58A 2CUZA 5FOSA 4LQ4A 2QJRA 1Q3VA 3LOQA 4WZBB 5C35A 2TMDA 2I3BA 3KO8A 4KR6A 2WWIA 4PAQA 4DV6B 1NYTA 2GK4A 3PA6A 4LCJA 2KD1A 2QMQA 3KOYA 3THVA 1WXWA 1VGRA 3DDHA 5FWYA 2VR1A 3PUYA 7ABPA 1J39A 1RLMA 2XVAA 2P11A 4MI3A 4CMBA 4ECXA 1AX9A 1HT1E 4E08A 1GPDG 4H7KA 2HXSA 1J0EA 2ID7A 2YIJA 2WD7A 1J8DA 3WWYA 4LJ5A 5LZ2A 3DTYA 5D46A 4R8VA 4EG6A 1EVEA 4E1VA 2C5GA 2NZWA 4KQGA 3SYRA 2V0CA 2CW5A 5GPBA 2N0SA 2XRFA 2FUCA 2VZ0A 3SBDA 4YRNA 2GBPA 3ZDDA 2OECA 2XH8A 1CY0A 3MCVA 1V1JA 2CJWB 2H1VA 1TUBB 2P2NA 1GL9B 1UT8A 3OQVA 2EFEB 1U9IC 3DBRB 3MA0A 4WXYB 3IH5A 1USUA 3H7IA 2P78A 5CYFA 2IH2A 2BQUA 1FSZA 1PEKE 1BROA 4DLGA 1ZH8A 3TGLA 1T1RA 8ICXA 1S7GA 5AK5A 1XRQA 4U2FA 4ZVLA 2K6GA 4LOHA 5KVQA 2NXNA 2PUCA 1KRXA 3LPNA 5HZKA 1NNLA 4KHZA 4IWYA 4TWRA 3Q7EA 3QLEA 1U0SY 1KHHA 3E7DA 3Q11A 3ZU6A 4D46A 1CQJB 4EVIA 3ETJA 1KZ7B 3CUUA 1APBA 1FFXA 4YJKA 1ZW6A 4NOJA 4OHPA 4G24A 5JVDA 3FE2A 1VLZA 2R6ZA 4PZ9A 2NPFA 2IE0A 3WIOA 2O14A 4RTPA 1M1UA 4XQ9A 1JKFA 5A5GA 3F98A 2DKNA 1KC1A 5B57C 2EWWA 1SV0C 4N76A 1CE8B 1R9JA 1XHEA 2W2LD 4E5PA 2EP7A 1PG0A 1PFYA 2XDQB 3H84A 2C8JA 5DGHA 3SVTA 1GG2A 1YOVA 3PW7A 4GPTA 3M6LA 4MJLA 1QGOA 3GL9A 1EB9A 4YVZA 1XQ9A 2J5QA 1U2EA 2XA1A 3OP4A 3PC6A 4DLNA 1OBOA 2CZCA 3ZQ4A 4KX5A 2NZVG 5ER6A 1EB8A 3A9CA 3RVKA 3D6NB 3HLKA 3KB2A 2DETA 3FBTA 1TUIA 1T9BA 1X9IA 1AHIA 3PFCA 2I33A 4FK8A 3A1FA 1U9LA 3JYPA 2G0AA 1SUCA 3EDYA 3IP9A 4FXOA 2NOAA 4JEMA 3CH4B 3SKXA 3WK8A 5BYKA 1E0DA 1JWAB 4LNHA 4NCNA 1J2RA 1GUBA 1W19A 2Y9MB 3CW9A 3KL4A 2I34A 2ATXA 4UB4A 1R1DA 3OO1A 4HAIA 4JCCA 3OOHA 3OGUA 1FC0A 1O5IA 4WOCA 3AEUB 1AS0A 1OZHA 4KMOB 3QOXA 2GHIA 4N03A 3ZV4A 5CDYA 1D2AA 3ZDEA 2I5HA 1RMYA 1E59A 3PF9A 1JIXA 1XRMA 2IBSA 5G2OA 2BM0A 1HYEA 1UBTS 1X80B 1QHSA 4UMEA 3EAFA 4AWXA 4P4SA 3HWX1 4QZ9A 2WPDA 4JH0A 2BDUA 2QAGC 4AZ0B 4BLTA 2WRZA 4R8SA 2AL7A 5EIHA 4CG0A 3I5XA 2Z7JA 2AJLI 3MINA 2O2CA 3EG9A 2JBAA 4J6EA 4Q3OA 3SNHA 3Q87B 4U7FA 1NN3A 2HWXA 2IA6A 3GAZA 3VHXB 3HL4A 4BCDA 1EJBA 1XPJA 1YONA 2G9ZA 2VYNA 2QDKA 2WG2A 1AQYA 2OTCA 3FWPA 2DBYA 4ZAWA 4B8YA 3GJTA 1TX4B 3DEFA 1V85A 3G82C 2X0DA 4L8WB 2VCHA 3HJGA 4O2BB 4DDUA 2JGJA 1CNEA 1EK5A 4BQNA 2I4NA 3BXEA 3PE3A 1G8PA 2CXNA 1QFYA 2CHEA 4RABA 5ILQA 1FW6A 4OGLA 4HTFB 1UMBB 1RI1A 4G89A 4H7IA 1F9EA 4CNQA 1NLUA 4IXNA 1KIFA 1OVGA 3U7RA 4IZHA 3PX3A 1YULA 3IIJA 3LWLA 3WHPA 4OA8A 4E5UA 4IXTA 3GFGA 1RE0A 2VHQA 3O8QB 4Y6OA 5LBIA 2YRFA 3R75A 3UGKA 4D6XA 4CGYA 4P1ZA 1N0UA 4CM7A 5EMJA 3MQFA 1XCJA 5DNUA 3N8HA 1F6WA 2P8JA 3BJEA 4U6QA 3VX3A 1CY2A 1O58A 4RY8A 2KQUA 4QQNA 5EIWA 3ZN2A 5IIJA 5BXYA 5BV8A 2XVTA 2DEUA 3V4PB 1LD3A 1E32A 4O8CA 4K9NA 4PZOA 3NKVA 3BJRA 4NI5A 4G4SP 5EZYF 5JLAA 2F9FA 4DIEA 4RJTA 4ZZ3A 3TTXA 1VCIA 1XVUA 4OB7A 4P08A 3HJCA 3BMNB 3INRA 2Q5HA 2RGAA 2R4UA 4R2HA 4YUYA 1WBDA 2IUFA 4R6XA 2GM5A 8AT1A 3F9IA 5LQNA 1W36B 2J5BA 3Q5DA 3MGBA 2K4PA 2G5GX 2HJHA 2GF9A 3DQZA 4MHOA 3U3XA 4C08A 5EJ6A 2J9XB 5BWBA 5ITZB 1Z6XA 4B2LA 2JLXA 2XCPA 1T8PA 2YJ3A 4NM2A 4BTEA 1U7UA 4W8HA 4DHEA 4DR1B 1FFHA 4XDZA 1B6SA 3OD1A 1QH8A 4GKBA 1V8OA 3W3ZB 5ADUS 4A8TA 4E2FA 4ZCRA 3AM1A 4NMMA 4UXJA 1EVLA 1H3EA 3H6KA 5CFQA 5JAOA 1DRJA 1Q6YA 2BGIA 4FWTA 4LF4B 1KFKB 2BFFA 3A14A 3HWRA 5JLJA 5KOJA 2AJCA 5TS2A 3AUJB 1X7XA 4ALKA 4JJFA 13PKA 1MDFA 1WNTA 3LH5A 3V6MA 4CQLB 3RRYA 3ZHXA 2DFDA 3L1JA 4K6HA 4U0JA 4CKZA 2G72A 3V1NA 1R88A 4JGIA 3ILYA 3SLGA 3UUGA 2MUTB 1ORVA 2H4FA 4RY9A 3ZJVA 3R8FA 4LXTA 3WYBA 4GI3A 4ZK6A 4XFJA 3CVYA 1JR3D 4BQSA 1IJEA 3B9RA 2CNLA 2H4WA 3WBKA 1ZCJA 2D1RA 2HOFA 3BZWA 2ES6A 3N2IA 4G4SO 1T10A 4ZP1A 3UAVA 5IWCA 4RU9A 4LGVA 5FB3A 3TOVA 2RAUA 2QE7D 3R4VA 4RA6B 2H07A 1LPOA 3E23A 3DBIA 4YFKA 3JARA 1PYOA 1JHAA 2QRJA 5AI8A 3AB8A 3D0KA 3QTBA 4IFTA 3FFWA 3H2IA 2CD9A 3KR2A 3WLKX 2DBRA 4XRGA 1AQ6A 4MVCA 3H87A 4RCVA 2AJQA 1P7CA 3P4XA 4KPUB 3AR4A 3HNOA 3MSCA 3WK4A 1VCOA 2V4ZA 4URUR 1WMDA 1HFKA 1YMVA 2VJPA 2VXCA 3CLTC 4WXPA 2JAOA 4B3XA 1JIJA 3C3XA 3NH6A 3REFA 4ZA2A 1UM9A 4H7PA 1NL3A 4NPHA 3FROA 4AS2A 5K01A 1QKIA 2GNOA 3OZXA 3EPLA 4Z53A 1PV2A 4FYPA 5FR2A 3WRYA 3D1JA 1YIDA 5HQTA 3RSLA 2GLEA 3E0FA 3LBYA 3O95A 5K0ZA 5LMNB 1TAMA 4C8KA 1SVKA 4P0PA 1NTRA 1NMXA 1Z2OX 1OREA 2OZLA 3KPWA 1JSZA 4KK4A 3LL4A 3N0WA 1S02A 3QKRB 4JLBA 1GNLA 2JI9A 3M70A 3SAJA 1P33A 2XUFA 4JUZA 4O4HF 1ADBA 1CR6A 5K3OA 2EW2A 1MG0A 1RCUA 1Z82A 2BZ1A 2EZTA 1VGVA 3NBFA 2VJCA 2EJBA 4MP8A 1X66A 1P9RA 3HCPA 5JRTA 4B9UA 4QW8A 2BR4A 4FHCA 4J4BA 2FGKA 2RGEA 3WC4A 1PBTA 4TTQA 2UVRA 4TVSA 1KDZA 2BT4A 3IOEA 5FPSA 1A2KC 2HRZA 1FBTA 2HUNA 4AJLA 3KJFA 2DT5A 4YRKA 2NO5A 3ROZA 1U2TA 3EDQA 3RW9A 3PUIA 1Q0ZA 4FYVA 3EIOA 3M3PA 2OEHA 4C7YA 2HJ9A 2Q45A 4ND1A 4LDJA 5CRIA 1OX4B 2CZGA 1IZ7A 2DTDA 3E2MA 2OQVA 1C0IA 1ISRA 1DWUA 5AI6A 1XQ1A 2OAGA 3I2IA 1JP7A 3PIDA 4F71A 4FW8A 2O07A 2RGCA 1YL6A 3L6CA 4L76A 1BD3A 4KPUA 1U90A 3RH6A 3WHKA 3EFBA 1ONNA 3OSUA 1MZVA 4E5KA 4FC7A 2RB4A 3P0RA 4JP8A 2BLNA 4TV9F 2VYND 1HZZC 5E7QA 5K3FB 1B8NA 3WBFA 5KFAA 2CB9A 2QX9A 3WTCA 4M1MA 4YV0A 2QX7A 3RBXA 3VM6A 4TXHA 2JCBA 4YP3A 3NHSA 3WSWA 3W4IA 1DTWA 2C5FA 2GYYA 1B22A 2FJPA 3KZ1E 5ADVA 3MS2A 1B2LA 1H2AS 3MD9A 2CE2X 2NRWA 4QD3A 4DUPA 4RQ7A 1ZR2A 1ESZA 1XRPA 1RM4A 2VANA 2XRMA 1F8FA 3F97A 4IINA 4R9VA 1XRSB 1SIWA 3LLUA 2MUTA 1TT7A 1IEXA 4PQFA 5KSYA 2WJPA 4MYDA 1GNPA 2WAAA 1XJ0A 5EXTA 1JT2A 1NW4A 2AEJA 3W6UA 3TF5A 1YR1A 4XGKA 1LV7A 4RZ3A 3I42A 1OQAA 1CG6A 2CJXA 2NSDA 3OIYA 3QLTA 3RO7A 2YHAA 1ECBA 1R8JA 2ZRAA 3NOVA 4V2IA 2I76A 3KQVA 3NYQA 3RB6A 2ETVA 3HCDA 4K86A 4MCAA 5CDUA 1QH8B 4OTZA 2RBGA 4B74A 2PQ6A 1IUOA 1P6QA 1DQPA 1I32A 2QLLA 1JTEA 2A4KA 2OCLA 4LSMA 1WETA 3DJYA 3L1KA 3IB6A 5I9SA 3KP1A 1TK9A 4YGYA 3CWQA 3PV8A 3H4BA 4H0FA 5BQFA 5C5DA 1ULHA 1PR5A 5GJCA 5GZ6A 1SKMA 2MAXA 4KO1S 1X39A 2MWMA 2R7MA 2IT1A 2JLUA 4KJXA 2QQ0A 1DLJA 1E1DA 2C58A 1JQDA 3ENQA 4QWAA 4EYOA 4DCCA 1YB7A 5DSXA 2FY8A 5THXA 1YAHA 2D74A 3DE3X 3ZDFA 2XY5A 1ORIA 3VOBA 1N2CA 5ER9A 1H42A 1NW3A 2DULA 3KKAC 1CK4A 1Z2PX 1KI6B 1YVDA 2V7UA 2ZI3A 1FA9A 1WD5A 2ZI7A 5E6UA 2NTNA 2AG5A 4TWZA 4EY8A 3JSXA 1W29A 4WZ6A 3GT7A 1W59A 1WM1A 1WHTA 4CCAA 4OHOA 2QZ9A 4EEXA 2O4CA 2YYAA 4EJFA 3FFAA 4JI7B 4GC7A 4DF3A 3I2FA 4FFWA 4DNXA 2WAMA 5CFZA 5JAHA 2K8AA 3ZE1B 1XDSA 3WP1B 3OJSA 1CI4A 1GVHA 1U7XA 3G0GA 4Q19A 5IC5A 1E1MA 2Q6VA 1TKDA 1WMBA 2PZEA 1HMPA 2UU9B 3MT0A 2FWAA 1U4NA 1G21E 1L3UA 1OSNA 1PEAA 1KFSA 4FSHA 1TE2A 4XJVA 3M1IA 4I6JA 5AQEA 1KY2A 2BELA 1XMSA 2WVAA 1GNQA 4ACAA 4QTXA 2GZRA 3WGKA 2A1UB 2C9OA 1P39A 2JF0A 4GZLA 3SAHA 4YMIA 2ZYHA 5F51A 2Q1TA 3EG9B 4L8GA 4MUBA 4F85A 5EYPA 3SYLA 2PX6A 2D8CA 1CUBA 3LVBA 3O8LA 4J2OA 1QHHA 3FDIA 4K6KA 3SF0A 3RVJA 1L8LA 1E5TA 1NI4A 1PLJA 3B82A 4MYTA 5CM2Z 1JXEA 4OO3A 2FW7A 1OBVA 3T0GA 5KQGA 4E2ZA 1ID8A 5COQA 1IHDA 4P3OA 3AZQA 3AXSA 1C3VA 2CSUA 5GAJA 3LRXA 2O7QA 4NLNA 5TNXA 2QR5A 1OV6A 4RX1A 3TZBA 3I3OA 1GFIA 3Q85A 1YRYE 4OL9A 5BYJA 4DT1B 2P91A 5TPZA 1EXDA 5H81A 4LISA 3BM5A 2PT6A 2MINB 4C8MA 3QF7A 4WX2B 4EI9A 4RK6A 3WL3A 2Z6AA 1ZUHA 2PZBA 2R6CA 2XOXA 2QXYA 3DOEA 4BUJA 4BQIA 1JR6A 4UVHA 2AFRA 3AFGA 1KJYA 2HGZA 1TPZA 4XI9A 1Q0TA 1F2TA 2IS6A 3D8UA 1DKLA 1C20A 2FZWA 4TQGA 1F8YA 3KG2A 3B60A 4IHKA 4KG7A 4C7JA 4PAWA 4H1UA 5DTRA 2HUPA 1MOQA 4KXVA 1JALA 4L7QA 1QCYA 1ICEA 5KTSA 1L5MA 3PFKA 4ML3A 1DTEA 1BWPA 2WYHA 3AG5A 3D7KA 3LTEA 2JI4A 3F2BA 4YXWA 3SY8A 3WQBA 4XWOA 5KNCA 1IPHA 3K0HA 4QOHA 3IEUA 3Q12A 2QRPA 4MMYB 2V1XA 2HHQA 3SP1A 1BOFA 2Q1YA 4BO5A 2I91A 4IPTA 3F8TA 5ULLA 4F9EA 2AOTA 5ECWA 4QZBA 2GRAA 3VYTB 3ZU4A 5AUOB 4ZYZA 5AI9A 1EFTA 1N5KA 1SIJA 2GUGA 5JXIA 4NLGA 1W87A 3RIGA 4B83A 1NK6A 1GRCA 2O7RA 4KN8A 4DQLA 1QVAA 4DW8A 5JXGA 5HK9A 4BX2A 4M9RA 4FZVA 1EA7A 2NPOA 3HJHA 4IVQA 1CQJA 2E4VA 3AESA 2KS6A 3X2SA 5CP2A 4CT0A 2H18A 4DNPA 3UN1A 3Q0IA 3UHFA 2PFOA 3FSGD 2GD1O 1I0LA 4PVDA 1WG8A 2J9RA 3L8YA 5KFXA 5DB6A 1NHGA 2PG3A 5FUBA 5FOQA 2PRIA 3EVNA 3MJRA 3JD2A 1EDEA 5LL6P 4WBSA 3BBPA 3PW5A 2AOXA 3B5IA 1YK1A 3GLHA 4NMXB 3ZE7A 2MOKA 5GIOE 3ZJUA 5BNTA 4QVGA 4FJ2A 2D5AA 3A9TA 3G2HA 4RCZA 3KZMA 3SEFA 1WNFA 2PMZF 3QLVC 4PPYA 2PR2A 1U1IA 4G5FA 4A2CA 2QVXX 2P35A 1GZUA 2OCBA 3NC4A 4DDHA 2WB1F 4HZUB 1GAWA 5T67A 2AUNA 1IVSA 3O1HB 3WK5A 3PNCA 4QZ8A 3AY0A 1Y4AE 3P19A 5BT9A 3ZCQA 2H9YA 5BY2A 1WHSB 4NLKA 4X3PA 4D8UA 5A0TA 3CRW1 2X6RA 3UWOA 1DB3A 1DTSA 2ZUEA 2K7FA 1NN1A 3VC8A 5DIFA 1YKFA 4MAAA 1AKRA 4HEQA 4D98A 1QSSA 1ISPA 5BN4A 2H2GA 3A6EA 1FDVA 3RPEA 1S10A 4EJ0A 2FUG6 3ANXA 2AIRA 2CNOA 1SL0A 4D8YA 4ZXPA 1MB2A 1JLHA 3V48A 4DBZA 2YWXA 2UXDB 4PZDA 4C30A 4X24A 1JB9A 3WMXA 2Q41A 2GEKA 5AW0A 2VF8A 1JIKA 2ZSIA 2VOJA 1RABA 3Q7PA 1ZCZA 1EXWA 4LRWA 1ZIOA 5BURA 3W3AH 3PEYA 9ICLA 1JV2B 2I03A 4D25A 2H2AA 2EH9A 4MR7A 2QV7A 3A6KA 4MKHA 5CH5A 1QRAA 1S2NA 3DVQX 3MJVA 4MV9A 4TMXA 4RV9A 3BD6A 4RSRA 4INAA 5EZ6B 2ZG6A 4IFIA 2C7RA 4G1EB 2EP8A 4WN9B 3ABZA 5DNWA 3FUUA 5IJ0B 5EI5A 4KO3S 5KVCA 2WVGA 4M8LA 1JB1A 3VYVA 4UB8U 2VWPA 1JI3A 4W5NA 4MXDA 3DCYA 5A71A 1BKYA 2W0SA 2HNKA 4X1KB 3IP6A 3N74A 3V8MA 2XDWA 1JKXA 4HDSB 4MQBA 3WSTA 4QTUB 2EKZA 1XVLA 4IILA 4YQEA 2XGPA 1S6YA 2Z98A 3PIRA 3OIUA 3ZHCA 3FPHA 3ZGVA 3TGWA 4IHAA 1F4LA 4R65A 3SLRA 3DYBA 1AIPA 1L4HA 3T7EA 5DH9A 4IDCA 4QIWF 4OQ4A 4X8OA 4DV5B 3QNUA 2VSOA 4FXPA 4YDRA 2M6KA 1MA7A 1R27A 3DL0A 3FLEA 2B36A 2ZPAA 2OQRA 1EAYA 3KOMA 5FWXA 1RZUA 3T7AA 5E1OA 2Z8YM 1J9ZA 5I7RA 3DGFC 2YMLA 2BMWA 3FYCA 3MXOA 1VXRA 3QVTA 5EVCA 5KT5A 1J99A 4WHMA 3N8GA 4M0DA 5C7LO 1WR8A 2Q21A 1FRZA 2GJ8A 4ZQHA 1RYYA 3KEQA 2CNBA 4MUMA 2H5EA 2OGTA 2YRXA 4B3GA 3FOCA 4XRRA 1DX6A 2CLDX 1G38A 3OIGA 5JDIC 4HOYA 4FMDB 3TFQA 1PFGA 4IDEA 1D1SA 4KIUA 1N6LA 2BGUA 2G8LA 1SCUA 4W5QA 4OK5A 2FMSA 1P1JA 2DBZA 3OO0A 3UJBA 3FUXA 4WNAB 1AV6A 3ZQ6A 1BXKA 3BCRA 3O2NA 3L8ZA 3DO6A 4MIKA 1UR5A 4QYWA 3TCXB 3UCXA 1JSLA 2P2SA 2D00A 2QP3A 3IMEA 3C5CA 3ORFA 2KHQA 4GX5A 1MQ3A 4HAUA 4K6CA 2KZMA 4N3CA 1XZCA 4RO0A 2O8CB 4PR3A 3VR2A 3KXPA 2X3UA 3HBNA 1E9VA 3OZAA 1AGPA 3N7UA 3THSA 3IX7A 5AOVA 2ZYAA 4DMHA 3GHYA 3HHPA 3K75D 5JATA 3KD3A 4ZAFA 3KKEA 5AVOA 1W2WB 1X87A 4FMCB 3KPVA 3GBSA 4OI1A 2QZPA 5LQJA 3E6AA 1N62A 3D3WA 3B1WA 4L3VA 3CV3A 4XYGA 4KLSA 4P4NA 1G8JA 3LA6A 3QFHA 1V7CA 1NJWA 1KZ4A 1JWBB 1SBNE 2IUEA 2B37A 4OQQA 1GUDA 2ZCUA 1E1QA 4M37A 1MVNA 2XITA 4X7MA 5DLFA 1LLFA 1KMNA 9ICQA 5JH7A 1YQTA 4O3SA 1CEQA 2QRGA 3KBOA 1UHUA 4CR6A 3O82A 3LQKA 4QRIA 1XP5A 1OI4A 2AXQA 4OSEA 3G6KA 5M3BA 1KVQA 3OJOA 1BGXT 1XKXA 4QM6A 1YZKA 3PXXA 5D87A 1TJPB 1Z0IA 3U3RA 2W6PA 4J7UA 2TSYB 2C9ZA 1GFZA 1SCJA 2O3SA 3B6EA 3BMOA 3MCUA 2OGUA 3BREA 4QXRA 3KFUF 4AYWA 4BZWA 2CNWD 1QRDA 2HHAA 2H2IA 1PJ4A 4W6ZA 1ZQGA 4NULA 3WMEA 1M7BA 4HH1A 4XVRA 1WO8A 1Y5LA 2ZUCA 1YSCA 6ABPA 2Q5JA 3S2IA 4J9SA 3RRHA 2O23A 3CG4A 3ORQA 4DIBA 4YCAA 4GP9A 1K5HA 2LXNA 5DHPA 2BF7A 4RF2A 3PPVA 4UHFA 5D5HA 4QA9A 2GWHA 2PIAA 1EZ4A 4G0ZA 2HLNA 3BZKA 3B70A 3IEXA 5I9IA 4ZQEA 1HL3A 5CDGA 2HDHA 3O4GA 1CQIB 2DTXA 3AJRA 5ALGA 3PRKE 1UUFA 4IIYA 2Y1JA 1U8CB 4XW2A 1VJDA 1T8TA 1EVJA 2CJPA 2PFGA 1IN8A 2PD4A 2V03A 1QGAA 3BIWA 3EF0A 3FFXA 4PRYA 3WGQA 4DUZB 4UTPA 4JI0B 3GVHA 1X2IA 3U9LA 3AGPA 5BR7A 5F7XA 4CFSA 1FIUA 2VG8A 1QGUB 3L92A 5GV7A 2DUYA 3O3MB 1S2IA 2H2DA 3PPWA 3O1JC 1CS4C 4KR3A 1FRQA 4D4GA 3OFND 2WIDA 2JJ2A 1QLNA 3V1UA 1E9CA 1NAHA 5CNMA 1YWGO 1YKSA 3MCAA 1KR2A 2B0JA 2FCRA 3KEGA 4TL9A 4ECWA 1XJWA 2ODWA 1R6AA 2ZSFA 3H0CA 3N6XA 1KFJB 3E18A 3NHKA 3CUYA 3HB9A 4HDOB 5JXWA 4R8UB 4XSHA 1P4RA 3T7CA 4H7JA 4BAGA 1RAEA 1ACLA 1D07A 3TADA 7ICJA 1AC5A 3QEMA 5K8CA 3N7RC 3KLPX 1XGKA 2GESA 1ZGHA 2DKXA 4KE8A 5AI0A 1VMIA 3V42A 2OV1A 4II2A 2E9SA 3T7IA 5KQPA 1XRRA 4DT1A 5K6RA 3T1TA 5ICSA 1M8JA 4RDIA 3WFIA 2HFKA 5KFVA 1N5LA 3NYRA 4DB2A 2FQWA 2HDOA 1TTQB 1B74A 3ZDZB 3WGHA 3A05A 2FNAA 4IDDA 3LQRA 4B40A 1NI4B 3AKCA 2W8KA 2OO5A 1C0PA 2O9JA 3SYMA 1MN8A 3TRKA 4BKUA 1FVFA 3QI7A 5IU6A 2Y1LA 3FYTA 1EFDN 4B9NA 1XQVA 2LKDA 2X0KA 3GZNB 3PB3A 4HQKA 4AMUA 2YY6A 2NSYA 3RIMA 2PFKA 4I5DA 4CM4B 3QU9A 3PMNA 1A5SB 1AKYA 2FH5B 1R12A 2HC9A 2VYQA 3A3PA 4X1YB 3EIWA 3IJEB 4S1TA 4HSGA 4KIFA 3SU8A 5BNIA 5EIFA 2V9PA 3C29A 1JE1A 2D3TA 4E5VA 3OOJA 2CLOB 2GM4A 1RJ9B 2I1LA 2R8BA 2E3TA 1I6KA 1ZG3A 2PUHA 3QXHA 1YRBA 2BMEA 2DMRA 3RU2A 2YN2A 5KG6A 2GEUA 4NYMR 4F5YA 3VJLA 1D9XA 2GNAA 3SSOA 5BSWA 2KM1A 1HLDA 4L3WA 2PJRA 1CUAA 1E79D 1G4UR 1RQRA 3ETRA 1TU4A 1WMEA 3DL2A 1OTHA 3L4BA 3SX2A 4YMHA 5KT6A 5LZ4A 2GKOA 1JVNA 3VO9A 4MKXA 2BN4A 1QORA 2BFWA 1S0UA 1V8PA 4OD0A 4Y9RA 3MMNA 1XZJA 5K3DA 2XZTA 4RENA 3ULKA 1ZQAA 1I2CA 2O05A 1QZUA 1RYNA 3OPNA 3OWXA 2E8NA 1AUOA 3FYUB 4P38A 1Q83A 1NE2A 1N2CB 4PC7A 3D31A 2QI9C 4QYSA 1JHXA 4R71A 5A4KA 1XHLA 5ALDA 2ZJ0A 1HFWA 3VH3A 2CBZA 1QOZA 3B53X 3W7BA 3ZTWA 3H19A 5K3EA 1KORA 1JEJA 1OXUA 2JVJA 2VP9A 3R6LA 3D5TA 3N2KA 3Q4GA 4LRQA 5DG8A 4DTIA 2ZIEA 1EBBA 3GPBA 3I72A 1KEVA 4G4IA 4R3NA 4EI7A 4YXWD 2YOGA 2ZIAA 1NHWA 3K9GA 3KSRA 3Q9UA 4RLHA 3ZBQA 4B8WA 4B80A 4RACA 1BJKA 4Q7LA 1T94A 2XC9A 3B7PA 1YR6A 2AZTA 2QVCA 3A9WA 4DUGD 5KFBA 4CM6A 2D2IA 2XPCA 3UJCA 2FMPA 3WP0A 4QW9A 5JNTA 1L6RA 4IR7A 5DLYA 1LSOA 4BP1A 3A4MA 3X1YA 2Z8ZA 2WABA 5HM8A 5KSZA 5LSAA 2C9YA 4JV5B 5C2JB 2AOVA 2RGWA 3ZE9A 5G0VA 1KOFA 2P7IA 4Y6SA 2F55A 1DMRA 1HYHA 2Z95A 3DUFA 4QU5A 4LHXA 2IBKA 1DKMA 3E9QA 3A9RA 2GEDA 2A57A 3I5MA 1NNUA 3L6EA 4ZOLA 3OQHA 1R0KA 4WJ3B 3VU9A 3BDVA 3CZ5A 4BV8A 3NBQA 8ICTA 1K2VN 1BFUA 1JGTA 5CWRA 2O3JA 3PL5A 2GZ1A 4OP2A 1Z3CA 4X71A 3IG5A 5KAFU 1SOVA 1DQRA 2UUCB 1QX3A 1SRRA 3RLFA 5AQ1A 3EVBA 4O5CA 2HDNB 2ICAA 2QTLA 3CIOA 3ASZA 1N25A 4MIOA 3HUTA 9ICNA 1TYEB 1NX6A 4C88A 3KKQA 3WK6A 2QYHA 3R0VA 3IR7A 4RVCA 1J5EB 1Q57A 2QM8A 2EBWA 1GR0A 5K3FA 4UHHA 3PW2A 1X8KA 3UXPA 1EXMA 2HU8A 2OV4A 4EG1A 4G0QA 4NDNE 1UBGA 1ATIA 1Z7GA 1ADFA 2ET6A 3PR1A 5GVRA 4QUGA 4PRZA 3PNBA 2GRUA 4QXAA 5FA8A 3AX6A 4Q6BA 9ICTA 1L3CA 2FP4A 2WYIA 5J2UB 3IEMA 5KTMA 1JFFB 3UNXA 4CMAA 2E4UA 1R8QA 2QTBA 3N2ZB 4IVRA 5DM2A 3PGXA 3G7UA 2C22A 1WXIA 3HR7A 4IVNA 5F9NA 1TZJA 1M34E 2CF5A 1TEHA 2FEXA 4FDUA 4BVEA 3O8OB 4ZDKA 3K4QA 2OO5C 4OOFA 1T0UA 5KTOA 2BFAA 1RJFA 4U7WA 2B21A 3AC0A 3O8BA 1UDCA 2B4AA 1NK9A 1ZQXA 1RYEA 4UQPA 4OHUA 4MULA 2P2YA 4L5JA 5AESA 2Q6LA 3ZZNA 1NZBA 1Q11A 3EF1A 4MKRA 1P19A 3AFOA 3PUWA 1OW3B 1SXPA 4M99A 4P22A 3QZ7A 1ZMRA 2CKMA 5FI3A 4Y2YA 5AW8A 3H65A 4CG2A 1PS0A 5KOYA 3VA7A 2PH7A 1NT2A 4P0TA 5DDMA 5BUSA 4TQRA 2V6FA 2ZVDA 2RAVA 4PPXA 4FGJA 4NJEA 1N2EA 4WQMA 1Z5ZA 4WLVA 5CIQA 3DQPA 3GDGA 3ISBA 4DQ0A 1VLQA 4YYEA 2Q1SA 1E2KA 4GSLA 4D79A 3BPSA 2V1UA 1Z3EB 1L9XA 3F8SA 4HQNA 1M9NA 2NO1A 2OENG 2HK6A 2FVXA 2O57A 1U7WA 2FSVC 4LK3A 2C4TA 3UMJA 4H4EA 2ZUBA 3FKSD 4F9FA 1KMIY 1WJGA 4R5HA 1K5OA 4GZ3A 1G17A 2ZKLA 3JARB 4GI5A 4M2YA 4MH0R 4WY2A 1AGNA 1SZJG 2JHGA 1ZM9A 4HNAA 1SKRA 1R5BA 1YHNA 4QPDA 5E3JA 4DXDA 3AHIA 4D45A 2PH5A 3G2LA 3S8EA 2I2XB 4O5KA 2FR0A 4PHPA 2ZTLA 1MT0A 5CW1A 1PLLA 1YS7A 4ZD6A 4A2QA 3MTBA 4EBEA 3OAAD 3TQQA 3G8DA 3FBWA 1QYVA 2VSNA 2YV2A 1E3IA 4MUEA 1BWRA 4GLFA 1N6HA 1OWNA 4UU8A 1YCFA 4O3OA 1CSEE 1QZZA 5A6SA 3FHTA 2RCNA 1KI8A 2I4LA 4GU5A 1UAAA 1YFJA 4NXMB 2IC5A 2XB9A 3K8ZA 2ZJZA 3PHIA 4PSCA 4WRRA 2AEFA 4J9QA 4MFFA 5TX7A 1LVHA 3S44A 3ZJ4A 2O5VA 4XX0B 3GJXC 5L7WA 1DOAA 2GJ4A 4JOCA 1V45E 1PVOA 1GPH1 3BKXA 1SC3A 1DAEA 1J8QA 2PI5A 2EKQA 4A27A 4ESVA 3L05A 4QJ4A 3C97A 5AHRA 3AF5A 4R1SA 4C3VA 3H1BA 3HJEA 3FR7A 4HDMA 2C94A 4LVUA 4ZHSA 4JLAA 1PUXA 3QX3A 2POQX 5ESXA 4M2LA 2QSJA 5L40A 1L1QA 4OKSA 1DWPA 5CD1A 5GTIU 2HIAA 3DM5A 4OHKA 1IOVA 1Q21A 2IUYA 2QSYA 1OI7A 5GQSA 4KXUA 1RAAA 3DE6X 3GQCA 4GI7A 1T6XA 2JLAA 1B6TA 1P62B 3G23A 4M9SA 5AP9A 1HUOA 2QRUA 2J9FB 5HXAA 7ICKA 5KFQA 2FWPA 3ASYA 2COKA 4RQ5A 1XTZA 5ECYA 1E2HA 4E94A 5J4LA 2D8AA 5KFWA 4C7XA 3IRVA 4LCEA 1K08A 3D2NA 1QZTA 5A9SB 5KSOA 2BM9A 4G6ZA 2VAWA 2LIPA 3CO5A 3JQAA 2DJIA 3OMWA 2IYLD 4RM2A 4CL0A 1STOA 3H0KA 5B7QA 2Y0PA 3RJHA 3NRZA 1PFWA 4CDGA 4F5NA 2JFZA 4KJZA 1JG2A 2Q3MA 3H5TA 5IFLA 1FFSA 2CDCA 1Z25A 3RUCA 1A5ZA 2ZYIA 5J0SA 3G2JA 4M9ZA 3IIKA 2C0QA 4YCDA 4B3JA 5KKNB 2R7LA 2OMEA 3BJZA 4USAA 3MOGA 4IF4A 1SVUA 4QFDA 3WBJA 5IS2A 4PIVA 2F9LA 1CCWA 2HJWA 2HA6A 2GM3A 1KE1A 4GSYA 1W88B 2CHUA 3HXKA 4BFZA 2VYFA 2BSAA 3SOPA 1A4XA 4WZAE 1PVRA 1V2GA 1OZ0A 4W63A 1QGYA 4TOIA 3QTTA 4TVOA 4LFBB 3OT1A 2TMKA 4O5AA 3OZBA 3WIBA 4XLLA 2QQ5A 2ABWA 3V4SA 1T3LA 1P1HA 2OCXA 5C4MA 1T5SA 1V3VA 2EBFX 1JH8A 1I7DA 1E2QA 5CHGA 3ESCA 3PRYA 2QRHA 2IX9A 4BDTA 4B9SA 4N0EA 3W05A 1K2WA 1KA9H 1N2GA 3KLNA 3K32A 3UBTA 5KTQA 2Q4EA 4C4RA 5GOZA 3NCHA 3FNHA 3NANA 2BH2A 2X76A 3DMGA 4CF6A 2XMZA 4OIMA 4UPDA 2OZPA 2QHXA 1NXPA 2WIGA 2Q3FA 3VYWA 1PRYA 2AFHB 2KEYA 1J1IA 2WHPB 2Y3IA 3L7BA 3ORYA 1CUFA 1J8VA 1LA2A 2DPJA 2W2KA 5IN5A 4E22A 4CODB 5IBCA 2DKOA 3OJEA 4WZBE 1G9XA 3QX8A 3TDNA 2W2TA 1KJNA 4R2WA 5CT6A 4DL6A 4PN3A 5IHPA 3C6XA 3ENNA 4PYLA 4W4TA 3TG8A 4GQAA 1GPYA 3UC9A 4H7EA 2H52A 4NS4A 5CD9A 1FUKA 4UUMA 3PTAA 3A1WA 4CIVA 4GS5A 3FCXA 1SHUX 1IUPA 4Q1CA 1GRRA 4Q47A 1PU2A 1QU3A 3ZV7A 2IXAA 4TTIA 2G9UA 1ESMA 1VCMA 1PL7A 5JSFA 2BGNA 1SXJA 1P6XA 3HP7A 3H9JA 4OGGA 1XLTC 3OZEA 2OWEA 1T9KA 1X9HA 3L2OB 5LP6C 2WK1A 2EXXA 3K16A 2LYHA 3RFVA 2BH9A 3SJ7A 3S1AA 2H4HA 2J7KA 4FX2A 5FBWB 2BMAA 4WLFA 2GCEA 1KGSA 3I83A 5IDXA 2AF4C 4R1MA 5EJ8A 2YC2C 1J23A 5IRCD 1L4LA 3KT6A 4PGGA 5A7FA 4I99A 2R8IA 1RQGA 2EL9A 3AR6A 4HFRA 2PSJA 4L8LA 5T3UA 2QP4A 1XEWX 3GEBA 1IQUA 1Z6PA 2BJWA 3CZQA 3U7EB 1ISFA 3PHBE 3R9WA 5E7IA 3ZS8A 2X8BA 4C4OA 4IO1A 2CWDA 2J8ZA 1RJWA 3FKSA 1GARA 2X8JB 2G0NA 2QUAA 5KG4A 4RIFA 5AW1A 1IZZA 1G3RA 2H7VA 2HQOA 3DDZX 5FF9A 2QZZA 5IEBA 3SR6A 2Z2KA 3FZNA 1BOOA 1QQ7A 4BEJA 2DJ5A 3LK9A 3C1UA 4FFLA 2DQ4A 3GJ4A 4M6WB 1CQXA 3NFYA 1IU9A 2WPDD 4NH0A 3F7MA 2IHZA 2XCUA 2EV9A 1C2TA 3ZH2A 5LLSA 5JWHA 4KWHA 4ICAA 1XTVA 2W4QA 3OCCA 3FB1A 4FZ3A 1ZD8A 2Q8NA 3T5DA 1WUHS 5A9SA 1L0BA 1FBNA 1ZXBA 4D7AA 1FFBA 2WG0A 2XXBA 1MN6A 1XDGA 2BI4A 3LCRA 4CKXA 3UYKA 4TYMA 3GIIA 3FGNA 3SHTA 1Z1BA 2JH3A 3CCFA 3PZPA 4MYUA 3RGWS 3RJTA 3HPQA 2PX2A 3OPYI 4S24A 2LCFA 2NU9A 3RU9A 4BKOA 5C80A 4KVAA 3ENVA 2HT6A 5KYNA 2IS4A 3WICA 1EUCB 5HSGA 4XDGA 4MDYA 4JI3B 1SZDA 2XCTB 1N61A 2CV2A 2ZGVA 3W3AD 2GEFA 1N32B 3FTQA 4MINA 4NMWA 4NONA 2PEYA 1XX6A 1GYRA 1A72A 1ABFA 2PGNA 3BXPA 3JALB 4R16A 2C7QA 2GCNA 5HIKA 1U48A 4QPNA 2GTPA 1CR0A 3DZFA 5EFOA 5DISB 1BHSA 4DWWA 3B38A 5AJHA 1CULC 1Y3IA 4F9GA 3CB4A 3USZA 5BSUA 5T57A 3MHTA 9ICJA 3I8SA 2XGQA 3B8EA 4D6PA 5HRUA 2H1OA 2VDWA 4TSFD 4G0XA 4ENTA 2P75A 4WPGA 2HIGA 2QUZA 2CB0A 2V97A 2NVUB 3OPMA 4KXWA 1Z36A 1U49A 4F38A 2WJHA 5KFKA 1BRTA 2YWGA 2RHJA 4WK0B 3SMQA 3DVLA 4EGFA 1W0JD 3EXAA 2P6OA 3WYEA 3VPGA 2Q46A 1KTQA 1WEKA 3ND5A 4OKNA 1WZIA 3AR2A 5DM1A 2X5OA 3NVZA 1ZJYA 4PWYA 1UBHS 3NP7A 1N5IA 1T34A 4LF8B 3RFAA 1ZQNA 2KZZA 2JK1A 2G8NA 1YT5A 4MW7A 4YO7A 3WRWA 4RQ1A 1CJCA 1Q1ZA 5B37A 1VRVA 1VE9A 5G0WA 4RE5A 4A4DA 3TOXA 1VYHA 1QQAA 1E3DA 2CXQA 4JYMA 2QSZA 4HVCA 4ANFA 5C5EA 2CWWA 1X1EA 1Q7TA 5TQ0B 3OSNA 3W8RA 3N97B 2DQYA 2AVNA 3M6KA 3Q98A 4PYOA 1GCUA 1R6UA 2QTRA 1J0AA 4XJTA 2Y71A 5CYGA 2W2VA 1M66A 2EL7A 2Y0EA 3ET5A 1ZQDA 3WQQA 2A94A 2PMEA 5H83A 3GMIA 1N4DA 2F1RA 1NKEA 2ZK7A 3BL6A 5LXTA 5HPYB 2AHRA 1EFKA 2H16A 4AWAA 4L15A 3D7SA 2KJ8A 3IFSA 2P9HA 3X2EA 1NIPA 1RXUA 2FOLA 1FO4A 3PFNA 1T43A 4DA7A 1FVHA 2ZIUB 5ENZA 5IXSA 3IULA 3GT3A 5J0PA 4MRVA 4P5EA 4YCBA 4COKA 4PN7A 4DV2B 5ITWA 2VHWA 2Q7XA 4A10A 1JDVA 2A0UA 2AMLA 3L8DA 4DN6A 1ISSA 2RDIA 1M2OB 1B15A 4YN4A 3SV4A 4TL7A 3GXOA 3INTA 1J42A 2OB2A 1JKJB 3SF8B 5LA6B 4DZRA 4GYYA 2IEGA 1YQGA 3PX7A 5DEIA 5AVTA 1OFVA 2ERCA 3R5JA 4ON9A 1C4OA 1T24A 3KEFA 1JHQA 2DFLA 1H65A 1UBEA 1JVSA 1U3VA 2WJ6A 2JD0A 3D8BA 3VVMA 3B78A 3SBXA 2VA9A 1CIPA 2QORA 1D8BA 4Y8VA 4BC0A 2BTEA 3MT7A 4K9RA 2UV8A 1M5UA 3FZYA 3NIWA 4BQRA 3BJYA 1Y98A 2RHBA 1KFCB 2XMGA 3DT9A 2DC1A 1JPNA 2CNNA 3RKUA 4DOCA 5E1MA 2W2MA 3H1PA 5KZMB 3RTDA 1E1RA 3A7DA 2GN8A 3GLIE 3SI7A 1GZ6A 4ZQIA 1VQ1A 1XVIA 2F4NA 3QWAA 1GU7A 1C3EA 1I5OA 3D9QX 4ENQA 2GN0A 3ZHOA 4CF7A 1Y5MA 2AKAB 3OLXA 2WE8A 1X7ZB 1PHRA 2IEYA 3D81A 4KH0A 2IPOA 3TLAA 4U2KA 1YCGA 4UXIA 4YH1A 1FIQA 1Q1QA 3HNRA 5JS6A 1AKUA 2IYFA 1SC1A 3Q2IA 1U8TA 3GLFB 2PL5A 3WAGA 4XCVA 3MJTA 1NX9A 2LKYA 3FVVA 3PJDA 3KTDA 4O4IA 5GY7A 2V3CC 2O0LA 1DHRA 1HQKA 3DAHA 2V4UA 3VSDA 3AN1A 2X0IA 4JBIA 2QU8A 4PIMA 4RIHA 1OZAA 2XA2A 2LIVA 1PGNA 3DMNA 1FNSA 3GCDA 1V7ZA 2HW8A 4DCMA 2GDJA 1NMEA 1JI7A 3WNVA 1HFJA 4P4MA 2A0XA 3EXHC 4Q4HA 4US1R 4CT5A 4ZOLB 4ER0A 2OPHA 5L95A 4C04A 4N5LA 1EWKA 4KPGA 2BISA 3EEFA 5BMOA 1XRJA 4XPIA 5B1SA 2O2XA 3Q8LA 3P2IA 1OLUA 1XDBA 3VX4A 3OFKA 2YMQA 1I4EB 3P5SA 4HB3A 4LE2A 3I58A 1G6Q1 3OD5A 4PCUA 2FMTA 3FPLA 5IKEA 2O1EA 5KKCA 1UKCA 1GSHA 3A10A 3CF4G 1J0XO 3R3JA 3G1UA 2X14A 4KYVA 1A76A 3E1GA 4TS3A 4WVFA 4M9HA 1BQ4A 1GILA 3V72A 4I55B 1OGJA 4HEHA 4RL6A 3T99A 3VR5A 3KVVA 2EYUA 5BPHA 4C0LA 1K1SA 1O5OA 3CUSA 1E6EA 4XWTA 4HDQB 2ZIFA 3UANA 2VT2A 2H17A 4N5NA 3MFHA 3JVUA 5E4FA 3PX0A 3QHPA 1C29B 5I8PA 4A8EA 1CQWA 3AUUA 2OFOA 3INGA 3K4PA 2EHDA 3SAGA 4OQFA 3EEBA 3GEPA 3BRWA 4QLBA 3WA7A 3RC9A 2ASJA 5D00A 1TRKA 3C0KA 4IZ6A 3UPUA 2CD7A 1FFVA 2WU4A 1YR8A 3KHLA 2V55B 4FHGA 5CA0B 4RNMA 1GTG1 2SBTA 3OJFA 5I4BA 3T41A 4RPZA 2QN9A 4L6CA 1F17A 2JMGA 2GZSA 4AJPA 2WQ6A 5ALSA 4DDVA 2ZAIA 1N6PA 5HBRA 4EGCB 1NVEA 1A3CA 2E6KA 2H1IA 3DOIA 5FBKA 3P7MA 5IC6A 4RZ2A 1NW5A 5EWLA 3U3JA 4F4UA 2R8EA 4BFUA 1K3UB 4KLCA 4B17A 4BX8A 3G8BA 2O8VA 1A2BA 3LYUA 4FTWA 4W1SA 3CFYA 3RVMA 1PNOA 3VGJA 4YJGA 4AKGA 2NVBA 4ZMBA 4C3ZA 2GZ2A 3H1TA 4MCIA 3GG9A 3SG0A 1T9ZA 4GBED 4H1VA 4JUCA 3PMLA 3F53A 3L4PA 1ZGCA 2NU6A 3IAM6 1RJ9A 2JJ1A 5AK0A 3GV5B 1ZQMA 2B2CA 1N9GA 2CUKA 2W6IA 4KQWA 4YMGA 5AKKA 2QX4A 1S9DA 2OWDA 3AG6A 3LHSA 5JR3A 4I2GA 2Q3DA 3EZGA 4IQ4A 4JA0A 4BBPA 1D4FA 3K9FC 2ACVA 3NVAA 3QKUA 4DNFA 2WB2A 1QHIA 3RR8A 5CR9A 4YV1A 3OU6A 2BFCB 3S5JA 5BVHA 4PV7A 1MH1A 3ZZTA 4EKIA 5IT5A 3IJRA 2EAMA 4RV5A 2GYVA 5KNBA 4NJMA 4U5QA 5AKXA 3L4EA 3O38A 4HNQA 1U0EA 3R9XA 4DIKA 2IYWA 7ICHA 1BXRA 1SZCA 4TTSA 3DFZA 5LZ7A 1IDOA 3LS2A 4IQGA 4GI2A 1LPPA 4K2HA 3VTZA 5ESWA 3FI9A 2BCJQ 2I55A 5CCBA 3RABA 1HEKA 2OCIA 4B3RB 4H1TA 5AKHA 1AY0A 1TM5E 1EWQA 1RM0A 3U56A 1JHPA 4Z0HO 3WFZA 3ZLUA 5HZMA 3BMXA 1DIOB 3I9FA 5JTUA 3Q8PB 4ODIA 1Z2CA 1AKEA 3I9NA 4RPJA 3R5XA 4K4GA 2F1JA 4GX0A 4KU4A 1IQ0A 1FRNA 3HBFA 5CA1A 4R8UA 5HWSA 5M7EA 4MI1A 1B14A 1L5SA 1KOJA 3VKGA 1PJRA 2QWXA 3NHWA 2YUTA 1O94A 1Y6ZA 3GWZA 4OYYA 4XPIB 2PD6A 1GG5A 1W581 3AEXA 1GKLA 3UQ2A 1ADGA 2FEOA 2PH3A 3W8DA 1GKYA 5A2QA 2DOKA 4J0CA 4XB6B 5I8ZA 2P9ZA 4Q24A 2XT9A 1YJQA 4KLJA 4XZ3A 3M1YA 2FWBA 1H5UA 4ZAZA 4AK9A 4D81A 4LI0A 5C1BA 3CE9A 5J43A 2CFTA 4JJZA 3LV8A 4KGZA 4LOIA 1O2DA 4JXKA 4LFCB 3I0NA 4KMSA 5JY1A 2DY0A 3GJSA 5KNBD 2G3YA 1N4AA 1TQDA 4N5IX 4BBAA 4E5MA 1ZQTA 1Z4LA 1EX1A 1VI6A 2H5LA 3AEKA 4S3MA 4UPEA 4FGZA 9ICBA 3L7IA 1ZVKA 4I8XA 3GD5A 5HYVA 5KYYB 4I1PA 1E2BA 5LB2A 2L18A 1G21B 1PGPA 2MTBA 3WV5A 1XTTA 3PNSA 4YUAA 2V98A 4US2R 2PFPA 3MVEA 4ENUA 2R79A 2I9GA 2FLWA 3WQHA 3QBVA 1QO9A 2EU8A 5DOVA 1SBYA 2DTEA 1IBCA 2QP9X 3HDVA 2QMEA 1XTPA 3E22A 4O4LB 3RM3A 3U3OA 1CERA 3BMOB 4DCJA 4R01A 4H17A 2ZUFA 3CT4A 1P7YA 2VHEA 2JI7A 4NDAA 1ZOPA 4XB2A 1X1DA 2GEBA 2R7KA 4A16A 1BA2A 2H8KA 3HXPA 4HS4A 5AHKA 4QREA 4G5XA 3MSXA 4IRCA 4J0DA 2WLTA 3I28A 4JCOA 4TXMA 1JEYA 3BGDA 2JI6A 4KK3A 1BGVA 5E6RB 3H42B 3P4UA 5CNIA 4A26A 5JH7B 1ODKA 1BMDA 3BTVA 4J0QA 4PG7A 1HNXB 3V4FA 2VP4A 3NM4A 4C22A 2ZRPA 4I81A 1JKJA 1VHWA 2QGFA 5DPMA 1TK0A 1OH5A 3EIHA 1GUAA 4MKIA 1LBSA 1VL6A 3COSA 3E70C 1RP1A 3FCEA 3AR7A 1N3BA 1L8AA 5BPFA 1V7QA 2I3ZA 3FJ1A 3NJ8A 5CDFE 2GKSA 9ICEA 2VVTA 2VYVA 1XCBA 3RADC 4BGDA 3GJ8A 2MSCB 3LCMA 3R0ZA 1Z0AA 1V3UA 4F8JA 5EERA 2QUBA 4J90A 2FFBA 4DQXA 3LQ2A 3RH0A 5JMWA 2RG1A 5BSVA 1JBQA 1NZFA 2X9LA 4RIIA 2P1DA 2QRKA 3OT4A 2ZDHA 4LOLA 3D5QA 5K2MA 1Y1KE 3A32A 6REQB 2WF5A 5J4VA 4L1KA 5IULC 4ARSA 2VLBA 3ONEA 2DPIA 1RMTA 2DPHA 1DRGA 1Y63A 4LDRA 4J9PA 5CJJA 4DSOA 3U1BA 3L6OO 5A3VA 2HJGA 1HNNA 1QFZA 5C3UA 4EH1A 1SCUB 2WUDA 4EWLA 3OIFA 4XPZA 3IILA 5IASA 3S29A 1AQIA 3IBGA 4DRXA 4UTRA 4RLSA 2EWMA 1T1SA 4E4YA 5K8TA 5J2TB 2JHAA 1PZEA 3Q7RA 1XZAA 5DNVA 2Z4TA 3C6BA 5HE9A 7ICPA 1GZ4A 2EYQA 1JU4A 2C03A 5KFNA 2VQEB 2A92A 4QAJA 4H3VA 4O3FA 4RHXA 1NBME 3P96A 1QGDA 1C1YA 1XL0A 2PLAA 4ZQGA 2ODNA 2UZ0A 1UDWA 4H60A 5B5SA 4PO8A 5JCZA 2JEGA 5KNIA 1LK7A 1SKUA 5DYTA 1GCIA 1PKEA 2FAXA 1FFAA 3I8XA 5DM0A 1GAEO 3TIFA 4MR9B 1E3SA 3G79A 2PCJA 3L0OA 4AY2A 1QANA 4QBTA 1R8XA 2ZJBA 3O8RA 5SYNA 1QE3A 2NVUA 2SKEA 4RD2A 1S9FA 3A1NA 4H4DA 4HDSA 4ARCA 3F5DA 3PDIA 5AM1A 1BO6A 5CU7A 5FYDA 4W5OA 3NWEA 1V3TA 4LJYA 3PS9A 2R6FA 2CT8A 3TUZC 3LQ4A 3ZLVA 2KJ9A 4G1MB 2Y0SC 1NOIA 3PDIB 1FFWA 2FUKA 4G1FA 2DPYA 4ZCLA 1Z7YA 3AU8A 1SOUA 3UJNA 5C5CA 2SKCA 2O2SA 2QJTA 4XKJA 4DOBA 3ANMA 2OAEA 4BU0A 3MGGA 1Q7GA 4TQSA 2HHLA 2V7QD 2Z43A 2ZRQA 4QHSA 4UBCA 4GDFA 2VRNA 4BJQA 1HURA 1TDJA 4BGUA 2WD8A 5GINE 3SJZA 4MWSA 4YRZA 1JXAA 1NLMA 3R3VA 1FZTA 4BJ3A 2X5NA 2EOAA 2QVGA 1UIRA 3KQWA 3H5AA 2Z4SA 5AM0A 3ITDA 3OE5A 4L9AA 4PXAA 4WLNA 2XE7A 3B3QA 721PA 1OE0A 2V8OA 1KKUA 3IVCA 1UZMA 5J2IA 1CZRA 3JVIA 3QPBA 5DHFA 4PFKA 1PVQA 4PLWA 3WB0A 5A04A 2JFGA 4Z1MD 3B85A 4RKEA 1O6ZA 1E7SA 1JDNA 1RAHA 4CNBA 1A0PA 1N2BA 1IWOA 2H7CA 1HDGO 1Z2EA 3O9MA 4JXJA 3REGA 5LVAA 1SOWA 1EGAA 2O8DA 1PTJC 2J6UA 4PX9A 1T8UA 2O3RA 2AD1A 3B3GA 3TQHA 3M9LA 2ONCA 1U99A 3HA5A 2HH9A 3SAFA 1R8SA 5EP3A 1XJQA 3DB1A 1UWCA 4FE7A 5EPUA 3TEJA 6REQA 1VL8A 2VFAA 4EFMA 5K8JB 2X8JA 3BJIC 4JEUA 4B2PA 2CXUA 3N59A 4QGHA 9MHTA 1RI2A 1NK7A 4UUPA 1ZOIA 3QZUA 2VEOA 3OWHA 4MUAA 1F8XA 421PA 1M8FA 3QFRA 1FMJA 1M1XB 3CF0A 2DH5A 2J0SA 3BT7A 3LQQA 1MW8X 4LQLA 2YTUA 2C96A 3NVMB 2M6SA 5CVVA 1WTCA 5JJ5A 1RWNA 3LQFA 5IWAB 4B87A 2F62A 2OYRA 4CZ2A 1FFGA 2PGXA 2KK0A 4PYKA 1QIDA 4U4AA 2VL7A 1DQZA 3B5JA 1CZNA 4IFEA 1AK9A 4H08A 1DEOA 1ODJA 1TFUA 1W85A 3PW0A 3DLIA 4JC8A 4V0NA 4QG3A 4IDPA 2J4DA 1ILEA 1U2QA 3DBVO 1NUTA 1TK8A 1GKUB 5TF4A 1MVLA 1MB4A 3TZLA 4BJ5A 5LYJF 5AOCA 3RVBA 3C70A 4URFA 5TIIA 1EK2A 3M6UA 4J3JA 1FXWF 1AQUA 3E61A 2BKEA 5TB5A 4EITA 3H4MA 5LKAA 1AF4A 4D5GA 1SUIA 1URJA 4TX1A 4IUDS 2G08A 2CXYA 3L7MA 3D4NA 2EKDA 3QE3A 4LZLA 2EW1A 2FPUA 5BOSB 1K7CA 1W2HA 1YUMA 1RWKA 5F77A 2H3ZA 2J4FA 3DYIA 2AFHA 3LC2O 4I46A 1JHMA 4ARUA 4QTTB 2OKCA 3GEIA 2Y4NA 2FFJA 3ABSB 3TL6A 2W70A 4IDHA 1XOIA 2OG1A 4Q01A 5AVJA 1HUZA 1RCFA 2C59A 2XEXA 4QJIA 1D8TA 2FR8A 1RYFA 2PZAA 3IQDB 5EIBD 4CHTA 3OF3A 1C7EA 2PKWA 3TNJA 2IU4A 1IMOA 4U7JA 3EC7A 4TMKA 4FOTA 1CC1S 1A9OA 4HY3A 4WDRA 4IIDA 4X44A 1P0MA 5DQIA 3TAHA 2LBOA 1ITZA 2IZ1A 4ZEOA 1W76A 3VZBA 3ZDAA 4O1IA 2IS1A 1U2RA 3Q40A 4MB2A 3KXKA 2WOOA 1QF9A 3IYLW 2JJ8A 2QN2A 2QTWB 4MYHA 1KKMA 3GLTA 1OOEA 3AK4A 3MWEB 1T4BA 4EUFA 1UP6A 2OC9A 2X2EA 1ZXXA 4X84A 1OWLA 2C99A 3CLUD 3C5EA 2AMYA 4JU9A 1RFGE 1GNSA 1MC4A 4XFDA 5IM4F 4U2BA 3GZFA 1ORTA 3CLTD 4U63A 4I29A 3Q5EA 1R2QA 2O0KA 1XZHA 5FADA 5F64A 2NLOA 3LQYA 4UVDA 2ZLBA 4DR7B 1KEJA 5C7YA 4B5LA 4RF5A 1YA8A 3HBAA 3ICVA 3RAXA 2ZQZA 4HLUC 4KFUA 4UTXA 3R9XB 1W30A 4J3NA 3MM4A 4JHLA 1ODLA 4OBXA 1J97A 2VA2A 2Z1NA 4RULA 1AO3A 4DSKA 2BFCA 4BE7B 5DBAA 2J48A 2JS7A 2QA5A 2RGGA 3FLBA 1P7VA 2JJMA 5AYVA 4K0RA 4HZIA 1CHNA 4V1CI 1RYSA 4IQ8A 3SR4A 4R98A 3NM5A 1M2WA 2GX6A 4WFIA 2JFUA 1PUZA 2WU8A 4QBKA 6CHYA 4FS2A 4G5RA 1H38A 3KZCA 4Q93A 3QVMA 3K92A 4RDCA 2WTEA 5G02A 5L4NA 1DIAA 3M82A 1DEHA 1WABA 3OTGA 3ZWDA 3UATA 3EX7C 2CHFA 3BE4A 4JOSA 5DKFA 5KCZA 2WHQA 2AGOA 2GN2A 3U62A 3B1XA 3OG9A 1DPFA 4YJGB 3P2KA 4BFYA 3KZVA 1K9SA 2VUHB 2AF3C 1V9LA 2XWQA 9ICVA 3B48A 2EJTA 1YB6A 2AN3A 3PI7A 3RYIA 3RSQA 3X44A 2QX6A 1GN9A 1CZOA 1NC3A 4TXNA 1FNBA 4P58A 1DQSA 3WHLA 3TANA 1QDLB 1TYCA 3PQ6A 1HE3A 3Q3EA 3L3FX 1Y6RA 4IMRA 1GA4A 4C7BA 3TLZA 1KL9A 1LWOA 2DGZA 4XX0A 4UAUA 1DAFA 3AF4A 2M98A 2HU5A 4OHWA 4WMLA 3I32A 1SVOA 3R0XA 3T5CA 1P9NA 4JYAB 1GSOA 1MAWA 4QHTA 2WHRA 3TM4A 1SXHA 1X6VA 3S2YA 7ADHA 4JXXA 1BFKA 3FHCB 4AFNA 4J2HA 1MA0A 1D0IA 2RH8A 3DHEA 4OXKA 1QO0D 3GJ7A 5A6SB 3VO1A 3OY2A 2O6HA 5THKA 2R25B 1U6KA 3M4XA 3CURA 5DXAA 5BN1A 4OUDB 2A1TR 2OBYA 1PR1A 2J9YB 4OVKA 1QTIA 1BMQA 5B53A 3V2IA 1USIA 5G4KA 3QLJA 1IUNA 1CVLA 5G53C 3LX8A 3UJHA 5JZVA 4MMXB 1GTSA 2RRDA 2H85A 1A95A 2J7PD 2EW8A 4DLRA 4QWMA 4V0QA 3TW4A 2VTBA 1UZUA 6YASA 4JQSA 5KHAA 2C4VA 3RU3A 1C7YA 4O59O 1QV7A 4B6FA 3MGAA 3PSAA 1ZRSA 1ZBDA 4UM8B 4EGQA 4NATA 5EZYA 4QBGB 1AU9A 3HYCA 3SQLA 2ADMA 1TQ4A 2A4MA 1V95A 2J6CA 2ZJ3A 4CW7A 4QZCA 2JLVA 1PQ4A 2AGVA 4QIWC 3ZWWA 4BFSA 5BSEA 3OTOB 1NVBA 3ZWXA 3GIDA 4WV3A 2Q3JA 2EEPA 1ENPA 2XB2A 2F76X 4YB8A 4Y2PA 3GIWA 5CXXA 3WI7A 2CBXA 2DXIA 4Y2JA 4NJEB 4YMUA 2BVNA 1YDHA 1JYEA 4GG1A 2C61A 4O3PA 4KRFA 1W0JA 4HP8A 3Q8KA 2G40A 2O52A 3RK1A 3U3MA 4DR3B 3COZA 3ORHA 3W4KA 1UMCB 2V6IA 3A9UA 5GMOA 3BN3A 4RZHA 2HWYA 3B5EA 3QOWA 3T7RA 4KR7A 2EZ9A 4F4YA 2Y68A 1X7ZA 3LBIA 3T06B 1X1TA 5JH7F 3GNQA 1KI3A 2XX3A 1SA0A 1XC7A 3IPAA 3TPFA 3TZ6A 2FN4A 2OBBA 2GPJA 3R3ZA 5FO0A 3DZHA 3NTUA 4U7PB 1DCFA 3SD7A 1F60A 4QWEA 5ALHA 1LC0A 1QCDA 2X23A 4LW8A 1CEYA 2XQIA 4NBRA 2FMIA 3Q2KA 2Q0ZX 3ESQA 5L7TA 2AFVA 3GRAA 3P9IA 5DDYA 1JFFA 5CEHA 3HRKA 3TQRA 3QA3E 1TJ3A 3AJDA 1UM9B 3HWSA 3KPJA 2Q4BA 4OYRA 1NVXQ 4YT2A 4XIGS 4R1PA 3V46A 3HO6A 3GLIB 2IV3A 2E2WA 3EPJA 2HV9A 2BWJA 4A6PA 4K1LA 3TACB 1WZCA 3UK1A 5GADl 1OMOA 2PEZA 1EJ0A 3OURA 4BB6A 3G9TA 3ETCA 3A1UA 2Q7OE 2HQBA 3MAAC 3HPOA 2Q3LA 4KLLA 4AS1A 1KH3A 2A3VA 3JQPA 1I0ZA 4AF6A 4RDXA 3BRCA 4RA6A 4YUVA 2WB1C 4PTYA 4C2BA 3PQCA 3AVUA 3I4FA 5LMZA 1ID1A 4OI2A 2HHCA 3HB0A 2CLLB 3W78A 5IC4A 1AD2A 1V6AA 5AKLA 1LF0A 1M6VB 3FPCA 2ZYTX 1JNXX 4LECA 2XUAA 5KX5F 1TFRA 2BZGA 3AQIA 2LDXA 3OZVA 4REMA 5KFGA 4W8GA 3EA4A 1EZ1A 1JMVA 5FOTA 3VHLB 2K60A 4YHBA 5LXTB 4F3TA 1L7BA 1FVXA 1FFEA 1QB8A 3VU9B 4QWBA 1W4LA 2WZQA 3LY8A 4KODA 4NQZA 2E8MA 4F2WA 2Q1UA 5JBNA 1XFDA 2P68A 2X4DA 4R51A 1C8BA 3CSDA 4LHEA 5J5VA 4I3HA 5TQ0A 4G9GA 3JTMA 5EKSA 3UTCA 2PRSA 4G97A 2I7TA 2XNHA 2RHLA 3PQ2A 2EFJA 1UJMA 4BN0A 1PK1A 4PZNA 2IUSA 5J2GA 3IUJA 5G4KB 4C4PA 2P5SA 4KMRA 3RJ9A 5H3CA 2W6NA 3W34A 3TLGA 2PZMA 2ZBRA 1VG1A 2XECA 1GTJ1 4KN9S 3DFUA 4YRTA 5DTMA 5LCXA 2D5LA 4ED1A 2ECPA 2P0EA 3THXB 2OV2A 3BCSA 2BC9A 3N2KB 1EH5A 3HZZA 2IZZA 1CY4A 1U1GA 4B3CA 2PXIA 4XVUA 2GPWA 3BAZA 3MCTA 5DBIA 5HCUA 5CCXA 1NF8A 4OB6A 4CFZA 1L4UA 3QZ8A 5IAOA 1E3JA 1KH1A 4EB8A 2XKBA 2WG1A 1U31A 4IW3B 4DYVA 1TV9A 4KRYA 5E95A 1TAHA 3UG7A 2KWIA 4Y2QA 1G63A 5SZHB 1JZSA 3OQNA 4G09A 5K0SA 4EUNA 5C0YA 5K0JA 1RQLA 1W34A 3O8QA 3N2GB 1CPYA 1DC6A 1TLLA 2HA5A 2I4RA 1YDFA 3AMVA 3NEAA 4HH3C 1BVSA 1SHZA 4BX0A 5CRXA 5EIOA 4AZ3A 4IDGA 2IFTA 3OIVA 1GPNA 1LB2B 1E2NA 2NU9B 3ZGNA 3B0XA 1UMBA 4QZDA 4OJOA 1E61A 5EJ9A 2B4YA 2WMYA 1P5HA 4F2RA 3ETDA 3NV7A 5HFAA 1Y0BA 2FZ4A 3SR0A 5C8YB 3EA0A 1EQUA 2YOFA 3JWHA 3EVCA 3LW7A 1OU4A 4GRAA 4HK4A 5TQ2A 2GVZC 3R4CA 3V4ZA 3VHXA 3QWIA 1SU6A 1MHTA 4JC5A 4LBYA 5HIJA 3MINB 5CT9A 3KKZA 3DLTA 1T13A 1JU9A 2BBOA 2DH6A 3N8KA 4KSCA 1OB2A 1NJZA 1ZJ4A 2IOYA 3BGVA 3B1VA 3COYA 2HMXA 1X80A 4KO4S 5ILGA 3AHDA 4PLHA 4FI3F 4OK3A 4D4IA 2BGLA 2IVFA 4GQBA 4HGNA 1N9KA 3WLFA 4P3YA 4BNXA 1E2JA 5HKLA 2ZYSA 3WGGA 1QCKA 2XUHA 3E9RA 4K9LA 4KMOA 1A7AA 2IP2A 4UEKA 4JMUA 1F20A 1IB6A 2QENA 4ZGBA 3ILVA 4QNNA 4ZJPA 3JQ9A 1ZMTA 1A1VA 1A7UA 3S6JA 2WILA 1XMJA 3P97A 1TGYA 3C7TA 1NQTA 1NXQA 2EZYA 1HDOA 2PWBA 1YE8A 3NU1A 3TOCA 5EEHA 4Z4HA 3WLJA 3ZDYB 2ECQA 3TNYA 3K70B 4AYTA 3V2UA 1G6HA 5DCYA 4IO0A 2K8BB 4R68A 1LLQA 2ROQA 5E38A 1GUFA 3O7MA 4YFVA 1X0XA 3RHTA 5AHXA 2O7NA 3T6KA 5FLYA 4Y98A 4BDPA 1DMSA 1RM3A 2XO7A 4ME6A 4Z5XA 2W90A 2FFHA 3PDJA 3DWIA 4M1ZA 3QITA 4B6RA 2VH1A 1O3YA 2H11A 4Q1BA 1T0BA 4B6SA 3V7KA 2C5BA 3NI2A 1QS0A 1BE0A 1XDUA 2TMYA 3OE1A 3QVJA 4HEA1 2JRLA 3MS4A 3OJCA 1J56A 4YN3A 1BCRB 1A8UA 1M2VB 4ZT7A 1LXCA 4U6NA 4DLKA 5C81A 4MRRA 2Y0SF 2C2DA 4F60A 3DPIA 1DFIA 3ZIDA 4NU8X 1QXSA 3KHUA 4KGDA 5ELLA 3RJKA 1YBVA 4FR2A 1F2DA 1XCMA 1X70A 2Z4RA 4Y2XA 1F51E 4KR9A 4E30A 1SIUA 5J0QA 1XEWY 4EFDA 3F49S 5IINA 1R0SA 2IIQA 3ILXA 3HB5X 3MRSA 4WLUA 4WOJA 1YFLA 3WWEA 3ND6A 4WK6A 1DJLA 1QOPB 2ZRBA 3F4BA 1E3WA 3U4MA 4AY3A 3FUCA 3VVCA 5B2FA 1JR4A 2J6BA 3AJEA 4EEZA 1SEPA 5JD6A 2WMNB 3VCBA 1SHLA 4DJ5X 3UT0A 1N0IA 1NWHA 2QQEA 2WHPA 3PG5A 2A14A 4YQYA 3WZLA 3AYZB 2QTFA 1Q95A 2B7LA 4Z9BA 1Z13A 2B4TO 3M2PA 3M6IA 4D0S<