4UB2A

Dna polymerase beta product complex with a templating cytosine and 8-oxodgmp, 120 s
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
319
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 104
structure length 319
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub2A03
3OV7A 5DGBA 4M47A 1TKDA 3EWAA 1WOTA 2FMPA 1TAUA 3OSNA 4YVZA 1MC8A 5IINA 3OSPA 4QWDA 4AT8A 3H4DA 4LZDA 5KFEA 1ZJNA 1KSPA 9ICEA 9ICTA 5KFMA 3TQ1A 5KT7A 3RRHA 3C5GA 3ZDDA 4IQVA 4QZDA 1NKCA 3G6VA 4QZ8A 7ICOA 5DG7A 1ZQNA 2HHWA 1ZQXA 4QZHA 4JV2A 4RQ4A 4NLNA 3UQ0A 4O5KA 4Z6EA 2VA8A 4YMNA 4Q43A 2A1JB 2W9CA 8ICIA 1L3SA 4O9MA 8ICAA 4QW9A 4IR1A 2ATLA 4ED6A 1UEUA 4WC6A 1FA0A 2W9CB 4M9HA 9ICLA 2PXIA 4EZ6A 3ETLA 4X4OA 4B9TA 3H39A 1BPEA 4PHAA 5L1IA 4I2BA 4ED2A 4RPZA 4F8RA 3IM1A 1T8EA 4KLIA 1KNYA 2BQUA 3AU6A 9ICIA 3AQLA 4XQ7A 3AQNA 9ICFA 2IA6A 2DPJA 4UB4A 5DLFA 3C5FA 4KLDA 3EPGA 5DDYA 1KDHA 3MR2A 1ZQOA 4M2YA 3MGHA 1SKSA 2C28A 2BR0A 4YMMA 9ICPA 1JMSA 5KG1A 4F4WA 2ASJA 4R8UA 1Q79A 1K1SA 4RQ8A 3M8RA 1ZQJA 2UVUA 4ED3A 3K75D 2BCSA 4O3OA 2IBKA 4P4MA 4KN4A 3EW9A 5HRDA 4F5PA 3JYYA 4R8UB 2C2RA 5KFCA 2J6TA 2ZUCA 2W9BB 4O3NA 5HHHA 4DSIA 4X4UA 3KHGA 4Q45A 3GFKB 5KFRA 3RJKA 3FDSA 3H7IA 4MEYA 3UXPA 1DGSA 2W9BA 2J6SA 2KTQA 1HJPA 2ZUDA 4NXZA 2C2EA 4ZH4A 5HRLA 4I2JA 5DB9A 3PW0A 2ID1A 2DRBA 4YCXA 5KFNA 4ECRA 5DGAA 1BPXA 9ICMA 2ZTCA 5CA7A 1KFTA 4E80A 4EYHB 4EZ9A 4QZEA 3EZ5A 4BWJA 4DFMA 4XA5A 4MF8A 2V4RA 4FS1A 4C8OA 7ICJA 1SKRA 3C23A 5J2AA 1ZQZA 2P66A 3KTQA 1NZPA 2ISPA 2JEIA 1UETA 5J0PA 4DLGA 4ED1A 3RBDA 2BGWA 4IRCA 4DOBA 1RPLA 8ICFA 1KTQA 2VANA 3MFIA 4B9MA 3RJEA 4I2DA 5KFLA 5IILA 9ICJA 3GV7B 2ZH2A 5KFAA 3TFSA 4KLSA 3LQCB 3OVAA 1VFGA 2DVIA 5KFJA 2BPGA 3PNCA 5KG4A 8ICRA 2KZZA 3B0YA 4X4SA 4P4OA 4O3PA 4EBEA 3H8JA 4QZGA 1KRPA 5CWRA 4DQSA 3RTVA 4KLQA 2HHTA 5KT2A 1RXWA 2R8HA 3H4BA 5L9XA 4EBDA 1U9LA 4P2HA 3FYHA 5CJ7A 4R65A 4F5QA 3LDAA 4DSEA 3TFRA 1MQ2A 3WFQE 4TURA 2WTFA 4B9VA 3JPRA 5CR0A 3NGDA 3M9MB 1QLNA 1R8BA 1ZQRA 1R89A 4EBKA 1Z3EB 2R8GA 3RH4A 8ICUA 3SV3A 4GXJA 4F5OA 4I27A 3PV8A 3OUYB 4YR3A 1ZQKA 1N48A 4G3IA 3AUOA 1XSLA 5J0TA 1ZQTA 8ICTA 3JZ0A 3UXNA 4FHVA 4X4TA 3Q8KA 2ZHAA 4EBJA 4NLKA 2ZJ5A 2R8JA 2DRAA 5J2GA 1MIYA 3PR5B 2HHQA 2C2DA 5KG7A 4I2CA 5KFHA 3OJUA 2W8KA 4ECVA 3QE9Y 2PI4A 8ICWA 3H8SA 4UBBA 4AT8B 2ZHBA 5BPCA 1XS9D 4O3QA 3HWTA 4ED0A 3PMNA 4ELUA 2RDJA 4X5VA 3T3FA 3JPQA 3H8WA 4DL4A 1KFDA 3RBEA 1ZQDA 8ICVA 8ICSA 4FHWA 1CUKA 4Z6DA 3OVBA 4QWCA 3G6XA 3N97B 4UB5A 3GIKA 1TK0A 1RYRA 2JEGA 8ICEA 1UT5A 4O5EA 3HIYA 2ZTDA 1T4GA 2HHVA 3RJGA 4TUSA 4R64A 3RRGA 4JWNA 5D4BA 3M9NB 1JN3A 2PI5A 7ICPA 3UXOA 4YR2A 4R66A 4KITB 4F2RA 4DF8A 1DK3A 1NOMA 2KFNA 8ICKA 4UD4A 1MQ3A 1F5AA 5KFXA 8ICGA 1AROP 1PZNA 2ZJAA 4UBCA 1S9FA 4O5CA 3RB0A 4LZGA 4B9SA 1XWLA 3OJSA 1NK7A 4DSLA 1JQRA 5CB1A 4I2GA 2PFNA 8ICOA 4FHXA 5KFOA 3RH5A 2XGQA 2ZH5A 1ZQIA 5J0QA 2F1JA 4DF4A 4X0BA 2NRXA 1B43A 9ICXA 1KLNA 3ORYA 5DBAA 4DQIA 3TARA 2OWOA 3HW8A 4DQQA 7ICGA 4F93B 4PPXA 4J9QA 1RYSA 3WFPA 1D9FA 2KZ3A 2V4QA 2NRKA 2PFPA 4RQ7A 3RJIA 3RB3A 3PO4A 4WC0A 5KFYA 3M8SA 3H37A 4PHPA 5IIMA 5HRHA 3C21A 1NJZA 1X2IA 2BPFA 3ISBA 1COOA 9ICAA 4S3NA 3OVSA 5DB6A 1RZTA 3C2KA 1L3VA 5EWGA 3C2LA 4YXJA 2XY7A 3QEAZ 1ZQMA 5KG5A 1IXRA 1ZQAA 5J2JA 3AQKA 7ICIA 1S0NA 4GC6A 1X9SA 4E0DA 2FMSA 2F1IA 4QZFA 2MUTA 1R8AA 4HYKA 1NK4A 2RFFA 5EWFA 3BDPA 2IHMA 4KLTA 4TQRA 4DL2A 3GIIA 1UA0A 3RR8A 7ICTA 4WC3A 3Q8RB 4GXIA 1C7YA 9ICOA 4XUSA 4J9LA 1H38A 5HRBA 4O3RA 1S97A 2ZH9A 1BGXT 4M6WA 4FO6A 4IQTA 4F4KA 2DFLA 4UAWA 9ICUA 3T5KA 4KLLA 5EWEA 5J2FA 5DBBA 4M9GA 3B0XA 4RNNA 9ICBA 1JXLA 3N4MB 3RJHA 4IG8A 1NO5A 5L1LA 4MFFA 4RPYA 4UAYA 3OHAA 2AGPA 5DQGA 4M9JA 4KLUA 1KEJA 7ICRA 3Q8LA 1EXNA 2ASLA 9ICHA 4C8MA 4DL5A 4QWBA 2BCUA 4IR9A 4QZBA 3PY8A 4M04A 2AQ4A 1DK2A 4C8KA 3V6KA 4AT7B 4EP7A 5HRGA 2DR8A 5HRIA 4I2EA 1TFYA 3V6HA 3WFSC 1SZPA 5DQIA 2R8KA 1QSSA 3PR4A 8ICNA 4X4RA 5IIOA 4RQ6A 2XO7A 1NJWA 4J9OA 3T5HA 2ALZA 1ZQSA 4Z6FA 4DSKA 2KFZA 2MAXA 8ICHA 5J2BA 3PW2A 2HHPA 4DLEA 5KFWA 1TVAA 1NK8A 5HC9A 4J9KA 3LWMA 2NRWA 1S0MA 1VJ7A 3KHRA 4LT6A 5BOMA 3RJJA 1OU5A 5IIKA 3BQ1A 1U45A 2V9WA 4TUQA 4F4ZA 4K4IA 8ICCA 4RNOA 2BDPA 3RR7A 9ICSA 5KFGA 2DR7A 1L5UA 1D9DA 4E8FA 4JV0A 3GILA 1XU4A 1SL2A 9ICCA 4NM1A 1ZJMA 9ICVA 1U4BA 1XSPA 3MABA 1MIVA 5KT5A 2NRVA 4F5NA 1QSLA 4XQ8A 3UPQA 4RPXA 3Q8MA 4YG2A 4NM2A 4J9RA 3HJ4A 1BPDA 2IHNA 5TZVA 4K4GA 4FH3A 4EEYA 2Q0ZX 1ZQLA 2NRTA 7ICQA 4UAZA 5J2HA 4X4NA 2KZMA 2KP7A 3NTUA 1Y88A 5J0OA 5DLGA 1XC9A 2R8IA 1WCNA 5DQHA 5KFQA 1SL0A 2AU0A 5HHIA 4DL3A 2NRZA 7ICUA 3L9DA 4NKTA 5KFTA 4KLEA 7ICKA 5KG2A 5J0SA 5KFZA 1SL1A 3H38A 1ZQGA 5KFVA 3RJFA 1NK6A 4FHPA 2BE3A 4F50A 1JAJA 3SI8A 4KLOA 4B9LA 1A76A 3EPIA 8ICZA 5J2KA 5DB8A 1DOQA 5HMMA 3MR6A 2JEFA 2P6UA 4PGXA 4M9NA 5J0YA 8ICYA 2W9AA 3TAPA 3PMLA 2VA3A 1NKBA 2ZH1A 1ZQUA 1TAQA 1Z00B 4ECQA 2BQRA 2ZH7A 2FPKA 3MFHA 4KLJA 4RWPA 4MFCA 2BCVA 2I1QA 4RT2A 4QZIA 8ICLA 3C1YA 7ICHA 4YP3A 3V7LA 5KFBA 4JWMA 1A77A 5J29A 4M9LA 1TV9A 3HT3A 4QZCA 4RWOA 2MUTB 4KLHA 2ZJ8A 3E2EA 1TK8A 5KG0A 4F92B 2W8LA 5KFDA 2P6RA 4NLGA 4GC7A 3C66A 3PX6A 1S10A 4EBCA 2PFQA 2HW3A 3HX0A 5KFIA 2DPIA 3V72A 2ZUBA 5D49A 8ICQA 3BQTA 3MDCA 5KT6A 3QEBZ 3AQMA 4PHEA 2AQ0A 1V9PA 3AU2A 4M6WB 5IIJA 5KFUA 4BGDA 1QSYA 1NJYA 2ZH6A 5DKWA 7ICSA 4F4YA 4MFAA 1ZQVA 2HHXA 1L3TA 1S0OA 1UEVA 4B9NA 8ICPA 4ECYA 8ICXA 4DWIA 3ZD8A 4DL7A 4FS2A 8ICBA 4JK1A 5F9NA 1JX4A 1ZQBA 5KFPA 1PX5A 1Q78A 1JIHA 4BDPA 1L3UA 4I2AA 3GIJA 1X9MA 2M2WA 1T3NA 5J0XA 3UPSA 2H5XA 1U48A 2BQ3A 4DQPA 5DG8A 3ISDA 1T7PA 4WBZA 4AT7A 2DR9A 3WFRE 4TUPA 5HRKA 5CHGA 3Q8SB 2PFOA 4BXOB 5DB7A 3JPNA 1JXEA 2XGPA 3BQ2A 2BKEA 4ED8A 5KT4A 3TAQA 2AJQA 8ICJA 4DSFA 7ICLA 4XRHA 4BXOA 3QZ7A 3BJYA 1HUOA 9ICQA 3HP6A 4P4PA 4RQ3A 3RB6A 1D8YA 3KHHA 3GV5B 4K4HA 4YR0A 2JZBB 5J2IA 4DS4A 3RB4A 1NK0A 5KTQA 4KMUA 2J6UA 2XY6A 5HRFA 1D8LA 4ECSA 4J9NA 4WC2A 1TFWA 2HHUA 5C5JA 3NYBA 7ICNA 5KT3A 3V7JA 1BVSA 3QZ8A 3GV8B 2UVVA 4NY8A 4KLMA 4UD5A 1CEZA 4AT9B 4RQ1A 5HREA 5DDMA 3M9OB 4ATBB 4ECWA 1RXVA 3IHQB 3RH6A 4X0AA 3C1ZA 3T5LA 4RQ0A 3JPPA 4J9MA 4PH5A 5HNKA 4AT9A 4Q44A 1ZQEA 4ATBA 4RT3A 2W9MA 4C8LA 4YD1A 1N56A 3OGUA 2PBEA 4RNMA 8ICMA 1NK5A 3Q8PB 4RQ2A 2FLNA 2Y1JA 3RAQA 2Q66A 3ZDBA 4UB3A 1YLQA 3HJ1A 4QWEA 4RUCA 5EOZA 2BPCA 4R63A 3PW7A 4IRKA 7ICFA 3ZDCA 5DECA 2Y1IA 4WCWA 3KHLA 4BWMA 1KFSA 3TI0A 4F4XA 3RAXA 2ZTEA 4O0IA 2XC9A 4DS5A 3PVXA 4DQRA 3TANA 4RWNA 4LVSA 5HP4A 4YFKA 5KFFA 3EYZA 4EYIB 1U47A 5F9LA 5J2EA 4WC4A 2VA2A 4YMOA 4IQUA 2M2UA 3MR3A 2A1JA 4DSJA 5D46A 3GDXA 3V6JA 4QW8A 9ICGA 4RUAA 3MGIA 2M2TA 2FMQA 5KG3A 4JV1A 4RZRA 4E7XA 4IRDA 4NLZA 2HVIA 1MSWD 3C18A 4PHDA 2BCQA 2O1PA 2ZH4A 7ICVA 3PW5A 3LWLA 2BCRA 1ZETA 1XO1A 5DEDA 1Z00A 5DG9A 2HVHA 5F2VO 2UVWA 3H40A 4DO9A 2RDIA 9ICNA 4RU9A 1ZQHA 4O3SA 4WC1A 4I29A 3HPOA 1BPYA 1BNPA 3GQCA 4IQWA 2KN7A 4YD2A 4FBTA 1HUZA 7ICMA 1BNOA 4YXMA 2GWSA 4MF2A 4I2IA 3PX0A 4YN4A 2I9GA 3MBYA 4DEZA 2FLPA 2XCAA 4ELVA 4F91B 1X9WA 4GLXA 4ECTA 4KLFA 1S76D 1LV5A 2ZH8A 4QZ9A 4J9SA 4ECZA 5CP2A 1S77D 4DOAA 4F5RA 4WC7A 4JUZA 3ZD9A 3SV4A 2B21A 4DFKA 3SZ2A 2ISOA 4C8NA 2FLLA 4ELTA 2UVRA 4ECXA 4Z6CA 4NKUA 2JEJA 3OHBA 1QTMA 1XSNA 3THVA 4Q8EA 1MIWA 1R8CA 5J0UA 2O5AA 4X4PA 3ZDAA 1BPBA 4M0AA 4QWAA 2XY5A 5DBCA 3PW4A 4I2HA 3PX4A 2IMWP 4I28A 2C22A 4MEXA 2F1HA 5KFSA 1NJXA 1S0VA 2M2VA 3UQ2A 1UT8A 2FPMA 4UQGA 5J0WA 4DFJA 3K4GA 3LK9A 1TFRA 5HMLA 4J9PA 9ICWA 1LB2B 2AGQA 1ZQFA 5HR9A 4UB1A 2LYHA 3Q8QB 2M9NA 2ASDA 1ZQPA 2XCPA 4CCHA 2ZH3A 5J2CA 4FH5A 3C2MA 5KFKA 1TK5A 4PGQA 3H3AA 2FPLA 4UB2A 4ED7A 2BHNA 5L1JA 1NKEA 4Q8FA 3ISCA 9ICRA 4RQ5A 3WFOA 1WCLA 4WC5A 3MDAA 3T5JA 4X4VA 5L1KA 1SKWA 4DOCA 2JZBA 1B22A 5IIIA 1NK9A 1ZYQA 2AGOA 3PO5A 5JUMA 4FHYA 3SYZA 1ZQQA 1ZQYA 2HHSA 4WBYA 4X4QA 1UA1A 4DFPA 4F2SA 4TQSA 1ZQWA 4QZAA 5J0RA 4F3OA 4I2FA 1ZQCA 3G6YA 1V4AA 7ICEA 4M5DA 3GIMA 3V7KA 4PGYA 1IM4A 4KN7A 5BOLA 9ICKA 4B9UA 4GXKA 3OUYA 3JPOA 4DL6A 5KG6A 4FBUA 3MR5A 4YQWA 4KLGA 3JPSA 1U49A 2DR5A 3JPTA 4RWQA 5J2DA 1BPZA 4ECUA 3ZDEA 1K1QA 3BQ0A 4KTQA
chains in the Genus database with same CATH superfamily
1V97A 5DGBA 5KL1B 4I0UA 2EZYA 9ICEA 2QB0B 4NWIA 2KSOA 4QZDA 2AH5A 3G6VA 2A3VA 4QZ8A 4JV2A 4NLNA 5AM4A 2VA8A 5ALWA 2W9CA 5EE3A 8ICIA 4O9MA 5AKJA 4M9HA 9ICLA 4Y2RA 1BPEA 4PHAA 1KNYA 4F8RA 4RPZA 3AQLA 3IM1A 1T8EA 2DPJA 5DLFA 3C5FA 2WF7A 1KDHA 1SKSA 9ICPA 2ASJA 4G9BA 1L7OA 4UB8U 4RQ8A 3M8RA 1ZQJA 1N2XA 1ZD2P 2EANA 4R8UB 5KFCA 2W9BB 1L7PA 4DSIA 4Q45A 5KFRA 3F5AA 4MEYA 1SB3C 1DGSA 2OYYA 1KFTA 5DGAA 2Y9UA 9ICMA 4EYHB 4BWJA 4DFMA 4XA5A 4FS1A 4KX5A 2P66A 3KTQA 5ALMA 4QIWF 4ED1A 2BGWA 2PMZF 2JMGA 3RJEA 5KFJA 2BPGA 4K97A 3B0YA 4EBEA 1KRPA 4C7ZA 1CRXA 4DQSA 1OUQA 4O6AA 4P2HA 1U9LA 5CJ7A 2KKVA 4OJ5A 3WFQE 3TFRA 1MQ2A 4TURA 2WTFA 3JPRA 5CR0A 2YX8A 2K8BB 1ZQ1C 4GXJA 4I27A 4FHVA 3JZ0A 2WF9A 3Q8KA 2ZHAA 4NL9C 3PR5B 4N7RA 5AKXA 2C2DA 4I2CA 5KFHA 4XJEA 3OJUA 2W8KA 1Z1VA 4ECVA 3QE9Y 4UBBA 3PSPA 3JCFA 4X5VA 4DL4A 8ICVA 4QWCA 2JEGA 3GIKA 8ICEA 3HIYA 4O5EA 1MA7A 4NXVA 3RJGA 4R64A 5ALTA 2W43A 1O08A 4DF8A 1NOMA 1F5AA 2F3NA 8ICGA 2Z7JA 4UBCA 4P0PA 2FE9A 2PFNA 8ICOA 3RH5A 2XGQA 4O69A 3SQIA 3I1YA 1SXEA 1B43A 9ICXA 5AI9A 4DQQA 4JLZA 1D9FA 2V4QA 2DF4B 2KEYA 1LVHA 4WC0A 5ALKA 5IIMA 5H2FU 1COOA 3OPXA 4S3NA 3OVSA 1RZTA 2YMMA 5EWGA 1AQ6A 1IXRA 5K4LA 1S0NA 2MUTA 5CFUA 4HYKA 2YMLA 5EWFA 4KLTA 3RR8A 4DL2A 3GIIA 1UA0A 7ICTA 1C7YA 5B3QA 2D6FC 1MN8A 3BS5A 2JV3A 5J2FA 4M9GA 1X9XA 3B0XA 4RNNA 1Q46A 9ICBA 1JXLA 3F2BA 4MFFA 4RPYA 4E80A 2AGPA 4M9JA 1C20A 2ASLA 1EXNA 9ICHA 4QWBA 2DGZA 4Y2SA 2AQ4A 3VCBA 3CYMA 1DK2A 5C0YA 1TFYA 2HBMA 1SZPA 3KZIU 3WK9A 1NJWA 2ALZA 1HEKA 4Z6FA 2EZZA 1NK8A 3KHRA 3RJJA 1RM6C 4F4ZA 1ZRMA 2DR7A 4A8EA 1D9DA 5E79U 4JV0A 3GILA 9ICCA 1U4BA 1XSPA 1MIVA 2VKQA 5KT5A 4F5NA 3LYSA 3VC8A 4UAVA 1QSLA 3UPQA 4YG2A 4NM2A 2PMZC 1SV0A 2IHNA 4EEYA 1GO3F 2KP7A 2LBOA 3NTUA 2KZMA 5J0OA 5JTGA 2G08A 2K8CB 1SL0A 7ICKA 1SL1A 5KFVA 3RJFA 3TACB 3H0LB 3SI8A 1A76A 5HMMA 3IN5A 3TAPA 1RG6A 1ZQUA 1TAQA 1Z00B 5ALHA 2FPKA 4MFCA 3HKZF 1N61A 3HKZC 3HT3A 4KLHA 1TK8A 5KG0A 2K4EA 4NLGA 5KFDA 1N5XA 3PX6A 1S10A 2HW3A 8ICQA 5D49A 2HBKA 3HRDD 2KV2A 1V9PA 3ER9B 2ZH6A 3UMCA 2F44A 5AICA 4NL9A 2HHXA 1UEVA 4FS2A 2O6KA 4U6PA 4JK1A 1Q78A 1PX5A 4DQPA 5DG8A 3ISDA 1T7PA 2PFOA 2F8LA 3JPNA 2XGPA 2AJQA 2BKEA 2G5IB 5KT4A 4XRHA 3QZ7A 1HUOA 4P4PA 4RQ3A 4UASA 5AKEA 4K4HA 4PL1A 4DS4A 2XY6A 2HHUA 1CEZA 1F5SA 3M9OB 3RH6A 4RQ0A 3JPPA 4O67A 4PH5A 4AT9A 2B56A 3NS1A 3ETRA 2PBEA 3RAQA 4RUCA 5EOZA 2BPCA 4O3MA 1KFSA 2ZTEA 3R9KA 3L5KA 5KFFA 2A19A 5J2EA 2A1JA 1SIJA 4RUAA 4K96A 2NYVA 2BBHA 4OAHA 2LPEA 2HVIA 3C18A 7ICVA 5A0LA 3LWLA 5DEDA 2HVHA 2UVWA 3NKUA 4DO9A 5AKKA 4WC1A 3GQCA 1A6SA 4MF2A 4I2IA 4ELVA 3MBYA 4OJ6A 2XCAA 4F91B 4GLXA 4ECTA 1S76D 1ZD5A 1LV5A 4AYBF 3N7PD 4ECZA 3L3FX 5CP2A 1LKYB 4JUZA 4FO1A 3WKBA 3SV4A 4OJLA 1ED1A 2UVRA 4ECXA 4NKUA 2JEJA 1DXSA 4K9AA 1XSNA 3THVA 4LEWA 1ZD4A 4OAIZ 3ZDAA 5KAIU 2CPRA 2XY5A 3ALRA 4GIBA 4I28A 3FM9A 5KFSA 4P0QB 3UQ2A 2EH9A 2FPMA 1L8LA 3PSIA 4UQGA 4DFJA 3LK9A 1TFRA 1ZQFA 4UB1A 2LYHA 1ZQPA 4FH5A 5KFKA 3WKDA 4ED7A 5HR6A 5L1JA 1NKEA 4BJQA 4DOCA 2JZBA 3QNMA 1NK9A 2AGOA 1ZQQA 1B4FA 1ZQYA 2HHSA 4WBYA 4EEKA 1UA1A 4F2SA 4QZAA 1ZQCA 2JGAA 3GIMA 3V7KA 9ICKA 5KL8B 3OUYA 4DL6A 2QB1A 3JPSA 1U49A 2DR5A 2QARB 1PUZA 5J2DA 1KSPA 1QQ6A 1TKDA 3EWAA 1WOTA 1GPJA 5IINA 1XNSA 4AT8A 3H4DA 4LZDA 1ZJNA 3AL0B 2LM4A 3C5GA 4IQVA 3KBBA 1NKCA 1PK1B 1FIQA 4LJXA 1ZQNA 2GH1A 3UQ0A 4C4RA 4Q43A 1L3SA 2EWRA 2YN4A 4ED6A 4WC6A 2W9CB 2PXIA 3ETLA 4B9TA 2NV3A 5L1IA 1IV8A 2ZXHA 4KLIA 2BQUA 3AQNA 2CXYA 9ICFA 2ZIWA 3H0MB 2DKXA 2HI0A 3EPGA 2D3DA 1ZQOA 3MR2A 4OAGA 3MGHA 2GLEA 1O03A 2IBKA 2E8OA 4P4MA 1RQLA 2ZUCA 4O3NA 4X4UA 3GFKB 3RJKA 3FDSA 3UXPA 2FI1A 2W9BA 2J6SA 2C2EA 2ZUDA 2DRBA 4I2JA 1BPXA 4C8OA 2BDUA 3NRWA 1UETA 1NZPA 1X6IA 4WJ3B 8ICFA 1KTQA 4QIWC 2ZH2A 5IILA 3KD3A 1VFGA 3LQCB 4AP9A 2HDOA 5KG4A 4X4SA 2KD1A 5CWRA 3RTVA 1RXWA 4EBDA 2GOLA 3MGVA 4UARA 4R65A 2FJ6A 4B9VA 1R8BA 2B51A 1Z3EB 4C4SA 3SV3A 1J2MA 1ZXIA 1XO0A 2JH1A 2LKYA 1N48A 4G3IA 2EAOA 4AYBC 4EBJA 2R8JA 2EAMA 4F72A 4ICAA 2HHQA 2XIDA 4B6JA 8ICWA 2ZHBA 5GTIU 5BPCA 4NLCA 3HWTA 5J8YA 3H8WA 1VLBA 1ZQDA 2K60A 4Z6DA 3G6XA 2WB1F 2WFAA 2ZTDA 1T4GA 2L5YA 4TUSA 3RRGA 4JWNA 2LYAA 3UXOA 4YR2A 2F8KA 4F2RA 1DK3A 2W03A 3SAFA 1AROP 1PZNA 2ZJAA 4O5CA 3QU9A 4LZGA 4FZNA 4B9SA 1YZ6A 1NK7A 4I2GA 4FHXA 5J0QA 2HOQA 2ZIXB 3TARA 3HW8A 7ICGA 2NRKA 4RQ7A 3RB3A 3PO4A 3M8SA 1X2IA 3ISBA 3IG8A 9ICAA 2W11A 5KG5A 4FZMA 3AQKA 1WUDA 1X9SA 1Z19A 2KHQA 1R8AA 3QU4A 2RFFA 5B66U 2IHMA 4TQRA 1WG8A 3Q8RB 4GXIA 1FEZA 5ALLA 4XUSA 4J9LA 2AXTU 1H38A 4O3RA 4IQTA 2IUBA 4F4KA 9ICUA 5B5EU 5EWEA 3RJHA 3BS5B 4IG8A 2W7OA 2YY6A 4UAYA 7ICRA 1KEJA 4JB3A 5ALSA 4EP7A 5TISU 1QQ7A 5HRGA 2DR8A 5HRIA 3V6HA 3WFSC 5DQIA 4X4RA 1QSSA 8ICNA 4RQ6A 2XO7A 4J9OA 1ZQSA 2HHPA 4K99A 4DLEA 1TVAA 3B9JA 4Y2VA 5HC9A 1VJ7A 2NRWA 4LT6A 5BOMA 3BQ1A 1WYGA 1SXDA 4EX6A 4RNOA 2BDPA 5CRXA 4UB6U 4NXXA 4E8FA 4NXUA 4NM1A 5AI0A 2G06A 4XQ8A 2B6GA 4RPXA 3Q8MA 2W54A 4J9RA 2H3ZA 2RP5A 4OJOA 1S8OA 2KJ8A 2OCEA 3HILA 1T94A 3WKEA 5DLGA 4Y2YA 2DKZA 2JHDA 4DL3A 5ALDA 5J0SA 2KVSA 4F50A 2DWQA 4KLOA 4KMOB 4B9LA 5D61A 5J2KA 4FZLA 5AI8A 2JEFA 2P6UA 5J0YA 2HSZA 4Y2UA 2RQ5A 1NKBA 2KIWA 2ZH1A 2BQRA 2ZH7A 4RWPA 2BCVA 8ICLA 5ALYA 3C1YA 7ICHA 3WK8A 3V7LA 5AM2A 4HAIA 2YB4A 5ALPA 5JRTA 5ALEA 1JUDA 2F76X 3F2DA 2P6RA 3C66A 2IHOA 5AK3A 1Z1BA 3ICXA 5AK5A 3QEBZ 2MSNA 3QXGA 4PHEA 4BGDA 2YB1A 3AU2A 4M6WB 1QSYA 4MHVA 7ICSA 4F4YA 1QQ5A 3H8MA 8ICBA 3IP4B 5F9NA 2N1RA 1ZQBA 1L3UA 1X9MA 3T79A 1T3NA 5J0XA 4Y2PA 2DR9A 4AT7A 4TUPA 5HRKA 3Q8SB 3J81j 3BQ2A 3TAQA 3SR6A 3HP6A 4C0ZA 4WQKA 3K1ZA 3E58A 3GV5B 4YR0A 5J2IA 1KBUA 3RB4A 1NK0A 5KTQA 2F2AB 1KL9A 1TFWA 1D8LA 2VJ5A 4ECSA 3QU7A 5KT3A 4RQ1A 4ATBB 1RXVA 4X0AA 1QH9A 5EE0A 1ZQEA 4RT3A 4RNMA 8ICMA 2FLNA 3UMGA 3ZDBA 4UB3A 4QWEA 2Y1IA 3KHLA 3RAXA 2QB0A 4O0IA 2XC9A 4DS5A 2YTUA 4RWNA 4DQRA 3TANA 4PZNA 5T14A 3PSFA 4YFKA 4WC4A 2VA2A 5KAFU 2K4PA 3AMZA 5D46A 3GDXA 4QW8A 2FMQA 4RZRA 5ALVA 5CFTA 1MSWD 2O1PA 3WKAA 1XO1A 2DBYA 5DG9A 5ALXA 4RU9A 4O3SA 4EEDA 1BNPA 2KN7A 4YD2A 4YN4A 2I9GA 2MA1A 2FLPA 1X9WA 4KLFA 2ZH8A 2ZIVB 2ISOA 3NUQA 2FLLA 5AKIA 1LKYA 4Z6CA 1X40A 5ALFA 1R8CA 1MIWA 2O5AA 4DCCA 2EDUA 1L7NA 4EENA 2LI6A 2IMWP 2C22A 3ERCC 5ALIA 1Q3UA 4MEXA 1OW5A 2M2VA 2MU2A 5J0WA 3K4GA 4J9PA 5HMLA 1Q8KA 9ICWA 4P0QA 5HR9A 4OCZA 5AIBA 3CK6A 2W3RA 4UB2A 2BHNA 4RQ5A 4WC5A 4X4VA 5L1KA 3PO5A 4FHYA 4X4QA 2Y9TA 5J0RA 4Y2XA 3SMVA 3IG5A 4B9UA 4GXKA 3JPOA 4YQWA 3JPTA 2YQEA 1NNLA 3DV9A 3Q8QB 4KLEA 5AI4A 4KX3A 2G5HB 3OV7A 4M47A 2FMPA 3OSNA 1MC8A 4PJ0U 3OSPA 4QWDA 9ICTA 3F53A 5KT7A 3WK4A 2WF6A 3RRHA 1PVQA 7ICOA 2ZIUB 4Z6EA 4YMNA 4OJPA 8ICAA 3F2CA 4IR1A 1V38A 1ZD3A 4EZ6A 4I2BA 4ED2A 4OO1J 3BZKA 4CRXA 4KLDA 2E1FA 5DDYA 4M2YA 2HCFA 2ZIWB 3NYBA 3SD7A 3DEEA 1Q79A 1K1SA 2UVUA 3K75D 2BCSA 4KN4A 5HRDA 3JYYA 1J2NA 5HHHA 4K8VA 5D63A 4PZOA 1HJPA 5HRLA 2ID1A 5DB9A 3PW0A 4YCXA 4ECRA 2E8NA 4EZ9A 2RRDA 4O68A 7ICJA 2W55A 5J2AA 2JEIA 5J0PA 3RBDA 4DOBA 1RPLA 2KMDA 3MFIA 4B9MA 2Q66A 3IV6A 1UCVA 5ALNA 5KFAA 2KZZA 4P4OA 2D8CA 4QZGA 5G5HA 2NO5A 4KLQA 3QUBA 2HHTA 3H4BA 5L9XA 3FYHA 4F5QA 3LDAA 2AHOB 3M9MB 4IL6U 1QLNA 5KNIA 2R8GA 2H3VA 3PHZA 4UAUA 5AI5A 3PV8A 2RLTA 1ZQKA 1XSLA 5J0TA 1ZQTA 2QKQA 5JTIA 4LEVA 4X4TA 4NLKA 2ZJ5A 2DRAA 3ZI4A 1MIYA 2KNJA 5KG7A 2RHFA 1DGJA 4CF3A 3H8SA 4O3QA 3PMNA 2WAQC 5AKGA 3T3FA 3RBEA 1KFDA 8ICSA 3QYPA 2YMPA 1UT5A 1Z4NA 4EX7A 3H0RB 3NWIA 1V85A 5D4BA 3M9NB 1JN3A 1JROA 2LYBA 4K9BA 5JU5A 2VJ4A 1MQ3A 2DL0A 3CRXA 3RB0A 1XWLA 2OH2A 1JQRA 5CB1A 5KFOA 4QNLA 2F1JA 2E8PA 2NRXA 1KLNA 3BZCA 5DBAA 4DQIA 3KOOA 4F93B 2ZIXA 5CHEA 3WFPA 4PL2A 2KZ3A 2PFPA 3H37A 5HRHA 1NJZA 2E5SA 5DB6A 3C2KA 3CNHA 3QEAZ 5J2JA 7ICIA 3NVZA 1HIWA 4WC3A 2XVTA 1D8BA 2G07A 2WF5A 3QU2A 5HRBA 1VJ5A 2ZH9A 4FO6A 4RQNA 3C28A 4UAWA 2WHEA 4KLLA 2KG5A 2FCLA 2A1AA 3I76A 5L1LA 3M7DA 3NVYA 3OHAA 4C8MA 4DL5A 4IR9A 4QZBA 3PY8A 3V6KA 1L6NA 2E8MA 2R8KA 4CE6A 5IIOA 3T5HA 4DSKA 2KFZA 8ICHA 2MAXA 5J2BA 3PW2A 2W3SA 1S5LU 4J9KA 1S0MA 4EEBA 5IIKA 2V9WA 5D62A 3CW2C 9ICSA 5KFGA 1L5UA 4KM5A 4Y2JA 1KN5A 9ICVA 3MABA 3AQEA 2R18A 5AM1A 4BUGA 5F3XB 3HJ4A 1BPDA 5TZVA 3N7RC 1ZQLA 3IRUA 7ICQA 4P0PB 2JR5A 2R8IA 1WCNA 1B0XA 4NKTA 1JI7A 1YZ7A 3H38A 1PVPA 3KFUF 1NK6A 2BE3A 1JAJA 1SGGA 3EPIA 8ICZA 5DB8A 1DOQA 3MR6A 3OTQA 4M9NA 4NXTA 4ACOA 8ICYA 2W9AA 4CNQA 3MFHA 1OXJA 4QZIA 4RT2A 1FFUA 5AKLA 4QZCA 4RWOA 2MUTB 3E2EA 4F92B 2NO4A 2W8LA 1JALA 4EBCA 3AQMA 3BS7A 4USAA 1NJYA 4MFAA 2HBJA 1ZQVA 2M0NA 2ESEA 2KJ5A 2LMRA 8ICXA 5AHXA 1JIHA 4BDPA 2M2WA 4I2AA 3GIJA 1JRPA 2KVCA 2H5XA 5ALJA 1U48A 2BQ3A 4WBZA 3WFRE 3WK5A 3WKCA 1Z4OA 4BXOB 1SWWA 4CDGA 5DB7A 5AIAA 1JXEA 4ED8A 7ICLA 3A0BU 3BJYA 9ICQA 4US9A 2JZBB 4WC2A 4WQLA 1F44A 7ICNA 3V7JA 4KLMA 3IHQB 4GFJA 2ZXIA 4IC9A 4K98A 4ATBA 5EE9A 1UHUA 5AK6A 3OGUA 2QARA 1NK5A 4US8A 1YLQA 2JXJA 3PW7A 4R63A 4IRKA 3O0FA 3C29A 4BWMA 3TI0A 4F4XA 2OEHA 3PZPA 4CF4A 3PVXA 5HP4A 3EYZA 2Y0SC 4IQUA 1YT3A 2KKPA 1J97A 1F0MA 2OHFA 9ICGA 3NVWA 1WWVA 4JV1A 3QUTA 4PHDA 2WB1C 5HR7A 2BCRA 2KIVA 1Z00A 4OAFA 5AKYA 1ZQHA 3F5EA 4I29A 1BPYA 5EE1A 4FBTA 1BNOA 5AM5A 2GWSA 2JH7A 4DEZA 2H3IA 3KKAC 2IOFA 4QZ9A 2B0CA 4DOAA 4WC7A 2MRLA 3ZD9A 4DFKA 3SZ2A 4C8NA 4ELTA 2ZIVA 5J8YC 1CI4A 5ALOA 1VDVA 1TE2A 5J0UA 4X4PA 4M0AA 3WK6A 3TKAA 1S0VA 1ECWA 3CP8A 3D2NA 4LEZA 2KJ9A 2ZH3A 2M9NA 2ASDA 4CCHA 2XCPA 5J2CA 1TK5A 4PGQA 2FPLA 3S6JA 3HJEA 4Q8FA 1WCLA 1QCKA 3MDAA 3T5JA 2BBJA 5L1MA 5AKHA 1SKWA 1B22A 5IIIA 3BQ7A 3SYZA 4CGZA 4DFPA 4TQSA 1V4AA 2H3QA 4M5DA 4I2FA 3G6YA 1M6YA 7ICEA 3D2SA 2HOIA 4PGYA 1IM4A 4KN7A 5BOLA 5KG6A 4FBUA 3MR5A 5FP0A 2Q4TA 4ECUA 3ZDEA 3PW5A 1ZQIA 1K1QA 1X66A 3M1YA 1TAUA 4YVZA 2KSOB 5KFEA 5KFMA 3TQ1A 4DFDA 4HX0A 3ZDDA 3AM9A 4NXWA 5DG7A 2HHWA 1ZQXA 4J03A 4QZHA 1UQVA 4RQ4A 4O5KA 2LHTA 5ALGA 2A1JB 4JLXA 3ED5A 4QW9A 2ZIUA 3E0FA 2ATLA 2KE7A 1UEUA 5ALQA 3K7DA 4C80A 1FA0A 3L4PA 4X4OA 3H39A 4XQ7A 3AN1A 3AU6A 9ICIA 1KQQA 2IA6A 4UB4A 1COKA 2W04A 2C28A 2BR0A 4YMMA 1JMSA 5KG1A 4F4WA 4R8UA 1PK3A 4ED3A 4O3OA 3EW9A 4F5PA 1ZRNA 2C2RA 2J6TA 3NRZA 3KHGA 3H7IA 2KTQA 4NXZA 2DUYA 4ZH4A 4U7CA 5AI6A 5KFNA 1IIPA 2H3FA 4EV6A 2ZTCA 3SAHA 5CA7A 5ALUA 4QZEA 3EZ5A 4MF8A 2V4RA 1SKRA 3C23A 3UMBA 1ZQZA 2ISPA 2VIXA 4DLGA 3D2QA 4IRCA 2VANA 4I2DA 5KFLA 9ICJA 3GV7B 1FFVA 4KLSA 3TFSA 3OVAA 2DVIA 8ICRA 4RQMA 3PNCA 2QLTA 4O3PA 3H8JA 4F71A 2DQNB 5KT2A 4QJFB 2R8HA 3FAHA 2KICA 4DSEA 2B4VA 3NGDA 1ZQRA 1R89A 1SV0C 4EBKA 3RH4A 8ICUA 2KK0A 4F5OA 1K5OA 3OUYB 4YR3A 4WOYA 3AUOA 8ICTA 1N5WA 3UXNA 1RQNA 5J2GA 1RDFA 4C7YA 4FFDA 3RFAA 2PI4A 1SZHA 4AT8B 3OWGA 5AM0A 1XS9D 4ED0A 4ELUA 2RDJA 3JPQA 2KHVA 3KZXA 4FHWA 3PSTA 1CUKA 1PK1A 3OVBA 3N97B 1TK0A 1RYRA 4UB5A 3SAGA 2HHVA 1UPHA 2PI5A 7ICPA 4R66A 4KITB 3AEVA 4UD4A 2KFNA 8ICKA 1P7DA 5KFXA 2E1EA 1S9FA 2IOHA 3OJSA 4DSLA 2ZG6A 2YMQA 2ZH5A 2OXOA 5G5GA 4DF4A 4X0BA 3ORYA 2OWOA 4CF5A 4PPXA 4J9QA 1RYSA 4BX9C 1Q3VA 3RJIA 2HN2A 5KFYA 4PHPA 2HOFA 3C21A 2WF8A 2BPFA 2OM6A 1L3VA 3C2LA 4YXJA 2XY7A 1ZQMA 1ZQAA 4E0DA 4GC6A 2FMSA 2F1IA 4QZFA 2P35A 1NK4A 3BDPA 2IOFK 1L7MA 2HBLA 9ICOA 1KKXA 1S97A 1RYUA 4NLBA 1BGXT 4M6WA 2K8AA 2DFLA 3K1RB 3T5KA 1A0PA 1SWVA 5DBBA 3N4MB 1NO5A 4NJ8A 1OU5A 4KLUA 5DQGA 3Q8LA 4LEYA 2BCUA 4M04A 3M6ZA 4C8KA 4AT7B 3AQFA 1FO4A 3ER8C 4I2EA 3IDWA 2HMXA 3PR4A 3MC1A 3I28A 5KFWA 3LWMA 2G09A 3A0HU 1U45A 3KKAA 2EZXA 4TUQA 4K4IA 8ICCA 3RR7A 5GTHU 1SL2A 1XU4A 1ZJMA 4NV0A 2NRVA 5B3PA 3SEIA 1KW4A 4MKPA 4FH3A 4K4GA 4UATA 2Q0ZX 2NRTA 4X4NA 4UAZA 5J2HA 1NI3A 2W7PA 4Y2QA 1Y88A 5ALZA 1XC9A 5DQHA 5KFQA 2AU0A 5HHIA 7ICUA 2NRZA 3L9DA 3GZFA 5KFTA 5KG2A 5KFZA 1ZQGA 3D6JA 4FHPA 4PGXA 3PMLA 2VA3A 1URJA 4ECQA 3WU2U 4KLJA 4EGWA 2I1QA 2I5HA 4YP3A 5KFBA 4JWMA 1A77A 5J29A 4M9LA 1TV9A 2ZJ8A 3QU5A 3QUCA 3TADA 4GC7A 2PFQA 3HX0A 2XI9A 5KFIA 2DPIA 3V72A 2ZUBA 3FC4A 3BQTA 4ZOHC 5KT6A 3MDCA 2CN1A 1X6JA 2AQ0A 1T3QA 5KFUA 5IIJA 5DKWA 1L3TA 1S0OA 4B9NA 8ICPA 4ECYA 4DWIA 3ZD8A 4DL7A 1IG6A 1JX4A 5KFPA 1NZBA 3EF2A 3UPSA 3RF9A 2E3TA 2I6XA 4EELA 5CHGA 8ICJA 4DSFA 3EUB2 4BXOA 3NVVA 1TAMA 1DRGA 3RB6A 1D8YA 3KHHA 3TADC 5HRFA 4KMUA 2J6UA 4J9NA 5C5JA 4NY8A 1BVSA 3QZ8A 3GV8B 2UVVA 4UD5A 4AT9B 5HREA 5DDMA 1L8OA 3UM9A 4ECWA 3C1ZA 3T5LA 4J9MA 5HNKA 4Q44A 5AKZA 3MCRA 2W9MA 4C8LA 4YD1A 2LM1A 2PKEA 1N56A 3WK7A 3Q8PB 2F77X 4RQ2A 3NASA 2Y1JA 3HJ1A 4FE3A 5DECA 7ICFA 3N7SC 3ZDCA 4WCWA 2G0AA 1SV4A 4LVSA 1N62A 4EYIB 4OD0A 1U47A 5F9LA 4YMOA 2M2UA 3LVWA 3MR3A 2FDRA 2Y0SF 4DSJA 3V6JA 1WWUA 3N28A 2WAQF 3GU3A 3MGIA 2M2TA 1N63A 5KG3A 4E7XA 2BZFA 4IRDA 4NLZA 5AM3A 1ZOLA 2ES6A 2BCQA 2ZH4A 2K89A 1ZETA 3QUQA 5F2VO 4JMUA 3H40A 2RDIA 9ICNA 3M6KA 3HPOA 4IQWA 1PVRA 1HUZA 7ICMA 4YXMA 2CRXA 5AK4A 3PX0A 4J9SA 1S77D 4F5RA 2B21A 2GO7A 3OHBA 1QTMA 4Q8EA 2GAFD 1BPBA 3SENA 4QWAA 2K4HA 2K4IA 5DBCA 3PW4A 4I2HA 3PX4A 2XICA 5CEHA 5ALRA 2F1HA 1NJXA 2HN1A 2JRZA 1N60A 1UT8A 2ODGA 1LB2B 2AGQA 2KOBA 4WH5A 4Y2TA 3C2MA 4IS7A 3H3AA 1X42A 3ISCA 9ICRA 3WFOA 3QX7A 4UW9A 3LVVA 1ZYQA 3NVOA 5JUMA 1ZQWA 4F3OA 2EAPA 5CFSA 2GA9D 4C4TA 3ONNA 4KB6A 4KLGA 3U26A 4RWQA 1BPZA 3DDHA 2EQYA 3BQ0A 4KTQA
chains in the Genus database with same CATH topology
3OV7A 5DGBA 4M47A 1TKDA 3EWAA 1WOTA 2FMPA 1TAUA 3OSNA 4YVZA 1MC8A 5IINA 3OSPA 4QWDA 4AT8A 3H4DA 4LZDA 5KFEA 1ZJNA 1KSPA 9ICEA 9ICTA 5KFMA 3TQ1A 5KT7A 3RRHA 3C5GA 3ZDDA 4IQVA 4QZDA 1NKCA 3G6VA 4QZ8A 7ICOA 5DG7A 1ZQNA 2HHWA 1ZQXA 4QZHA 4JV2A 4RQ4A 4NLNA 3UQ0A 4O5KA 4Z6EA 2VA8A 4YMNA 4Q43A 2A1JB 2W9CA 8ICIA 1L3SA 4O9MA 8ICAA 4QW9A 4IR1A 2ATLA 4ED6A 1UEUA 4WC6A 1FA0A 2W9CB 4M9HA 9ICLA 2PXIA 4EZ6A 3ETLA 4X4OA 4B9TA 3H39A 1BPEA 4PHAA 5L1IA 4I2BA 4ED2A 4RPZA 4F8RA 3IM1A 1T8EA 4KLIA 1KNYA 2BQUA 3AU6A 9ICIA 3AQLA 4XQ7A 3AQNA 9ICFA 2IA6A 2DPJA 4UB4A 5DLFA 3C5FA 4KLDA 3EPGA 5DDYA 1KDHA 3MR2A 1ZQOA 4M2YA 3MGHA 1SKSA 2C28A 2BR0A 4YMMA 9ICPA 1JMSA 5KG1A 4F4WA 2ASJA 4R8UA 1Q79A 1K1SA 4RQ8A 3M8RA 1ZQJA 2UVUA 4ED3A 3K75D 2BCSA 4O3OA 2IBKA 4P4MA 4KN4A 3EW9A 5HRDA 4F5PA 3JYYA 4R8UB 2C2RA 5KFCA 2J6TA 2ZUCA 2W9BB 4O3NA 5HHHA 4DSIA 4X4UA 3KHGA 4Q45A 3GFKB 5KFRA 3RJKA 3FDSA 3H7IA 4MEYA 3UXPA 1DGSA 2W9BA 2J6SA 2KTQA 1HJPA 2ZUDA 4NXZA 2C2EA 4ZH4A 5HRLA 4I2JA 5DB9A 3PW0A 2ID1A 2DRBA 4YCXA 5KFNA 4ECRA 5DGAA 1BPXA 9ICMA 2ZTCA 5CA7A 1KFTA 4E80A 4EYHB 4EZ9A 4QZEA 3EZ5A 4BWJA 4DFMA 4XA5A 4MF8A 2V4RA 4FS1A 4C8OA 7ICJA 1SKRA 3C23A 5J2AA 1ZQZA 2P66A 3KTQA 1NZPA 2ISPA 2JEIA 1UETA 5J0PA 4DLGA 4ED1A 3RBDA 2BGWA 4IRCA 4DOBA 1RPLA 8ICFA 1KTQA 2VANA 3MFIA 4B9MA 3RJEA 4I2DA 5KFLA 5IILA 9ICJA 3GV7B 2ZH2A 5KFAA 3TFSA 4KLSA 3LQCB 3OVAA 1VFGA 2DVIA 5KFJA 2BPGA 3PNCA 5KG4A 8ICRA 2KZZA 3B0YA 4X4SA 4P4OA 4O3PA 4EBEA 3H8JA 4QZGA 1KRPA 5CWRA 4DQSA 3RTVA 4KLQA 2HHTA 5KT2A 1RXWA 2R8HA 3H4BA 5L9XA 4EBDA 1U9LA 4P2HA 3FYHA 5CJ7A 4R65A 4F5QA 3LDAA 4DSEA 3TFRA 1MQ2A 3WFQE 4TURA 2WTFA 4B9VA 3JPRA 5CR0A 3NGDA 3M9MB 1QLNA 1R8BA 1ZQRA 1R89A 4EBKA 1Z3EB 2R8GA 3RH4A 8ICUA 3SV3A 4GXJA 4F5OA 4I27A 3PV8A 3OUYB 4YR3A 1ZQKA 1N48A 4G3IA 3AUOA 1XSLA 5J0TA 1ZQTA 8ICTA 3JZ0A 3UXNA 4FHVA 4X4TA 3Q8KA 2ZHAA 4EBJA 4NLKA 2ZJ5A 2R8JA 2DRAA 5J2GA 1MIYA 3PR5B 2HHQA 2C2DA 5KG7A 4I2CA 5KFHA 3OJUA 2W8KA 4ECVA 3QE9Y 2PI4A 8ICWA 3H8SA 4UBBA 4AT8B 2ZHBA 5BPCA 1XS9D 4O3QA 3HWTA 4ED0A 3PMNA 4ELUA 2RDJA 4X5VA 3T3FA 3JPQA 3H8WA 4DL4A 1KFDA 3RBEA 1ZQDA 8ICVA 8ICSA 4FHWA 1CUKA 4Z6DA 3OVBA 4QWCA 3G6XA 3N97B 4UB5A 3GIKA 1TK0A 1RYRA 2JEGA 8ICEA 1UT5A 4O5EA 3HIYA 2ZTDA 1T4GA 2HHVA 3RJGA 4TUSA 4R64A 3RRGA 4JWNA 5D4BA 3M9NB 1JN3A 2PI5A 7ICPA 3UXOA 4YR2A 4R66A 4KITB 4F2RA 4DF8A 1DK3A 1NOMA 2KFNA 8ICKA 4UD4A 1MQ3A 1F5AA 5KFXA 8ICGA 1AROP 1PZNA 2ZJAA 4UBCA 1S9FA 4O5CA 3RB0A 4LZGA 4B9SA 1XWLA 3OJSA 1NK7A 4DSLA 1JQRA 5CB1A 4I2GA 2PFNA 8ICOA 4FHXA 5KFOA 3RH5A 2XGQA 2ZH5A 1ZQIA 5J0QA 2F1JA 4DF4A 4X0BA 2NRXA 1B43A 9ICXA 1KLNA 3ORYA 5DBAA 4DQIA 3TARA 2OWOA 3HW8A 4DQQA 7ICGA 4F93B 4PPXA 4J9QA 1RYSA 3WFPA 1D9FA 2KZ3A 2V4QA 2NRKA 2PFPA 4RQ7A 3RJIA 3RB3A 3PO4A 4WC0A 5KFYA 3M8SA 3H37A 4PHPA 5IIMA 5HRHA 3C21A 1NJZA 1X2IA 2BPFA 3ISBA 1COOA 9ICAA 4S3NA 3OVSA 5DB6A 1RZTA 3C2KA 1L3VA 5EWGA 3C2LA 4YXJA 2XY7A 3QEAZ 1ZQMA 5KG5A 1IXRA 1ZQAA 5J2JA 3AQKA 7ICIA 1S0NA 4GC6A 1X9SA 4E0DA 2FMSA 2F1IA 4QZFA 2MUTA 1R8AA 4HYKA 1NK4A 2RFFA 5EWFA 3BDPA 2IHMA 4KLTA 4TQRA 4DL2A 3GIIA 1UA0A 3RR8A 7ICTA 4WC3A 3Q8RB 4GXIA 1C7YA 9ICOA 4XUSA 4J9LA 1H38A 5HRBA 4O3RA 1S97A 2ZH9A 1BGXT 4M6WA 4FO6A 4IQTA 4F4KA 2DFLA 4UAWA 9ICUA 3T5KA 4KLLA 5EWEA 5J2FA 5DBBA 4M9GA 3B0XA 4RNNA 9ICBA 1JXLA 3N4MB 3RJHA 4IG8A 1NO5A 5L1LA 4MFFA 4RPYA 4UAYA 3OHAA 2AGPA 5DQGA 4M9JA 4KLUA 1KEJA 7ICRA 3Q8LA 1EXNA 2ASLA 9ICHA 4C8MA 4DL5A 4QWBA 2BCUA 4IR9A 4QZBA 3PY8A 4M04A 2AQ4A 1DK2A 4C8KA 3V6KA 4AT7B 4EP7A 5HRGA 2DR8A 5HRIA 4I2EA 1TFYA 3V6HA 3WFSC 1SZPA 5DQIA 2R8KA 1QSSA 3PR4A 8ICNA 4X4RA 5IIOA 4RQ6A 2XO7A 1NJWA 4J9OA 3T5HA 2ALZA 1ZQSA 4Z6FA 4DSKA 2KFZA 2MAXA 8ICHA 5J2BA 3PW2A 2HHPA 4DLEA 5KFWA 1TVAA 1NK8A 5HC9A 4J9KA 3LWMA 2NRWA 1S0MA 1VJ7A 3KHRA 4LT6A 5BOMA 3RJJA 1OU5A 5IIKA 3BQ1A 1U45A 2V9WA 4TUQA 4F4ZA 4K4IA 8ICCA 4RNOA 2BDPA 3RR7A 9ICSA 5KFGA 2DR7A 1L5UA 1D9DA 4E8FA 4JV0A 3GILA 1XU4A 1SL2A 9ICCA 4NM1A 1ZJMA 9ICVA 1U4BA 1XSPA 3MABA 1MIVA 5KT5A 2NRVA 4F5NA 1QSLA 4XQ8A 3UPQA 4RPXA 3Q8MA 4YG2A 4NM2A 4J9RA 3HJ4A 1BPDA 2IHNA 5TZVA 4K4GA 4FH3A 4EEYA 2Q0ZX 1ZQLA 2NRTA 7ICQA 4UAZA 5J2HA 4X4NA 2KZMA 2KP7A 3NTUA 1Y88A 5J0OA 5DLGA 1XC9A 2R8IA 1WCNA 5DQHA 5KFQA 1SL0A 2AU0A 5HHIA 4DL3A 2NRZA 7ICUA 3L9DA 4NKTA 5KFTA 4KLEA 7ICKA 5KG2A 5J0SA 5KFZA 1SL1A 3H38A 1ZQGA 5KFVA 3RJFA 1NK6A 4FHPA 2BE3A 4F50A 1JAJA 3SI8A 4KLOA 4B9LA 1A76A 3EPIA 8ICZA 5J2KA 5DB8A 1DOQA 5HMMA 3MR6A 2JEFA 2P6UA 4PGXA 4M9NA 5J0YA 8ICYA 2W9AA 3TAPA 3PMLA 2VA3A 1NKBA 2ZH1A 1ZQUA 1TAQA 1Z00B 4ECQA 2BQRA 2ZH7A 2FPKA 3MFHA 4KLJA 4RWPA 4MFCA 2BCVA 2I1QA 4RT2A 4QZIA 8ICLA 3C1YA 7ICHA 4YP3A 3V7LA 5KFBA 4JWMA 1A77A 5J29A 4M9LA 1TV9A 3HT3A 4QZCA 4RWOA 2MUTB 4KLHA 2ZJ8A 3E2EA 1TK8A 5KG0A 4F92B 2W8LA 5KFDA 2P6RA 4NLGA 4GC7A 3C66A 3PX6A 1S10A 4EBCA 2PFQA 2HW3A 3HX0A 5KFIA 2DPIA 3V72A 2ZUBA 5D49A 8ICQA 3BQTA 3MDCA 5KT6A 3QEBZ 3AQMA 4PHEA 2AQ0A 1V9PA 3AU2A 4M6WB 5IIJA 5KFUA 4BGDA 1QSYA 1NJYA 2ZH6A 5DKWA 7ICSA 4F4YA 4MFAA 1ZQVA 2HHXA 1L3TA 1S0OA 1UEVA 4B9NA 8ICPA 4ECYA 8ICXA 4DWIA 3ZD8A 4DL7A 4FS2A 8ICBA 4JK1A 5F9NA 1JX4A 1ZQBA 5KFPA 1PX5A 1Q78A 1JIHA 4BDPA 1L3UA 4I2AA 3GIJA 1X9MA 2M2WA 1T3NA 5J0XA 3UPSA 2H5XA 1U48A 2BQ3A 4DQPA 5DG8A 3ISDA 1T7PA 4WBZA 4AT7A 2DR9A 3WFRE 4TUPA 5HRKA 5CHGA 3Q8SB 2PFOA 4BXOB 5DB7A 3JPNA 1JXEA 2XGPA 3BQ2A 2BKEA 4ED8A 5KT4A 3TAQA 2AJQA 8ICJA 4DSFA 7ICLA 4XRHA 4BXOA 3QZ7A 3BJYA 1HUOA 9ICQA 3HP6A 4P4PA 4RQ3A 3RB6A 1D8YA 3KHHA 3GV5B 4K4HA 4YR0A 2JZBB 5J2IA 4DS4A 3RB4A 1NK0A 5KTQA 4KMUA 2J6UA 2XY6A 5HRFA 1D8LA 4ECSA 4J9NA 4WC2A 1TFWA 2HHUA 5C5JA 3NYBA 7ICNA 5KT3A 3V7JA 1BVSA 3QZ8A 3GV8B 2UVVA 4NY8A 4KLMA 4UD5A 1CEZA 4AT9B 4RQ1A 5HREA 5DDMA 3M9OB 4ATBB 4ECWA 1RXVA 3IHQB 3RH6A 4X0AA 3C1ZA 3T5LA 4RQ0A 3JPPA 4J9MA 4PH5A 5HNKA 4AT9A 4Q44A 1ZQEA 4ATBA 4RT3A 2W9MA 4C8LA 4YD1A 1N56A 3OGUA 2PBEA 4RNMA 8ICMA 1NK5A 3Q8PB 4RQ2A 2FLNA 2Y1JA 3RAQA 2Q66A 3ZDBA 4UB3A 1YLQA 3HJ1A 4QWEA 4RUCA 5EOZA 2BPCA 4R63A 3PW7A 4IRKA 7ICFA 3ZDCA 5DECA 2Y1IA 4WCWA 3KHLA 4BWMA 1KFSA 3TI0A 4F4XA 3RAXA 2ZTEA 4O0IA 2XC9A 4DS5A 3PVXA 4DQRA 3TANA 4RWNA 4LVSA 5HP4A 4YFKA 5KFFA 3EYZA 4EYIB 1U47A 5F9LA 5J2EA 4WC4A 2VA2A 4YMOA 4IQUA 2M2UA 3MR3A 2A1JA 4DSJA 5D46A 3GDXA 3V6JA 4QW8A 9ICGA 4RUAA 3MGIA 2M2TA 2FMQA 5KG3A 4JV1A 4RZRA 4E7XA 4IRDA 4NLZA 2HVIA 1MSWD 3C18A 4PHDA 2BCQA 2O1PA 2ZH4A 7ICVA 3PW5A 3LWLA 2BCRA 1ZETA 1XO1A 5DEDA 1Z00A 5DG9A 2HVHA 5F2VO 2UVWA 3H40A 4DO9A 2RDIA 9ICNA 4RU9A 1ZQHA 4O3SA 4WC1A 4I29A 3HPOA 1BPYA 1BNPA 3GQCA 4IQWA 2KN7A 4YD2A 4FBTA 1HUZA 7ICMA 1BNOA 4YXMA 2GWSA 4MF2A 4I2IA 3PX0A 4YN4A 2I9GA 3MBYA 4DEZA 2FLPA 2XCAA 4ELVA 4F91B 1X9WA 4GLXA 4ECTA 4KLFA 1S76D 1LV5A 2ZH8A 4QZ9A 4J9SA 4ECZA 5CP2A 1S77D 4DOAA 4F5RA 4WC7A 4JUZA 3ZD9A 3SV4A 2B21A 4DFKA 3SZ2A 2ISOA 4C8NA 2FLLA 4ELTA 2UVRA 4ECXA 4Z6CA 4NKUA 2JEJA 3OHBA 1QTMA 1XSNA 3THVA 4Q8EA 1MIWA 1R8CA 5J0UA 2O5AA 4X4PA 3ZDAA 1BPBA 4M0AA 4QWAA 2XY5A 5DBCA 3PW4A 4I2HA 3PX4A 2IMWP 4I28A 2C22A 4MEXA 2F1HA 5KFSA 1NJXA 1S0VA 2M2VA 3UQ2A 1UT8A 2FPMA 4UQGA 5J0WA 4DFJA 3K4GA 3LK9A 1TFRA 5HMLA 4J9PA 9ICWA 1LB2B 2AGQA 1ZQFA 5HR9A 4UB1A 2LYHA 3Q8QB 2M9NA 2ASDA 1ZQPA 2XCPA 4CCHA 2ZH3A 5J2CA 4FH5A 3C2MA 5KFKA 1TK5A 4PGQA 3H3AA 2FPLA 4UB2A 4ED7A 2BHNA 5L1JA 1NKEA 4Q8FA 3ISCA 9ICRA 4RQ5A 3WFOA 1WCLA 4WC5A 3MDAA 3T5JA 4X4VA 5L1KA 1SKWA 4DOCA 2JZBA 1B22A 5IIIA 1NK9A 1ZYQA 2AGOA 3PO5A 5JUMA 4FHYA 3SYZA 1ZQQA 1ZQYA 2HHSA 4WBYA 4X4QA 1UA1A 4DFPA 4F2SA 4TQSA 1ZQWA 4QZAA 5J0RA 4F3OA 4I2FA 1ZQCA 3G6YA 1V4AA 7ICEA 4M5DA 3GIMA 3V7KA 4PGYA 1IM4A 4KN7A 5BOLA 9ICKA 4B9UA 4GXKA 3OUYA 3JPOA 4DL6A 5KG6A 4FBUA 3MR5A 4YQWA 4KLGA 3JPSA 1U49A 2DR5A 3JPTA 4RWQA 5J2DA 1BPZA 4ECUA 3ZDEA 1K1QA 3BQ0A 4KTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OV7 A;  5DGB A;  4M47 A;  1TKD A;  3EWA A;  1WOT A;  2FMP A;  1TAU A;  3OSN A;  4YVZ A;  1MC8 A;  5IIN A;  3OSP A;  4QWD A;  4AT8 A;  3H4D A;  4LZD A;  5KFE A;  1ZJN A;  1KSP A;  9ICE A;  9ICT A;  5KFM A;  3TQ1 A;  5KT7 A;  3RRH A;  3C5G A;  3ZDD A;  4IQV A;  4QZD A;  1NKC A;  3G6V A;  4QZ8 A;  7ICO A;  5DG7 A;  1ZQN A;  2HHW A;  1ZQX A;  4QZH A;  4JV2 A;  4RQ4 A;  4NLN A;  3UQ0 A;  4O5K A;  4Z6E A;  2VA8 A;  4YMN A;  4Q43 A;  2A1J B;  2W9C A;  8ICI A;  1L3S A;  4O9M A;  8ICA A;  4QW9 A;  4IR1 A;  2ATL A;  4ED6 A;  1UEU A;  4WC6 A;  1FA0 A;  2W9C B;  4M9H A;  9ICL A;  2PXI A;  4EZ6 A;  3ETL A;  4X4O A;  4B9T A;  3H39 A;  1BPE A;  4PHA A;  5L1I A;  4I2B A;  4ED2 A;  4RPZ A;  4F8R A;  3IM1 A;  1T8E A;  4KLI A;  1KNY A;  2BQU A;  3AU6 A;  9ICI A;  3AQL A;  4XQ7 A;  3AQN A;  9ICF A;  2IA6 A;  2DPJ A;  4UB4 A;  5DLF A;  3C5F A;  4KLD A;  3EPG A;  5DDY A;  1KDH A;  3MR2 A;  1ZQO A;  4M2Y A;  3MGH A;  1SKS A;  2C28 A;  2BR0 A;  4YMM A;  9ICP A;  1JMS A;  5KG1 A;  4F4W A;  2ASJ A;  4R8U A;  1Q79 A;  1K1S A;  4RQ8 A;  3M8R A;  1ZQJ A;  2UVU A;  4ED3 A;  3K75 D;  2BCS A;  4O3O A;  2IBK A;  4P4M A;  4KN4 A;  3EW9 A;  5HRD A;  4F5P A;  3JYY A;  4R8U B;  2C2R A;  5KFC A;  2J6T A;  2ZUC A;  2W9B B;  4O3N A;  5HHH A;  4DSI A;  4X4U A;  3KHG A;  4Q45 A;  3GFK B;  5KFR A;  3RJK A;  3FDS A;  3H7I A;  4MEY A;  3UXP A;  1DGS A;  2W9B A;  2J6S A;  2KTQ A;  1HJP A;  2ZUD A;  4NXZ A;  2C2E A;  4ZH4 A;  5HRL A;  4I2J A;  5DB9 A;  3PW0 A;  2ID1 A;  2DRB A;  4YCX A;  5KFN A;  4ECR A;  5DGA A;  1BPX A;  9ICM A;  2ZTC A;  5CA7 A;  1KFT A;  4E80 A;  4EYH B;  4EZ9 A;  4QZE A;  3EZ5 A;  4BWJ A;  4DFM A;  4XA5 A;  4MF8 A;  2V4R A;  4FS1 A;  4C8O A;  7ICJ A;  1SKR A;  3C23 A;  5J2A A;  1ZQZ A;  2P66 A;  3KTQ A;  1NZP A;  2ISP A;  2JEI A;  1UET A;  5J0P A;  4DLG A;  4ED1 A;  3RBD A;  2BGW A;  4IRC A;  4DOB A;  1RPL A;  8ICF A;  1KTQ A;  2VAN A;  3MFI A;  4B9M A;  3RJE A;  4I2D A;  5KFL A;  5IIL A;  9ICJ A;  3GV7 B;  2ZH2 A;  5KFA A;  3TFS A;  4KLS A;  3LQC B;  3OVA A;  1VFG A;  2DVI A;  5KFJ A;  2BPG A;  3PNC A;  5KG4 A;  8ICR A;  2KZZ A;  3B0Y A;  4X4S A;  4P4O A;  4O3P A;  4EBE A;  3H8J A;  4QZG A;  1KRP A;  5CWR A;  4DQS A;  3RTV A;  4KLQ A;  2HHT A;  5KT2 A;  1RXW A;  2R8H A;  3H4B A;  5L9X A;  4EBD A;  1U9L A;  4P2H A;  3FYH A;  5CJ7 A;  4R65 A;  4F5Q A;  3LDA A;  4DSE A;  3TFR A;  1MQ2 A;  3WFQ E;  4TUR A;  2WTF A;  4B9V A;  3JPR A;  5CR0 A;  3NGD A;  3M9M B;  1QLN A;  1R8B A;  1ZQR A;  1R89 A;  4EBK A;  1Z3E B;  2R8G A;  3RH4 A;  8ICU A;  3SV3 A;  4GXJ A;  4F5O A;  4I27 A;  3PV8 A;  3OUY B;  4YR3 A;  1ZQK A;  1N48 A;  4G3I A;  3AUO A;  1XSL A;  5J0T A;  1ZQT A;  8ICT A;  3JZ0 A;  3UXN A;  4FHV A;  4X4T A;  3Q8K A;  2ZHA A;  4EBJ A;  4NLK A;  2ZJ5 A;  2R8J A;  2DRA A;  5J2G A;  1MIY A;  3PR5 B;  2HHQ A;  2C2D A;  5KG7 A;  4I2C A;  5KFH A;  3OJU A;  2W8K A;  4ECV A;  3QE9 Y;  2PI4 A;  8ICW A;  3H8S A;  4UBB A;  4AT8 B;  2ZHB A;  5BPC A;  1XS9 D;  4O3Q A;  3HWT A;  4ED0 A;  3PMN A;  4ELU A;  2RDJ A;  4X5V A;  3T3F A;  3JPQ A;  3H8W A;  4DL4 A;  1KFD A;  3RBE A;  1ZQD A;  8ICV A;  8ICS A;  4FHW A;  1CUK A;  4Z6D A;  3OVB A;  4QWC A;  3G6X A;  3N97 B;  4UB5 A;  3GIK A;  1TK0 A;  1RYR A;  2JEG A;  8ICE A;  1UT5 A;  4O5E A;  3HIY A;  2ZTD A;  1T4G A;  2HHV A;  3RJG A;  4TUS A;  4R64 A;  3RRG A;  4JWN A;  5D4B A;  3M9N B;  1JN3 A;  2PI5 A;  7ICP A;  3UXO A;  4YR2 A;  4R66 A;  4KIT B;  4F2R A;  4DF8 A;  1DK3 A;  1NOM A;  2KFN A;  8ICK A;  4UD4 A;  1MQ3 A;  1F5A A;  5KFX A;  8ICG A;  1ARO P;  1PZN A;  2ZJA A;  4UBC A;  1S9F A;  4O5C A;  3RB0 A;  4LZG A;  4B9S A;  1XWL A;  3OJS A;  1NK7 A;  4DSL A;  1JQR A;  5CB1 A;  4I2G A;  2PFN A;  8ICO A;  4FHX A;  5KFO A;  3RH5 A;  2XGQ A;  2ZH5 A;  1ZQI A;  5J0Q A;  2F1J A;  4DF4 A;  4X0B A;  2NRX A;  1B43 A;  9ICX A;  1KLN A;  3ORY A;  5DBA A;  4DQI A;  3TAR A;  2OWO A;  3HW8 A;  4DQQ A;  7ICG A;  4F93 B;  4PPX A;  4J9Q A;  1RYS A;  3WFP A;  1D9F A;  2KZ3 A;  2V4Q A;  2NRK A;  2PFP A;  4RQ7 A;  3RJI A;  3RB3 A;  3PO4 A;  4WC0 A;  5KFY A;  3M8S A;  3H37 A;  4PHP A;  5IIM A;  5HRH A;  3C21 A;  1NJZ A;  1X2I A;  2BPF A;  3ISB A;  1COO A;  9ICA A;  4S3N A;  3OVS A;  5DB6 A;  1RZT A;  3C2K A;  1L3V A;  5EWG A;  3C2L A;  4YXJ A;  2XY7 A;  3QEA Z;  1ZQM A;  5KG5 A;  1IXR A;  1ZQA A;  5J2J A;  3AQK A;  7ICI A;  1S0N A;  4GC6 A;  1X9S A;  4E0D A;  2FMS A;  2F1I A;  4QZF A;  2MUT A;  1R8A A;  4HYK A;  1NK4 A;  2RFF A;  5EWF A;  3BDP A;  2IHM A;  4KLT A;  4TQR A;  4DL2 A;  3GII A;  1UA0 A;  3RR8 A;  7ICT A;  4WC3 A;  3Q8R B;  4GXI A;  1C7Y A;  9ICO A;  4XUS A;  4J9L A;  1H38 A;  5HRB A;  4O3R A;  1S97 A;  2ZH9 A;  1BGX T;  4M6W A;  4FO6 A;  4IQT A;  4F4K A;  2DFL A;  4UAW A;  9ICU A;  3T5K A;  4KLL A;  5EWE A;  5J2F A;  5DBB A;  4M9G A;  3B0X A;  4RNN A;  9ICB A;  1JXL A;  3N4M B;  3RJH A;  4IG8 A;  1NO5 A;  5L1L A;  4MFF A;  4RPY A;  4UAY A;  3OHA A;  2AGP A;  5DQG A;  4M9J A;  4KLU A;  1KEJ A;  7ICR A;  3Q8L A;  1EXN A;  2ASL A;  9ICH A;  4C8M A;  4DL5 A;  4QWB A;  2BCU A;  4IR9 A;  4QZB A;  3PY8 A;  4M04 A;  2AQ4 A;  1DK2 A;  4C8K A;  3V6K A;  4AT7 B;  4EP7 A;  5HRG A;  2DR8 A;  5HRI A;  4I2E A;  1TFY A;  3V6H A;  3WFS C;  1SZP A;  5DQI A;  2R8K A;  1QSS A;  3PR4 A;  8ICN A;  4X4R A;  5IIO A;  4RQ6 A;  2XO7 A;  1NJW A;  4J9O A;  3T5H A;  2ALZ A;  1ZQS A;  4Z6F A;  4DSK A;  2KFZ A;  2MAX A;  8ICH A;  5J2B A;  3PW2 A;  2HHP A;  4DLE A;  5KFW A;  1TVA A;  1NK8 A;  5HC9 A;  4J9K A;  3LWM A;  2NRW A;  1S0M A;  1VJ7 A;  3KHR A;  4LT6 A;  5BOM A;  3RJJ A;  1OU5 A;  5IIK A;  3BQ1 A;  1U45 A;  2V9W A;  4TUQ A;  4F4Z A;  4K4I A;  8ICC A;  4RNO A;  2BDP A;  3RR7 A;  9ICS A;  5KFG A;  2DR7 A;  1L5U A;  1D9D A;  4E8F A;  4JV0 A;  3GIL A;  1XU4 A;  1SL2 A;  9ICC A;  4NM1 A;  1ZJM A;  9ICV A;  1U4B A;  1XSP A;  3MAB A;  1MIV A;  5KT5 A;  2NRV A;  4F5N A;  1QSL A;  4XQ8 A;  3UPQ A;  4RPX A;  3Q8M A;  4YG2 A;  4NM2 A;  4J9R A;  3HJ4 A;  1BPD A;  2IHN A;  5TZV A;  4K4G A;  4FH3 A;  4EEY A;  2Q0Z X;  1ZQL A;  2NRT A;  7ICQ A;  4UAZ A;  5J2H A;  4X4N A;  2KZM A;  2KP7 A;  3NTU A;  1Y88 A;  5J0O A;  5DLG A;  1XC9 A;  2R8I A;  1WCN A;  5DQH A;  5KFQ A;  1SL0 A;  2AU0 A;  5HHI A;  4DL3 A;  2NRZ A;  7ICU A;  3L9D A;  4NKT A;  5KFT A;  4KLE A;  7ICK A;  5KG2 A;  5J0S A;  5KFZ A;  1SL1 A;  3H38 A;  1ZQG A;  5KFV A;  3RJF A;  1NK6 A;  4FHP A;  2BE3 A;  4F50 A;  1JAJ A;  3SI8 A;  4KLO A;  4B9L A;  1A76 A;  3EPI A;  8ICZ A;  5J2K A;  5DB8 A;  1DOQ A;  5HMM A;  3MR6 A;  2JEF A;  2P6U A;  4PGX A;  4M9N A;  5J0Y A;  8ICY A;  2W9A A;  3TAP A;  3PML A;  2VA3 A;  1NKB A;  2ZH1 A;  1ZQU A;  1TAQ A;  1Z00 B;  4ECQ A;  2BQR A;  2ZH7 A;  2FPK A;  3MFH A;  4KLJ A;  4RWP A;  4MFC A;  2BCV A;  2I1Q A;  4RT2 A;  4QZI A;  8ICL A;  3C1Y A;  7ICH A;  4YP3 A;  3V7L A;  5KFB A;  4JWM A;  1A77 A;  5J29 A;  4M9L A;  1TV9 A;  3HT3 A;  4QZC A;  4RWO A;  2MUT B;  4KLH A;  2ZJ8 A;  3E2E A;  1TK8 A;  5KG0 A;  4F92 B;  2W8L A;  5KFD A;  2P6R A;  4NLG A;  4GC7 A;  3C66 A;  3PX6 A;  1S10 A;  4EBC A;  2PFQ A;  2HW3 A;  3HX0 A;  5KFI A;  2DPI A;  3V72 A;  2ZUB A;  5D49 A;  8ICQ A;  3BQT A;  3MDC A;  5KT6 A;  3QEB Z;  3AQM A;  4PHE A;  2AQ0 A;  1V9P A;  3AU2 A;  4M6W B;  5IIJ A;  5KFU A;  4BGD A;  1QSY A;  1NJY A;  2ZH6 A;  5DKW A;  7ICS A;  4F4Y A;  4MFA A;  1ZQV A;  2HHX A;  1L3T A;  1S0O A;  1UEV A;  4B9N A;  8ICP A;  4ECY A;  8ICX A;  4DWI A;  3ZD8 A;  4DL7 A;  4FS2 A;  8ICB A;  4JK1 A;  5F9N A;  1JX4 A;  1ZQB A;  5KFP A;  1PX5 A;  1Q78 A;  1JIH A;  4BDP A;  1L3U A;  4I2A A;  3GIJ A;  1X9M A;  2M2W A;  1T3N A;  5J0X A;  3UPS A;  2H5X A;  1U48 A;  2BQ3 A;  4DQP A;  5DG8 A;  3ISD A;  1T7P A;  4WBZ A;  4AT7 A;  2DR9 A;  3WFR E;  4TUP A;  5HRK A;  5CHG A;  3Q8S B;  2PFO A;  4BXO B;  5DB7 A;  3JPN A;  1JXE A;  2XGP A;  3BQ2 A;  2BKE A;  4ED8 A;  5KT4 A;  3TAQ A;  2AJQ A;  8ICJ A;  4DSF A;  7ICL A;  4XRH A;  4BXO A;  3QZ7 A;  3BJY A;  1HUO A;  9ICQ A;  3HP6 A;  4P4P A;  4RQ3 A;  3RB6 A;  1D8Y A;  3KHH A;  3GV5 B;  4K4H A;  4YR0 A;  2JZB B;  5J2I A;  4DS4 A;  3RB4 A;  1NK0 A;  5KTQ A;  4KMU A;  2J6U A;  2XY6 A;  5HRF A;  1D8L A;  4ECS A;  4J9N A;  4WC2 A;  1TFW A;  2HHU A;  5C5J A;  3NYB A;  7ICN A;  5KT3 A;  3V7J A;  1BVS A;  3QZ8 A;  3GV8 B;  2UVV A;  4NY8 A;  4KLM A;  4UD5 A;  1CEZ A;  4AT9 B;  4RQ1 A;  5HRE A;  5DDM A;  3M9O B;  4ATB B;  4ECW A;  1RXV A;  3IHQ B;  3RH6 A;  4X0A A;  3C1Z A;  3T5L A;  4RQ0 A;  3JPP A;  4J9M A;  4PH5 A;  5HNK A;  4AT9 A;  4Q44 A;  1ZQE A;  4ATB A;  4RT3 A;  2W9M A;  4C8L A;  4YD1 A;  1N56 A;  3OGU A;  2PBE A;  4RNM A;  8ICM A;  1NK5 A;  3Q8P B;  4RQ2 A;  2FLN A;  2Y1J A;  3RAQ A;  2Q66 A;  3ZDB A;  4UB3 A;  1YLQ A;  3HJ1 A;  4QWE A;  4RUC A;  5EOZ A;  2BPC A;  4R63 A;  3PW7 A;  4IRK A;  7ICF A;  3ZDC A;  5DEC A;  2Y1I A;  4WCW A;  3KHL A;  4BWM A;  1KFS A;  3TI0 A;  4F4X A;  3RAX A;  2ZTE A;  4O0I A;  2XC9 A;  4DS5 A;  3PVX A;  4DQR A;  3TAN A;  4RWN A;  4LVS A;  5HP4 A;  4YFK A;  5KFF A;  3EYZ A;  4EYI B;  1U47 A;  5F9L A;  5J2E A;  4WC4 A;  2VA2 A;  4YMO A;  4IQU A;  2M2U A;  3MR3 A;  2A1J A;  4DSJ A;  5D46 A;  3GDX A;  3V6J A;  4QW8 A;  9ICG A;  4RUA A;  3MGI A;  2M2T A;  2FMQ A;  5KG3 A;  4JV1 A;  4RZR A;  4E7X A;  4IRD A;  4NLZ A;  2HVI A;  1MSW D;  3C18 A;  4PHD A;  2BCQ A;  2O1P A;  2ZH4 A;  7ICV A;  3PW5 A;  3LWL A;  2BCR A;  1ZET A;  1XO1 A;  5DED A;  1Z00 A;  5DG9 A;  2HVH A;  5F2V O;  2UVW A;  3H40 A;  4DO9 A;  2RDI A;  9ICN A;  4RU9 A;  1ZQH A;  4O3S A;  4WC1 A;  4I29 A;  3HPO A;  1BPY A;  1BNP A;  3GQC A;  4IQW A;  2KN7 A;  4YD2 A;  4FBT A;  1HUZ A;  7ICM A;  1BNO A;  4YXM A;  2GWS A;  4MF2 A;  4I2I A;  3PX0 A;  4YN4 A;  2I9G A;  3MBY A;  4DEZ A;  2FLP A;  2XCA A;  4ELV A;  4F91 B;  1X9W A;  4GLX A;  4ECT A;  4KLF A;  1S76 D;  1LV5 A;  2ZH8 A;  4QZ9 A;  4J9S A;  4ECZ A;  5CP2 A;  1S77 D;  4DOA A;  4F5R A;  4WC7 A;  4JUZ A;  3ZD9 A;  3SV4 A;  2B21 A;  4DFK A;  3SZ2 A;  2ISO A;  4C8N A;  2FLL A;  4ELT A;  2UVR A;  4ECX A;  4Z6C A;  4NKU A;  2JEJ A;  3OHB A;  1QTM A;  1XSN A;  3THV A;  4Q8E A;  1MIW A;  1R8C A;  5J0U A;  2O5A A;  4X4P A;  3ZDA A;  1BPB A;  4M0A A;  4QWA A;  2XY5 A;  5DBC A;  3PW4 A;  4I2H A;  3PX4 A;  2IMW P;  4I28 A;  2C22 A;  4MEX A;  2F1H A;  5KFS A;  1NJX A;  1S0V A;  2M2V A;  3UQ2 A;  1UT8 A;  2FPM A;  4UQG A;  5J0W A;  4DFJ A;  3K4G A;  3LK9 A;  1TFR A;  5HML A;  4J9P A;  9ICW A;  1LB2 B;  2AGQ A;  1ZQF A;  5HR9 A;  4UB1 A;  2LYH A;  3Q8Q B;  2M9N A;  2ASD A;  1ZQP A;  2XCP A;  4CCH A;  2ZH3 A;  5J2C A;  4FH5 A;  3C2M A;  5KFK A;  1TK5 A;  4PGQ A;  3H3A A;  2FPL A;  4UB2 A;  4ED7 A;  2BHN A;  5L1J A;  1NKE A;  4Q8F A;  3ISC A;  9ICR A;  4RQ5 A;  3WFO A;  1WCL A;  4WC5 A;  3MDA A;  3T5J A;  4X4V A;  5L1K A;  1SKW A;  4DOC A;  2JZB A;  1B22 A;  5III A;  1NK9 A;  1ZYQ A;  2AGO A;  3PO5 A;  5JUM A;  4FHY A;  3SYZ A;  1ZQQ A;  1ZQY A;  2HHS A;  4WBY A;  4X4Q A;  1UA1 A;  4DFP A;  4F2S A;  4TQS A;  1ZQW A;  4QZA A;  5J0R A;  4F3O A;  4I2F A;  1ZQC A;  3G6Y A;  1V4A A;  7ICE A;  4M5D A;  3GIM A;  3V7K A;  4PGY A;  1IM4 A;  4KN7 A;  5BOL A;  9ICK A;  4B9U A;  4GXK A;  3OUY A;  3JPO A;  4DL6 A;  5KG6 A;  4FBU A;  3MR5 A;  4YQW A;  4KLG A;  3JPS A;  1U49 A;  2DR5 A;  3JPT A;  4RWQ A;  5J2D A;  1BPZ A;  4ECU A;  3ZDE A;  1K1Q A;  3BQ0 A;  4KTQ A; 
#chains in the Genus database with same CATH topology
 1V97 A;  5DGB A;  5KL1 B;  4I0U A;  2EZY A;  9ICE A;  2QB0 B;  4NWI A;  2KSO A;  4QZD A;  2AH5 A;  3G6V A;  2A3V A;  4QZ8 A;  4JV2 A;  4NLN A;  5AM4 A;  2VA8 A;  5ALW A;  2W9C A;  5EE3 A;  8ICI A;  4O9M A;  5AKJ A;  4M9H A;  9ICL A;  4Y2R A;  1BPE A;  4PHA A;  1KNY A;  4F8R A;  4RPZ A;  3AQL A;  3IM1 A;  1T8E A;  2DPJ A;  5DLF A;  3C5F A;  2WF7 A;  1KDH A;  1SKS A;  9ICP A;  2ASJ A;  4G9B A;  1L7O A;  4UB8 U;  4RQ8 A;  3M8R A;  1ZQJ A;  1N2X A;  1ZD2 P;  2EAN A;  4R8U B;  5KFC A;  2W9B B;  1L7P A;  4DSI A;  4Q45 A;  5KFR A;  3F5A A;  4MEY A;  1SB3 C;  1DGS A;  2OYY A;  1KFT A;  5DGA A;  2Y9U A;  9ICM A;  4EYH B;  4BWJ A;  4DFM A;  4XA5 A;  4FS1 A;  4KX5 A;  2P66 A;  3KTQ A;  5ALM A;  4QIW F;  4ED1 A;  2BGW A;  2PMZ F;  2JMG A;  3RJE A;  5KFJ A;  2BPG A;  4K97 A;  3B0Y A;  4EBE A;  1KRP A;  4C7Z A;  1CRX A;  4DQS A;  1OUQ A;  4O6A A;  4P2H A;  1U9L A;  5CJ7 A;  2KKV A;  4OJ5 A;  3WFQ E;  3TFR A;  1MQ2 A;  4TUR A;  2WTF A;  3JPR A;  5CR0 A;  2YX8 A;  2K8B B;  1ZQ1 C;  4GXJ A;  4I27 A;  4FHV A;  3JZ0 A;  2WF9 A;  3Q8K A;  2ZHA A;  4NL9 C;  3PR5 B;  4N7R A;  5AKX A;  2C2D A;  4I2C A;  5KFH A;  4XJE A;  3OJU A;  2W8K A;  1Z1V A;  4ECV A;  3QE9 Y;  4UBB A;  3PSP A;  3JCF A;  4X5V A;  4DL4 A;  8ICV A;  4QWC A;  2JEG A;  3GIK A;  8ICE A;  3HIY A;  4O5E A;  1MA7 A;  4NXV A;  3RJG A;  4R64 A;  5ALT A;  2W43 A;  1O08 A;  4DF8 A;  1NOM A;  1F5A A;  2F3N A;  8ICG A;  2Z7J A;  4UBC A;  4P0P A;  2FE9 A;  2PFN A;  8ICO A;  3RH5 A;  2XGQ A;  4O69 A;  3SQI A;  3I1Y A;  1SXE A;  1B43 A;  9ICX A;  5AI9 A;  4DQQ A;  4JLZ A;  1D9F A;  2V4Q A;  2DF4 B;  2KEY A;  1LVH A;  4WC0 A;  5ALK A;  5IIM A;  5H2F U;  1COO A;  3OPX A;  4S3N A;  3OVS A;  1RZT A;  2YMM A;  5EWG A;  1AQ6 A;  1IXR A;  5K4L A;  1S0N A;  2MUT A;  5CFU A;  4HYK A;  2YML A;  5EWF A;  4KLT A;  3RR8 A;  4DL2 A;  3GII A;  1UA0 A;  7ICT A;  1C7Y A;  5B3Q A;  2D6F C;  1MN8 A;  3BS5 A;  2JV3 A;  5J2F A;  4M9G A;  1X9X A;  3B0X A;  4RNN A;  1Q46 A;  9ICB A;  1JXL A;  3F2B A;  4MFF A;  4RPY A;  4E80 A;  2AGP A;  4M9J A;  1C20 A;  2ASL A;  1EXN A;  9ICH A;  4QWB A;  2DGZ A;  4Y2S A;  2AQ4 A;  3VCB A;  3CYM A;  1DK2 A;  5C0Y A;  1TFY A;  2HBM A;  1SZP A;  3KZI U;  3WK9 A;  1NJW A;  2ALZ A;  1HEK A;  4Z6F A;  2EZZ A;  1NK8 A;  3KHR A;  3RJJ A;  1RM6 C;  4F4Z A;  1ZRM A;  2DR7 A;  4A8E A;  1D9D A;  5E79 U;  4JV0 A;  3GIL A;  9ICC A;  1U4B A;  1XSP A;  1MIV A;  2VKQ A;  5KT5 A;  4F5N A;  3LYS A;  3VC8 A;  4UAV A;  1QSL A;  3UPQ A;  4YG2 A;  4NM2 A;  2PMZ C;  1SV0 A;  2IHN A;  4EEY A;  1GO3 F;  2KP7 A;  2LBO A;  3NTU A;  2KZM A;  5J0O A;  5JTG A;  2G08 A;  2K8C B;  1SL0 A;  7ICK A;  1SL1 A;  5KFV A;  3RJF A;  3TAC B;  3H0L B;  3SI8 A;  1A76 A;  5HMM A;  3IN5 A;  3TAP A;  1RG6 A;  1ZQU A;  1TAQ A;  1Z00 B;  5ALH A;  2FPK A;  4MFC A;  3HKZ F;  1N61 A;  3HKZ C;  3HT3 A;  4KLH A;  1TK8 A;  5KG0 A;  2K4E A;  4NLG A;  5KFD A;  1N5X A;  3PX6 A;  1S10 A;  2HW3 A;  8ICQ A;  5D49 A;  2HBK A;  3HRD D;  2KV2 A;  1V9P A;  3ER9 B;  2ZH6 A;  3UMC A;  2F44 A;  5AIC A;  4NL9 A;  2HHX A;  1UEV A;  4FS2 A;  2O6K A;  4U6P A;  4JK1 A;  1Q78 A;  1PX5 A;  4DQP A;  5DG8 A;  3ISD A;  1T7P A;  2PFO A;  2F8L A;  3JPN A;  2XGP A;  2AJQ A;  2BKE A;  2G5I B;  5KT4 A;  4XRH A;  3QZ7 A;  1HUO A;  4P4P A;  4RQ3 A;  4UAS A;  5AKE A;  4K4H A;  4PL1 A;  4DS4 A;  2XY6 A;  2HHU A;  1CEZ A;  1F5S A;  3M9O B;  3RH6 A;  4RQ0 A;  3JPP A;  4O67 A;  4PH5 A;  4AT9 A;  2B56 A;  3NS1 A;  3ETR A;  2PBE A;  3RAQ A;  4RUC A;  5EOZ A;  2BPC A;  4O3M A;  1KFS A;  2ZTE A;  3R9K A;  3L5K A;  5KFF A;  2A19 A;  5J2E A;  2A1J A;  1SIJ A;  4RUA A;  4K96 A;  2NYV A;  2BBH A;  4OAH A;  2LPE A;  2HVI A;  3C18 A;  7ICV A;  5A0L A;  3LWL A;  5DED A;  2HVH A;  2UVW A;  3NKU A;  4DO9 A;  5AKK A;  4WC1 A;  3GQC A;  1A6S A;  4MF2 A;  4I2I A;  4ELV A;  3MBY A;  4OJ6 A;  2XCA A;  4F91 B;  4GLX A;  4ECT A;  1S76 D;  1ZD5 A;  1LV5 A;  4AYB F;  3N7P D;  4ECZ A;  3L3F X;  5CP2 A;  1LKY B;  4JUZ A;  4FO1 A;  3WKB A;  3SV4 A;  4OJL A;  1ED1 A;  2UVR A;  4ECX A;  4NKU A;  2JEJ A;  1DXS A;  4K9A A;  1XSN A;  3THV A;  4LEW A;  1ZD4 A;  4OAI Z;  3ZDA A;  5KAI U;  2CPR A;  2XY5 A;  3ALR A;  4GIB A;  4I28 A;  3FM9 A;  5KFS A;  4P0Q B;  3UQ2 A;  2EH9 A;  2FPM A;  1L8L A;  3PSI A;  4UQG A;  4DFJ A;  3LK9 A;  1TFR A;  1ZQF A;  4UB1 A;  2LYH A;  1ZQP A;  4FH5 A;  5KFK A;  3WKD A;  4ED7 A;  5HR6 A;  5L1J A;  1NKE A;  4BJQ A;  4DOC A;  2JZB A;  3QNM A;  1NK9 A;  2AGO A;  1ZQQ A;  1B4F A;  1ZQY A;  2HHS A;  4WBY A;  4EEK A;  1UA1 A;  4F2S A;  4QZA A;  1ZQC A;  2JGA A;  3GIM A;  3V7K A;  9ICK A;  5KL8 B;  3OUY A;  4DL6 A;  2QB1 A;  3JPS A;  1U49 A;  2DR5 A;  2QAR B;  1PUZ A;  5J2D A;  1KSP A;  1QQ6 A;  1TKD A;  3EWA A;  1WOT A;  1GPJ A;  5IIN A;  1XNS A;  4AT8 A;  3H4D A;  4LZD A;  1ZJN A;  3AL0 B;  2LM4 A;  3C5G A;  4IQV A;  3KBB A;  1NKC A;  1PK1 B;  1FIQ A;  4LJX A;  1ZQN A;  2GH1 A;  3UQ0 A;  4C4R A;  4Q43 A;  1L3S A;  2EWR A;  2YN4 A;  4ED6 A;  4WC6 A;  2W9C B;  2PXI A;  3ETL A;  4B9T A;  2NV3 A;  5L1I A;  1IV8 A;  2ZXH A;  4KLI A;  2BQU A;  3AQN A;  2CXY A;  9ICF A;  2ZIW A;  3H0M B;  2DKX A;  2HI0 A;  3EPG A;  2D3D A;  1ZQO A;  3MR2 A;  4OAG A;  3MGH A;  2GLE A;  1O03 A;  2IBK A;  2E8O A;  4P4M A;  1RQL A;  2ZUC A;  4O3N A;  4X4U A;  3GFK B;  3RJK A;  3FDS A;  3UXP A;  2FI1 A;  2W9B A;  2J6S A;  2C2E A;  2ZUD A;  2DRB A;  4I2J A;  1BPX A;  4C8O A;  2BDU A;  3NRW A;  1UET A;  1NZP A;  1X6I A;  4WJ3 B;  8ICF A;  1KTQ A;  4QIW C;  2ZH2 A;  5IIL A;  3KD3 A;  1VFG A;  3LQC B;  4AP9 A;  2HDO A;  5KG4 A;  4X4S A;  2KD1 A;  5CWR A;  3RTV A;  1RXW A;  4EBD A;  2GOL A;  3MGV A;  4UAR A;  4R65 A;  2FJ6 A;  4B9V A;  1R8B A;  2B51 A;  1Z3E B;  4C4S A;  3SV3 A;  1J2M A;  1ZXI A;  1XO0 A;  2JH1 A;  2LKY A;  1N48 A;  4G3I A;  2EAO A;  4AYB C;  4EBJ A;  2R8J A;  2EAM A;  4F72 A;  4ICA A;  2HHQ A;  2XID A;  4B6J A;  8ICW A;  2ZHB A;  5GTI U;  5BPC A;  4NLC A;  3HWT A;  5J8Y A;  3H8W A;  1VLB A;  1ZQD A;  2K60 A;  4Z6D A;  3G6X A;  2WB1 F;  2WFA A;  2ZTD A;  1T4G A;  2L5Y A;  4TUS A;  3RRG A;  4JWN A;  2LYA A;  3UXO A;  4YR2 A;  2F8K A;  4F2R A;  1DK3 A;  2W03 A;  3SAF A;  1ARO P;  1PZN A;  2ZJA A;  4O5C A;  3QU9 A;  4LZG A;  4FZN A;  4B9S A;  1YZ6 A;  1NK7 A;  4I2G A;  4FHX A;  5J0Q A;  2HOQ A;  2ZIX B;  3TAR A;  3HW8 A;  7ICG A;  2NRK A;  4RQ7 A;  3RB3 A;  3PO4 A;  3M8S A;  1X2I A;  3ISB A;  3IG8 A;  9ICA A;  2W11 A;  5KG5 A;  4FZM A;  3AQK A;  1WUD A;  1X9S A;  1Z19 A;  2KHQ A;  1R8A A;  3QU4 A;  2RFF A;  5B66 U;  2IHM A;  4TQR A;  1WG8 A;  3Q8R B;  4GXI A;  1FEZ A;  5ALL A;  4XUS A;  4J9L A;  2AXT U;  1H38 A;  4O3R A;  4IQT A;  2IUB A;  4F4K A;  9ICU A;  5B5E U;  5EWE A;  3RJH A;  3BS5 B;  4IG8 A;  2W7O A;  2YY6 A;  4UAY A;  7ICR A;  1KEJ A;  4JB3 A;  5ALS A;  4EP7 A;  5TIS U;  1QQ7 A;  5HRG A;  2DR8 A;  5HRI A;  3V6H A;  3WFS C;  5DQI A;  4X4R A;  1QSS A;  8ICN A;  4RQ6 A;  2XO7 A;  4J9O A;  1ZQS A;  2HHP A;  4K99 A;  4DLE A;  1TVA A;  3B9J A;  4Y2V A;  5HC9 A;  1VJ7 A;  2NRW A;  4LT6 A;  5BOM A;  3BQ1 A;  1WYG A;  1SXD A;  4EX6 A;  4RNO A;  2BDP A;  5CRX A;  4UB6 U;  4NXX A;  4E8F A;  4NXU A;  4NM1 A;  5AI0 A;  2G06 A;  4XQ8 A;  2B6G A;  4RPX A;  3Q8M A;  2W54 A;  4J9R A;  2H3Z A;  2RP5 A;  4OJO A;  1S8O A;  2KJ8 A;  2OCE A;  3HIL A;  1T94 A;  3WKE A;  5DLG A;  4Y2Y A;  2DKZ A;  2JHD A;  4DL3 A;  5ALD A;  5J0S A;  2KVS A;  4F50 A;  2DWQ A;  4KLO A;  4KMO B;  4B9L A;  5D61 A;  5J2K A;  4FZL A;  5AI8 A;  2JEF A;  2P6U A;  5J0Y A;  2HSZ A;  4Y2U A;  2RQ5 A;  1NKB A;  2KIW A;  2ZH1 A;  2BQR A;  2ZH7 A;  4RWP A;  2BCV A;  8ICL A;  5ALY A;  3C1Y A;  7ICH A;  3WK8 A;  3V7L A;  5AM2 A;  4HAI A;  2YB4 A;  5ALP A;  5JRT A;  5ALE A;  1JUD A;  2F76 X;  3F2D A;  2P6R A;  3C66 A;  2IHO A;  5AK3 A;  1Z1B A;  3ICX A;  5AK5 A;  3QEB Z;  2MSN A;  3QXG A;  4PHE A;  4BGD A;  2YB1 A;  3AU2 A;  4M6W B;  1QSY A;  4MHV A;  7ICS A;  4F4Y A;  1QQ5 A;  3H8M A;  8ICB A;  3IP4 B;  5F9N A;  2N1R A;  1ZQB A;  1L3U A;  1X9M A;  3T79 A;  1T3N A;  5J0X A;  4Y2P A;  2DR9 A;  4AT7 A;  4TUP A;  5HRK A;  3Q8S B;  3J81 j;  3BQ2 A;  3TAQ A;  3SR6 A;  3HP6 A;  4C0Z A;  4WQK A;  3K1Z A;  3E58 A;  3GV5 B;  4YR0 A;  5J2I A;  1KBU A;  3RB4 A;  1NK0 A;  5KTQ A;  2F2A B;  1KL9 A;  1TFW A;  1D8L A;  2VJ5 A;  4ECS A;  3QU7 A;  5KT3 A;  4RQ1 A;  4ATB B;  1RXV A;  4X0A A;  1QH9 A;  5EE0 A;  1ZQE A;  4RT3 A;  4RNM A;  8ICM A;  2FLN A;  3UMG A;  3ZDB A;  4UB3 A;  4QWE A;  2Y1I A;  3KHL A;  3RAX A;  2QB0 A;  4O0I A;  2XC9 A;  4DS5 A;  2YTU A;  4RWN A;  4DQR A;  3TAN A;  4PZN A;  5T14 A;  3PSF A;  4YFK A;  4WC4 A;  2VA2 A;  5KAF U;  2K4P A;  3AMZ A;  5D46 A;  3GDX A;  4QW8 A;  2FMQ A;  4RZR A;  5ALV A;  5CFT A;  1MSW D;  2O1P A;  3WKA A;  1XO1 A;  2DBY A;  5DG9 A;  5ALX A;  4RU9 A;  4O3S A;  4EED A;  1BNP A;  2KN7 A;  4YD2 A;  4YN4 A;  2I9G A;  2MA1 A;  2FLP A;  1X9W A;  4KLF A;  2ZH8 A;  2ZIV B;  2ISO A;  3NUQ A;  2FLL A;  5AKI A;  1LKY A;  4Z6C A;  1X40 A;  5ALF A;  1R8C A;  1MIW A;  2O5A A;  4DCC A;  2EDU A;  1L7N A;  4EEN A;  2LI6 A;  2IMW P;  2C22 A;  3ERC C;  5ALI A;  1Q3U A;  4MEX A;  1OW5 A;  2M2V A;  2MU2 A;  5J0W A;  3K4G A;  4J9P A;  5HML A;  1Q8K A;  9ICW A;  4P0Q A;  5HR9 A;  4OCZ A;  5AIB A;  3CK6 A;  2W3R A;  4UB2 A;  2BHN A;  4RQ5 A;  4WC5 A;  4X4V A;  5L1K A;  3PO5 A;  4FHY A;  4X4Q A;  2Y9T A;  5J0R A;  4Y2X A;  3SMV A;  3IG5 A;  4B9U A;  4GXK A;  3JPO A;  4YQW A;  3JPT A;  2YQE A;  1NNL A;  3DV9 A;  3Q8Q B;  4KLE A;  5AI4 A;  4KX3 A;  2G5H B;  3OV7 A;  4M47 A;  2FMP A;  3OSN A;  1MC8 A;  4PJ0 U;  3OSP A;  4QWD A;  9ICT A;  3F53 A;  5KT7 A;  3WK4 A;  2WF6 A;  3RRH A;  1PVQ A;  7ICO A;  2ZIU B;  4Z6E A;  4YMN A;  4OJP A;  8ICA A;  3F2C A;  4IR1 A;  1V38 A;  1ZD3 A;  4EZ6 A;  4I2B A;  4ED2 A;  4OO1 J;  3BZK A;  4CRX A;  4KLD A;  2E1F A;  5DDY A;  4M2Y A;  2HCF A;  2ZIW B;  3NYB A;  3SD7 A;  3DEE A;  1Q79 A;  1K1S A;  2UVU A;  3K75 D;  2BCS A;  4KN4 A;  5HRD A;  3JYY A;  1J2N A;  5HHH A;  4K8V A;  5D63 A;  4PZO A;  1HJP A;  5HRL A;  2ID1 A;  5DB9 A;  3PW0 A;  4YCX A;  4ECR A;  2E8N A;  4EZ9 A;  2RRD A;  4O68 A;  7ICJ A;  2W55 A;  5J2A A;  2JEI A;  5J0P A;  3RBD A;  4DOB A;  1RPL A;  2KMD A;  3MFI A;  4B9M A;  2Q66 A;  3IV6 A;  1UCV A;  5ALN A;  5KFA A;  2KZZ A;  4P4O A;  2D8C A;  4QZG A;  5G5H A;  2NO5 A;  4KLQ A;  3QUB A;  2HHT A;  3H4B A;  5L9X A;  3FYH A;  4F5Q A;  3LDA A;  2AHO B;  3M9M B;  4IL6 U;  1QLN A;  5KNI A;  2R8G A;  2H3V A;  3PHZ A;  4UAU A;  5AI5 A;  3PV8 A;  2RLT A;  1ZQK A;  1XSL A;  5J0T A;  1ZQT A;  2QKQ A;  5JTI A;  4LEV A;  4X4T A;  4NLK A;  2ZJ5 A;  2DRA A;  3ZI4 A;  1MIY A;  2KNJ A;  5KG7 A;  2RHF A;  1DGJ A;  4CF3 A;  3H8S A;  4O3Q A;  3PMN A;  2WAQ C;  5AKG A;  3T3F A;  3RBE A;  1KFD A;  8ICS A;  3QYP A;  2YMP A;  1UT5 A;  1Z4N A;  4EX7 A;  3H0R B;  3NWI A;  1V85 A;  5D4B A;  3M9N B;  1JN3 A;  1JRO A;  2LYB A;  4K9B A;  5JU5 A;  2VJ4 A;  1MQ3 A;  2DL0 A;  3CRX A;  3RB0 A;  1XWL A;  2OH2 A;  1JQR A;  5CB1 A;  5KFO A;  4QNL A;  2F1J A;  2E8P A;  2NRX A;  1KLN A;  3BZC A;  5DBA A;  4DQI A;  3KOO A;  4F93 B;  2ZIX A;  5CHE A;  3WFP A;  4PL2 A;  2KZ3 A;  2PFP A;  3H37 A;  5HRH A;  1NJZ A;  2E5S A;  5DB6 A;  3C2K A;  3CNH A;  3QEA Z;  5J2J A;  7ICI A;  3NVZ A;  1HIW A;  4WC3 A;  2XVT A;  1D8B A;  2G07 A;  2WF5 A;  3QU2 A;  5HRB A;  1VJ5 A;  2ZH9 A;  4FO6 A;  4RQN A;  3C28 A;  4UAW A;  2WHE A;  4KLL A;  2KG5 A;  2FCL A;  2A1A A;  3I76 A;  5L1L A;  3M7D A;  3NVY A;  3OHA A;  4C8M A;  4DL5 A;  4IR9 A;  4QZB A;  3PY8 A;  3V6K A;  1L6N A;  2E8M A;  2R8K A;  4CE6 A;  5IIO A;  3T5H A;  4DSK A;  2KFZ A;  8ICH A;  2MAX A;  5J2B A;  3PW2 A;  2W3S A;  1S5L U;  4J9K A;  1S0M A;  4EEB A;  5IIK A;  2V9W A;  5D62 A;  3CW2 C;  9ICS A;  5KFG A;  1L5U A;  4KM5 A;  4Y2J A;  1KN5 A;  9ICV A;  3MAB A;  3AQE A;  2R18 A;  5AM1 A;  4BUG A;  5F3X B;  3HJ4 A;  1BPD A;  5TZV A;  3N7R C;  1ZQL A;  3IRU A;  7ICQ A;  4P0P B;  2JR5 A;  2R8I A;  1WCN A;  1B0X A;  4NKT A;  1JI7 A;  1YZ7 A;  3H38 A;  1PVP A;  3KFU F;  1NK6 A;  2BE3 A;  1JAJ A;  1SGG A;  3EPI A;  8ICZ A;  5DB8 A;  1DOQ A;  3MR6 A;  3OTQ A;  4M9N A;  4NXT A;  4ACO A;  8ICY A;  2W9A A;  4CNQ A;  3MFH A;  1OXJ A;  4QZI A;  4RT2 A;  1FFU A;  5AKL A;  4QZC A;  4RWO A;  2MUT B;  3E2E A;  4F92 B;  2NO4 A;  2W8L A;  1JAL A;  4EBC A;  3AQM A;  3BS7 A;  4USA A;  1NJY A;  4MFA A;  2HBJ A;  1ZQV A;  2M0N A;  2ESE A;  2KJ5 A;  2LMR A;  8ICX A;  5AHX A;  1JIH A;  4BDP A;  2M2W A;  4I2A A;  3GIJ A;  1JRP A;  2KVC A;  2H5X A;  5ALJ A;  1U48 A;  2BQ3 A;  4WBZ A;  3WFR E;  3WK5 A;  3WKC A;  1Z4O A;  4BXO B;  1SWW A;  4CDG A;  5DB7 A;  5AIA A;  1JXE A;  4ED8 A;  7ICL A;  3A0B U;  3BJY A;  9ICQ A;  4US9 A;  2JZB B;  4WC2 A;  4WQL A;  1F44 A;  7ICN A;  3V7J A;  4KLM A;  3IHQ B;  4GFJ A;  2ZXI A;  4IC9 A;  4K98 A;  4ATB A;  5EE9 A;  1UHU A;  5AK6 A;  3OGU A;  2QAR A;  1NK5 A;  4US8 A;  1YLQ A;  2JXJ A;  3PW7 A;  4R63 A;  4IRK A;  3O0F A;  3C29 A;  4BWM A;  3TI0 A;  4F4X A;  2OEH A;  3PZP A;  4CF4 A;  3PVX A;  5HP4 A;  3EYZ A;  2Y0S C;  4IQU A;  1YT3 A;  2KKP A;  1J97 A;  1F0M A;  2OHF A;  9ICG A;  3NVW A;  1WWV A;  4JV1 A;  3QUT A;  4PHD A;  2WB1 C;  5HR7 A;  2BCR A;  2KIV A;  1Z00 A;  4OAF A;  5AKY A;  1ZQH A;  3F5E A;  4I29 A;  1BPY A;  5EE1 A;  4FBT A;  1BNO A;  5AM5 A;  2GWS A;  2JH7 A;  4DEZ A;  2H3I A;  3KKA C;  2IOF A;  4QZ9 A;  2B0C A;  4DOA A;  4WC7 A;  2MRL A;  3ZD9 A;  4DFK A;  3SZ2 A;  4C8N A;  4ELT A;  2ZIV A;  5J8Y C;  1CI4 A;  5ALO A;  1VDV A;  1TE2 A;  5J0U A;  4X4P A;  4M0A A;  3WK6 A;  3TKA A;  1S0V A;  1ECW A;  3CP8 A;  3D2N A;  4LEZ A;  2KJ9 A;  2ZH3 A;  2M9N A;  2ASD A;  4CCH A;  2XCP A;  5J2C A;  1TK5 A;  4PGQ A;  2FPL A;  3S6J A;  3HJE A;  4Q8F A;  1WCL A;  1QCK A;  3MDA A;  3T5J A;  2BBJ A;  5L1M A;  5AKH A;  1SKW A;  1B22 A;  5III A;  3BQ7 A;  3SYZ A;  4CGZ A;  4DFP A;  4TQS A;  1V4A A;  2H3Q A;  4M5D A;  4I2F A;  3G6Y A;  1M6Y A;  7ICE A;  3D2S A;  2HOI A;  4PGY A;  1IM4 A;  4KN7 A;  5BOL A;  5KG6 A;  4FBU A;  3MR5 A;  5FP0 A;  2Q4T A;  4ECU A;  3ZDE A;  3PW5 A;  1ZQI A;  1K1Q A;  1X66 A;  3M1Y A;  1TAU A;  4YVZ A;  2KSO B;  5KFE A;  5KFM A;  3TQ1 A;  4DFD A;  4HX0 A;  3ZDD A;  3AM9 A;  4NXW A;  5DG7 A;  2HHW A;  1ZQX A;  4J03 A;  4QZH A;  1UQV A;  4RQ4 A;  4O5K A;  2LHT A;  5ALG A;  2A1J B;  4JLX A;  3ED5 A;  4QW9 A;  2ZIU A;  3E0F A;  2ATL A;  2KE7 A;  1UEU A;  5ALQ A;  3K7D A;  4C80 A;  1FA0 A;  3L4P A;  4X4O A;  3H39 A;  4XQ7 A;  3AN1 A;  3AU6 A;  9ICI A;  1KQQ A;  2IA6 A;  4UB4 A;  1COK A;  2W04 A;  2C28 A;  2BR0 A;  4YMM A;  1JMS A;  5KG1 A;  4F4W A;  4R8U A;  1PK3 A;  4ED3 A;  4O3O A;  3EW9 A;  4F5P A;  1ZRN A;  2C2R A;  2J6T A;  3NRZ A;  3KHG A;  3H7I A;  2KTQ A;  4NXZ A;  2DUY A;  4ZH4 A;  4U7C A;  5AI6 A;  5KFN A;  1IIP A;  2H3F A;  4EV6 A;  2ZTC A;  3SAH A;  5CA7 A;  5ALU A;  4QZE A;  3EZ5 A;  4MF8 A;  2V4R A;  1SKR A;  3C23 A;  3UMB A;  1ZQZ A;  2ISP A;  2VIX A;  4DLG A;  3D2Q A;  4IRC A;  2VAN A;  4I2D A;  5KFL A;  9ICJ A;  3GV7 B;  1FFV A;  4KLS A;  3TFS A;  3OVA A;  2DVI A;  8ICR A;  4RQM A;  3PNC A;  2QLT A;  4O3P A;  3H8J A;  4F71 A;  2DQN B;  5KT2 A;  4QJF B;  2R8H A;  3FAH A;  2KIC A;  4DSE A;  2B4V A;  3NGD A;  1ZQR A;  1R89 A;  1SV0 C;  4EBK A;  3RH4 A;  8ICU A;  2KK0 A;  4F5O A;  1K5O A;  3OUY B;  4YR3 A;  4WOY A;  3AUO A;  8ICT A;  1N5W A;  3UXN A;  1RQN A;  5J2G A;  1RDF A;  4C7Y A;  4FFD A;  3RFA A;  2PI4 A;  1SZH A;  4AT8 B;  3OWG A;  5AM0 A;  1XS9 D;  4ED0 A;  4ELU A;  2RDJ A;  3JPQ A;  2KHV A;  3KZX A;  4FHW A;  3PST A;  1CUK A;  1PK1 A;  3OVB A;  3N97 B;  1TK0 A;  1RYR A;  4UB5 A;  3SAG A;  2HHV A;  1UPH A;  2PI5 A;  7ICP A;  4R66 A;  4KIT B;  3AEV A;  4UD4 A;  2KFN A;  8ICK A;  1P7D A;  5KFX A;  2E1E A;  1S9F A;  2IOH A;  3OJS A;  4DSL A;  2ZG6 A;  2YMQ A;  2ZH5 A;  2OXO A;  5G5G A;  4DF4 A;  4X0B A;  3ORY A;  2OWO A;  4CF5 A;  4PPX A;  4J9Q A;  1RYS A;  4BX9 C;  1Q3V A;  3RJI A;  2HN2 A;  5KFY A;  4PHP A;  2HOF A;  3C21 A;  2WF8 A;  2BPF A;  2OM6 A;  1L3V A;  3C2L A;  4YXJ A;  2XY7 A;  1ZQM A;  1ZQA A;  4E0D A;  4GC6 A;  2FMS A;  2F1I A;  4QZF A;  2P35 A;  1NK4 A;  3BDP A;  2IOF K;  1L7M A;  2HBL A;  9ICO A;  1KKX A;  1S97 A;  1RYU A;  4NLB A;  1BGX T;  4M6W A;  2K8A A;  2DFL A;  3K1R B;  3T5K A;  1A0P A;  1SWV A;  5DBB A;  3N4M B;  1NO5 A;  4NJ8 A;  1OU5 A;  4KLU A;  5DQG A;  3Q8L A;  4LEY A;  2BCU A;  4M04 A;  3M6Z A;  4C8K A;  4AT7 B;  3AQF A;  1FO4 A;  3ER8 C;  4I2E A;  3IDW A;  2HMX A;  3PR4 A;  3MC1 A;  3I28 A;  5KFW A;  3LWM A;  2G09 A;  3A0H U;  1U45 A;  3KKA A;  2EZX A;  4TUQ A;  4K4I A;  8ICC A;  3RR7 A;  5GTH U;  1SL2 A;  1XU4 A;  1ZJM A;  4NV0 A;  2NRV A;  5B3P A;  3SEI A;  1KW4 A;  4MKP A;  4FH3 A;  4K4G A;  4UAT A;  2Q0Z X;  2NRT A;  4X4N A;  4UAZ A;  5J2H A;  1NI3 A;  2W7P A;  4Y2Q A;  1Y88 A;  5ALZ A;  1XC9 A;  5DQH A;  5KFQ A;  2AU0 A;  5HHI A;  7ICU A;  2NRZ A;  3L9D A;  3GZF A;  5KFT A;  5KG2 A;  5KFZ A;  1ZQG A;  3D6J A;  4FHP A;  4PGX A;  3PML A;  2VA3 A;  1URJ A;  4ECQ A;  3WU2 U;  4KLJ A;  4EGW A;  2I1Q A;  2I5H A;  4YP3 A;  5KFB A;  4JWM A;  1A77 A;  5J29 A;  4M9L A;  1TV9 A;  2ZJ8 A;  3QU5 A;  3QUC A;  3TAD A;  4GC7 A;  2PFQ A;  3HX0 A;  2XI9 A;  5KFI A;  2DPI A;  3V72 A;  2ZUB A;  3FC4 A;  3BQT A;  4ZOH C;  5KT6 A;  3MDC A;  2CN1 A;  1X6J A;  2AQ0 A;  1T3Q A;  5KFU A;  5IIJ A;  5DKW A;  1L3T A;  1S0O A;  4B9N A;  8ICP A;  4ECY A;  4DWI A;  3ZD8 A;  4DL7 A;  1IG6 A;  1JX4 A;  5KFP A;  1NZB A;  3EF2 A;  3UPS A;  3RF9 A;  2E3T A;  2I6X A;  4EEL A;  5CHG A;  8ICJ A;  4DSF A;  3EUB 2;  4BXO A;  3NVV A;  1TAM A;  1DRG A;  3RB6 A;  1D8Y A;  3KHH A;  3TAD C;  5HRF A;  4KMU A;  2J6U A;  4J9N A;  5C5J A;  4NY8 A;  1BVS A;  3QZ8 A;  3GV8 B;  2UVV A;  4UD5 A;  4AT9 B;  5HRE A;  5DDM A;  1L8O A;  3UM9 A;  4ECW A;  3C1Z A;  3T5L A;  4J9M A;  5HNK A;  4Q44 A;  5AKZ A;  3MCR A;  2W9M A;  4C8L A;  4YD1 A;  2LM1 A;  2PKE A;  1N56 A;  3WK7 A;  3Q8P B;  2F77 X;  4RQ2 A;  3NAS A;  2Y1J A;  3HJ1 A;  4FE3 A;  5DEC A;  7ICF A;  3N7S C;  3ZDC A;  4WCW A;  2G0A A;  1SV4 A;  4LVS A;  1N62 A;  4EYI B;  4OD0 A;  1U47 A;  5F9L A;  4YMO A;  2M2U A;  3LVW A;  3MR3 A;  2FDR A;  2Y0S F;  4DSJ A;  3V6J A;  1WWU A;  3N28 A;  2WAQ F;  3GU3 A;  3MGI A;  2M2T A;  1N63 A;  5KG3 A;  4E7X A;  2BZF A;  4IRD A;  4NLZ A;  5AM3 A;  1ZOL A;  2ES6 A;  2BCQ A;  2ZH4 A;  2K89 A;  1ZET A;  3QUQ A;  5F2V O;  4JMU A;  3H40 A;  2RDI A;  9ICN A;  3M6K A;  3HPO A;  4IQW A;  1PVR A;  1HUZ A;  7ICM A;  4YXM A;  2CRX A;  5AK4 A;  3PX0 A;  4J9S A;  1S77 D;  4F5R A;  2B21 A;  2GO7 A;  3OHB A;  1QTM A;  4Q8E A;  2GAF D;  1BPB A;  3SEN A;  4QWA A;  2K4H A;  2K4I A;  5DBC A;  3PW4 A;  4I2H A;  3PX4 A;  2XIC A;  5CEH A;  5ALR A;  2F1H A;  1NJX A;  2HN1 A;  2JRZ A;  1N60 A;  1UT8 A;  2ODG A;  1LB2 B;  2AGQ A;  2KOB A;  4WH5 A;  4Y2T A;  3C2M A;  4IS7 A;  3H3A A;  1X42 A;  3ISC A;  9ICR A;  3WFO A;  3QX7 A;  4UW9 A;  3LVV A;  1ZYQ A;  3NVO A;  5JUM A;  1ZQW A;  4F3O A;  2EAP A;  5CFS A;  2GA9 D;  4C4T A;  3ONN A;  4KB6 A;  4KLG A;  3U26 A;  4RWQ A;  1BPZ A;  3DDH A;  2EQY A;  3BQ0 A;  4KTQ A; 
#chains in the Genus database with same CATH homology
 3OV7 A;  5DGB A;  4M47 A;  1TKD A;  3EWA A;  1WOT A;  2FMP A;  1TAU A;  3OSN A;  4YVZ A;  1MC8 A;  5IIN A;  3OSP A;  4QWD A;  4AT8 A;  3H4D A;  4LZD A;  5KFE A;  1ZJN A;  1KSP A;  9ICE A;  9ICT A;  5KFM A;  3TQ1 A;  5KT7 A;  3RRH A;  3C5G A;  3ZDD A;  4IQV A;  4QZD A;  1NKC A;  3G6V A;  4QZ8 A;  7ICO A;  5DG7 A;  1ZQN A;  2HHW A;  1ZQX A;  4QZH A;  4JV2 A;  4RQ4 A;  4NLN A;  3UQ0 A;  4O5K A;  4Z6E A;  2VA8 A;  4YMN A;  4Q43 A;  2A1J B;  2W9C A;  8ICI A;  1L3S A;  4O9M A;  8ICA A;  4QW9 A;  4IR1 A;  2ATL A;  4ED6 A;  1UEU A;  4WC6 A;  1FA0 A;  2W9C B;  4M9H A;  9ICL A;  2PXI A;  4EZ6 A;  3ETL A;  4X4O A;  4B9T A;  3H39 A;  1BPE A;  4PHA A;  5L1I A;  4I2B A;  4ED2 A;  4RPZ A;  4F8R A;  3IM1 A;  1T8E A;  4KLI A;  1KNY A;  2BQU A;  3AU6 A;  9ICI A;  3AQL A;  4XQ7 A;  3AQN A;  9ICF A;  2IA6 A;  2DPJ A;  4UB4 A;  5DLF A;  3C5F A;  4KLD A;  3EPG A;  5DDY A;  1KDH A;  3MR2 A;  1ZQO A;  4M2Y A;  3MGH A;  1SKS A;  2C28 A;  2BR0 A;  4YMM A;  9ICP A;  1JMS A;  5KG1 A;  4F4W A;  2ASJ A;  4R8U A;  1Q79 A;  1K1S A;  4RQ8 A;  3M8R A;  1ZQJ A;  2UVU A;  4ED3 A;  3K75 D;  2BCS A;  4O3O A;  2IBK A;  4P4M A;  4KN4 A;  3EW9 A;  5HRD A;  4F5P A;  3JYY A;  4R8U B;  2C2R A;  5KFC A;  2J6T A;  2ZUC A;  2W9B B;  4O3N A;  5HHH A;  4DSI A;  4X4U A;  3KHG A;  4Q45 A;  3GFK B;  5KFR A;  3RJK A;  3FDS A;  3H7I A;  4MEY A;  3UXP A;  1DGS A;  2W9B A;  2J6S A;  2KTQ A;  1HJP A;  2ZUD A;  4NXZ A;  2C2E A;  4ZH4 A;  5HRL A;  4I2J A;  5DB9 A;  3PW0 A;  2ID1 A;  2DRB A;  4YCX A;  5KFN A;  4ECR A;  5DGA A;  1BPX A;  9ICM A;  2ZTC A;  5CA7 A;  1KFT A;  4E80 A;  4EYH B;  4EZ9 A;  4QZE A;  3EZ5 A;  4BWJ A;  4DFM A;  4XA5 A;  4MF8 A;  2V4R A;  4FS1 A;  4C8O A;  7ICJ A;  1SKR A;  3C23 A;  5J2A A;  1ZQZ A;  2P66 A;  3KTQ A;  1NZP A;  2ISP A;  2JEI A;  1UET A;  5J0P A;  4DLG A;  4ED1 A;  3RBD A;  2BGW A;  4IRC A;  4DOB A;  1RPL A;  8ICF A;  1KTQ A;  2VAN A;  3MFI A;  4B9M A;  3RJE A;  4I2D A;  5KFL A;  5IIL A;  9ICJ A;  3GV7 B;  2ZH2 A;  5KFA A;  3TFS A;  4KLS A;  3LQC B;  3OVA A;  1VFG A;  2DVI A;  5KFJ A;  2BPG A;  3PNC A;  5KG4 A;  8ICR A;  2KZZ A;  3B0Y A;  4X4S A;  4P4O A;  4O3P A;  4EBE A;  3H8J A;  4QZG A;  1KRP A;  5CWR A;  4DQS A;  3RTV A;  4KLQ A;  2HHT A;  5KT2 A;  1RXW A;  2R8H A;  3H4B A;  5L9X A;  4EBD A;  1U9L A;  4P2H A;  3FYH A;  5CJ7 A;  4R65 A;  4F5Q A;  3LDA A;  4DSE A;  3TFR A;  1MQ2 A;  3WFQ E;  4TUR A;  2WTF A;  4B9V A;  3JPR A;  5CR0 A;  3NGD A;  3M9M B;  1QLN A;  1R8B A;  1ZQR A;  1R89 A;  4EBK A;  1Z3E B;  2R8G A;  3RH4 A;  8ICU A;  3SV3 A;  4GXJ A;  4F5O A;  4I27 A;  3PV8 A;  3OUY B;  4YR3 A;  1ZQK A;  1N48 A;  4G3I A;  3AUO A;  1XSL A;  5J0T A;  1ZQT A;  8ICT A;  3JZ0 A;  3UXN A;  4FHV A;  4X4T A;  3Q8K A;  2ZHA A;  4EBJ A;  4NLK A;  2ZJ5 A;  2R8J A;  2DRA A;  5J2G A;  1MIY A;  3PR5 B;  2HHQ A;  2C2D A;  5KG7 A;  4I2C A;  5KFH A;  3OJU A;  2W8K A;  4ECV A;  3QE9 Y;  2PI4 A;  8ICW A;  3H8S A;  4UBB A;  4AT8 B;  2ZHB A;  5BPC A;  1XS9 D;  4O3Q A;  3HWT A;  4ED0 A;  3PMN A;  4ELU A;  2RDJ A;  4X5V A;  3T3F A;  3JPQ A;  3H8W A;  4DL4 A;  1KFD A;  3RBE A;  1ZQD A;  8ICV A;  8ICS A;  4FHW A;  1CUK A;  4Z6D A;  3OVB A;  4QWC A;  3G6X A;  3N97 B;  4UB5 A;  3GIK A;  1TK0 A;  1RYR A;  2JEG A;  8ICE A;  1UT5 A;  4O5E A;  3HIY A;  2ZTD A;  1T4G A;  2HHV A;  3RJG A;  4TUS A;  4R64 A;  3RRG A;  4JWN A;  5D4B A;  3M9N B;  1JN3 A;  2PI5 A;  7ICP A;  3UXO A;  4YR2 A;  4R66 A;  4KIT B;  4F2R A;  4DF8 A;  1DK3 A;  1NOM A;  2KFN A;  8ICK A;  4UD4 A;  1MQ3 A;  1F5A A;  5KFX A;  8ICG A;  1ARO P;  1PZN A;  2ZJA A;  4UBC A;  1S9F A;  4O5C A;  3RB0 A;  4LZG A;  4B9S A;  1XWL A;  3OJS A;  1NK7 A;  4DSL A;  1JQR A;  5CB1 A;  4I2G A;  2PFN A;  8ICO A;  4FHX A;  5KFO A;  3RH5 A;  2XGQ A;  2ZH5 A;  1ZQI A;  5J0Q A;  2F1J A;  4DF4 A;  4X0B A;  2NRX A;  1B43 A;  9ICX A;  1KLN A;  3ORY A;  5DBA A;  4DQI A;  3TAR A;  2OWO A;  3HW8 A;  4DQQ A;  7ICG A;  4F93 B;  4PPX A;  4J9Q A;  1RYS A;  3WFP A;  1D9F A;  2KZ3 A;  2V4Q A;  2NRK A;  2PFP A;  4RQ7 A;  3RJI A;  3RB3 A;  3PO4 A;  4WC0 A;  5KFY A;  3M8S A;  3H37 A;  4PHP A;  5IIM A;  5HRH A;  3C21 A;  1NJZ A;  1X2I A;  2BPF A;  3ISB A;  1COO A;  9ICA A;  4S3N A;  3OVS A;  5DB6 A;  1RZT A;  3C2K A;  1L3V A;  5EWG A;  3C2L A;  4YXJ A;  2XY7 A;  3QEA Z;  1ZQM A;  5KG5 A;  1IXR A;  1ZQA A;  5J2J A;  3AQK A;  7ICI A;  1S0N A;  4GC6 A;  1X9S A;  4E0D A;  2FMS A;  2F1I A;  4QZF A;  2MUT A;  1R8A A;  4HYK A;  1NK4 A;  2RFF A;  5EWF A;  3BDP A;  2IHM A;  4KLT A;  4TQR A;  4DL2 A;  3GII A;  1UA0 A;  3RR8 A;  7ICT A;  4WC3 A;  3Q8R B;  4GXI A;  1C7Y A;  9ICO A;  4XUS A;  4J9L A;  1H38 A;  5HRB A;  4O3R A;  1S97 A;  2ZH9 A;  1BGX T;  4M6W A;  4FO6 A;  4IQT A;  4F4K A;  2DFL A;  4UAW A;  9ICU A;  3T5K A;  4KLL A;  5EWE A;  5J2F A;  5DBB A;  4M9G A;  3B0X A;  4RNN A;  9ICB A;  1JXL A;  3N4M B;  3RJH A;  4IG8 A;  1NO5 A;  5L1L A;  4MFF A;  4RPY A;  4UAY A;  3OHA A;  2AGP A;  5DQG A;  4M9J A;  4KLU A;  1KEJ A;  7ICR A;  3Q8L A;  1EXN A;  2ASL A;  9ICH A;  4C8M A;  4DL5 A;  4QWB A;  2BCU A;  4IR9 A;  4QZB A;  3PY8 A;  4M04 A;  2AQ4 A;  1DK2 A;  4C8K A;  3V6K A;  4AT7 B;  4EP7 A;  5HRG A;  2DR8 A;  5HRI A;  4I2E A;  1TFY A;  3V6H A;  3WFS C;  1SZP A;  5DQI A;  2R8K A;  1QSS A;  3PR4 A;  8ICN A;  4X4R A;  5IIO A;  4RQ6 A;  2XO7 A;  1NJW A;  4J9O A;  3T5H A;  2ALZ A;  1ZQS A;  4Z6F A;  4DSK A;  2KFZ A;  2MAX A;  8ICH A;  5J2B A;  3PW2 A;  2HHP A;  4DLE A;  5KFW A;  1TVA A;  1NK8 A;  5HC9 A;  4J9K A;  3LWM A;  2NRW A;  1S0M A;  1VJ7 A;  3KHR A;  4LT6 A;  5BOM A;  3RJJ A;  1OU5 A;  5IIK A;  3BQ1 A;  1U45 A;  2V9W A;  4TUQ A;  4F4Z A;  4K4I A;  8ICC A;  4RNO A;  2BDP A;  3RR7 A;  9ICS A;  5KFG A;  2DR7 A;  1L5U A;  1D9D A;  4E8F A;  4JV0 A;  3GIL A;  1XU4 A;  1SL2 A;  9ICC A;  4NM1 A;  1ZJM A;  9ICV A;  1U4B A;  1XSP A;  3MAB A;  1MIV A;  5KT5 A;  2NRV A;  4F5N A;  1QSL A;  4XQ8 A;  3UPQ A;  4RPX A;  3Q8M A;  4YG2 A;  4NM2 A;  4J9R A;  3HJ4 A;  1BPD A;  2IHN A;  5TZV A;  4K4G A;  4FH3 A;  4EEY A;  2Q0Z X;  1ZQL A;  2NRT A;  7ICQ A;  4UAZ A;  5J2H A;  4X4N A;  2KZM A;  2KP7 A;  3NTU A;  1Y88 A;  5J0O A;  5DLG A;  1XC9 A;  2R8I A;  1WCN A;  5DQH A;  5KFQ A;  1SL0 A;  2AU0 A;  5HHI A;  4DL3 A;  2NRZ A;  7ICU A;  3L9D A;  4NKT A;  5KFT A;  4KLE A;  7ICK A;  5KG2 A;  5J0S A;  5KFZ A;  1SL1 A;  3H38 A;  1ZQG A;  5KFV A;  3RJF A;  1NK6 A;  4FHP A;  2BE3 A;  4F50 A;  1JAJ A;  3SI8 A;  4KLO A;  4B9L A;  1A76 A;  3EPI A;  8ICZ A;  5J2K A;  5DB8 A;  1DOQ A;  5HMM A;  3MR6 A;  2JEF A;  2P6U A;  4PGX A;  4M9N A;  5J0Y A;  8ICY A;  2W9A A;  3TAP A;  3PML A;  2VA3 A;  1NKB A;  2ZH1 A;  1ZQU A;  1TAQ A;  1Z00 B;  4ECQ A;  2BQR A;  2ZH7 A;  2FPK A;  3MFH A;  4KLJ A;  4RWP A;  4MFC A;  2BCV A;  2I1Q A;  4RT2 A;  4QZI A;  8ICL A;  3C1Y A;  7ICH A;  4YP3 A;  3V7L A;  5KFB A;  4JWM A;  1A77 A;  5J29 A;  4M9L A;  1TV9 A;  3HT3 A;  4QZC A;  4RWO A;  2MUT B;  4KLH A;  2ZJ8 A;  3E2E A;  1TK8 A;  5KG0 A;  4F92 B;  2W8L A;  5KFD A;  2P6R A;  4NLG A;  4GC7 A;  3C66 A;  3PX6 A;  1S10 A;  4EBC A;  2PFQ A;  2HW3 A;  3HX0 A;  5KFI A;  2DPI A;  3V72 A;  2ZUB A;  5D49 A;  8ICQ A;  3BQT A;  3MDC A;  5KT6 A;  3QEB Z;  3AQM A;  4PHE A;  2AQ0 A;  1V9P A;  3AU2 A;  4M6W B;  5IIJ A;  5KFU A;  4BGD A;  1QSY A;  1NJY A;  2ZH6 A;  5DKW A;  7ICS A;  4F4Y A;  4MFA A;  1ZQV A;  2HHX A;  1L3T A;  1S0O A;  1UEV A;  4B9N A;  8ICP A;  4ECY A;  8ICX A;  4DWI A;  3ZD8 A;  4DL7 A;  4FS2 A;  8ICB A;  4JK1 A;  5F9N A;  1JX4 A;  1ZQB A;  5KFP A;  1PX5 A;  1Q78 A;  1JIH A;  4BDP A;  1L3U A;  4I2A A;  3GIJ A;  1X9M A;  2M2W A;  1T3N A;  5J0X A;  3UPS A;  2H5X A;  1U48 A;  2BQ3 A;  4DQP A;  5DG8 A;  3ISD A;  1T7P A;  4WBZ A;  4AT7 A;  2DR9 A;  3WFR E;  4TUP A;  5HRK A;  5CHG A;  3Q8S B;  2PFO A;  4BXO B;  5DB7 A;  3JPN A;  1JXE A;  2XGP A;  3BQ2 A;  2BKE A;  4ED8 A;  5KT4 A;  3TAQ A;  2AJQ A;  8ICJ A;  4DSF A;  7ICL A;  4XRH A;  4BXO A;  3QZ7 A;  3BJY A;  1HUO A;  9ICQ A;  3HP6 A;  4P4P A;  4RQ3 A;  3RB6 A;  1D8Y A;  3KHH A;  3GV5 B;  4K4H A;  4YR0 A;  2JZB B;  5J2I A;  4DS4 A;  3RB4 A;  1NK0 A;  5KTQ A;  4KMU A;  2J6U A;  2XY6 A;  5HRF A;  1D8L A;  4ECS A;  4J9N A;  4WC2 A;  1TFW A;  2HHU A;  5C5J A;  3NYB A;  7ICN A;  5KT3 A;  3V7J A;  1BVS A;  3QZ8 A;  3GV8 B;  2UVV A;  4NY8 A;  4KLM A;  4UD5 A;  1CEZ A;  4AT9 B;  4RQ1 A;  5HRE A;  5DDM A;  3M9O B;  4ATB B;  4ECW A;  1RXV A;  3IHQ B;  3RH6 A;  4X0A A;  3C1Z A;  3T5L A;  4RQ0 A;  3JPP A;  4J9M A;  4PH5 A;  5HNK A;  4AT9 A;  4Q44 A;  1ZQE A;  4ATB A;  4RT3 A;  2W9M A;  4C8L A;  4YD1 A;  1N56 A;  3OGU A;  2PBE A;  4RNM A;  8ICM A;  1NK5 A;  3Q8P B;  4RQ2 A;  2FLN A;  2Y1J A;  3RAQ A;  2Q66 A;  3ZDB A;  4UB3 A;  1YLQ A;  3HJ1 A;  4QWE A;  4RUC A;  5EOZ A;  2BPC A;  4R63 A;  3PW7 A;  4IRK A;  7ICF A;  3ZDC A;  5DEC A;  2Y1I A;  4WCW A;  3KHL A;  4BWM A;  1KFS A;  3TI0 A;  4F4X A;  3RAX A;  2ZTE A;  4O0I A;  2XC9 A;  4DS5 A;  3PVX A;  4DQR A;  3TAN A;  4RWN A;  4LVS A;  5HP4 A;  4YFK A;  5KFF A;  3EYZ A;  4EYI B;  1U47 A;  5F9L A;  5J2E A;  4WC4 A;  2VA2 A;  4YMO A;  4IQU A;  2M2U A;  3MR3 A;  2A1J A;  4DSJ A;  5D46 A;  3GDX A;  3V6J A;  4QW8 A;  9ICG A;  4RUA A;  3MGI A;  2M2T A;  2FMQ A;  5KG3 A;  4JV1 A;  4RZR A;  4E7X A;  4IRD A;  4NLZ A;  2HVI A;  1MSW D;  3C18 A;  4PHD A;  2BCQ A;  2O1P A;  2ZH4 A;  7ICV A;  3PW5 A;  3LWL A;  2BCR A;  1ZET A;  1XO1 A;  5DED A;  1Z00 A;  5DG9 A;  2HVH A;  5F2V O;  2UVW A;  3H40 A;  4DO9 A;  2RDI A;  9ICN A;  4RU9 A;  1ZQH A;  4O3S A;  4WC1 A;  4I29 A;  3HPO A;  1BPY A;  1BNP A;  3GQC A;  4IQW A;  2KN7 A;  4YD2 A;  4FBT A;  1HUZ A;  7ICM A;  1BNO A;  4YXM A;  2GWS A;  4MF2 A;  4I2I A;  3PX0 A;  4YN4 A;  2I9G A;  3MBY A;  4DEZ A;  2FLP A;  2XCA A;  4ELV A;  4F91 B;  1X9W A;  4GLX A;  4ECT A;  4KLF A;  1S76 D;  1LV5 A;  2ZH8 A;  4QZ9 A;  4J9S A;  4ECZ A;  5CP2 A;  1S77 D;  4DOA A;  4F5R A;  4WC7 A;  4JUZ A;  3ZD9 A;  3SV4 A;  2B21 A;  4DFK A;  3SZ2 A;  2ISO A;  4C8N A;  2FLL A;  4ELT A;  2UVR A;  4ECX A;  4Z6C A;  4NKU A;  2JEJ A;  3OHB A;  1QTM A;  1XSN A;  3THV A;  4Q8E A;  1MIW A;  1R8C A;  5J0U A;  2O5A A;  4X4P A;  3ZDA A;  1BPB A;  4M0A A;  4QWA A;  2XY5 A;  5DBC A;  3PW4 A;  4I2H A;  3PX4 A;  2IMW P;  4I28 A;  2C22 A;  4MEX A;  2F1H A;  5KFS A;  1NJX A;  1S0V A;  2M2V A;  3UQ2 A;  1UT8 A;  2FPM A;  4UQG A;  5J0W A;  4DFJ A;  3K4G A;  3LK9 A;  1TFR A;  5HML A;  4J9P A;  9ICW A;  1LB2 B;  2AGQ A;  1ZQF A;  5HR9 A;  4UB1 A;  2LYH A;  3Q8Q B;  2M9N A;  2ASD A;  1ZQP A;  2XCP A;  4CCH A;  2ZH3 A;  5J2C A;  4FH5 A;  3C2M A;  5KFK A;  1TK5 A;  4PGQ A;  3H3A A;  2FPL A;  4UB2 A;  4ED7 A;  2BHN A;  5L1J A;  1NKE A;  4Q8F A;  3ISC A;  9ICR A;  4RQ5 A;  3WFO A;  1WCL A;  4WC5 A;  3MDA A;  3T5J A;  4X4V A;  5L1K A;  1SKW A;  4DOC A;  2JZB A;  1B22 A;  5III A;  1NK9 A;  1ZYQ A;  2AGO A;  3PO5 A;  5JUM A;  4FHY A;  3SYZ A;  1ZQQ A;  1ZQY A;  2HHS A;  4WBY A;  4X4Q A;  1UA1 A;  4DFP A;  4F2S A;  4TQS A;  1ZQW A;  4QZA A;  5J0R A;  4F3O A;  4I2F A;  1ZQC A;  3G6Y A;  1V4A A;  7ICE A;  4M5D A;  3GIM A;  3V7K A;  4PGY A;  1IM4 A;  4KN7 A;  5BOL A;  9ICK A;  4B9U A;  4GXK A;  3OUY A;  3JPO A;  4DL6 A;  5KG6 A;  4FBU A;  3MR5 A;  4YQW A;  4KLG A;  3JPS A;  1U49 A;  2DR5 A;  3JPT A;  4RWQ A;  5J2D A;  1BPZ A;  4ECU A;  3ZDE A;  1K1Q A;  3BQ0 A;  4KTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...