4UB2A

Dna polymerase beta product complex with a templating cytosine and 8-oxodgmp, 120 s
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
319
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 104
structure length 319
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub2A03
4ECZA 3RJFA 4Z6CA 1WCLA 5DG7A 3AQNA 5DG8A 3G6YA 4ED2A 4YXMA 7ICEA 2ZJ5A 2VANA 5J2CA 4DL2A 4ATBA 3RB3A 2XCAA 5KT3A 4TQRA 4IQUA 4ECVA 2ATLA 3HX0A 1TK8A 4RPYA 4FO6A 5F9NA 1ZQCA 1RXVA 4WC5A 4EZ9A 1XWLA 1ZQOA 3C21A 2J6TA 3MABA 2ASJA 5KG4A 4BXOB 9ICHA 4PGXA 1DGSA 1H38A 3M9MB 3AUOA 2KZMA 1L3VA 2DVIA 4J9RA 2XO7A 4ECSA 5KFVA 1TAUA 1R8CA 3AQLA 4RWQA 1V4AA 4DFMA 4R66A 4DSLA 8ICOA 5J0XA 4PHPA 5BOLA 2JEFA 4B9TA 2M2UA 2C28A 4UB3A 5HREA 3JPTA 3RTVA 3UQ0A 3C18A 5L1JA 4DFJA 8ICQA 5KFDA 5KFKA 4KLTA 7ICLA 2BQUA 4KMUA 1L3SA 3WFOA 4I2CA 4M6WA 4RQ0A 2FLPA 5DQIA 1ZQVA 3HWTA 3C2MA 4M04A 2NRKA 4DL4A 3PV8A 4FHYA 4AT8A 4YR0A 4UB2A 3RJJA 4TURA 5KG1A 1BPDA 4QZ9A 4F5PA 4DSEA 2UVVA 4FBUA 4LZGA 5HRHA 1KNYA 1Q78A 2W8LA 1KFSA 3TFRA 3OVSA 3ETLA 3PX0A 3OGUA 7ICRA 1HUOA 4FBTA 1U4BA 4RWPA 1ZQUA 2F1JA 3T5LA 4PGQA 3M8RA 1ZQGA 2PXIA 4F4XA 4KLLA 8ICEA 2ZHBA 2JEJA 4AT9A 2J6SA 3TAQA 5L9XA 3SI8A 3PY8A 5KG2A 2V4QA 4J9KA 5KFOA 2BQRA 7ICNA 2P66A 9ICIA 4NM2A 5DGAA 3V7JA 1XSLA 4WC1A 3GFKB 9ICAA 3RJEA 2DR8A 3N97B 1QTMA 2R8KA 4ECQA 2GWSA 4DWIA 4RQ3A 1SL1A 1ZQNA 4ATBB 4UB1A 4R63A 1RYRA 2J6UA 2VA3A 5KFNA 2BKEA 1R8BA 3QZ7A 1X9SA 4KLJA 3B0YA 3SV3A 2KZ3A 1PZNA 1NJZA 4IRKA 4K4GA 2AGPA 4KLQA 1JAJA 1DK2A 4QW8A 4KLHA 3HPOA 3L9DA 4RT3A 1NK8A 3GIIA 2R8HA 2V9WA 2B21A 4DL7A 5DB9A 3H37A 2AGQA 4QWEA 1UT8A 4DQIA 1NZPA 2KTQA 3C23A 5F2VO 4PHEA 2W9CB 4LT6A 1IXRA 2MUTB 5D49A 1XU4A 3HW8A 1BNOA 4P4MA 2F1IA 1A77A 2BR0A 2DPJA 3ZDCA 3PO5A 8ICNA 4I2DA 5J2JA 8ICXA 9ICQA 3RB4A 3MGIA 1L3UA 4I2AA 1U49A 1XO1A 4C8KA 4DSKA 3TI0A 1ZQWA 8ICAA 2BHNA 1MIVA 3HJ4A 3H8WA 2A1JA 4FH5A 3G6XA 3UXOA 2W9BA 1ZQTA 5IILA 3RAXA 1NJXA 8ICWA 8ICTA 1UEUA 4P2HA 2C2RA 4YFKA 3V72A 2HHSA 2XC9A 5DECA 3PW7A 1JIHA 4YR3A 4JV1A 4E8FA 5J0RA 1NK7A 3C2LA 2PFOA 2PI4A 1U47A 1XC9A 1KLNA 8ICZA 4DQSA 4C8LA 1S0VA 3UQ2A 2BCQA 1ZQZA 3RJIA 1L5UA 3HP6A 5J2HA 1FA0A 1ZQLA 7ICHA 5KFJA 1NJYA 4MFCA 2JZBA 1Z00B 2BCUA 4YMOA 2XGPA 4ECXA 4JV2A 4RNOA 2KP7A 4ED8A 3V6KA 4F3OA 3HT3A 1XSNA 1ZQFA 2FMQA 3PNCA 2ISPA 1RYSA 4EYHB 4DQPA 4I2FA 8ICHA 5KT4A 2BE3A 4E7XA 3T5HA 4R64A 5KFFA 3OJUA 3KHLA 3BJYA 4WC7A 4QZHA 5DB8A 5TZVA 2AU0A 2FLLA 3RJKA 3H8SA 2ZH7A 1SKSA 1X9MA 5HRIA 4DEZA 4KLEA 2O5AA 2VA2A 2Y1JA 2RDJA 9ICSA 4M9JA 2ZH5A 5KFAA 3ZDAA 3V7LA 4ELUA 1ZQXA 4MEYA 1D9DA 2HHTA 2UVRA 5KT2A 2KZZA 4RNMA 3MGHA 4RQ2A 4ECYA 3EZ5A 3SZ2A 1WOTA 1QSLA 3H38A 5DGBA 1ZQBA 5J0OA 3PMNA 2HVIA 4ED0A 4QWCA 4ECWA 2BPFA 4UD5A 3RJGA 3RH5A 1BPXA 4B9VA 4IRCA 4F5QA 4O3SA 4QZEA 3GIKA 4BGDA 4M9LA 1PX5A 7ICIA 3OVBA 4F5NA 4DFKA 1RXWA 5IIJA 3OJSA 5IIMA 4X4TA 2DFLA 3GV8B 2LYHA 2ZJAA 2R8IA 3TFSA 2M2WA 4AT7A 3MR3A 4EZ6A 5KFLA 4QZAA 4C8OA 1MIYA 4RZRA 5IINA 4XRHA 3BQ0A 2IMWP 4YD2A 5J2EA 3PW4A 3OSNA 5L1LA 4O5CA 4RQ5A 4KTQA 4NM1A 4AT9B 3EW9A 4I2IA 3Q8KA 4F93B 4QZDA 9ICNA 5KFTA 1BVSA 5J2BA 3KHRA 3G6VA 3GQCA 4FS1A 8ICPA 5DEDA 4DS5A 5KFMA 4I2EA 4KITB 4BWMA 4M5DA 3KHHA 4YG2A 2FMSA 2ZH2A 4EBCA 7ICPA 3IHQB 2JEGA 3WFSC 9ICWA 2PBEA 5KT6A 3OUYB 1SL2A 4WBZA 4UAYA 1BGXT 3WFQE 5HNKA 4RQ8A 4ED1A 2ISOA 4YQWA 5DBCA 4TUPA 4NLNA 2M2TA 4DQRA 3ISBA 2VA8A 8ICMA 3LDAA 5HC9A 3OHAA 2WTFA 3AU6A 5KFIA 3H7IA 2JEIA 3C66A 1VFGA 1U48A 5C5JA 3H40A 3RBDA 4M9GA 1NO5A 4DOBA 4Q44A 3RR8A 1DK3A 3AU2A 5J29A 2Q0ZX 4ED3A 4WC2A 2Y1IA 5KG0A 5HR9A 4JWNA 5KG7A 4FHXA 4GLXA 4Q43A 3M9OB 4ECUA 4GXJA 4CCHA 4O5KA 5KTQA 3AQMA 1TFYA 2ZH8A 3KTQA 3JPQA 3H3AA 4MFFA 3NTUA 1KDHA 4B9MA 3OV7A 1WCNA 1HJPA 4J9SA 5HRBA 4KLFA 4J9LA 2XY6A 5CJ7A 1U9LA 4ELVA 4Z6FA 4P4OA 5J0PA 4KLUA 2NRXA 5CA7A 3MBYA 4DF4A 2IA6A 4DSFA 4J9MA 4NXZA 1NOMA 5KFHA 4G3IA 4Q45A 3THVA 3PW5A 1MQ3A 3T3FA 2HHWA 4O3QA 2PFQA 4X4OA 9ICFA 3UXPA 1ZQMA 7ICJA 9ICRA 4J9NA 5DLGA 4E80A 2AQ4A 4M6WB 2C2EA 1ZQIA 3JPNA 1ZQKA 1S0MA 8ICSA 5CHGA 1ZQEA 3PO4A 2W8KA 4HYKA 1AROP 2ZH6A 2IBKA 4DOCA 3NGDA 5DLFA 7ICGA 1NK4A 4JV0A 1IM4A 5CWRA 2DPIA 4I29A 2FPKA 3EPIA 4XQ8A 2NRTA 4EBKA 5DBBA 2ZH4A 2R8GA 4RWOA 9ICGA 3JYYA 1NK6A 4NLKA 9ICCA 1UA1A 2OWOA 4UQGA 2R8JA 4IQTA 3EYZA 1UT5A 5JUMA 9ICEA 5J2AA 2I1QA 4JWMA 4PHAA 4DOAA 5IIIA 4P4PA 3OHBA 4ED6A 5HMMA 4RQ4A 4YXJA 3M9NB 2V4RA 4DFPA 4B9NA 1BNPA 5J2GA 4Z6EA 2RFFA 3BQTA 2P6RA 1JXLA 4MF2A 4O3NA 4FS2A 8ICFA 4I2JA 4X4PA 4QZFA 3H4BA 1KFTA 4I28A 2BQ3A 3JPRA 4MF8A 2HVHA 9ICPA 4F4KA 4UAZA 1BPBA 1SZPA 2ZJ8A 5KG6A 9ICVA 5HRLA 4LZDA 2XY7A 3ISCA 1KRPA 4O9MA 1TVAA 2ZUCA 5EWFA 4F8RA 9ICMA 2HHPA 4X4VA 5KFRA 4C8NA 4QZCA 1ZETA 4F2SA 1MIWA 3GIMA 3TAPA 1L3TA 5DQHA 3H39A 4BWJA 4M9HA 2BCRA 1T4GA 3MFHA 5J2DA 4RQ1A 4EYIB 2ALZA 1LB2B 1BPZA 3ZDDA 1T8EA 1D8LA 4DSJA 3B0XA 1ZQPA 4X4SA 5BOMA 1ZJNA 3MDCA 4KN7A 5KFYA 4EBEA 9ICTA 4WBYA 2ZHAA 3Q8PB 1TK5A 3Q8QB 1QLNA 1N48A 1ZQAA 2MAXA 3ZDBA 4WCWA 2MUTA 5J0QA 3E2EA 4R65A 5HRFA 3NYBA 1RPLA 2NRZA 1NK5A 1N56A 1Q79A 9ICBA 5J0SA 1NJWA 7ICUA 5J0WA 4QZBA 2BCSA 5HHIA 1R8AA 4EP7A 7ICFA 4FHVA 4PGYA 1MC8A 3LWMA 3AQKA 4DF8A 1BPEA 1MQ2A 1JX4A 5KT7A 3IM1A 4IQVA 4O3RA 5KFEA 3C1YA 5D46A 4J9QA 2XY5A 3SV4A 4C8MA 4ELTA 8ICKA 3C5GA 3C1ZA 2I9GA 1ZYQA 5DDYA 4AT8B 3RBEA 2AGOA 1JQRA 4GC6A 3JPPA 4TUSA 4B9LA 1SKWA 3ZD8A 4F4YA 4X4NA 4F2RA 4IG8A 4J9OA 1Z00A 2FLNA 3T5KA 2BDPA 4UBCA 8ICJA 5KFWA 3PVXA 4F4ZA 4DL5A 4KLGA 1K1SA 8ICUA 3M8SA 3RAQA 4PPXA 1YLQA 4YD1A 3SYZA 4GC7A 3PX4A 3OUYA 1JN3A 4R8UB 2H5XA 2IHMA 9ICKA 1Y88A 1S77D 2ID1A 2DR9A 4WC4A 1JXEA 4DLEA 3WFRE 1S0OA 5EOZA 1X9WA 1CUKA 2HHVA 5DDMA 8ICRA 2F1HA 4FHWA 4ZH4A 2A1JB 1S10A 2W9BB 4E0DA 7ICSA 3LQCB 2BPCA 2FMPA 7ICTA 1NKCA 1V9PA 9ICXA 7ICOA 3K4GA 3GV7B 4NKTA 4IR9A 4X0AA 2C22A 3RRHA 4RWNA 3PW2A 9ICLA 4O5EA 4IRDA 1KEJA 1S0NA 3V7KA 3QEBZ 1T3NA 2BPGA 1QSSA 4YCXA 3ISDA 4NY8A 3PR4A 5HRGA 5KT5A 4YN4A 3MR6A 4BDPA 4M47A 5KFPA 2P6UA 4EBDA 2DR7A 5CR0A 4PH5A 2ZH9A 1A76A 3BQ1A 1HUZA 5IIKA 3RH6A 4X4UA 3LK9A 4UD4A 2Q66A 3ZDEA 4QWDA 1B43A 4FHPA 1TFRA 4F92B 4LVSA 5L1KA 1TK0A 2DRAA 5DG9A 4UBBA 3GDXA 4JK1A 3QEAZ 2C2DA 3Q8SB 1KSPA 1U45A 2W9CA 3RR7A 4NKUA 3PR5B 1SL0A 2ZH3A 2ZH1A 3UPQA 4RNNA 5CP2A 3OSPA 2ASDA 4I27A 1KTQA 4WC6A 4KN4A 3JPOA 4J9PA 2KFNA 1NK9A 4KLMA 3OVAA 5KFGA 1XS9D 3PW0A 3HIYA 4RUCA 3UPSA 4RT2A 4UB4A 4ECRA 4S3NA 4R8UA 3JPSA 1XSPA 4TUQA 1TFWA 4O3PA 2ZTDA 1TV9A 2KFZA 4YR2A 2AJQA 4F4WA 4MFAA 5J2FA 3WFPA 2IHNA 5DB7A 1JMSA 2DRBA 1S97A 3ORYA 5DQGA 5HHHA 5DKWA 5HP4A 5KFQA 4RUAA 4YMNA 4KLIA 4KLSA 1B22A 5DBAA 3H4DA 4XQ7A 5KFBA 2JZBB 4B9UA 2W9AA 1VJ7A 2RDIA 3TANA 4DO9A 4QWBA 3H8JA 3GV5B 3C5FA 8ICGA 3MFIA 3FYHA 1C7YA 9ICUA 4UB5A 1NK0A 5J0UA 5F9LA 5KFZA 4WC0A 3GILA 4DL6A 3ZD9A 2ZTEA 1QSYA 4BXOA 2HHXA 5J2IA 2O1PA 2FPLA 1UA0A 4AT7B 4K4HA 5J0YA 4WC3A 4YVZA 5L1IA 1UETA 4Z6DA 3K75D 8ICBA 4IR1A 4KLOA 3V6HA 5HMLA 1SKRA 4EEYA 4K4IA 4ED7A 5HRKA 5KG5A 4M0AA 5D4BA 3MR5A 4DS4A 3FDSA 1ZQSA 3MDAA 2KN7A 4IQWA 4X0BA 2HW3A 4ECTA 5J2KA 3PX6A 3T5JA 2W9MA 2NRWA 1EXNA 2HHUA 2FPMA 2PI5A 4QZ8A 3BDPA 4F50A 2DR5A 5KFCA 3LWLA 3QE9Y 1RZTA 1NKEA 3RB6A 3EPGA 4X4RA 1D9FA 4FH3A 1F5AA 3UXNA 3EWAA 3Q8RB 3TQ1A 2NRVA 1ZJMA 4TQSA 8ICCA 3RRGA 1ZQYA 1Z3EB 2BGWA 5KFSA 2AQ0A 4NLZA 3KHGA 9ICJA 1UEVA 5KFXA 4DL3A 4PHDA 2ZUDA 3TARA 4MEXA 2UVWA 1TAQA 4KLDA 4I2BA 4M2YA 3JZ0A 2ASLA 1X2IA 1COOA 1ZQRA 1T7PA 8ICYA 3HJ1A 5J0TA 1TKDA 4DSIA 8ICIA 4GXKA 1K1QA 4QWAA 1ZQDA 7ICQA 4F5OA 3QZ8A 3N4MB 5HRDA 5BPCA 2PFPA 4UAWA 2UVUA 4F91B 1BPYA 3RJHA 4NLGA 3MR2A 7ICKA 9ICOA 4RPXA 7ICVA 4O0IA 3PMLA 4X5VA 5KFUA 3RB0A 3Q8MA 1NKBA 2ZUBA 5DB6A 4YP3A 4M9NA 1ZQHA 5KG3A 1KFDA 1DOQA 4XUSA 4RQ6A 1MSWD 4GXIA 2ZTCA 8ICLA 4X4QA 4DLGA 2PFNA 4JUZA 4I2GA 3RH4A 3GIJA 4F5RA 5EWEA 1ZQJA 4RPZA 1OU5A 2XCPA 4DQQA 4YMMA 4XA5A 4RQ7A 3C2KA 4Q8EA 7ICMA 1ZQQA 1S9FA 2HHQA 1LV5A 2M9NA 1CEZA 5CB1A 4I2HA 4RU9A 1S76D 3V6JA 4B9SA 8ICVA 2BCVA 3BQ2A 4Q8FA 2XGQA 2M2VA 5EWGA 4QW9A 1R89A 4EBJA 3Q8LA 4QZIA 1D8YA 4O3OA 4QZGA 5IIOA
chains in the Genus database with same CATH superfamily
1L7NA 4ECZA 4Z6CA 1O03A 3AQNA 1HIWA 5DG8A 4ED2A 1KL9A 4ATBA 2LKYA 2JHDA 5AK5A 5KT3A 4IQUA 2ATLA 3QU7A 4FO6A 5ALSA 2R18A 4BXOB 3MGVA 9ICHA 2Z7JA 3M9MB 2DVIA 4J9RA 1J97A 2OCEA 4R66A 4OCZA 2DQNB 4UB3A 3UQ0A 2LBOA 2LYAA 4RQ0A 2NRKA 2ZG6A 4DSEA 5KG1A 4QZ9A 4FBUA 2UVVA 5HRHA 4LZGA 2CN1A 3ETLA 3PX0A 4FBTA 4PGQA 1WG8A 4F4XA 2JEJA 2V4QA 5KFOA 3BS7A 2P66A 1DRGA 2GOLA 5DGAA 3RFAA 3V7JA 1XSLA 3RJEA 2DGZA 3N97B 2WAQF 2OYYA 4ECQA 3VCBA 2GWSA 3FAHA 4O6AA 2JH1A 1L7PA 3BZKA 1X6JA 2WF8A 3QZ7A 1X9SA 4KLJA 1R8BA 2KD1A 3IG8A 4K4GA 2YMQA 3KKAC 2KE7A 2AGPA 4KLQA 4KLHA 5F3XB 1DK2A 5B66U 1ZOLA 4DL7A 1UT8A 5J8YA 3A0BU 3SMVA 1IXRA 2MUTB 4Y2XA 1XU4A 2F1IA 2BR0A 3PO5A 5J2JA 3ICXA 3RB4A 4BUGA 1L3UA 5AICA 2HI0A 3TI0A 3H8WA 3LVWA 2A19A 4Y2UA 4YFKA 3NRWA 3ER8C 1L7OA 4CF3A 1NK7A 3C2LA 8ICZA 1U47A 5A0LA 4C8LA 2GO7A 3BZCA 1FA0A 3F5AA 7ICHA 5KFJA 4EX6A 1KQQA 2JZBA 4NXVA 4RNOA 3E58A 4ED8A 4F3OA 3HT3A 1ZQFA 1F5SA 1RYSA 2BE3A 4E7XA 5KT4A 3PSTA 3OJUA 1Z1BA 4QIWF 1IV8A 1B4FA 4G9BA 1A6SA 5AKIA 4DEZA 5KFAA 1D9DA 4RQ2A 1ZQBA 3PMNA 4OAIZ 2BPFA 3RH5A 1BPXA 3GIKA 4M9LA 2KOBA 3OVBA 4F5NA 3RF9A 5IIMA 3TFSA 2IHOA 3MR3A 2W7PA 4EEKA 4QZAA 1MIYA 2RP5A 4RZRA 1X9XA 5EE0A 2IMWP 5J2EA 3Q8KA 1BVSA 5JTGA 3U26A 4FZMA 5KFMA 4KITB 4YG2A 9ICWA 5KT6A 2ZIWA 1WWUA 2ISOA 5ALGA 2W3RA 2M2TA 5AIAA 5JRTA 4DQRA 2WTFA 2F3NA 5KFIA 3C66A 2W03A 1U48A 3RR8A 1YT3A 4ED3A 4GLXA 4Q43A 3M9OB 1TFYA 5KTQA 2CPRA 2GH1A 3JPQA 3H3AA 4MFFA 5HRBA 2E5SA 4KLUA 2ZXIA 2FI1A 4J9MA 5KFHA 1NOMA 1SV0C 3PW5A 3THVA 2W54A 2HHWA 4O3QA 3M6KA 1RDFA 5JU5A 2FJ6A 1ZQMA 9ICRA 4J9NA 2AQ4A 1CRXA 4M6WB 1ZQKA 1S0MA 4WOYA 5CHGA 1ZQEA 5CFTA 4HYKA 2ZH6A 2K60A 3NGDA 5DLFA 1QQ6A 1IM4A 4EBKA 5H2FU 2ZH4A 9ICGA 3JYYA 4NLKA 5GTHU 9ICCA 3EYZA 5JUMA 5AM0A 1MA7A 9ICEA 2IOFK 5J2AA 4PHAA 1SWVA 3OHBA 4DFPA 4B9NA 4RQ4A 2V4RA 4QNLA 5ALLA 1FFUA 4Y2TA 4I2JA 4QZFA 3H4BA 1KFTA 4I28A 4NLBA 2YTUA 9ICPA 2RFFA 9ICVA 4O9MA 2ZUCA 1ZETA 1RQLA 1UPHA 4US8A 3H39A 3MFHA 1LB2B 1JROA 5BOMA 1ZJNA 2YMMA 3Q8QB 3ZDBA 5J0QA 5CRXA 2K4EA 1N56A 3MCRA 1S5LU 2ZIXA 2BCSA 1R8AA 1NNLA 3AMZA 3OUYB 3BS5B 3HJEA 1MQ2A 1JX4A 3C1YA 5D46A 8ICKA 3C1ZA 5ALYA 2ZIWB 1JQRA 4B9LA 1SKWA 3ZD8A 4IG8A 2YN4A 4DL5A 1YLQA 3RAQA 4YD1A 4GC7A 1JN3A 2H5XA 1Y88A 4WC4A 3L5KA 1JXEA 1OUQA 4FHWA 4E0DA 2BPCA 2FMPA 4NKTA 2DL0A 3K4GA 3GV7B 2C22A 3QEBZ 2GA9D 4KX5A 3SAHA 4YN4A 3MR6A 4EBDA 2ZIXB 4FZLA 4UB6U 4MHVA 2QB1A 4F92B 5DG9A 3GDXA 2ZH3A 3IV6A 3UPQA 3JPOA 4J9PA 3QXGA 2OHFA 3M6ZA 1FFVA 3I28A 4RT2A 3WK7A 4UATA 4YR2A 5DB7A 1S97A 3ORYA 5KFQA 4KLIA 5DBAA 5KFBA 3K1ZA 4B9UA 1VJ7A 2RDIA 2XVTA 4QWBA 3GV5B 5ALOA 1DXSA 5F9LA 1V97A 2G5HB 2OM6A 3KZXA 4GIBA 2FCLA 3ETRA 4NV0A 3HKZC 1UETA 8ICBA 4KLOA 5B3QA 1ZD5A 5D4BA 4IQWA 3JCFA 2HW3A 3HILA 3PX6A 3T5JA 4K9BA 4Y2VA 2HHUA 2FPMA 2PI5A 3IG5A 2DF4B 5D61A 2DR5A 2MRLA 3QE9Y 1N62A 2LHTA 2NRVA 1N63A 2KV2A 2KKVA 8ICCA 3A0HU 3NASA 1UEVA 2UVWA 1B0XA 4KLDA 2K8AA 4I2BA 1ZQRA 1X2IA 2E8MA 5ALWA 8ICIA 4QWAA 4Y2YA 2HOIA 5HRDA 7ICKA 2NO5A 3PMLA 1J2NA 3Q8MA 4YP3A 1KFDA 2ZTCA 4I2GA 3RH4A 3NWIA 4DQQA 4EX7A 4OAHA 1N5WA 2H3QA 2IOHA 3BQ2A 3AN1A 4EBJA 3Q8LA 1ZRMA 1FEZA 4O68A 3OVAA 3RJFA 1LKYA 3G6YA 1ZXIA 2ZJ5A 5J2CA 4DL2A 2RHFA 4TQRA 4ECVA 4OJ6A 4RPYA 4EZ9A 4OJ5A 1ZQOA 4NXXA 5KG4A 1Z1VA 1H38A 4NXUA 1QQ7A 4OJOA 1L3VA 4RWQA 8ICOA 5BOLA 3JPTA 2W11A 1MN8A 4Y2JA 5KFDA 4OJPA 5DQIA 1ZQVA 3C2MA 4M04A 2H3FA 4DL4A 4AT8A 4FZNA 4YR0A 4UB2A 2B56A 1KFSA 3OVSA 3OGUA 7ICRA 1HUOA 1X6IA 1CI4A 2JMGA 4KLLA 2PXIA 8ICEA 1S8OA 1SGGA 4IC9A 2PMZF 3TAQA 2H3IA 4WC1A 4K8VA 1QTMA 1ZQNA 4RQNA 4R63A 1RYRA 4U7CA 2PKEA 5KFNA 3B0YA 2YY6A 3SV3A 2KZ3A 4IRKA 5AKLA 3AQFA 1NK8A 3GIIA 2R8HA 4HAIA 5DB9A 1UCVA 3PHZA 1FIQA 4Y2PA 1NZPA 3QU5A 2W9CB 1BNOA 4P4MA 1LVHA 1OW5A 9ICQA 3FM9A 4I2AA 3HJ4A 2BHNA 3G6XA 1ZQTA 3FC4A 5IILA 1NJXA 8ICWA 1IIPA 4P2HA 3V72A 5DECA 2XC9A 3KZIU 5EE1A 4E8FA 5AI0A 1J2MA 4IL6U 4UARA 1S0VA 4OD0A 3HP6A 5J2HA 2DKZA 2BCUA 2XGPA 3CYMA 2KP7A 3V6KA 1A0PA 4WQKA 4EYHB 4DQPA 4I2FA 4R64A 1JALA 2HBKA 3WK5A 3QUBA 2FLLA 3RJKA 2W43A 1X9MA 5HRIA 2Y1JA 1D8BA 3LYSA 2RDJA 3F53A 5B5EU 4M9JA 9ICSA 2HHTA 3ZDAA 5AKKA 1V85A 3EZ5A 1WOTA 4OJLA 4PZNA 5DGBA 3NVOA 2Q4TA 2HVIA 3S6JA 4F5QA 4QZEA 1PX5A 5AI8A 1KKXA 2IUBA 2DFLA 3GV8B 2M2WA 2B6GA 4EZ6A 4C8OA 5IINA 4XRHA 2N1RA 2W55A 4RQ5A 4KTQA 4PJ0U 4F93B 2EAMA 9ICNA 5KFTA 3SD7A 8ICPA 3UMCA 3KHHA 3WFSC 3IHQB 2WF6A 5E79U 4NL9C 1BGXT 4ED1A 5DBCA 1M6YA 2JRZA 8ICMA 1L8LA 3LDAA 3H7IA 2JEIA 3F2CA 2AXTU 3AEVA 5C5JA 3H40A 1NO5A 4M9GA 4DOBA 2BBJA 2Q0ZX 4WC2A 2Y1IA 3WKDA 1PK1B 1SV4A 4ECUA 4GXJA 4CCHA 3AQMA 3KTQA 3T79A 4UAUA 3DDHA 4J9SA 2XY6A 1U9LA 2CRXA 4P4OA 3WK8A 5J0PA 4O3MA 1GPJA 2NRXA 4G3IA 5AKHA 4Q45A 2O6KA 9ICFA 4E80A 4EELA 5DLGA 8ICSA 3PO4A 1AROP 1ECWA 1NK4A 5ALFA 5CWRA 4XQ8A 2NRTA 2YQEA 2R8GA 2ZIVB 1NK6A 2KHVA 1UA1A 2R8JA 4QJFB 1UT5A 4JWMA 2HN1A 4DOAA 4P4PA 4ED6A 5HMMA 3M9NB 1BNPA 3BQTA 2P6RA 1JXLA 4F4KA 1BPBA 1SZPA 2ZJ8A 3ISCA 3HKZF 5EWFA 4F8RA 2HHPA 3NVZA 4QZCA 4F2SA 1L3TA 3TKAA 3OPXA 2D6FC 3UMGA 1GO3F 2ALZA 1D8LA 4DSJA 1ZQPA 1N48A 1ZQAA 1SXEA 3NYBA 5HRFA 5ALUA 1O08A 5JTIA 2F8LA 3CP8A 1NJWA 4AYBF 3KD3A 4OAFA 5HHIA 2KEYA 5C0YA 5CEHA 1IG6A 4DF8A 1BPEA 5G5HA 3IM1A 5KFEA 1X40A 3K1RB 4C8MA 4ELTA 2HBLA 5DDYA 4TUSA 4F4YA 5EE9A 4F2RA 1T3QA 1Z00A 4FE3A 2FLNA 5KFWA 2YMPA 4F4ZA 8ICUA 2DUYA 4R8UB 2IHMA 9ICKA 4DLEA 3N28A 1CUKA 2HHVA 3LQCB 4NJ8A 1P7DA 3J81j 2MU2A 4RWNA 3NS1A 4X0AA 2E3TA 3WKBA 1S0NA 3V7KA 5AM2A 2JXJA 2K4PA 2DR7A 5CR0A 3BQ7A 1A76A 1HUZA 3MC1A 3RH6A 3IN5A 1ZD4A 2Q66A 5KNIA 1TFRA 4UBBA 4UW9A 4JLZA 3Q8SB 3F2BA 3PZPA 1U45A 4NKUA 3PR5B 3ER9B 3OSPA 1Z4OA 4WC6A 1KW4A 2JH7A 1F44A 3HIYA 3UPSA 4UB4A 4ECRA 2OH2A 4S3NA 4R8UA 1TFWA 4TUQA 2A1AA 1QQ5A 3C29A 1JMSA 3ALRA 5DKWA 5HP4A 4NXTA 4YMNA 1B22A 5CFSA 2JZBB 3TANA 3H8JA 8ICGA 1C7YA 5KFZA 4WC0A 4BXOA 3ZD9A 1UHUA 5AI6A 2HHXA 3WKAA 1UA0A 2O1PA 4AT7B 2KJ5A 4WC3A 5L1IA 4IR1A 3V6HA 5HMLA 1SKRA 4EEYA 4K4IA 4ED7A 5HRKA 2EZZA 2LI6A 3MR5A 2KIWA 4I0UA 2AHOB 2KN7A 3O0FA 2NRWA 4P0QA 4LEYA 3SQIA 3EPGA 1D9FA 1Z4NA 4FH3A 1QH9A 4Y2SA 5HR6A 4K9AA 1PUZA 1ZQYA 2AQ0A 4DL3A 2I5HA 3N7RC 3TARA 1TAQA 2ZH8A 5FP0A 1K1QA 4F5OA 2B4VA 3RJHA 4PZOA 9ICOA 3WK9A 7ICVA 4AYBC 4X5VA 3RB0A 2ZUBA 1ZQHA 5KG3A 1MSWD 4X4QA 8ICLA 4GXIA 3SAFA 2PFNA 5AM3A 4F5RA 4RPZA 1HEKA 1JRPA 4XA5A 3IDWA 3C2KA 1ZQQA 1CEZA 2B0CA 2BCVA 5AM1A 4Q8FA 2XGQA 1Q3VA 5EWGA 4QW9A 1R89A 4QZIA 4PPXA 4O3OA 5AK6A 3ONNA 5IIOA 3KKAA 2LM4A 2ESEA 7ICEA 3RB3A 2XCAA 1ZD3A 2ZIVA 3HX0A 1ZQCA 1Q46A 2J6TA 3MABA 2ASJA 3QNMA 3AUOA 4ECSA 1TAUA 1V4AA 5J0XA 3M7DA 2JEFA 4B9TA 2M2UA 1Z19A 2C28A 5HREA 3RTVA 1WUDA 5AKEA 5L1JA 4DFJA 8ICQA 5B3PA 5KFKA 4KLTA 2Y9UA 4M6WA 2FLPA 4FHYA 4DSKA 3NVYA 3RJJA 1KNYA 1BPDA 2F2AB 4HX0A 4GFJA 3TFRA 1U4BA 4RWPA 3T5LA 3M8RA 1ZQGA 5L9XA 3SI8A 4CNQA 3PY8A 5KG2A 7ICNA 1N2XA 3GFKB 5ALXA 2R8KA 3N7SC 1SL1A 4UB1A 2EZXA 2YB4A 1NI3A 2BKEA 1ZD2P 1NJZA 1PZNA 2B51A 3AL0B 2V9WA 3VC8A 4QWEA 4CF5A 4DQIA 2KTQA 2EANA 5F2VO 4LT6A 1A77A 2DPJA 3ZDCA 8ICXA 4WQLA 4I2DA 4CF4A 2Y9TA 1U49A 1PVRA 1XO1A 8ICAA 4EV6A 2A1JA 2KJ9A 1UEUA 3TACB 5AK4A 8ICTA 3PW7A 1JIHA 4YR3A 3BS5A 3GU3A 2PI4A 2KSOA 1XC9A 1KLNA 4DQSA 2F77X 3UQ2A 2XIDA 1L5UA 3N7PD 1ZQLA 4MFCA 5AKZA 4O67A 1XSNA 3D2NA 1SB3C 2ISPA 2M0NA 5KFFA 3KHLA 4WC7A 3H8SA 2O5AA 2LM1A 4ELUA 1RM6C 3CNHA 2UVRA 5KT2A 1Q3UA 3SZ2A 1PK1A 3H38A 3AQEA 4ECWA 4UD5A 3H8MA 3RJGA 4IRCA 1DGJA 3WK4A 7ICIA 4DFKA 5L1MA 1RXWA 2G09A 3OJSA 4X4TA 2LYHA 2ZJAA 2KNJA 2WAQC 4AT7A 5KFLA 4LJXA 5ALZA 1WYGA 3BQ0A 2NYVA 2KJ8A 4YD2A 3OSNA 4O5CA 4NM1A 4K98A 2IOFA 3KHRA 3G6VA 1C20A 5DEDA 3I76A 4DS5A 5AKXA 3QU2A 4EBCA 2JEGA 4ACOA 4WBZA 2EH9A 5AKJA 5HNKA 4RQ8A 4TUPA 2K89A 2RQ5A 2A3VA 3QUTA 5HC9A 3OHAA 1VJ5A 4B6JA 3RBDA 4ICAA 4Q44A 1T94A 4FHXA 4O5KA 1ZRNA 1WCNA 1HJPA 4J9LA 4ELVA 5AKGA 5ALVA 4DF4A 2IA6A 4DSFA 1MQ3A 3T3FA 5AI4A 4NL9A 5ALEA 7ICJA 2F8KA 1ZQIA 4DOCA 4P0PA 7ICGA 4JV0A 2L5YA 2DPIA 5ALIA 2FPKA 4I29A 2VIXA 3L3FX 5DBBA 1ED1A 2OWOA 4IQTA 4PL2A 2I1QA 5IIIA 4YXJA 1PVPA 4MF2A 8ICFA 5AIBA 1VDVA 3NVVA 4PL1A 2BQ3A 2FDRA 4MF8A 2HVHA 4X4UA 1Q79A 4K99A 4X0BA 2XY7A 9ICMA 5ALNA 2OEHA 4X4VA 2VJ4A 4C8NA 4WJ3B 1RYUA 2BCRA 4KB6A 4EYIB 4RQ1A 1BPZA 1T8EA 1K5OA 2HMXA 3MDCA 2ZHAA 5KFYA 9ICTA 4C4TA 1L7MA 3Q8PB 2MAXA 4WCWA 2MUTA 4P0PB 3TADA 7ICUA 2WF5A 7ICFA 4FHVA 3LWMA 1SZHA 4O3RA 4J9QA 2XY5A 1N61A 3RBEA 2WF7A 1XO0A 4J9OA 2DBYA 1L8OA 4UBCA 8ICJA 3PVXA 4KLGA 1K1SA 4DCCA 3PX4A 3OUYA 2YB1A 1S77D 2DR9A 3WFRE 1S0OA 3NKUA 4UAVA 5DDMA 2F1HA 2ZIUB 2A1JB 1NKCA 1V9PA 9ICXA 4IR9A 4C80A 2D8CA 3WK6A 3D2SA 2KSOB 5HRGA 4YCXA 3ISDA 3PR4A 3SR6A 5KFPA 2P6UA 2ZH9A 3BQ1A 5IIKA 4UD4A 3NVWA 2KIVA 4EEDA 4JLXA 4LVSA 3TADC 3CW2C 3L4PA 2C2DA 1N60A 1KSPA 4CE6A 2W9CA 2HCFA 2HN2A 2KHQA 4K96A 2F44A 5CP2A 4I27A 1KTQA 4EENA 5ALJA 1NK9A 4KLMA 1XS9D 3DV9A 3KFUF 3PSFA 5KL1B 2XI9A 1XSPA 5D62A 4O3PA 2ZTDA 5J8YC 1TV9A 2AJQA 4F4WA 4MFAA 5J2FA 2K4IA 3QYPA 2IHNA 2DRBA 5DQGA 4RUAA 3H4DA 4BJQA 3ED5A 3C5FA 4J03A 3MFIA 3FYHA 3NRZA 4UB5A 3KOOA 4USAA 4RQMA 1QSYA 2ZTEA 5J2IA 4IS7A 5J0YA 5KAIU 3HRDD 2ZXHA 4M0AA 1ZQSA 4DS4A 3FDSA 2EAOA 3C28A 2HOQA 5TISU 5J2KA 2W9MA 1N5XA 2WF9A 1AQ6A 4QZ8A 2HSZA 4UASA 1ZQ1C 4F50A 2G5IB 2WB1C 3WKEA 5KFCA 1NKEA 3EF2A 2QLTA 3UXNA 3EWAA 3TQ1A 1NZBA 4Y2RA 1ZJMA 4C7ZA 3RRGA 3K7DA 5KFSA 1X66A 5KFXA 4M2YA 8ICYA 3HJ1A 2JGAA 5J0TA 1TKDA 3QU9A 4MKPA 3QZ8A 3N4MB 5BPCA 2PFPA 4UAWA 2UVUA 4F91B 3IP4B 1BPYA 4NLGA 3MR2A 2OXOA 4CRXA 4C0ZA 1JI7A 5KFUA 2E1FA 2ZIUA 1NKBA 1LKYB 4M9NA 4RQ6A 4KX3A 2RLTA 2XICA 2ID1A 3GIJA 1ZQJA 4YMMA 1KBUA 4Q8EA 7ICMA 2HHQA 1LV5A 1VLBA 2M9NA 4I2HA 4RU9A 1S76D 4B9SA 2I6XA 3UM9A 2KVCA 1D8YA 4ZOHC 4O5EA 4F72A 1WCLA 5DG7A 2YX8A 4YXMA 2VANA 3EUB2 4AP9A 1TK8A 5F9NA 1RXVA 4WC5A 1OXJA 1XWLA 3C21A 2QARA 4PGXA 1DGSA 2KZMA 4CGZA 2XO7A 1R8CA 5KFVA 3AQLA 4DFMA 4DSLA 2E8OA 4PHPA 2K8BB 4U6PA 2MA1A 3C18A 5ALPA 4QIWC 1PVQA 2BQUA 4KMUA 3UMBA 1L3SA 4I2CA 3H0LB 7ICLA 3WFOA 3D6JA 3HWTA 3PV8A 4TURA 2EAPA 5K4LA 4F5PA 1Q78A 4LEVA 2CXYA 2W8LA 4F71A 4UB8U 1ZQUA 2F1JA 1PK3A 1SV0A 2ZHBA 4C4SA 4AT9A 2J6SA 4J9KA 1Q8KA 2BQRA 9ICIA 4NM2A 1SXDA 2HBJA 5AK3A 4FO1A 2Y0SF 9ICAA 2DR8A 5KAFU 4DFDA 3QX7A 4DWIA 4RQ3A 4ATBB 2W7OA 2J6UA 3I1YA 1TAMA 2VA3A 4OO1J 4BX9C 1JAJA 4QW8A 3HPOA 3L9DA 4RT3A 2AH5A 3SENA 2ES6A 2VJ5A 2B21A 3H37A 2AGQA 2LPEA 1RG6A 3C23A 4PHEA 3H0RB 5D49A 2WB1F 3HW8A 8ICNA 3MGIA 4C8KA 1ZQWA 1MIVA 5GTIU 2EZYA 4FH5A 2K8CB 3UXOA 2W9BA 3RAXA 1L6NA 3D2QA 2C2RA 2HHSA 4JV1A 5J0RA 3CK6A 3SEIA 2PFOA 4JMUA 2GAFD 2BCQA 1ZQZA 3RJIA 2LMRA 5ALQA 2G0AA 1V38A 1NJYA 1Z00B 3AM9A 4YMOA 1YZ6A 4ECXA 4JV2A 3H0MB 2FMQA 3PNCA 8ICHA 1UQVA 3T5HA 3BJYA 4QZHA 2G07A 5DB8A 5TZVA 2AU0A 1SIJA 2ZH7A 1SKSA 4KLEA 2VA2A 2ZH5A 3V7LA 1ZQXA 4MEYA 4K97A 2KK0A 2KZZA 4RNMA 3MGHA 4ECYA 5ALTA 1QSLA 4P0QB 2PMZC 5J0OA 4ED0A 4QWCA 4O3SA 4B9VA 4EEBA 4BGDA 3DEEA 5IIJA 4KM5A 2R8IA 4A8EA 3PW4A 5AI9A 5L1LA 4AT9B 3EW9A 4I2IA 4KMOB 4QZDA 5J2BA 2HOFA 4FS1A 3GQCA 2MSNA 5EE3A 3SAGA 4I2EA 2GLEA 5G5GA 4BWMA 4M5DA 2FMSA 2ZH2A 2YMLA 2KG5A 7ICPA 4NLCA 2PBEA 1SL2A 1QCKA 4UAYA 3WFQE 1RQNA 4YQWA 4NLNA 3ISBA 2VA8A 3AU6A 1VFGA 1DK3A 2ODGA 3AU2A 5J29A 1JUDA 4RWOA 5KG0A 2DKXA 4JWNA 5KG7A 5HR9A 3KBBA 3NTUA 1KDHA 4B9MA 3M1YA 3OV7A 2NV3A 5ALHA 4KLFA 5CJ7A 4Z6FA 5CA7A 3MBYA 3B9JA 4NXZA 2G08A 1XNSA 2W04A 5AKYA 2PFQA 2KVSA 4C7YA 4X4OA 3UXPA 5HR7A 4NXWA 3IRUA 2C2EA 2H3VA 3JPNA 2W8KA 5AM4A 2WFAA 4FFDA 1X42A 2W3SA 2IBKA 4XJEA 4WH5A 2QB0B 2G06A 3EPIA 4UQGA 3QUQA 2QARB 2BBHA 5J2GA 4Z6EA 2F76X 3ERCC 4US9A 4N7RA 5AM5A 4O3NA 4FS2A 4X4PA 2JR5A 3JPRA 1FO4A 4UAZA 5KG6A 5HRLA 4LZDA 1KRPA 5D63A 1TVAA 5KFRA 5KL8B 1MIWA 3GIMA 3TAPA 5DQHA 4LEWA 4BWJA 4M9HA 4LEZA 3ZDDA 1T4GA 5J2DA 5CHEA 3OWGA 2WHEA 3B0XA 4X4SA 4WBYA 4KN7A 5T14A 4EBEA 1TK5A 1QLNA 3E2EA 5ALKA 4R65A 1RPLA 3F5EA 2NRZA 1NK5A 9ICBA 5J0SA 5J0WA 4QZBA 2QB0A 2KICA 2D3DA 4EP7A 5AI5A 2BDUA 4PGYA 1MC8A 3AQKA 5KT7A 4IQVA 1KN5A 3SV4A 4AT8B 3C5GA 2I9GA 1ZYQA 2AGOA 5ALMA 4GC6A 3JPPA 4X4NA 2H3ZA 4Y2QA 3T5KA 2DWQA 2BDPA 3PSIA 3M8SA 3R9KA 3SYZA 2BZFA 4OAGA 2KKPA 1SWWA 5EOZA 1X9WA 8ICRA 4C4RA 3E0FA 4ZH4A 1S10A 2W9BB 7ICSA 1TE2A 7ICTA 7ICOA 3RRHA 3PW2A 9ICLA 4IRDA 1KEJA 1T3NA 2BPGA 1QSSA 4NY8A 5KT5A 4BDPA 4M47A 4PH5A 2JV3A 2E1EA 3LK9A 2EDUA 3ZDEA 4QWDA 1B43A 4FHPA 2RRDA 5L1KA 1TK0A 2DRAA 1COKA 4JK1A 3QEAZ 1F0MA 5CFUA 3QUCA 3RR7A 1SL0A 2KMDA 2ZH1A 4RNNA 3NUQA 2E8NA 2ASDA 3CRXA 2EWRA 4KN4A 2KFNA 4EGWA 5KFGA 3PW0A 4RUCA 2QKQA 2HDOA 2P35A 3JPSA 2KFZA 3WFPA 3LVVA 3WU2U 3WKCA 5HHHA 4KLSA 4NWIA 3GZFA 4XQ7A 2W9AA 4DO9A 5ALRA 9ICUA 4JB3A 1NK0A 3ZI4A 5J0UA 2EQYA 3GILA 2FE9A 4DL6A 2FPLA 4K4HA 4YVZA 4Z6DA 3K75D 2LYBA 4O69A 5KG5A 3MDAA 2E8PA 4ECTA 1EXNA 1URJA 3PSPA 3BDPA 3LWLA 1RZTA 2HBMA 3RB6A 4X4RA 1F5AA 3Q8RB 4TQSA 1Z3EB 2BGWA 4NLZA 3KHGA 9ICJA 1YZ7A 4MEXA 4CDGA 2ZUDA 4PHDA 3JZ0A 2ASLA 1T7PA 1COOA 4DSIA 4GXKA 1ZQDA 7ICQA 3F2DA 3OTQA 4RPXA 4O0IA 2K4HA 5DB6A 3QU4A 2NO4A 2Y0SC 1DOQA 4XUSA 4DLGA 4JUZA 5AHXA 1OU5A 5EWEA 2XCPA 4RQ7A 1S9FA 5ALDA 5CB1A 1WWVA 3V6JA 8ICVA 2M2VA 2VKQA 4QZGA
chains in the Genus database with same CATH topology
4ECZA 3RJFA 4Z6CA 1WCLA 5DG7A 3AQNA 5DG8A 3G6YA 4ED2A 4YXMA 7ICEA 2ZJ5A 2VANA 5J2CA 4DL2A 4ATBA 3RB3A 2XCAA 5KT3A 4TQRA 4IQUA 4ECVA 2ATLA 3HX0A 1TK8A 4RPYA 4FO6A 5F9NA 1ZQCA 1RXVA 4WC5A 4EZ9A 1XWLA 1ZQOA 3C21A 2J6TA 3MABA 2ASJA 5KG4A 4BXOB 9ICHA 4PGXA 1DGSA 1H38A 3M9MB 3AUOA 2KZMA 1L3VA 2DVIA 4J9RA 2XO7A 4ECSA 5KFVA 1TAUA 1R8CA 3AQLA 4RWQA 1V4AA 4DFMA 4R66A 4DSLA 8ICOA 5J0XA 4PHPA 5BOLA 2JEFA 4B9TA 2M2UA 2C28A 4UB3A 5HREA 3JPTA 3RTVA 3UQ0A 3C18A 5L1JA 4DFJA 8ICQA 5KFDA 5KFKA 4KLTA 7ICLA 2BQUA 4KMUA 1L3SA 3WFOA 4I2CA 4M6WA 4RQ0A 2FLPA 5DQIA 1ZQVA 3HWTA 3C2MA 4M04A 2NRKA 4DL4A 3PV8A 4FHYA 4AT8A 4YR0A 4UB2A 3RJJA 4TURA 5KG1A 1BPDA 4QZ9A 4F5PA 4DSEA 2UVVA 4FBUA 4LZGA 5HRHA 1KNYA 1Q78A 2W8LA 1KFSA 3TFRA 3OVSA 3ETLA 3PX0A 3OGUA 7ICRA 1HUOA 4FBTA 1U4BA 4RWPA 1ZQUA 2F1JA 3T5LA 4PGQA 3M8RA 1ZQGA 2PXIA 4F4XA 4KLLA 8ICEA 2ZHBA 2JEJA 4AT9A 2J6SA 3TAQA 5L9XA 3SI8A 3PY8A 5KG2A 2V4QA 4J9KA 5KFOA 2BQRA 7ICNA 2P66A 9ICIA 4NM2A 5DGAA 3V7JA 1XSLA 4WC1A 3GFKB 9ICAA 3RJEA 2DR8A 3N97B 1QTMA 2R8KA 4ECQA 2GWSA 4DWIA 4RQ3A 1SL1A 1ZQNA 4ATBB 4UB1A 4R63A 1RYRA 2J6UA 2VA3A 5KFNA 2BKEA 1R8BA 3QZ7A 1X9SA 4KLJA 3B0YA 3SV3A 2KZ3A 1PZNA 1NJZA 4IRKA 4K4GA 2AGPA 4KLQA 1JAJA 1DK2A 4QW8A 4KLHA 3HPOA 3L9DA 4RT3A 1NK8A 3GIIA 2R8HA 2V9WA 2B21A 4DL7A 5DB9A 3H37A 2AGQA 4QWEA 1UT8A 4DQIA 1NZPA 2KTQA 3C23A 5F2VO 4PHEA 2W9CB 4LT6A 1IXRA 2MUTB 5D49A 1XU4A 3HW8A 1BNOA 4P4MA 2F1IA 1A77A 2BR0A 2DPJA 3ZDCA 3PO5A 8ICNA 4I2DA 5J2JA 8ICXA 9ICQA 3RB4A 3MGIA 1L3UA 4I2AA 1U49A 1XO1A 4C8KA 4DSKA 3TI0A 1ZQWA 8ICAA 2BHNA 1MIVA 3HJ4A 3H8WA 2A1JA 4FH5A 3G6XA 3UXOA 2W9BA 1ZQTA 5IILA 3RAXA 1NJXA 8ICWA 8ICTA 1UEUA 4P2HA 2C2RA 4YFKA 3V72A 2HHSA 2XC9A 5DECA 3PW7A 1JIHA 4YR3A 4JV1A 4E8FA 5J0RA 1NK7A 3C2LA 2PFOA 2PI4A 1U47A 1XC9A 1KLNA 8ICZA 4DQSA 4C8LA 1S0VA 3UQ2A 2BCQA 1ZQZA 3RJIA 1L5UA 3HP6A 5J2HA 1FA0A 1ZQLA 7ICHA 5KFJA 1NJYA 4MFCA 2JZBA 1Z00B 2BCUA 4YMOA 2XGPA 4ECXA 4JV2A 4RNOA 2KP7A 4ED8A 3V6KA 4F3OA 3HT3A 1XSNA 1ZQFA 2FMQA 3PNCA 2ISPA 1RYSA 4EYHB 4DQPA 4I2FA 8ICHA 5KT4A 2BE3A 4E7XA 3T5HA 4R64A 5KFFA 3OJUA 3KHLA 3BJYA 4WC7A 4QZHA 5DB8A 5TZVA 2AU0A 2FLLA 3RJKA 3H8SA 2ZH7A 1SKSA 1X9MA 5HRIA 4DEZA 4KLEA 2O5AA 2VA2A 2Y1JA 2RDJA 9ICSA 4M9JA 2ZH5A 5KFAA 3ZDAA 3V7LA 4ELUA 1ZQXA 4MEYA 1D9DA 2HHTA 2UVRA 5KT2A 2KZZA 4RNMA 3MGHA 4RQ2A 4ECYA 3EZ5A 3SZ2A 1WOTA 1QSLA 3H38A 5DGBA 1ZQBA 5J0OA 3PMNA 2HVIA 4ED0A 4QWCA 4ECWA 2BPFA 4UD5A 3RJGA 3RH5A 1BPXA 4B9VA 4IRCA 4F5QA 4O3SA 4QZEA 3GIKA 4BGDA 4M9LA 1PX5A 7ICIA 3OVBA 4F5NA 4DFKA 1RXWA 5IIJA 3OJSA 5IIMA 4X4TA 2DFLA 3GV8B 2LYHA 2ZJAA 2R8IA 3TFSA 2M2WA 4AT7A 3MR3A 4EZ6A 5KFLA 4QZAA 4C8OA 1MIYA 4RZRA 5IINA 4XRHA 3BQ0A 2IMWP 4YD2A 5J2EA 3PW4A 3OSNA 5L1LA 4O5CA 4RQ5A 4KTQA 4NM1A 4AT9B 3EW9A 4I2IA 3Q8KA 4F93B 4QZDA 9ICNA 5KFTA 1BVSA 5J2BA 3KHRA 3G6VA 3GQCA 4FS1A 8ICPA 5DEDA 4DS5A 5KFMA 4I2EA 4KITB 4BWMA 4M5DA 3KHHA 4YG2A 2FMSA 2ZH2A 4EBCA 7ICPA 3IHQB 2JEGA 3WFSC 9ICWA 2PBEA 5KT6A 3OUYB 1SL2A 4WBZA 4UAYA 1BGXT 3WFQE 5HNKA 4RQ8A 4ED1A 2ISOA 4YQWA 5DBCA 4TUPA 4NLNA 2M2TA 4DQRA 3ISBA 2VA8A 8ICMA 3LDAA 5HC9A 3OHAA 2WTFA 3AU6A 5KFIA 3H7IA 2JEIA 3C66A 1VFGA 1U48A 5C5JA 3H40A 3RBDA 4M9GA 1NO5A 4DOBA 4Q44A 3RR8A 1DK3A 3AU2A 5J29A 2Q0ZX 4ED3A 4WC2A 2Y1IA 5KG0A 5HR9A 4JWNA 5KG7A 4FHXA 4GLXA 4Q43A 3M9OB 4ECUA 4GXJA 4CCHA 4O5KA 5KTQA 3AQMA 1TFYA 2ZH8A 3KTQA 3JPQA 3H3AA 4MFFA 3NTUA 1KDHA 4B9MA 3OV7A 1WCNA 1HJPA 4J9SA 5HRBA 4KLFA 4J9LA 2XY6A 5CJ7A 1U9LA 4ELVA 4Z6FA 4P4OA 5J0PA 4KLUA 2NRXA 5CA7A 3MBYA 4DF4A 2IA6A 4DSFA 4J9MA 4NXZA 1NOMA 5KFHA 4G3IA 4Q45A 3THVA 3PW5A 1MQ3A 3T3FA 2HHWA 4O3QA 2PFQA 4X4OA 9ICFA 3UXPA 1ZQMA 7ICJA 9ICRA 4J9NA 5DLGA 4E80A 2AQ4A 4M6WB 2C2EA 1ZQIA 3JPNA 1ZQKA 1S0MA 8ICSA 5CHGA 1ZQEA 3PO4A 2W8KA 4HYKA 1AROP 2ZH6A 2IBKA 4DOCA 3NGDA 5DLFA 7ICGA 1NK4A 4JV0A 1IM4A 5CWRA 2DPIA 4I29A 2FPKA 3EPIA 4XQ8A 2NRTA 4EBKA 5DBBA 2ZH4A 2R8GA 4RWOA 9ICGA 3JYYA 1NK6A 4NLKA 9ICCA 1UA1A 2OWOA 4UQGA 2R8JA 4IQTA 3EYZA 1UT5A 5JUMA 9ICEA 5J2AA 2I1QA 4JWMA 4PHAA 4DOAA 5IIIA 4P4PA 3OHBA 4ED6A 5HMMA 4RQ4A 4YXJA 3M9NB 2V4RA 4DFPA 4B9NA 1BNPA 5J2GA 4Z6EA 2RFFA 3BQTA 2P6RA 1JXLA 4MF2A 4O3NA 4FS2A 8ICFA 4I2JA 4X4PA 4QZFA 3H4BA 1KFTA 4I28A 2BQ3A 3JPRA 4MF8A 2HVHA 9ICPA 4F4KA 4UAZA 1BPBA 1SZPA 2ZJ8A 5KG6A 9ICVA 5HRLA 4LZDA 2XY7A 3ISCA 1KRPA 4O9MA 1TVAA 2ZUCA 5EWFA 4F8RA 9ICMA 2HHPA 4X4VA 5KFRA 4C8NA 4QZCA 1ZETA 4F2SA 1MIWA 3GIMA 3TAPA 1L3TA 5DQHA 3H39A 4BWJA 4M9HA 2BCRA 1T4GA 3MFHA 5J2DA 4RQ1A 4EYIB 2ALZA 1LB2B 1BPZA 3ZDDA 1T8EA 1D8LA 4DSJA 3B0XA 1ZQPA 4X4SA 5BOMA 1ZJNA 3MDCA 4KN7A 5KFYA 4EBEA 9ICTA 4WBYA 2ZHAA 3Q8PB 1TK5A 3Q8QB 1QLNA 1N48A 1ZQAA 2MAXA 3ZDBA 4WCWA 2MUTA 5J0QA 3E2EA 4R65A 5HRFA 3NYBA 1RPLA 2NRZA 1NK5A 1N56A 1Q79A 9ICBA 5J0SA 1NJWA 7ICUA 5J0WA 4QZBA 2BCSA 5HHIA 1R8AA 4EP7A 7ICFA 4FHVA 4PGYA 1MC8A 3LWMA 3AQKA 4DF8A 1BPEA 1MQ2A 1JX4A 5KT7A 3IM1A 4IQVA 4O3RA 5KFEA 3C1YA 5D46A 4J9QA 2XY5A 3SV4A 4C8MA 4ELTA 8ICKA 3C5GA 3C1ZA 2I9GA 1ZYQA 5DDYA 4AT8B 3RBEA 2AGOA 1JQRA 4GC6A 3JPPA 4TUSA 4B9LA 1SKWA 3ZD8A 4F4YA 4X4NA 4F2RA 4IG8A 4J9OA 1Z00A 2FLNA 3T5KA 2BDPA 4UBCA 8ICJA 5KFWA 3PVXA 4F4ZA 4DL5A 4KLGA 1K1SA 8ICUA 3M8SA 3RAQA 4PPXA 1YLQA 4YD1A 3SYZA 4GC7A 3PX4A 3OUYA 1JN3A 4R8UB 2H5XA 2IHMA 9ICKA 1Y88A 1S77D 2ID1A 2DR9A 4WC4A 1JXEA 4DLEA 3WFRE 1S0OA 5EOZA 1X9WA 1CUKA 2HHVA 5DDMA 8ICRA 2F1HA 4FHWA 4ZH4A 2A1JB 1S10A 2W9BB 4E0DA 7ICSA 3LQCB 2BPCA 2FMPA 7ICTA 1NKCA 1V9PA 9ICXA 7ICOA 3K4GA 3GV7B 4NKTA 4IR9A 4X0AA 2C22A 3RRHA 4RWNA 3PW2A 9ICLA 4O5EA 4IRDA 1KEJA 1S0NA 3V7KA 3QEBZ 1T3NA 2BPGA 1QSSA 4YCXA 3ISDA 4NY8A 3PR4A 5HRGA 5KT5A 4YN4A 3MR6A 4BDPA 4M47A 5KFPA 2P6UA 4EBDA 2DR7A 5CR0A 4PH5A 2ZH9A 1A76A 3BQ1A 1HUZA 5IIKA 3RH6A 4X4UA 3LK9A 4UD4A 2Q66A 3ZDEA 4QWDA 1B43A 4FHPA 1TFRA 4F92B 4LVSA 5L1KA 1TK0A 2DRAA 5DG9A 4UBBA 3GDXA 4JK1A 3QEAZ 2C2DA 3Q8SB 1KSPA 1U45A 2W9CA 3RR7A 4NKUA 3PR5B 1SL0A 2ZH3A 2ZH1A 3UPQA 4RNNA 5CP2A 3OSPA 2ASDA 4I27A 1KTQA 4WC6A 4KN4A 3JPOA 4J9PA 2KFNA 1NK9A 4KLMA 3OVAA 5KFGA 1XS9D 3PW0A 3HIYA 4RUCA 3UPSA 4RT2A 4UB4A 4ECRA 4S3NA 4R8UA 3JPSA 1XSPA 4TUQA 1TFWA 4O3PA 2ZTDA 1TV9A 2KFZA 4YR2A 2AJQA 4F4WA 4MFAA 5J2FA 3WFPA 2IHNA 5DB7A 1JMSA 2DRBA 1S97A 3ORYA 5DQGA 5HHHA 5DKWA 5HP4A 5KFQA 4RUAA 4YMNA 4KLIA 4KLSA 1B22A 5DBAA 3H4DA 4XQ7A 5KFBA 2JZBB 4B9UA 2W9AA 1VJ7A 2RDIA 3TANA 4DO9A 4QWBA 3H8JA 3GV5B 3C5FA 8ICGA 3MFIA 3FYHA 1C7YA 9ICUA 4UB5A 1NK0A 5J0UA 5F9LA 5KFZA 4WC0A 3GILA 4DL6A 3ZD9A 2ZTEA 1QSYA 4BXOA 2HHXA 5J2IA 2O1PA 2FPLA 1UA0A 4AT7B 4K4HA 5J0YA 4WC3A 4YVZA 5L1IA 1UETA 4Z6DA 3K75D 8ICBA 4IR1A 4KLOA 3V6HA 5HMLA 1SKRA 4EEYA 4K4IA 4ED7A 5HRKA 5KG5A 4M0AA 5D4BA 3MR5A 4DS4A 3FDSA 1ZQSA 3MDAA 2KN7A 4IQWA 4X0BA 2HW3A 4ECTA 5J2KA 3PX6A 3T5JA 2W9MA 2NRWA 1EXNA 2HHUA 2FPMA 2PI5A 4QZ8A 3BDPA 4F50A 2DR5A 5KFCA 3LWLA 3QE9Y 1RZTA 1NKEA 3RB6A 3EPGA 4X4RA 1D9FA 4FH3A 1F5AA 3UXNA 3EWAA 3Q8RB 3TQ1A 2NRVA 1ZJMA 4TQSA 8ICCA 3RRGA 1ZQYA 1Z3EB 2BGWA 5KFSA 2AQ0A 4NLZA 3KHGA 9ICJA 1UEVA 5KFXA 4DL3A 4PHDA 2ZUDA 3TARA 4MEXA 2UVWA 1TAQA 4KLDA 4I2BA 4M2YA 3JZ0A 2ASLA 1X2IA 1COOA 1ZQRA 1T7PA 8ICYA 3HJ1A 5J0TA 1TKDA 4DSIA 8ICIA 4GXKA 1K1QA 4QWAA 1ZQDA 7ICQA 4F5OA 3QZ8A 3N4MB 5HRDA 5BPCA 2PFPA 4UAWA 2UVUA 4F91B 1BPYA 3RJHA 4NLGA 3MR2A 7ICKA 9ICOA 4RPXA 7ICVA 4O0IA 3PMLA 4X5VA 5KFUA 3RB0A 3Q8MA 1NKBA 2ZUBA 5DB6A 4YP3A 4M9NA 1ZQHA 5KG3A 1KFDA 1DOQA 4XUSA 4RQ6A 1MSWD 4GXIA 2ZTCA 8ICLA 4X4QA 4DLGA 2PFNA 4JUZA 4I2GA 3RH4A 3GIJA 4F5RA 5EWEA 1ZQJA 4RPZA 1OU5A 2XCPA 4DQQA 4YMMA 4XA5A 4RQ7A 3C2KA 4Q8EA 7ICMA 1ZQQA 1S9FA 2HHQA 1LV5A 2M9NA 1CEZA 5CB1A 4I2HA 4RU9A 1S76D 3V6JA 4B9SA 8ICVA 2BCVA 3BQ2A 4Q8FA 2XGQA 2M2VA 5EWGA 4QW9A 1R89A 4EBJA 3Q8LA 4QZIA 1D8YA 4O3OA 4QZGA 5IIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECZ A;  3RJF A;  4Z6C A;  1WCL A;  5DG7 A;  3AQN A;  5DG8 A;  3G6Y A;  4ED2 A;  4YXM A;  7ICE A;  2ZJ5 A;  2VAN A;  5J2C A;  4DL2 A;  4ATB A;  3RB3 A;  2XCA A;  5KT3 A;  4TQR A;  4IQU A;  4ECV A;  2ATL A;  3HX0 A;  1TK8 A;  4RPY A;  4FO6 A;  5F9N A;  1ZQC A;  1RXV A;  4WC5 A;  4EZ9 A;  1XWL A;  1ZQO A;  3C21 A;  2J6T A;  3MAB A;  2ASJ A;  5KG4 A;  4BXO B;  9ICH A;  4PGX A;  1DGS A;  1H38 A;  3M9M B;  3AUO A;  2KZM A;  1L3V A;  2DVI A;  4J9R A;  2XO7 A;  4ECS A;  5KFV A;  1TAU A;  1R8C A;  3AQL A;  4RWQ A;  1V4A A;  4DFM A;  4R66 A;  4DSL A;  8ICO A;  5J0X A;  4PHP A;  5BOL A;  2JEF A;  4B9T A;  2M2U A;  2C28 A;  4UB3 A;  5HRE A;  3JPT A;  3RTV A;  3UQ0 A;  3C18 A;  5L1J A;  4DFJ A;  8ICQ A;  5KFD A;  5KFK A;  4KLT A;  7ICL A;  2BQU A;  4KMU A;  1L3S A;  3WFO A;  4I2C A;  4M6W A;  4RQ0 A;  2FLP A;  5DQI A;  1ZQV A;  3HWT A;  3C2M A;  4M04 A;  2NRK A;  4DL4 A;  3PV8 A;  4FHY A;  4AT8 A;  4YR0 A;  4UB2 A;  3RJJ A;  4TUR A;  5KG1 A;  1BPD A;  4QZ9 A;  4F5P A;  4DSE A;  2UVV A;  4FBU A;  4LZG A;  5HRH A;  1KNY A;  1Q78 A;  2W8L A;  1KFS A;  3TFR A;  3OVS A;  3ETL A;  3PX0 A;  3OGU A;  7ICR A;  1HUO A;  4FBT A;  1U4B A;  4RWP A;  1ZQU A;  2F1J A;  3T5L A;  4PGQ A;  3M8R A;  1ZQG A;  2PXI A;  4F4X A;  4KLL A;  8ICE A;  2ZHB A;  2JEJ A;  4AT9 A;  2J6S A;  3TAQ A;  5L9X A;  3SI8 A;  3PY8 A;  5KG2 A;  2V4Q A;  4J9K A;  5KFO A;  2BQR A;  7ICN A;  2P66 A;  9ICI A;  4NM2 A;  5DGA A;  3V7J A;  1XSL A;  4WC1 A;  3GFK B;  9ICA A;  3RJE A;  2DR8 A;  3N97 B;  1QTM A;  2R8K A;  4ECQ A;  2GWS A;  4DWI A;  4RQ3 A;  1SL1 A;  1ZQN A;  4ATB B;  4UB1 A;  4R63 A;  1RYR A;  2J6U A;  2VA3 A;  5KFN A;  2BKE A;  1R8B A;  3QZ7 A;  1X9S A;  4KLJ A;  3B0Y A;  3SV3 A;  2KZ3 A;  1PZN A;  1NJZ A;  4IRK A;  4K4G A;  2AGP A;  4KLQ A;  1JAJ A;  1DK2 A;  4QW8 A;  4KLH A;  3HPO A;  3L9D A;  4RT3 A;  1NK8 A;  3GII A;  2R8H A;  2V9W A;  2B21 A;  4DL7 A;  5DB9 A;  3H37 A;  2AGQ A;  4QWE A;  1UT8 A;  4DQI A;  1NZP A;  2KTQ A;  3C23 A;  5F2V O;  4PHE A;  2W9C B;  4LT6 A;  1IXR A;  2MUT B;  5D49 A;  1XU4 A;  3HW8 A;  1BNO A;  4P4M A;  2F1I A;  1A77 A;  2BR0 A;  2DPJ A;  3ZDC A;  3PO5 A;  8ICN A;  4I2D A;  5J2J A;  8ICX A;  9ICQ A;  3RB4 A;  3MGI A;  1L3U A;  4I2A A;  1U49 A;  1XO1 A;  4C8K A;  4DSK A;  3TI0 A;  1ZQW A;  8ICA A;  2BHN A;  1MIV A;  3HJ4 A;  3H8W A;  2A1J A;  4FH5 A;  3G6X A;  3UXO A;  2W9B A;  1ZQT A;  5IIL A;  3RAX A;  1NJX A;  8ICW A;  8ICT A;  1UEU A;  4P2H A;  2C2R A;  4YFK A;  3V72 A;  2HHS A;  2XC9 A;  5DEC A;  3PW7 A;  1JIH A;  4YR3 A;  4JV1 A;  4E8F A;  5J0R A;  1NK7 A;  3C2L A;  2PFO A;  2PI4 A;  1U47 A;  1XC9 A;  1KLN A;  8ICZ A;  4DQS A;  4C8L A;  1S0V A;  3UQ2 A;  2BCQ A;  1ZQZ A;  3RJI A;  1L5U A;  3HP6 A;  5J2H A;  1FA0 A;  1ZQL A;  7ICH A;  5KFJ A;  1NJY A;  4MFC A;  2JZB A;  1Z00 B;  2BCU A;  4YMO A;  2XGP A;  4ECX A;  4JV2 A;  4RNO A;  2KP7 A;  4ED8 A;  3V6K A;  4F3O A;  3HT3 A;  1XSN A;  1ZQF A;  2FMQ A;  3PNC A;  2ISP A;  1RYS A;  4EYH B;  4DQP A;  4I2F A;  8ICH A;  5KT4 A;  2BE3 A;  4E7X A;  3T5H A;  4R64 A;  5KFF A;  3OJU A;  3KHL A;  3BJY A;  4WC7 A;  4QZH A;  5DB8 A;  5TZV A;  2AU0 A;  2FLL A;  3RJK A;  3H8S A;  2ZH7 A;  1SKS A;  1X9M A;  5HRI A;  4DEZ A;  4KLE A;  2O5A A;  2VA2 A;  2Y1J A;  2RDJ A;  9ICS A;  4M9J A;  2ZH5 A;  5KFA A;  3ZDA A;  3V7L A;  4ELU A;  1ZQX A;  4MEY A;  1D9D A;  2HHT A;  2UVR A;  5KT2 A;  2KZZ A;  4RNM A;  3MGH A;  4RQ2 A;  4ECY A;  3EZ5 A;  3SZ2 A;  1WOT A;  1QSL A;  3H38 A;  5DGB A;  1ZQB A;  5J0O A;  3PMN A;  2HVI A;  4ED0 A;  4QWC A;  4ECW A;  2BPF A;  4UD5 A;  3RJG A;  3RH5 A;  1BPX A;  4B9V A;  4IRC A;  4F5Q A;  4O3S A;  4QZE A;  3GIK A;  4BGD A;  4M9L A;  1PX5 A;  7ICI A;  3OVB A;  4F5N A;  4DFK A;  1RXW A;  5IIJ A;  3OJS A;  5IIM A;  4X4T A;  2DFL A;  3GV8 B;  2LYH A;  2ZJA A;  2R8I A;  3TFS A;  2M2W A;  4AT7 A;  3MR3 A;  4EZ6 A;  5KFL A;  4QZA A;  4C8O A;  1MIY A;  4RZR A;  5IIN A;  4XRH A;  3BQ0 A;  2IMW P;  4YD2 A;  5J2E A;  3PW4 A;  3OSN A;  5L1L A;  4O5C A;  4RQ5 A;  4KTQ A;  4NM1 A;  4AT9 B;  3EW9 A;  4I2I A;  3Q8K A;  4F93 B;  4QZD A;  9ICN A;  5KFT A;  1BVS A;  5J2B A;  3KHR A;  3G6V A;  3GQC A;  4FS1 A;  8ICP A;  5DED A;  4DS5 A;  5KFM A;  4I2E A;  4KIT B;  4BWM A;  4M5D A;  3KHH A;  4YG2 A;  2FMS A;  2ZH2 A;  4EBC A;  7ICP A;  3IHQ B;  2JEG A;  3WFS C;  9ICW A;  2PBE A;  5KT6 A;  3OUY B;  1SL2 A;  4WBZ A;  4UAY A;  1BGX T;  3WFQ E;  5HNK A;  4RQ8 A;  4ED1 A;  2ISO A;  4YQW A;  5DBC A;  4TUP A;  4NLN A;  2M2T A;  4DQR A;  3ISB A;  2VA8 A;  8ICM A;  3LDA A;  5HC9 A;  3OHA A;  2WTF A;  3AU6 A;  5KFI A;  3H7I A;  2JEI A;  3C66 A;  1VFG A;  1U48 A;  5C5J A;  3H40 A;  3RBD A;  4M9G A;  1NO5 A;  4DOB A;  4Q44 A;  3RR8 A;  1DK3 A;  3AU2 A;  5J29 A;  2Q0Z X;  4ED3 A;  4WC2 A;  2Y1I A;  5KG0 A;  5HR9 A;  4JWN A;  5KG7 A;  4FHX A;  4GLX A;  4Q43 A;  3M9O B;  4ECU A;  4GXJ A;  4CCH A;  4O5K A;  5KTQ A;  3AQM A;  1TFY A;  2ZH8 A;  3KTQ A;  3JPQ A;  3H3A A;  4MFF A;  3NTU A;  1KDH A;  4B9M A;  3OV7 A;  1WCN A;  1HJP A;  4J9S A;  5HRB A;  4KLF A;  4J9L A;  2XY6 A;  5CJ7 A;  1U9L A;  4ELV A;  4Z6F A;  4P4O A;  5J0P A;  4KLU A;  2NRX A;  5CA7 A;  3MBY A;  4DF4 A;  2IA6 A;  4DSF A;  4J9M A;  4NXZ A;  1NOM A;  5KFH A;  4G3I A;  4Q45 A;  3THV A;  3PW5 A;  1MQ3 A;  3T3F A;  2HHW A;  4O3Q A;  2PFQ A;  4X4O A;  9ICF A;  3UXP A;  1ZQM A;  7ICJ A;  9ICR A;  4J9N A;  5DLG A;  4E80 A;  2AQ4 A;  4M6W B;  2C2E A;  1ZQI A;  3JPN A;  1ZQK A;  1S0M A;  8ICS A;  5CHG A;  1ZQE A;  3PO4 A;  2W8K A;  4HYK A;  1ARO P;  2ZH6 A;  2IBK A;  4DOC A;  3NGD A;  5DLF A;  7ICG A;  1NK4 A;  4JV0 A;  1IM4 A;  5CWR A;  2DPI A;  4I29 A;  2FPK A;  3EPI A;  4XQ8 A;  2NRT A;  4EBK A;  5DBB A;  2ZH4 A;  2R8G A;  4RWO A;  9ICG A;  3JYY A;  1NK6 A;  4NLK A;  9ICC A;  1UA1 A;  2OWO A;  4UQG A;  2R8J A;  4IQT A;  3EYZ A;  1UT5 A;  5JUM A;  9ICE A;  5J2A A;  2I1Q A;  4JWM A;  4PHA A;  4DOA A;  5III A;  4P4P A;  3OHB A;  4ED6 A;  5HMM A;  4RQ4 A;  4YXJ A;  3M9N B;  2V4R A;  4DFP A;  4B9N A;  1BNP A;  5J2G A;  4Z6E A;  2RFF A;  3BQT A;  2P6R A;  1JXL A;  4MF2 A;  4O3N A;  4FS2 A;  8ICF A;  4I2J A;  4X4P A;  4QZF A;  3H4B A;  1KFT A;  4I28 A;  2BQ3 A;  3JPR A;  4MF8 A;  2HVH A;  9ICP A;  4F4K A;  4UAZ A;  1BPB A;  1SZP A;  2ZJ8 A;  5KG6 A;  9ICV A;  5HRL A;  4LZD A;  2XY7 A;  3ISC A;  1KRP A;  4O9M A;  1TVA A;  2ZUC A;  5EWF A;  4F8R A;  9ICM A;  2HHP A;  4X4V A;  5KFR A;  4C8N A;  4QZC A;  1ZET A;  4F2S A;  1MIW A;  3GIM A;  3TAP A;  1L3T A;  5DQH A;  3H39 A;  4BWJ A;  4M9H A;  2BCR A;  1T4G A;  3MFH A;  5J2D A;  4RQ1 A;  4EYI B;  2ALZ A;  1LB2 B;  1BPZ A;  3ZDD A;  1T8E A;  1D8L A;  4DSJ A;  3B0X A;  1ZQP A;  4X4S A;  5BOM A;  1ZJN A;  3MDC A;  4KN7 A;  5KFY A;  4EBE A;  9ICT A;  4WBY A;  2ZHA A;  3Q8P B;  1TK5 A;  3Q8Q B;  1QLN A;  1N48 A;  1ZQA A;  2MAX A;  3ZDB A;  4WCW A;  2MUT A;  5J0Q A;  3E2E A;  4R65 A;  5HRF A;  3NYB A;  1RPL A;  2NRZ A;  1NK5 A;  1N56 A;  1Q79 A;  9ICB A;  5J0S A;  1NJW A;  7ICU A;  5J0W A;  4QZB A;  2BCS A;  5HHI A;  1R8A A;  4EP7 A;  7ICF A;  4FHV A;  4PGY A;  1MC8 A;  3LWM A;  3AQK A;  4DF8 A;  1BPE A;  1MQ2 A;  1JX4 A;  5KT7 A;  3IM1 A;  4IQV A;  4O3R A;  5KFE A;  3C1Y A;  5D46 A;  4J9Q A;  2XY5 A;  3SV4 A;  4C8M A;  4ELT A;  8ICK A;  3C5G A;  3C1Z A;  2I9G A;  1ZYQ A;  5DDY A;  4AT8 B;  3RBE A;  2AGO A;  1JQR A;  4GC6 A;  3JPP A;  4TUS A;  4B9L A;  1SKW A;  3ZD8 A;  4F4Y A;  4X4N A;  4F2R A;  4IG8 A;  4J9O A;  1Z00 A;  2FLN A;  3T5K A;  2BDP A;  4UBC A;  8ICJ A;  5KFW A;  3PVX A;  4F4Z A;  4DL5 A;  4KLG A;  1K1S A;  8ICU A;  3M8S A;  3RAQ A;  4PPX A;  1YLQ A;  4YD1 A;  3SYZ A;  4GC7 A;  3PX4 A;  3OUY A;  1JN3 A;  4R8U B;  2H5X A;  2IHM A;  9ICK A;  1Y88 A;  1S77 D;  2ID1 A;  2DR9 A;  4WC4 A;  1JXE A;  4DLE A;  3WFR E;  1S0O A;  5EOZ A;  1X9W A;  1CUK A;  2HHV A;  5DDM A;  8ICR A;  2F1H A;  4FHW A;  4ZH4 A;  2A1J B;  1S10 A;  2W9B B;  4E0D A;  7ICS A;  3LQC B;  2BPC A;  2FMP A;  7ICT A;  1NKC A;  1V9P A;  9ICX A;  7ICO A;  3K4G A;  3GV7 B;  4NKT A;  4IR9 A;  4X0A A;  2C22 A;  3RRH A;  4RWN A;  3PW2 A;  9ICL A;  4O5E A;  4IRD A;  1KEJ A;  1S0N A;  3V7K A;  3QEB Z;  1T3N A;  2BPG A;  1QSS A;  4YCX A;  3ISD A;  4NY8 A;  3PR4 A;  5HRG A;  5KT5 A;  4YN4 A;  3MR6 A;  4BDP A;  4M47 A;  5KFP A;  2P6U A;  4EBD A;  2DR7 A;  5CR0 A;  4PH5 A;  2ZH9 A;  1A76 A;  3BQ1 A;  1HUZ A;  5IIK A;  3RH6 A;  4X4U A;  3LK9 A;  4UD4 A;  2Q66 A;  3ZDE A;  4QWD A;  1B43 A;  4FHP A;  1TFR A;  4F92 B;  4LVS A;  5L1K A;  1TK0 A;  2DRA A;  5DG9 A;  4UBB A;  3GDX A;  4JK1 A;  3QEA Z;  2C2D A;  3Q8S B;  1KSP A;  1U45 A;  2W9C A;  3RR7 A;  4NKU A;  3PR5 B;  1SL0 A;  2ZH3 A;  2ZH1 A;  3UPQ A;  4RNN A;  5CP2 A;  3OSP A;  2ASD A;  4I27 A;  1KTQ A;  4WC6 A;  4KN4 A;  3JPO A;  4J9P A;  2KFN A;  1NK9 A;  4KLM A;  3OVA A;  5KFG A;  1XS9 D;  3PW0 A;  3HIY A;  4RUC A;  3UPS A;  4RT2 A;  4UB4 A;  4ECR A;  4S3N A;  4R8U A;  3JPS A;  1XSP A;  4TUQ A;  1TFW A;  4O3P A;  2ZTD A;  1TV9 A;  2KFZ A;  4YR2 A;  2AJQ A;  4F4W A;  4MFA A;  5J2F A;  3WFP A;  2IHN A;  5DB7 A;  1JMS A;  2DRB A;  1S97 A;  3ORY A;  5DQG A;  5HHH A;  5DKW A;  5HP4 A;  5KFQ A;  4RUA A;  4YMN A;  4KLI A;  4KLS A;  1B22 A;  5DBA A;  3H4D A;  4XQ7 A;  5KFB A;  2JZB B;  4B9U A;  2W9A A;  1VJ7 A;  2RDI A;  3TAN A;  4DO9 A;  4QWB A;  3H8J A;  3GV5 B;  3C5F A;  8ICG A;  3MFI A;  3FYH A;  1C7Y A;  9ICU A;  4UB5 A;  1NK0 A;  5J0U A;  5F9L A;  5KFZ A;  4WC0 A;  3GIL A;  4DL6 A;  3ZD9 A;  2ZTE A;  1QSY A;  4BXO A;  2HHX A;  5J2I A;  2O1P A;  2FPL A;  1UA0 A;  4AT7 B;  4K4H A;  5J0Y A;  4WC3 A;  4YVZ A;  5L1I A;  1UET A;  4Z6D A;  3K75 D;  8ICB A;  4IR1 A;  4KLO A;  3V6H A;  5HML A;  1SKR A;  4EEY A;  4K4I A;  4ED7 A;  5HRK A;  5KG5 A;  4M0A A;  5D4B A;  3MR5 A;  4DS4 A;  3FDS A;  1ZQS A;  3MDA A;  2KN7 A;  4IQW A;  4X0B A;  2HW3 A;  4ECT A;  5J2K A;  3PX6 A;  3T5J A;  2W9M A;  2NRW A;  1EXN A;  2HHU A;  2FPM A;  2PI5 A;  4QZ8 A;  3BDP A;  4F50 A;  2DR5 A;  5KFC A;  3LWL A;  3QE9 Y;  1RZT A;  1NKE A;  3RB6 A;  3EPG A;  4X4R A;  1D9F A;  4FH3 A;  1F5A A;  3UXN A;  3EWA A;  3Q8R B;  3TQ1 A;  2NRV A;  1ZJM A;  4TQS A;  8ICC A;  3RRG A;  1ZQY A;  1Z3E B;  2BGW A;  5KFS A;  2AQ0 A;  4NLZ A;  3KHG A;  9ICJ A;  1UEV A;  5KFX A;  4DL3 A;  4PHD A;  2ZUD A;  3TAR A;  4MEX A;  2UVW A;  1TAQ A;  4KLD A;  4I2B A;  4M2Y A;  3JZ0 A;  2ASL A;  1X2I A;  1COO A;  1ZQR A;  1T7P A;  8ICY A;  3HJ1 A;  5J0T A;  1TKD A;  4DSI A;  8ICI A;  4GXK A;  1K1Q A;  4QWA A;  1ZQD A;  7ICQ A;  4F5O A;  3QZ8 A;  3N4M B;  5HRD A;  5BPC A;  2PFP A;  4UAW A;  2UVU A;  4F91 B;  1BPY A;  3RJH A;  4NLG A;  3MR2 A;  7ICK A;  9ICO A;  4RPX A;  7ICV A;  4O0I A;  3PML A;  4X5V A;  5KFU A;  3RB0 A;  3Q8M A;  1NKB A;  2ZUB A;  5DB6 A;  4YP3 A;  4M9N A;  1ZQH A;  5KG3 A;  1KFD A;  1DOQ A;  4XUS A;  4RQ6 A;  1MSW D;  4GXI A;  2ZTC A;  8ICL A;  4X4Q A;  4DLG A;  2PFN A;  4JUZ A;  4I2G A;  3RH4 A;  3GIJ A;  4F5R A;  5EWE A;  1ZQJ A;  4RPZ A;  1OU5 A;  2XCP A;  4DQQ A;  4YMM A;  4XA5 A;  4RQ7 A;  3C2K A;  4Q8E A;  7ICM A;  1ZQQ A;  1S9F A;  2HHQ A;  1LV5 A;  2M9N A;  1CEZ A;  5CB1 A;  4I2H A;  4RU9 A;  1S76 D;  3V6J A;  4B9S A;  8ICV A;  2BCV A;  3BQ2 A;  4Q8F A;  2XGQ A;  2M2V A;  5EWG A;  4QW9 A;  1R89 A;  4EBJ A;  3Q8L A;  4QZI A;  1D8Y A;  4O3O A;  4QZG A;  5IIO A; 
#chains in the Genus database with same CATH topology
 1L7N A;  4ECZ A;  4Z6C A;  1O03 A;  3AQN A;  1HIW A;  5DG8 A;  4ED2 A;  1KL9 A;  4ATB A;  2LKY A;  2JHD A;  5AK5 A;  5KT3 A;  4IQU A;  2ATL A;  3QU7 A;  4FO6 A;  5ALS A;  2R18 A;  4BXO B;  3MGV A;  9ICH A;  2Z7J A;  3M9M B;  2DVI A;  4J9R A;  1J97 A;  2OCE A;  4R66 A;  4OCZ A;  2DQN B;  4UB3 A;  3UQ0 A;  2LBO A;  2LYA A;  4RQ0 A;  2NRK A;  2ZG6 A;  4DSE A;  5KG1 A;  4QZ9 A;  4FBU A;  2UVV A;  5HRH A;  4LZG A;  2CN1 A;  3ETL A;  3PX0 A;  4FBT A;  4PGQ A;  1WG8 A;  4F4X A;  2JEJ A;  2V4Q A;  5KFO A;  3BS7 A;  2P66 A;  1DRG A;  2GOL A;  5DGA A;  3RFA A;  3V7J A;  1XSL A;  3RJE A;  2DGZ A;  3N97 B;  2WAQ F;  2OYY A;  4ECQ A;  3VCB A;  2GWS A;  3FAH A;  4O6A A;  2JH1 A;  1L7P A;  3BZK A;  1X6J A;  2WF8 A;  3QZ7 A;  1X9S A;  4KLJ A;  1R8B A;  2KD1 A;  3IG8 A;  4K4G A;  2YMQ A;  3KKA C;  2KE7 A;  2AGP A;  4KLQ A;  4KLH A;  5F3X B;  1DK2 A;  5B66 U;  1ZOL A;  4DL7 A;  1UT8 A;  5J8Y A;  3A0B U;  3SMV A;  1IXR A;  2MUT B;  4Y2X A;  1XU4 A;  2F1I A;  2BR0 A;  3PO5 A;  5J2J A;  3ICX A;  3RB4 A;  4BUG A;  1L3U A;  5AIC A;  2HI0 A;  3TI0 A;  3H8W A;  3LVW A;  2A19 A;  4Y2U A;  4YFK A;  3NRW A;  3ER8 C;  1L7O A;  4CF3 A;  1NK7 A;  3C2L A;  8ICZ A;  1U47 A;  5A0L A;  4C8L A;  2GO7 A;  3BZC A;  1FA0 A;  3F5A A;  7ICH A;  5KFJ A;  4EX6 A;  1KQQ A;  2JZB A;  4NXV A;  4RNO A;  3E58 A;  4ED8 A;  4F3O A;  3HT3 A;  1ZQF A;  1F5S A;  1RYS A;  2BE3 A;  4E7X A;  5KT4 A;  3PST A;  3OJU A;  1Z1B A;  4QIW F;  1IV8 A;  1B4F A;  4G9B A;  1A6S A;  5AKI A;  4DEZ A;  5KFA A;  1D9D A;  4RQ2 A;  1ZQB A;  3PMN A;  4OAI Z;  2BPF A;  3RH5 A;  1BPX A;  3GIK A;  4M9L A;  2KOB A;  3OVB A;  4F5N A;  3RF9 A;  5IIM A;  3TFS A;  2IHO A;  3MR3 A;  2W7P A;  4EEK A;  4QZA A;  1MIY A;  2RP5 A;  4RZR A;  1X9X A;  5EE0 A;  2IMW P;  5J2E A;  3Q8K A;  1BVS A;  5JTG A;  3U26 A;  4FZM A;  5KFM A;  4KIT B;  4YG2 A;  9ICW A;  5KT6 A;  2ZIW A;  1WWU A;  2ISO A;  5ALG A;  2W3R A;  2M2T A;  5AIA A;  5JRT A;  4DQR A;  2WTF A;  2F3N A;  5KFI A;  3C66 A;  2W03 A;  1U48 A;  3RR8 A;  1YT3 A;  4ED3 A;  4GLX A;  4Q43 A;  3M9O B;  1TFY A;  5KTQ A;  2CPR A;  2GH1 A;  3JPQ A;  3H3A A;  4MFF A;  5HRB A;  2E5S A;  4KLU A;  2ZXI A;  2FI1 A;  4J9M A;  5KFH A;  1NOM A;  1SV0 C;  3PW5 A;  3THV A;  2W54 A;  2HHW A;  4O3Q A;  3M6K A;  1RDF A;  5JU5 A;  2FJ6 A;  1ZQM A;  9ICR A;  4J9N A;  2AQ4 A;  1CRX A;  4M6W B;  1ZQK A;  1S0M A;  4WOY A;  5CHG A;  1ZQE A;  5CFT A;  4HYK A;  2ZH6 A;  2K60 A;  3NGD A;  5DLF A;  1QQ6 A;  1IM4 A;  4EBK A;  5H2F U;  2ZH4 A;  9ICG A;  3JYY A;  4NLK A;  5GTH U;  9ICC A;  3EYZ A;  5JUM A;  5AM0 A;  1MA7 A;  9ICE A;  2IOF K;  5J2A A;  4PHA A;  1SWV A;  3OHB A;  4DFP A;  4B9N A;  4RQ4 A;  2V4R A;  4QNL A;  5ALL A;  1FFU A;  4Y2T A;  4I2J A;  4QZF A;  3H4B A;  1KFT A;  4I28 A;  4NLB A;  2YTU A;  9ICP A;  2RFF A;  9ICV A;  4O9M A;  2ZUC A;  1ZET A;  1RQL A;  1UPH A;  4US8 A;  3H39 A;  3MFH A;  1LB2 B;  1JRO A;  5BOM A;  1ZJN A;  2YMM A;  3Q8Q B;  3ZDB A;  5J0Q A;  5CRX A;  2K4E A;  1N56 A;  3MCR A;  1S5L U;  2ZIX A;  2BCS A;  1R8A A;  1NNL A;  3AMZ A;  3OUY B;  3BS5 B;  3HJE A;  1MQ2 A;  1JX4 A;  3C1Y A;  5D46 A;  8ICK A;  3C1Z A;  5ALY A;  2ZIW B;  1JQR A;  4B9L A;  1SKW A;  3ZD8 A;  4IG8 A;  2YN4 A;  4DL5 A;  1YLQ A;  3RAQ A;  4YD1 A;  4GC7 A;  1JN3 A;  2H5X A;  1Y88 A;  4WC4 A;  3L5K A;  1JXE A;  1OUQ A;  4FHW A;  4E0D A;  2BPC A;  2FMP A;  4NKT A;  2DL0 A;  3K4G A;  3GV7 B;  2C22 A;  3QEB Z;  2GA9 D;  4KX5 A;  3SAH A;  4YN4 A;  3MR6 A;  4EBD A;  2ZIX B;  4FZL A;  4UB6 U;  4MHV A;  2QB1 A;  4F92 B;  5DG9 A;  3GDX A;  2ZH3 A;  3IV6 A;  3UPQ A;  3JPO A;  4J9P A;  3QXG A;  2OHF A;  3M6Z A;  1FFV A;  3I28 A;  4RT2 A;  3WK7 A;  4UAT A;  4YR2 A;  5DB7 A;  1S97 A;  3ORY A;  5KFQ A;  4KLI A;  5DBA A;  5KFB A;  3K1Z A;  4B9U A;  1VJ7 A;  2RDI A;  2XVT A;  4QWB A;  3GV5 B;  5ALO A;  1DXS A;  5F9L A;  1V97 A;  2G5H B;  2OM6 A;  3KZX A;  4GIB A;  2FCL A;  3ETR A;  4NV0 A;  3HKZ C;  1UET A;  8ICB A;  4KLO A;  5B3Q A;  1ZD5 A;  5D4B A;  4IQW A;  3JCF A;  2HW3 A;  3HIL A;  3PX6 A;  3T5J A;  4K9B A;  4Y2V A;  2HHU A;  2FPM A;  2PI5 A;  3IG5 A;  2DF4 B;  5D61 A;  2DR5 A;  2MRL A;  3QE9 Y;  1N62 A;  2LHT A;  2NRV A;  1N63 A;  2KV2 A;  2KKV A;  8ICC A;  3A0H U;  3NAS A;  1UEV A;  2UVW A;  1B0X A;  4KLD A;  2K8A A;  4I2B A;  1ZQR A;  1X2I A;  2E8M A;  5ALW A;  8ICI A;  4QWA A;  4Y2Y A;  2HOI A;  5HRD A;  7ICK A;  2NO5 A;  3PML A;  1J2N A;  3Q8M A;  4YP3 A;  1KFD A;  2ZTC A;  4I2G A;  3RH4 A;  3NWI A;  4DQQ A;  4EX7 A;  4OAH A;  1N5W A;  2H3Q A;  2IOH A;  3BQ2 A;  3AN1 A;  4EBJ A;  3Q8L A;  1ZRM A;  1FEZ A;  4O68 A;  3OVA A;  3RJF A;  1LKY A;  3G6Y A;  1ZXI A;  2ZJ5 A;  5J2C A;  4DL2 A;  2RHF A;  4TQR A;  4ECV A;  4OJ6 A;  4RPY A;  4EZ9 A;  4OJ5 A;  1ZQO A;  4NXX A;  5KG4 A;  1Z1V A;  1H38 A;  4NXU A;  1QQ7 A;  4OJO A;  1L3V A;  4RWQ A;  8ICO A;  5BOL A;  3JPT A;  2W11 A;  1MN8 A;  4Y2J A;  5KFD A;  4OJP A;  5DQI A;  1ZQV A;  3C2M A;  4M04 A;  2H3F A;  4DL4 A;  4AT8 A;  4FZN A;  4YR0 A;  4UB2 A;  2B56 A;  1KFS A;  3OVS A;  3OGU A;  7ICR A;  1HUO A;  1X6I A;  1CI4 A;  2JMG A;  4KLL A;  2PXI A;  8ICE A;  1S8O A;  1SGG A;  4IC9 A;  2PMZ F;  3TAQ A;  2H3I A;  4WC1 A;  4K8V A;  1QTM A;  1ZQN A;  4RQN A;  4R63 A;  1RYR A;  4U7C A;  2PKE A;  5KFN A;  3B0Y A;  2YY6 A;  3SV3 A;  2KZ3 A;  4IRK A;  5AKL A;  3AQF A;  1NK8 A;  3GII A;  2R8H A;  4HAI A;  5DB9 A;  1UCV A;  3PHZ A;  1FIQ A;  4Y2P A;  1NZP A;  3QU5 A;  2W9C B;  1BNO A;  4P4M A;  1LVH A;  1OW5 A;  9ICQ A;  3FM9 A;  4I2A A;  3HJ4 A;  2BHN A;  3G6X A;  1ZQT A;  3FC4 A;  5IIL A;  1NJX A;  8ICW A;  1IIP A;  4P2H A;  3V72 A;  5DEC A;  2XC9 A;  3KZI U;  5EE1 A;  4E8F A;  5AI0 A;  1J2M A;  4IL6 U;  4UAR A;  1S0V A;  4OD0 A;  3HP6 A;  5J2H A;  2DKZ A;  2BCU A;  2XGP A;  3CYM A;  2KP7 A;  3V6K A;  1A0P A;  4WQK A;  4EYH B;  4DQP A;  4I2F A;  4R64 A;  1JAL A;  2HBK A;  3WK5 A;  3QUB A;  2FLL A;  3RJK A;  2W43 A;  1X9M A;  5HRI A;  2Y1J A;  1D8B A;  3LYS A;  2RDJ A;  3F53 A;  5B5E U;  4M9J A;  9ICS A;  2HHT A;  3ZDA A;  5AKK A;  1V85 A;  3EZ5 A;  1WOT A;  4OJL A;  4PZN A;  5DGB A;  3NVO A;  2Q4T A;  2HVI A;  3S6J A;  4F5Q A;  4QZE A;  1PX5 A;  5AI8 A;  1KKX A;  2IUB A;  2DFL A;  3GV8 B;  2M2W A;  2B6G A;  4EZ6 A;  4C8O A;  5IIN A;  4XRH A;  2N1R A;  2W55 A;  4RQ5 A;  4KTQ A;  4PJ0 U;  4F93 B;  2EAM A;  9ICN A;  5KFT A;  3SD7 A;  8ICP A;  3UMC A;  3KHH A;  3WFS C;  3IHQ B;  2WF6 A;  5E79 U;  4NL9 C;  1BGX T;  4ED1 A;  5DBC A;  1M6Y A;  2JRZ A;  8ICM A;  1L8L A;  3LDA A;  3H7I A;  2JEI A;  3F2C A;  2AXT U;  3AEV A;  5C5J A;  3H40 A;  1NO5 A;  4M9G A;  4DOB A;  2BBJ A;  2Q0Z X;  4WC2 A;  2Y1I A;  3WKD A;  1PK1 B;  1SV4 A;  4ECU A;  4GXJ A;  4CCH A;  3AQM A;  3KTQ A;  3T79 A;  4UAU A;  3DDH A;  4J9S A;  2XY6 A;  1U9L A;  2CRX A;  4P4O A;  3WK8 A;  5J0P A;  4O3M A;  1GPJ A;  2NRX A;  4G3I A;  5AKH A;  4Q45 A;  2O6K A;  9ICF A;  4E80 A;  4EEL A;  5DLG A;  8ICS A;  3PO4 A;  1ARO P;  1ECW A;  1NK4 A;  5ALF A;  5CWR A;  4XQ8 A;  2NRT A;  2YQE A;  2R8G A;  2ZIV B;  1NK6 A;  2KHV A;  1UA1 A;  2R8J A;  4QJF B;  1UT5 A;  4JWM A;  2HN1 A;  4DOA A;  4P4P A;  4ED6 A;  5HMM A;  3M9N B;  1BNP A;  3BQT A;  2P6R A;  1JXL A;  4F4K A;  1BPB A;  1SZP A;  2ZJ8 A;  3ISC A;  3HKZ F;  5EWF A;  4F8R A;  2HHP A;  3NVZ A;  4QZC A;  4F2S A;  1L3T A;  3TKA A;  3OPX A;  2D6F C;  3UMG A;  1GO3 F;  2ALZ A;  1D8L A;  4DSJ A;  1ZQP A;  1N48 A;  1ZQA A;  1SXE A;  3NYB A;  5HRF A;  5ALU A;  1O08 A;  5JTI A;  2F8L A;  3CP8 A;  1NJW A;  4AYB F;  3KD3 A;  4OAF A;  5HHI A;  2KEY A;  5C0Y A;  5CEH A;  1IG6 A;  4DF8 A;  1BPE A;  5G5H A;  3IM1 A;  5KFE A;  1X40 A;  3K1R B;  4C8M A;  4ELT A;  2HBL A;  5DDY A;  4TUS A;  4F4Y A;  5EE9 A;  4F2R A;  1T3Q A;  1Z00 A;  4FE3 A;  2FLN A;  5KFW A;  2YMP A;  4F4Z A;  8ICU A;  2DUY A;  4R8U B;  2IHM A;  9ICK A;  4DLE A;  3N28 A;  1CUK A;  2HHV A;  3LQC B;  4NJ8 A;  1P7D A;  3J81 j;  2MU2 A;  4RWN A;  3NS1 A;  4X0A A;  2E3T A;  3WKB A;  1S0N A;  3V7K A;  5AM2 A;  2JXJ A;  2K4P A;  2DR7 A;  5CR0 A;  3BQ7 A;  1A76 A;  1HUZ A;  3MC1 A;  3RH6 A;  3IN5 A;  1ZD4 A;  2Q66 A;  5KNI A;  1TFR A;  4UBB A;  4UW9 A;  4JLZ A;  3Q8S B;  3F2B A;  3PZP A;  1U45 A;  4NKU A;  3PR5 B;  3ER9 B;  3OSP A;  1Z4O A;  4WC6 A;  1KW4 A;  2JH7 A;  1F44 A;  3HIY A;  3UPS A;  4UB4 A;  4ECR A;  2OH2 A;  4S3N A;  4R8U A;  1TFW A;  4TUQ A;  2A1A A;  1QQ5 A;  3C29 A;  1JMS A;  3ALR A;  5DKW A;  5HP4 A;  4NXT A;  4YMN A;  1B22 A;  5CFS A;  2JZB B;  3TAN A;  3H8J A;  8ICG A;  1C7Y A;  5KFZ A;  4WC0 A;  4BXO A;  3ZD9 A;  1UHU A;  5AI6 A;  2HHX A;  3WKA A;  1UA0 A;  2O1P A;  4AT7 B;  2KJ5 A;  4WC3 A;  5L1I A;  4IR1 A;  3V6H A;  5HML A;  1SKR A;  4EEY A;  4K4I A;  4ED7 A;  5HRK A;  2EZZ A;  2LI6 A;  3MR5 A;  2KIW A;  4I0U A;  2AHO B;  2KN7 A;  3O0F A;  2NRW A;  4P0Q A;  4LEY A;  3SQI A;  3EPG A;  1D9F A;  1Z4N A;  4FH3 A;  1QH9 A;  4Y2S A;  5HR6 A;  4K9A A;  1PUZ A;  1ZQY A;  2AQ0 A;  4DL3 A;  2I5H A;  3N7R C;  3TAR A;  1TAQ A;  2ZH8 A;  5FP0 A;  1K1Q A;  4F5O A;  2B4V A;  3RJH A;  4PZO A;  9ICO A;  3WK9 A;  7ICV A;  4AYB C;  4X5V A;  3RB0 A;  2ZUB A;  1ZQH A;  5KG3 A;  1MSW D;  4X4Q A;  8ICL A;  4GXI A;  3SAF A;  2PFN A;  5AM3 A;  4F5R A;  4RPZ A;  1HEK A;  1JRP A;  4XA5 A;  3IDW A;  3C2K A;  1ZQQ A;  1CEZ A;  2B0C A;  2BCV A;  5AM1 A;  4Q8F A;  2XGQ A;  1Q3V A;  5EWG A;  4QW9 A;  1R89 A;  4QZI A;  4PPX A;  4O3O A;  5AK6 A;  3ONN A;  5IIO A;  3KKA A;  2LM4 A;  2ESE A;  7ICE A;  3RB3 A;  2XCA A;  1ZD3 A;  2ZIV A;  3HX0 A;  1ZQC A;  1Q46 A;  2J6T A;  3MAB A;  2ASJ A;  3QNM A;  3AUO A;  4ECS A;  1TAU A;  1V4A A;  5J0X A;  3M7D A;  2JEF A;  4B9T A;  2M2U A;  1Z19 A;  2C28 A;  5HRE A;  3RTV A;  1WUD A;  5AKE A;  5L1J A;  4DFJ A;  8ICQ A;  5B3P A;  5KFK A;  4KLT A;  2Y9U A;  4M6W A;  2FLP A;  4FHY A;  4DSK A;  3NVY A;  3RJJ A;  1KNY A;  1BPD A;  2F2A B;  4HX0 A;  4GFJ A;  3TFR A;  1U4B A;  4RWP A;  3T5L A;  3M8R A;  1ZQG A;  5L9X A;  3SI8 A;  4CNQ A;  3PY8 A;  5KG2 A;  7ICN A;  1N2X A;  3GFK B;  5ALX A;  2R8K A;  3N7S C;  1SL1 A;  4UB1 A;  2EZX A;  2YB4 A;  1NI3 A;  2BKE A;  1ZD2 P;  1NJZ A;  1PZN A;  2B51 A;  3AL0 B;  2V9W A;  3VC8 A;  4QWE A;  4CF5 A;  4DQI A;  2KTQ A;  2EAN A;  5F2V O;  4LT6 A;  1A77 A;  2DPJ A;  3ZDC A;  8ICX A;  4WQL A;  4I2D A;  4CF4 A;  2Y9T A;  1U49 A;  1PVR A;  1XO1 A;  8ICA A;  4EV6 A;  2A1J A;  2KJ9 A;  1UEU A;  3TAC B;  5AK4 A;  8ICT A;  3PW7 A;  1JIH A;  4YR3 A;  3BS5 A;  3GU3 A;  2PI4 A;  2KSO A;  1XC9 A;  1KLN A;  4DQS A;  2F77 X;  3UQ2 A;  2XID A;  1L5U A;  3N7P D;  1ZQL A;  4MFC A;  5AKZ A;  4O67 A;  1XSN A;  3D2N A;  1SB3 C;  2ISP A;  2M0N A;  5KFF A;  3KHL A;  4WC7 A;  3H8S A;  2O5A A;  2LM1 A;  4ELU A;  1RM6 C;  3CNH A;  2UVR A;  5KT2 A;  1Q3U A;  3SZ2 A;  1PK1 A;  3H38 A;  3AQE A;  4ECW A;  4UD5 A;  3H8M A;  3RJG A;  4IRC A;  1DGJ A;  3WK4 A;  7ICI A;  4DFK A;  5L1M A;  1RXW A;  2G09 A;  3OJS A;  4X4T A;  2LYH A;  2ZJA A;  2KNJ A;  2WAQ C;  4AT7 A;  5KFL A;  4LJX A;  5ALZ A;  1WYG A;  3BQ0 A;  2NYV A;  2KJ8 A;  4YD2 A;  3OSN A;  4O5C A;  4NM1 A;  4K98 A;  2IOF A;  3KHR A;  3G6V A;  1C20 A;  5DED A;  3I76 A;  4DS5 A;  5AKX A;  3QU2 A;  4EBC A;  2JEG A;  4ACO A;  4WBZ A;  2EH9 A;  5AKJ A;  5HNK A;  4RQ8 A;  4TUP A;  2K89 A;  2RQ5 A;  2A3V A;  3QUT A;  5HC9 A;  3OHA A;  1VJ5 A;  4B6J A;  3RBD A;  4ICA A;  4Q44 A;  1T94 A;  4FHX A;  4O5K A;  1ZRN A;  1WCN A;  1HJP A;  4J9L A;  4ELV A;  5AKG A;  5ALV A;  4DF4 A;  2IA6 A;  4DSF A;  1MQ3 A;  3T3F A;  5AI4 A;  4NL9 A;  5ALE A;  7ICJ A;  2F8K A;  1ZQI A;  4DOC A;  4P0P A;  7ICG A;  4JV0 A;  2L5Y A;  2DPI A;  5ALI A;  2FPK A;  4I29 A;  2VIX A;  3L3F X;  5DBB A;  1ED1 A;  2OWO A;  4IQT A;  4PL2 A;  2I1Q A;  5III A;  4YXJ A;  1PVP A;  4MF2 A;  8ICF A;  5AIB A;  1VDV A;  3NVV A;  4PL1 A;  2BQ3 A;  2FDR A;  4MF8 A;  2HVH A;  4X4U A;  1Q79 A;  4K99 A;  4X0B A;  2XY7 A;  9ICM A;  5ALN A;  2OEH A;  4X4V A;  2VJ4 A;  4C8N A;  4WJ3 B;  1RYU A;  2BCR A;  4KB6 A;  4EYI B;  4RQ1 A;  1BPZ A;  1T8E A;  1K5O A;  2HMX A;  3MDC A;  2ZHA A;  5KFY A;  9ICT A;  4C4T A;  1L7M A;  3Q8P B;  2MAX A;  4WCW A;  2MUT A;  4P0P B;  3TAD A;  7ICU A;  2WF5 A;  7ICF A;  4FHV A;  3LWM A;  1SZH A;  4O3R A;  4J9Q A;  2XY5 A;  1N61 A;  3RBE A;  2WF7 A;  1XO0 A;  4J9O A;  2DBY A;  1L8O A;  4UBC A;  8ICJ A;  3PVX A;  4KLG A;  1K1S A;  4DCC A;  3PX4 A;  3OUY A;  2YB1 A;  1S77 D;  2DR9 A;  3WFR E;  1S0O A;  3NKU A;  4UAV A;  5DDM A;  2F1H A;  2ZIU B;  2A1J B;  1NKC A;  1V9P A;  9ICX A;  4IR9 A;  4C80 A;  2D8C A;  3WK6 A;  3D2S A;  2KSO B;  5HRG A;  4YCX A;  3ISD A;  3PR4 A;  3SR6 A;  5KFP A;  2P6U A;  2ZH9 A;  3BQ1 A;  5IIK A;  4UD4 A;  3NVW A;  2KIV A;  4EED A;  4JLX A;  4LVS A;  3TAD C;  3CW2 C;  3L4P A;  2C2D A;  1N60 A;  1KSP A;  4CE6 A;  2W9C A;  2HCF A;  2HN2 A;  2KHQ A;  4K96 A;  2F44 A;  5CP2 A;  4I27 A;  1KTQ A;  4EEN A;  5ALJ A;  1NK9 A;  4KLM A;  1XS9 D;  3DV9 A;  3KFU F;  3PSF A;  5KL1 B;  2XI9 A;  1XSP A;  5D62 A;  4O3P A;  2ZTD A;  5J8Y C;  1TV9 A;  2AJQ A;  4F4W A;  4MFA A;  5J2F A;  2K4I A;  3QYP A;  2IHN A;  2DRB A;  5DQG A;  4RUA A;  3H4D A;  4BJQ A;  3ED5 A;  3C5F A;  4J03 A;  3MFI A;  3FYH A;  3NRZ A;  4UB5 A;  3KOO A;  4USA A;  4RQM A;  1QSY A;  2ZTE A;  5J2I A;  4IS7 A;  5J0Y A;  5KAI U;  3HRD D;  2ZXH A;  4M0A A;  1ZQS A;  4DS4 A;  3FDS A;  2EAO A;  3C28 A;  2HOQ A;  5TIS U;  5J2K A;  2W9M A;  1N5X A;  2WF9 A;  1AQ6 A;  4QZ8 A;  2HSZ A;  4UAS A;  1ZQ1 C;  4F50 A;  2G5I B;  2WB1 C;  3WKE A;  5KFC A;  1NKE A;  3EF2 A;  2QLT A;  3UXN A;  3EWA A;  3TQ1 A;  1NZB A;  4Y2R A;  1ZJM A;  4C7Z A;  3RRG A;  3K7D A;  5KFS A;  1X66 A;  5KFX A;  4M2Y A;  8ICY A;  3HJ1 A;  2JGA A;  5J0T A;  1TKD A;  3QU9 A;  4MKP A;  3QZ8 A;  3N4M B;  5BPC A;  2PFP A;  4UAW A;  2UVU A;  4F91 B;  3IP4 B;  1BPY A;  4NLG A;  3MR2 A;  2OXO A;  4CRX A;  4C0Z A;  1JI7 A;  5KFU A;  2E1F A;  2ZIU A;  1NKB A;  1LKY B;  4M9N A;  4RQ6 A;  4KX3 A;  2RLT A;  2XIC A;  2ID1 A;  3GIJ A;  1ZQJ A;  4YMM A;  1KBU A;  4Q8E A;  7ICM A;  2HHQ A;  1LV5 A;  1VLB A;  2M9N A;  4I2H A;  4RU9 A;  1S76 D;  4B9S A;  2I6X A;  3UM9 A;  2KVC A;  1D8Y A;  4ZOH C;  4O5E A;  4F72 A;  1WCL A;  5DG7 A;  2YX8 A;  4YXM A;  2VAN A;  3EUB 2;  4AP9 A;  1TK8 A;  5F9N A;  1RXV A;  4WC5 A;  1OXJ A;  1XWL A;  3C21 A;  2QAR A;  4PGX A;  1DGS A;  2KZM A;  4CGZ A;  2XO7 A;  1R8C A;  5KFV A;  3AQL A;  4DFM A;  4DSL A;  2E8O A;  4PHP A;  2K8B B;  4U6P A;  2MA1 A;  3C18 A;  5ALP A;  4QIW C;  1PVQ A;  2BQU A;  4KMU A;  3UMB A;  1L3S A;  4I2C A;  3H0L B;  7ICL A;  3WFO A;  3D6J A;  3HWT A;  3PV8 A;  4TUR A;  2EAP A;  5K4L A;  4F5P A;  1Q78 A;  4LEV A;  2CXY A;  2W8L A;  4F71 A;  4UB8 U;  1ZQU A;  2F1J A;  1PK3 A;  1SV0 A;  2ZHB A;  4C4S A;  4AT9 A;  2J6S A;  4J9K A;  1Q8K A;  2BQR A;  9ICI A;  4NM2 A;  1SXD A;  2HBJ A;  5AK3 A;  4FO1 A;  2Y0S F;  9ICA A;  2DR8 A;  5KAF U;  4DFD A;  3QX7 A;  4DWI A;  4RQ3 A;  4ATB B;  2W7O A;  2J6U A;  3I1Y A;  1TAM A;  2VA3 A;  4OO1 J;  4BX9 C;  1JAJ A;  4QW8 A;  3HPO A;  3L9D A;  4RT3 A;  2AH5 A;  3SEN A;  2ES6 A;  2VJ5 A;  2B21 A;  3H37 A;  2AGQ A;  2LPE A;  1RG6 A;  3C23 A;  4PHE A;  3H0R B;  5D49 A;  2WB1 F;  3HW8 A;  8ICN A;  3MGI A;  4C8K A;  1ZQW A;  1MIV A;  5GTI U;  2EZY A;  4FH5 A;  2K8C B;  3UXO A;  2W9B A;  3RAX A;  1L6N A;  3D2Q A;  2C2R A;  2HHS A;  4JV1 A;  5J0R A;  3CK6 A;  3SEI A;  2PFO A;  4JMU A;  2GAF D;  2BCQ A;  1ZQZ A;  3RJI A;  2LMR A;  5ALQ A;  2G0A A;  1V38 A;  1NJY A;  1Z00 B;  3AM9 A;  4YMO A;  1YZ6 A;  4ECX A;  4JV2 A;  3H0M B;  2FMQ A;  3PNC A;  8ICH A;  1UQV A;  3T5H A;  3BJY A;  4QZH A;  2G07 A;  5DB8 A;  5TZV A;  2AU0 A;  1SIJ A;  2ZH7 A;  1SKS A;  4KLE A;  2VA2 A;  2ZH5 A;  3V7L A;  1ZQX A;  4MEY A;  4K97 A;  2KK0 A;  2KZZ A;  4RNM A;  3MGH A;  4ECY A;  5ALT A;  1QSL A;  4P0Q B;  2PMZ C;  5J0O A;  4ED0 A;  4QWC A;  4O3S A;  4B9V A;  4EEB A;  4BGD A;  3DEE A;  5IIJ A;  4KM5 A;  2R8I A;  4A8E A;  3PW4 A;  5AI9 A;  5L1L A;  4AT9 B;  3EW9 A;  4I2I A;  4KMO B;  4QZD A;  5J2B A;  2HOF A;  4FS1 A;  3GQC A;  2MSN A;  5EE3 A;  3SAG A;  4I2E A;  2GLE A;  5G5G A;  4BWM A;  4M5D A;  2FMS A;  2ZH2 A;  2YML A;  2KG5 A;  7ICP A;  4NLC A;  2PBE A;  1SL2 A;  1QCK A;  4UAY A;  3WFQ E;  1RQN A;  4YQW A;  4NLN A;  3ISB A;  2VA8 A;  3AU6 A;  1VFG A;  1DK3 A;  2ODG A;  3AU2 A;  5J29 A;  1JUD A;  4RWO A;  5KG0 A;  2DKX A;  4JWN A;  5KG7 A;  5HR9 A;  3KBB A;  3NTU A;  1KDH A;  4B9M A;  3M1Y A;  3OV7 A;  2NV3 A;  5ALH A;  4KLF A;  5CJ7 A;  4Z6F A;  5CA7 A;  3MBY A;  3B9J A;  4NXZ A;  2G08 A;  1XNS A;  2W04 A;  5AKY A;  2PFQ A;  2KVS A;  4C7Y A;  4X4O A;  3UXP A;  5HR7 A;  4NXW A;  3IRU A;  2C2E A;  2H3V A;  3JPN A;  2W8K A;  5AM4 A;  2WFA A;  4FFD A;  1X42 A;  2W3S A;  2IBK A;  4XJE A;  4WH5 A;  2QB0 B;  2G06 A;  3EPI A;  4UQG A;  3QUQ A;  2QAR B;  2BBH A;  5J2G A;  4Z6E A;  2F76 X;  3ERC C;  4US9 A;  4N7R A;  5AM5 A;  4O3N A;  4FS2 A;  4X4P A;  2JR5 A;  3JPR A;  1FO4 A;  4UAZ A;  5KG6 A;  5HRL A;  4LZD A;  1KRP A;  5D63 A;  1TVA A;  5KFR A;  5KL8 B;  1MIW A;  3GIM A;  3TAP A;  5DQH A;  4LEW A;  4BWJ A;  4M9H A;  4LEZ A;  3ZDD A;  1T4G A;  5J2D A;  5CHE A;  3OWG A;  2WHE A;  3B0X A;  4X4S A;  4WBY A;  4KN7 A;  5T14 A;  4EBE A;  1TK5 A;  1QLN A;  3E2E A;  5ALK A;  4R65 A;  1RPL A;  3F5E A;  2NRZ A;  1NK5 A;  9ICB A;  5J0S A;  5J0W A;  4QZB A;  2QB0 A;  2KIC A;  2D3D A;  4EP7 A;  5AI5 A;  2BDU A;  4PGY A;  1MC8 A;  3AQK A;  5KT7 A;  4IQV A;  1KN5 A;  3SV4 A;  4AT8 B;  3C5G A;  2I9G A;  1ZYQ A;  2AGO A;  5ALM A;  4GC6 A;  3JPP A;  4X4N A;  2H3Z A;  4Y2Q A;  3T5K A;  2DWQ A;  2BDP A;  3PSI A;  3M8S A;  3R9K A;  3SYZ A;  2BZF A;  4OAG A;  2KKP A;  1SWW A;  5EOZ A;  1X9W A;  8ICR A;  4C4R A;  3E0F A;  4ZH4 A;  1S10 A;  2W9B B;  7ICS A;  1TE2 A;  7ICT A;  7ICO A;  3RRH A;  3PW2 A;  9ICL A;  4IRD A;  1KEJ A;  1T3N A;  2BPG A;  1QSS A;  4NY8 A;  5KT5 A;  4BDP A;  4M47 A;  4PH5 A;  2JV3 A;  2E1E A;  3LK9 A;  2EDU A;  3ZDE A;  4QWD A;  1B43 A;  4FHP A;  2RRD A;  5L1K A;  1TK0 A;  2DRA A;  1COK A;  4JK1 A;  3QEA Z;  1F0M A;  5CFU A;  3QUC A;  3RR7 A;  1SL0 A;  2KMD A;  2ZH1 A;  4RNN A;  3NUQ A;  2E8N A;  2ASD A;  3CRX A;  2EWR A;  4KN4 A;  2KFN A;  4EGW A;  5KFG A;  3PW0 A;  4RUC A;  2QKQ A;  2HDO A;  2P35 A;  3JPS A;  2KFZ A;  3WFP A;  3LVV A;  3WU2 U;  3WKC A;  5HHH A;  4KLS A;  4NWI A;  3GZF A;  4XQ7 A;  2W9A A;  4DO9 A;  5ALR A;  9ICU A;  4JB3 A;  1NK0 A;  3ZI4 A;  5J0U A;  2EQY A;  3GIL A;  2FE9 A;  4DL6 A;  2FPL A;  4K4H A;  4YVZ A;  4Z6D A;  3K75 D;  2LYB A;  4O69 A;  5KG5 A;  3MDA A;  2E8P A;  4ECT A;  1EXN A;  1URJ A;  3PSP A;  3BDP A;  3LWL A;  1RZT A;  2HBM A;  3RB6 A;  4X4R A;  1F5A A;  3Q8R B;  4TQS A;  1Z3E B;  2BGW A;  4NLZ A;  3KHG A;  9ICJ A;  1YZ7 A;  4MEX A;  4CDG A;  2ZUD A;  4PHD A;  3JZ0 A;  2ASL A;  1T7P A;  1COO A;  4DSI A;  4GXK A;  1ZQD A;  7ICQ A;  3F2D A;  3OTQ A;  4RPX A;  4O0I A;  2K4H A;  5DB6 A;  3QU4 A;  2NO4 A;  2Y0S C;  1DOQ A;  4XUS A;  4DLG A;  4JUZ A;  5AHX A;  1OU5 A;  5EWE A;  2XCP A;  4RQ7 A;  1S9F A;  5ALD A;  5CB1 A;  1WWV A;  3V6J A;  8ICV A;  2M2V A;  2VKQ A;  4QZG A; 
#chains in the Genus database with same CATH homology
 4ECZ A;  3RJF A;  4Z6C A;  1WCL A;  5DG7 A;  3AQN A;  5DG8 A;  3G6Y A;  4ED2 A;  4YXM A;  7ICE A;  2ZJ5 A;  2VAN A;  5J2C A;  4DL2 A;  4ATB A;  3RB3 A;  2XCA A;  5KT3 A;  4TQR A;  4IQU A;  4ECV A;  2ATL A;  3HX0 A;  1TK8 A;  4RPY A;  4FO6 A;  5F9N A;  1ZQC A;  1RXV A;  4WC5 A;  4EZ9 A;  1XWL A;  1ZQO A;  3C21 A;  2J6T A;  3MAB A;  2ASJ A;  5KG4 A;  4BXO B;  9ICH A;  4PGX A;  1DGS A;  1H38 A;  3M9M B;  3AUO A;  2KZM A;  1L3V A;  2DVI A;  4J9R A;  2XO7 A;  4ECS A;  5KFV A;  1TAU A;  1R8C A;  3AQL A;  4RWQ A;  1V4A A;  4DFM A;  4R66 A;  4DSL A;  8ICO A;  5J0X A;  4PHP A;  5BOL A;  2JEF A;  4B9T A;  2M2U A;  2C28 A;  4UB3 A;  5HRE A;  3JPT A;  3RTV A;  3UQ0 A;  3C18 A;  5L1J A;  4DFJ A;  8ICQ A;  5KFD A;  5KFK A;  4KLT A;  7ICL A;  2BQU A;  4KMU A;  1L3S A;  3WFO A;  4I2C A;  4M6W A;  4RQ0 A;  2FLP A;  5DQI A;  1ZQV A;  3HWT A;  3C2M A;  4M04 A;  2NRK A;  4DL4 A;  3PV8 A;  4FHY A;  4AT8 A;  4YR0 A;  4UB2 A;  3RJJ A;  4TUR A;  5KG1 A;  1BPD A;  4QZ9 A;  4F5P A;  4DSE A;  2UVV A;  4FBU A;  4LZG A;  5HRH A;  1KNY A;  1Q78 A;  2W8L A;  1KFS A;  3TFR A;  3OVS A;  3ETL A;  3PX0 A;  3OGU A;  7ICR A;  1HUO A;  4FBT A;  1U4B A;  4RWP A;  1ZQU A;  2F1J A;  3T5L A;  4PGQ A;  3M8R A;  1ZQG A;  2PXI A;  4F4X A;  4KLL A;  8ICE A;  2ZHB A;  2JEJ A;  4AT9 A;  2J6S A;  3TAQ A;  5L9X A;  3SI8 A;  3PY8 A;  5KG2 A;  2V4Q A;  4J9K A;  5KFO A;  2BQR A;  7ICN A;  2P66 A;  9ICI A;  4NM2 A;  5DGA A;  3V7J A;  1XSL A;  4WC1 A;  3GFK B;  9ICA A;  3RJE A;  2DR8 A;  3N97 B;  1QTM A;  2R8K A;  4ECQ A;  2GWS A;  4DWI A;  4RQ3 A;  1SL1 A;  1ZQN A;  4ATB B;  4UB1 A;  4R63 A;  1RYR A;  2J6U A;  2VA3 A;  5KFN A;  2BKE A;  1R8B A;  3QZ7 A;  1X9S A;  4KLJ A;  3B0Y A;  3SV3 A;  2KZ3 A;  1PZN A;  1NJZ A;  4IRK A;  4K4G A;  2AGP A;  4KLQ A;  1JAJ A;  1DK2 A;  4QW8 A;  4KLH A;  3HPO A;  3L9D A;  4RT3 A;  1NK8 A;  3GII A;  2R8H A;  2V9W A;  2B21 A;  4DL7 A;  5DB9 A;  3H37 A;  2AGQ A;  4QWE A;  1UT8 A;  4DQI A;  1NZP A;  2KTQ A;  3C23 A;  5F2V O;  4PHE A;  2W9C B;  4LT6 A;  1IXR A;  2MUT B;  5D49 A;  1XU4 A;  3HW8 A;  1BNO A;  4P4M A;  2F1I A;  1A77 A;  2BR0 A;  2DPJ A;  3ZDC A;  3PO5 A;  8ICN A;  4I2D A;  5J2J A;  8ICX A;  9ICQ A;  3RB4 A;  3MGI A;  1L3U A;  4I2A A;  1U49 A;  1XO1 A;  4C8K A;  4DSK A;  3TI0 A;  1ZQW A;  8ICA A;  2BHN A;  1MIV A;  3HJ4 A;  3H8W A;  2A1J A;  4FH5 A;  3G6X A;  3UXO A;  2W9B A;  1ZQT A;  5IIL A;  3RAX A;  1NJX A;  8ICW A;  8ICT A;  1UEU A;  4P2H A;  2C2R A;  4YFK A;  3V72 A;  2HHS A;  2XC9 A;  5DEC A;  3PW7 A;  1JIH A;  4YR3 A;  4JV1 A;  4E8F A;  5J0R A;  1NK7 A;  3C2L A;  2PFO A;  2PI4 A;  1U47 A;  1XC9 A;  1KLN A;  8ICZ A;  4DQS A;  4C8L A;  1S0V A;  3UQ2 A;  2BCQ A;  1ZQZ A;  3RJI A;  1L5U A;  3HP6 A;  5J2H A;  1FA0 A;  1ZQL A;  7ICH A;  5KFJ A;  1NJY A;  4MFC A;  2JZB A;  1Z00 B;  2BCU A;  4YMO A;  2XGP A;  4ECX A;  4JV2 A;  4RNO A;  2KP7 A;  4ED8 A;  3V6K A;  4F3O A;  3HT3 A;  1XSN A;  1ZQF A;  2FMQ A;  3PNC A;  2ISP A;  1RYS A;  4EYH B;  4DQP A;  4I2F A;  8ICH A;  5KT4 A;  2BE3 A;  4E7X A;  3T5H A;  4R64 A;  5KFF A;  3OJU A;  3KHL A;  3BJY A;  4WC7 A;  4QZH A;  5DB8 A;  5TZV A;  2AU0 A;  2FLL A;  3RJK A;  3H8S A;  2ZH7 A;  1SKS A;  1X9M A;  5HRI A;  4DEZ A;  4KLE A;  2O5A A;  2VA2 A;  2Y1J A;  2RDJ A;  9ICS A;  4M9J A;  2ZH5 A;  5KFA A;  3ZDA A;  3V7L A;  4ELU A;  1ZQX A;  4MEY A;  1D9D A;  2HHT A;  2UVR A;  5KT2 A;  2KZZ A;  4RNM A;  3MGH A;  4RQ2 A;  4ECY A;  3EZ5 A;  3SZ2 A;  1WOT A;  1QSL A;  3H38 A;  5DGB A;  1ZQB A;  5J0O A;  3PMN A;  2HVI A;  4ED0 A;  4QWC A;  4ECW A;  2BPF A;  4UD5 A;  3RJG A;  3RH5 A;  1BPX A;  4B9V A;  4IRC A;  4F5Q A;  4O3S A;  4QZE A;  3GIK A;  4BGD A;  4M9L A;  1PX5 A;  7ICI A;  3OVB A;  4F5N A;  4DFK A;  1RXW A;  5IIJ A;  3OJS A;  5IIM A;  4X4T A;  2DFL A;  3GV8 B;  2LYH A;  2ZJA A;  2R8I A;  3TFS A;  2M2W A;  4AT7 A;  3MR3 A;  4EZ6 A;  5KFL A;  4QZA A;  4C8O A;  1MIY A;  4RZR A;  5IIN A;  4XRH A;  3BQ0 A;  2IMW P;  4YD2 A;  5J2E A;  3PW4 A;  3OSN A;  5L1L A;  4O5C A;  4RQ5 A;  4KTQ A;  4NM1 A;  4AT9 B;  3EW9 A;  4I2I A;  3Q8K A;  4F93 B;  4QZD A;  9ICN A;  5KFT A;  1BVS A;  5J2B A;  3KHR A;  3G6V A;  3GQC A;  4FS1 A;  8ICP A;  5DED A;  4DS5 A;  5KFM A;  4I2E A;  4KIT B;  4BWM A;  4M5D A;  3KHH A;  4YG2 A;  2FMS A;  2ZH2 A;  4EBC A;  7ICP A;  3IHQ B;  2JEG A;  3WFS C;  9ICW A;  2PBE A;  5KT6 A;  3OUY B;  1SL2 A;  4WBZ A;  4UAY A;  1BGX T;  3WFQ E;  5HNK A;  4RQ8 A;  4ED1 A;  2ISO A;  4YQW A;  5DBC A;  4TUP A;  4NLN A;  2M2T A;  4DQR A;  3ISB A;  2VA8 A;  8ICM A;  3LDA A;  5HC9 A;  3OHA A;  2WTF A;  3AU6 A;  5KFI A;  3H7I A;  2JEI A;  3C66 A;  1VFG A;  1U48 A;  5C5J A;  3H40 A;  3RBD A;  4M9G A;  1NO5 A;  4DOB A;  4Q44 A;  3RR8 A;  1DK3 A;  3AU2 A;  5J29 A;  2Q0Z X;  4ED3 A;  4WC2 A;  2Y1I A;  5KG0 A;  5HR9 A;  4JWN A;  5KG7 A;  4FHX A;  4GLX A;  4Q43 A;  3M9O B;  4ECU A;  4GXJ A;  4CCH A;  4O5K A;  5KTQ A;  3AQM A;  1TFY A;  2ZH8 A;  3KTQ A;  3JPQ A;  3H3A A;  4MFF A;  3NTU A;  1KDH A;  4B9M A;  3OV7 A;  1WCN A;  1HJP A;  4J9S A;  5HRB A;  4KLF A;  4J9L A;  2XY6 A;  5CJ7 A;  1U9L A;  4ELV A;  4Z6F A;  4P4O A;  5J0P A;  4KLU A;  2NRX A;  5CA7 A;  3MBY A;  4DF4 A;  2IA6 A;  4DSF A;  4J9M A;  4NXZ A;  1NOM A;  5KFH A;  4G3I A;  4Q45 A;  3THV A;  3PW5 A;  1MQ3 A;  3T3F A;  2HHW A;  4O3Q A;  2PFQ A;  4X4O A;  9ICF A;  3UXP A;  1ZQM A;  7ICJ A;  9ICR A;  4J9N A;  5DLG A;  4E80 A;  2AQ4 A;  4M6W B;  2C2E A;  1ZQI A;  3JPN A;  1ZQK A;  1S0M A;  8ICS A;  5CHG A;  1ZQE A;  3PO4 A;  2W8K A;  4HYK A;  1ARO P;  2ZH6 A;  2IBK A;  4DOC A;  3NGD A;  5DLF A;  7ICG A;  1NK4 A;  4JV0 A;  1IM4 A;  5CWR A;  2DPI A;  4I29 A;  2FPK A;  3EPI A;  4XQ8 A;  2NRT A;  4EBK A;  5DBB A;  2ZH4 A;  2R8G A;  4RWO A;  9ICG A;  3JYY A;  1NK6 A;  4NLK A;  9ICC A;  1UA1 A;  2OWO A;  4UQG A;  2R8J A;  4IQT A;  3EYZ A;  1UT5 A;  5JUM A;  9ICE A;  5J2A A;  2I1Q A;  4JWM A;  4PHA A;  4DOA A;  5III A;  4P4P A;  3OHB A;  4ED6 A;  5HMM A;  4RQ4 A;  4YXJ A;  3M9N B;  2V4R A;  4DFP A;  4B9N A;  1BNP A;  5J2G A;  4Z6E A;  2RFF A;  3BQT A;  2P6R A;  1JXL A;  4MF2 A;  4O3N A;  4FS2 A;  8ICF A;  4I2J A;  4X4P A;  4QZF A;  3H4B A;  1KFT A;  4I28 A;  2BQ3 A;  3JPR A;  4MF8 A;  2HVH A;  9ICP A;  4F4K A;  4UAZ A;  1BPB A;  1SZP A;  2ZJ8 A;  5KG6 A;  9ICV A;  5HRL A;  4LZD A;  2XY7 A;  3ISC A;  1KRP A;  4O9M A;  1TVA A;  2ZUC A;  5EWF A;  4F8R A;  9ICM A;  2HHP A;  4X4V A;  5KFR A;  4C8N A;  4QZC A;  1ZET A;  4F2S A;  1MIW A;  3GIM A;  3TAP A;  1L3T A;  5DQH A;  3H39 A;  4BWJ A;  4M9H A;  2BCR A;  1T4G A;  3MFH A;  5J2D A;  4RQ1 A;  4EYI B;  2ALZ A;  1LB2 B;  1BPZ A;  3ZDD A;  1T8E A;  1D8L A;  4DSJ A;  3B0X A;  1ZQP A;  4X4S A;  5BOM A;  1ZJN A;  3MDC A;  4KN7 A;  5KFY A;  4EBE A;  9ICT A;  4WBY A;  2ZHA A;  3Q8P B;  1TK5 A;  3Q8Q B;  1QLN A;  1N48 A;  1ZQA A;  2MAX A;  3ZDB A;  4WCW A;  2MUT A;  5J0Q A;  3E2E A;  4R65 A;  5HRF A;  3NYB A;  1RPL A;  2NRZ A;  1NK5 A;  1N56 A;  1Q79 A;  9ICB A;  5J0S A;  1NJW A;  7ICU A;  5J0W A;  4QZB A;  2BCS A;  5HHI A;  1R8A A;  4EP7 A;  7ICF A;  4FHV A;  4PGY A;  1MC8 A;  3LWM A;  3AQK A;  4DF8 A;  1BPE A;  1MQ2 A;  1JX4 A;  5KT7 A;  3IM1 A;  4IQV A;  4O3R A;  5KFE A;  3C1Y A;  5D46 A;  4J9Q A;  2XY5 A;  3SV4 A;  4C8M A;  4ELT A;  8ICK A;  3C5G A;  3C1Z A;  2I9G A;  1ZYQ A;  5DDY A;  4AT8 B;  3RBE A;  2AGO A;  1JQR A;  4GC6 A;  3JPP A;  4TUS A;  4B9L A;  1SKW A;  3ZD8 A;  4F4Y A;  4X4N A;  4F2R A;  4IG8 A;  4J9O A;  1Z00 A;  2FLN A;  3T5K A;  2BDP A;  4UBC A;  8ICJ A;  5KFW A;  3PVX A;  4F4Z A;  4DL5 A;  4KLG A;  1K1S A;  8ICU A;  3M8S A;  3RAQ A;  4PPX A;  1YLQ A;  4YD1 A;  3SYZ A;  4GC7 A;  3PX4 A;  3OUY A;  1JN3 A;  4R8U B;  2H5X A;  2IHM A;  9ICK A;  1Y88 A;  1S77 D;  2ID1 A;  2DR9 A;  4WC4 A;  1JXE A;  4DLE A;  3WFR E;  1S0O A;  5EOZ A;  1X9W A;  1CUK A;  2HHV A;  5DDM A;  8ICR A;  2F1H A;  4FHW A;  4ZH4 A;  2A1J B;  1S10 A;  2W9B B;  4E0D A;  7ICS A;  3LQC B;  2BPC A;  2FMP A;  7ICT A;  1NKC A;  1V9P A;  9ICX A;  7ICO A;  3K4G A;  3GV7 B;  4NKT A;  4IR9 A;  4X0A A;  2C22 A;  3RRH A;  4RWN A;  3PW2 A;  9ICL A;  4O5E A;  4IRD A;  1KEJ A;  1S0N A;  3V7K A;  3QEB Z;  1T3N A;  2BPG A;  1QSS A;  4YCX A;  3ISD A;  4NY8 A;  3PR4 A;  5HRG A;  5KT5 A;  4YN4 A;  3MR6 A;  4BDP A;  4M47 A;  5KFP A;  2P6U A;  4EBD A;  2DR7 A;  5CR0 A;  4PH5 A;  2ZH9 A;  1A76 A;  3BQ1 A;  1HUZ A;  5IIK A;  3RH6 A;  4X4U A;  3LK9 A;  4UD4 A;  2Q66 A;  3ZDE A;  4QWD A;  1B43 A;  4FHP A;  1TFR A;  4F92 B;  4LVS A;  5L1K A;  1TK0 A;  2DRA A;  5DG9 A;  4UBB A;  3GDX A;  4JK1 A;  3QEA Z;  2C2D A;  3Q8S B;  1KSP A;  1U45 A;  2W9C A;  3RR7 A;  4NKU A;  3PR5 B;  1SL0 A;  2ZH3 A;  2ZH1 A;  3UPQ A;  4RNN A;  5CP2 A;  3OSP A;  2ASD A;  4I27 A;  1KTQ A;  4WC6 A;  4KN4 A;  3JPO A;  4J9P A;  2KFN A;  1NK9 A;  4KLM A;  3OVA A;  5KFG A;  1XS9 D;  3PW0 A;  3HIY A;  4RUC A;  3UPS A;  4RT2 A;  4UB4 A;  4ECR A;  4S3N A;  4R8U A;  3JPS A;  1XSP A;  4TUQ A;  1TFW A;  4O3P A;  2ZTD A;  1TV9 A;  2KFZ A;  4YR2 A;  2AJQ A;  4F4W A;  4MFA A;  5J2F A;  3WFP A;  2IHN A;  5DB7 A;  1JMS A;  2DRB A;  1S97 A;  3ORY A;  5DQG A;  5HHH A;  5DKW A;  5HP4 A;  5KFQ A;  4RUA A;  4YMN A;  4KLI A;  4KLS A;  1B22 A;  5DBA A;  3H4D A;  4XQ7 A;  5KFB A;  2JZB B;  4B9U A;  2W9A A;  1VJ7 A;  2RDI A;  3TAN A;  4DO9 A;  4QWB A;  3H8J A;  3GV5 B;  3C5F A;  8ICG A;  3MFI A;  3FYH A;  1C7Y A;  9ICU A;  4UB5 A;  1NK0 A;  5J0U A;  5F9L A;  5KFZ A;  4WC0 A;  3GIL A;  4DL6 A;  3ZD9 A;  2ZTE A;  1QSY A;  4BXO A;  2HHX A;  5J2I A;  2O1P A;  2FPL A;  1UA0 A;  4AT7 B;  4K4H A;  5J0Y A;  4WC3 A;  4YVZ A;  5L1I A;  1UET A;  4Z6D A;  3K75 D;  8ICB A;  4IR1 A;  4KLO A;  3V6H A;  5HML A;  1SKR A;  4EEY A;  4K4I A;  4ED7 A;  5HRK A;  5KG5 A;  4M0A A;  5D4B A;  3MR5 A;  4DS4 A;  3FDS A;  1ZQS A;  3MDA A;  2KN7 A;  4IQW A;  4X0B A;  2HW3 A;  4ECT A;  5J2K A;  3PX6 A;  3T5J A;  2W9M A;  2NRW A;  1EXN A;  2HHU A;  2FPM A;  2PI5 A;  4QZ8 A;  3BDP A;  4F50 A;  2DR5 A;  5KFC A;  3LWL A;  3QE9 Y;  1RZT A;  1NKE A;  3RB6 A;  3EPG A;  4X4R A;  1D9F A;  4FH3 A;  1F5A A;  3UXN A;  3EWA A;  3Q8R B;  3TQ1 A;  2NRV A;  1ZJM A;  4TQS A;  8ICC A;  3RRG A;  1ZQY A;  1Z3E B;  2BGW A;  5KFS A;  2AQ0 A;  4NLZ A;  3KHG A;  9ICJ A;  1UEV A;  5KFX A;  4DL3 A;  4PHD A;  2ZUD A;  3TAR A;  4MEX A;  2UVW A;  1TAQ A;  4KLD A;  4I2B A;  4M2Y A;  3JZ0 A;  2ASL A;  1X2I A;  1COO A;  1ZQR A;  1T7P A;  8ICY A;  3HJ1 A;  5J0T A;  1TKD A;  4DSI A;  8ICI A;  4GXK A;  1K1Q A;  4QWA A;  1ZQD A;  7ICQ A;  4F5O A;  3QZ8 A;  3N4M B;  5HRD A;  5BPC A;  2PFP A;  4UAW A;  2UVU A;  4F91 B;  1BPY A;  3RJH A;  4NLG A;  3MR2 A;  7ICK A;  9ICO A;  4RPX A;  7ICV A;  4O0I A;  3PML A;  4X5V A;  5KFU A;  3RB0 A;  3Q8M A;  1NKB A;  2ZUB A;  5DB6 A;  4YP3 A;  4M9N A;  1ZQH A;  5KG3 A;  1KFD A;  1DOQ A;  4XUS A;  4RQ6 A;  1MSW D;  4GXI A;  2ZTC A;  8ICL A;  4X4Q A;  4DLG A;  2PFN A;  4JUZ A;  4I2G A;  3RH4 A;  3GIJ A;  4F5R A;  5EWE A;  1ZQJ A;  4RPZ A;  1OU5 A;  2XCP A;  4DQQ A;  4YMM A;  4XA5 A;  4RQ7 A;  3C2K A;  4Q8E A;  7ICM A;  1ZQQ A;  1S9F A;  2HHQ A;  1LV5 A;  2M9N A;  1CEZ A;  5CB1 A;  4I2H A;  4RU9 A;  1S76 D;  3V6J A;  4B9S A;  8ICV A;  2BCV A;  3BQ2 A;  4Q8F A;  2XGQ A;  2M2V A;  5EWG A;  4QW9 A;  1R89 A;  4EBJ A;  3Q8L A;  4QZI A;  1D8Y A;  4O3O A;  4QZG A;  5IIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...