4UB2A

Dna polymerase beta product complex with a templating cytosine and 8-oxodgmp, 120 s
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
319
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 104
structure length 319
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub2A03
3HW8A 2XCPA 8ICCA 1F5AA 4DL5A 1ZQCA 3SV3A 2NRWA 2R8IA 1ZQTA 2Q66A 1KFDA 1NK0A 2ZH4A 2ASDA 1TFWA 1X2IA 3OHAA 3Q8SB 2A1JB 1K1QA 8ICAA 4P4MA 3Q8RB 2BCSA 1QSSA 4K4IA 5DBAA 4KLGA 3M9NB 2ZH7A 3SV4A 5KG1A 3RRHA 3B0XA 3MR2A 4X0AA 1TAUA 2VA2A 3PMLA 2RDJA 3OVSA 1L5UA 1BPBA 1NKBA 4DQIA 5J2GA 4GXIA 4YR2A 3H4DA 3ISCA 2BCUA 7ICGA 9ICSA 2XGPA 4LZDA 4QZHA 2ZH9A 4DSLA 2C22A 3C23A 5J2HA 2NRKA 4DLGA 1HUZA 4F5OA 4DLEA 3AQMA 4MFCA 8ICGA 4J9RA 4ED1A 3LQCB 5J2IA 9ICUA 1X9WA 1ZQFA 4XQ7A 2KZ3A 4ECTA 3THVA 2DR7A 5L1JA 4J9SA 4RU9A 2BCQA 4O3QA 1U49A 1KDHA 5DB8A 3TI0A 4F4WA 3PO4A 3ZDCA 1B43A 5DB9A 9ICXA 3GIMA 3G6VA 3UQ2A 4QZAA 3MGHA 4UB3A 4J9OA 1BPZA 1SZPA 1SKWA 1MQ3A 3BQTA 2HVIA 4O5EA 2M2WA 5HP4A 4C8NA 5KT6A 3GQCA 9ICMA 3UPQA 4PHEA 5KFVA 2W9CA 5KFBA 1ZQYA 4F5NA 2AGQA 1L3TA 3RJJA 4FHXA 3OHBA 3C2MA 5KFEA 7ICUA 4X0BA 4HYKA 4EYIB 5DGAA 3RB0A 3WFSC 3ZD9A 3HPOA 2PFQA 2DR8A 3EW9A 5DG7A 1ZETA 2P66A 4YMNA 4M5DA 2W9BB 5DQGA 5HHIA 2M9NA 4JK1A 4DQQA 2ZUCA 2A1JA 4LVSA 4FHWA 4B9LA 3UPSA 2FLPA 5KFTA 5DLGA 5KFNA 3LWLA 5KFAA 3GILA 3GV7B 3RH6A 5DQHA 4UB4A 4ECQA 4P4OA 1NJZA 8ICXA 2AJQA 1ZQOA 9ICBA 4DL2A 4YN4A 1WCNA 4YQWA 5EWEA 4DF4A 1D9FA 4F2SA 8ICHA 8ICOA 2ZUBA 4C8MA 5EOZA 3JPNA 2HHVA 1KNYA 2XCAA 3WFPA 1CEZA 2ZHBA 1KEJA 4YXJA 4UAWA 5J0WA 3PR4A 1KLNA 3C2LA 2UVRA 4Q8EA 4DSFA 3V7KA 4IG8A 2AGOA 5J0XA 8ICPA 4ECVA 3L9DA 4K4GA 7ICKA 3ISDA 1DGSA 4R8UB 5DB7A 5HRKA 4DFMA 4G3IA 4IQUA 5KFXA 2H5XA 3OJSA 1BPYA 1Q78A 2MUTB 3MDCA 4RQ7A 3JPOA 4E80A 7ICMA 4ECZA 4GLXA 1U45A 5HRLA 1ZQPA 3PX4A 3GIJA 1ZQBA 2BPGA 8ICRA 4O3NA 7ICPA 2GWSA 3H39A 5KG5A 9ICGA 5J0TA 2HW3A 4YR3A 5KFPA 4F8RA 7ICFA 4NLKA 1XS9D 4I2IA 5CP2A 2AQ0A 1MQ2A 1ZQZA 4RT2A 2HHXA 3PW2A 2KTQA 2BR0A 3IM1A 4EBCA 4PPXA 4QZGA 4EZ6A 2ZH8A 7ICRA 1DK3A 3PY8A 4PHAA 2PFOA 1C7YA 3V6KA 4FHYA 1AROP 4M2YA 7ICLA 4LT6A 5HREA 4ATBA 4I2DA 1QTMA 1NKEA 2R8GA 2PI5A 3PV8A 1QLNA 1U9LA 1MIYA 1U4BA 2BPCA 4KMUA 2JZBA 4ECSA 1UA1A 4DSKA 2PBEA 1VFGA 4RQ3A 4Q45A 4TURA 7ICJA 3H40A 1KTQA 2NRTA 1JIHA 4YVZA 4NM2A 1JN3A 4NY8A 2HVHA 4QZBA 5CR0A 1UEVA 3JYYA 2PFNA 3HP6A 3PR5B 3M8SA 3KHLA 4I2EA 4AT9B 4RQ8A 5KFCA 2PI4A 4RPYA 4YFKA 2ALZA 1JX4A 1S97A 3Q8LA 1ZQKA 1L3VA 4ELTA 5DEDA 4I2JA 5HRDA 7ICHA 3ISBA 4QZEA 4O3PA 9ICIA 4ECXA 2ISOA 5IIOA 4R66A 5KFSA 4FHPA 1T3NA 9ICPA 4X4VA 1JXLA 3JZ0A 3JPTA 3OVBA 4R8UA 4PGQA 3FDSA 1ZQIA 1FA0A 1ZQEA 1XU4A 5C5JA 3V6HA 1N48A 2MUTA 2BE3A 4DOAA 2FLNA 3RB4A 9ICNA 8ICNA 2ZTEA 4DQPA 4R63A 2BDPA 2PXIA 4RNOA 3PW0A 5CHGA 3ZDAA 4C8KA 3V7JA 4DFJA 4DSEA 1B22A 3H3AA 4EYHB 5CWRA 4M9JA 4M9GA 2F1HA 3V7LA 2P6UA 5HRHA 2BKEA 5J0QA 1ZQWA 4I29A 1BNOA 3G6YA 4ED8A 4MEXA 1N56A 1Z3EB 4WC7A 5DBCA 3MFIA 1JMSA 1ZQQA 1ZQHA 9ICJA 1WCLA 5J0RA 3RBDA 4MEYA 1NK8A 4B9UA 3RJIA 4KLOA 2ZH2A 4LZGA 4MF2A 4X4PA 4YR0A 4F3OA 4QZDA 3TAQA 4KLLA 3PMNA 5DDYA 4M0AA 3RJHA 5IILA 4F91B 4B9SA 4B9TA 8ICBA 4BXOB 2ZJ5A 2KZMA 4DOBA 2M2UA 3H8SA 4X4UA 2C28A 3H37A 4O3RA 3LK9A 3AUOA 4DL3A 4X5VA 2ZJAA 3ETLA 4Z6FA 5J2DA 5L1LA 4X4OA 3EZ5A 4AT9A 8ICKA 2JEIA 2BQ3A 4RQ2A 4J9PA 3MR5A 5KG2A 1R8BA 9ICLA 8ICQA 4B9NA 2ISPA 5DDMA 7ICNA 3NGDA 5KFHA 4F4ZA 4QWEA 4FH3A 2ATLA 3ZDEA 3OSNA 3PW5A 4KLFA 2I1QA 4IR1A 4EBEA 2HHUA 4RT3A 2ZTDA 3BQ2A 4GXJA 4RNMA 3RBEA 1TK8A 2XY6A 1T7PA 9ICOA 1ZQJA 4RWNA 1ZQGA 4O5CA 3RRGA 1KFTA 4KLJA 1R8CA 1L3SA 4QZ9A 4J9QA 4DL6A 2KN7A 5IIMA 1BNPA 4KTQA 1VJ7A 3RR7A 4FH5A 1S0MA 4I27A 8ICLA 5CJ7A 4DFPA 3HX0A 4DWIA 9ICTA 5KT7A 4ECRA 1UEUA 3MFHA 1XSNA 2O5AA 4RWOA 4ECYA 4YCXA 3HJ4A 1K1SA 2IBKA 5IIKA 4X4QA 5L1IA 1TFYA 2IA6A 1TV9A 2IMWP 2FMPA 4X4SA 4RNNA 3C2KA 4C8LA 2C2DA 5KFZA 2I9GA 3KTQA 4QZCA 3EWAA 4EP7A 4I2HA 1EXNA 5KFKA 5DGBA 5KG6A 5D46A 5KT5A 4YD2A 3PNCA 3ORYA 3EPGA 4RPXA 3V72A 4F5QA 1BPDA 4UB5A 3OVAA 4RQ4A 4ED0A 2AGPA 1ZQRA 4KLDA 4B9MA 3HIYA 2F1IA 4WC5A 3RB6A 4IRDA 4AT7B 4M47A 4O5KA 3C1ZA 3UXNA 5HMLA 2V4RA 3EPIA 3PVXA 1Q79A 2BHNA 1TAQA 5KFYA 3M9MB 1NK7A 4F4KA 2IHNA 3B0YA 5KFLA 4R64A 4IQVA 1NKCA 4RPZA 5CB1A 1RXWA 5J0YA 4WC3A 2LYHA 2VA3A 2ZH1A 4O3OA 4DS4A 4RWPA 1ZQXA 2HHPA 4ZH4A 4RQ1A 1ZYQA 4Q8FA 2VANA 4X4RA 5KFGA 3RJKA 5KT2A 4RUAA 3K75D 5KT4A 3C5FA 3QEAZ 4WBYA 3KHHA 1MIVA 1TK5A 8ICWA 3RJEA 5DBBA 4KN4A 4I2AA 1ZQVA 1SKRA 2W9AA 5HNKA 1XSLA 4DSJA 2W9BA 1R89A 4AT8B 2F1JA 2DR5A 2BQRA 3SYZA 1UT5A 3PW4A 5HRFA 4NKTA 5IIIA 2DRBA 1HJPA 3C66A 3RTVA 3PX0A 1DOQA 2PFPA 4XA5A 4KITB 4MFAA 1TKDA 2M2TA 5J2JA 4ED7A 4RQ5A 1T8EA 3RAXA 3QZ7A 5BPCA 9ICWA 2Q0ZX 4GC6A 4X4TA 4FS1A 4ED2A 4JV2A 3RH4A 4M9LA 5KFWA 8ICVA 1JAJA 5F9LA 2WTFA 4GC7A 4KLUA 5J2EA 5KG4A 3RAQA 3SI8A 4XUSA 3N4MB 8ICSA 3KHGA 1COOA 7ICOA 5J0OA 1U47A 2JEGA 3C21A 3WFQE 4NM1A 2KP7A 3GFKB 4PHPA 4ECUA 4JWMA 4TUSA 4X4NA 4WBZA 4FBTA 3OJUA 1XWLA 4Z6DA 4BDPA 2BQUA 2FPMA 5J2BA 4M9NA 4YMMA 2W8KA 1RYRA 3PW7A 4O9MA 1S0VA 1PZNA 3H8JA 3K4GA 3WFRE 1ZJMA 5KG3A 3EYZA 4UBBA 4P4PA 5IINA 1SKSA 1U48A 3RJFA 4CCHA 4TQSA 2J6SA 4E0DA 3TFRA 4M9HA 1NO5A 3HT3A 4EEYA 2DPJA 4B9VA 3T5HA 5HRGA 5TZVA 1NZPA 4QWCA 3T3FA 4DL4A 3TQ1A 4QWBA 4I2GA 5KFQA 2ZH6A 1LV5A 3ZDDA 1ZQNA 7ICTA 3T5KA 4FBUA 2DRAA 3TANA 5F2VO 4QZ8A 5KFDA 3H8WA 3WFOA 5KG0A 1BPEA 4O0IA 4DQRA 2Y1IA 1UETA 1UT8A 1ZQUA 3FYHA 4M6WB 3QE9Y 5CA7A 9ICVA 3RR8A 4I2BA 2J6UA 1JXEA 4UAZA 4FS2A 4WC1A 4EBKA 2V9WA 4EBJA 1D8YA 4KLMA 2KZZA 2XC9A 2UVUA 4KLSA 4S3NA 2UVWA 2R8JA 2DVIA 4F4YA 1MSWD 1A76A 2NRVA 5KFRA 4EBDA 4IRKA 1L3UA 2FMQA 4K4HA 1NOMA 8ICYA 4P2HA 4DOCA 2BCRA 4O3SA 9ICEA 2XO7A 3BQ1A 4IRCA 3OUYB 5EWFA 1NK9A 1V9PA 4NLNA 7ICSA 4RWQA 9ICQA 1SL2A 1NJXA 2FLLA 4I2CA 5KTQA 4RQ6A 3JPPA 5DB6A 2V4QA 2R8HA 1LB2B 8ICTA 1ZQMA 1V4AA 3JPQA 8ICIA 4QWAA 4RZRA 2XGQA 4KLQA 9ICRA 1Z00B 1YLQA 3OV7A 4YP3A 5EWGA 3RJGA 4NLZA 5J2FA 1KSPA 9ICHA 3AU2A 3ZD8A 4WC2A 5J2KA 4KLTA 1PX5A 5DG8A 5J0PA 3UXPA 7ICEA 2R8KA 3H38A 3C1YA 3Q8QB 4ED6A 3ZDBA 3QZ8A 2AQ4A 3GDXA 5HMMA 3BDPA 5KFOA 4F4XA 4DO9A 3TARA 1X9SA 5HRBA 2B21A 4F5RA 1TK0A 4UAYA 4EZ9A 3M9OB 4F2RA 4MFFA 2HHWA 5KFFA 2ZH3A 5KT3A 4UB2A 5DECA 1WOTA 2NRXA 3RH5A 2AU0A 4E7XA 4C8OA 8ICMA 4DL7A 2ASJA 4JUZA 3IHQB 4YMOA 4F50A 4XRHA 2XY7A 4UBCA 1QSLA 3V6JA 2W9MA 4IR9A 1S76D 5KFJA 1D9DA 3C5GA 1BGXT 4M6WA 5KFUA 1NJWA 3SZ2A 4DQSA 4QZIA 4RUCA 1RXVA 4WC6A 8ICEA 1S9FA 2BPFA 1SL0A 5J0SA 4KLHA 3Q8PB 4ATBB 4IQTA 4TUQA 4BXOA 3LDAA 3M8RA 4F92B 1D8LA 5D49A 4QZFA 1XC9A 4F5PA 2ASLA 2JZBB 1BVSA 1JQRA 5KFMA 2O1PA 4DS5A 4KLIA 4WC0A 3OUYA 4ED3A 3Q8KA 2FPKA 1ZQLA 2OWOA 4NLGA 9ICCA 1OU5A 2ID1A 4JV1A 4E8FA 2DR9A 4J9NA 1S0OA 2VA8A 1S77D 3H4BA 5F9NA 3QEBZ 5KFIA 3JPSA 3GIIA 1H38A 4QWDA 2C2RA 2BCVA 5HC9A 4TUPA 1CUKA 1DK2A 1Z00A 4J9MA 2M2VA 8ICUA 1IM4A 5BOLA 3OSPA 3AU6A 1ZQAA 1A77A 5HRIA 1S0NA 5JUMA 2J6TA 3MABA 2Y1JA 4PH5A 1ZJNA 1R8AA 3RB3A 2HHQA 2DPIA 3N97B 2XY5A 3TAPA 2ZH5A 4YD1A 1S10A 2IHMA 4BGDA 3Q8MA 1RYSA 3AQLA 4I2FA 4XQ8A 1NK4A 4DF8A 3JPRA 4QW8A 3AQKA 3UQ0A 8ICJA 1T4GA 4MF8A 3GIKA 3LWMA 2ZUDA 3TFSA 1X9MA 4DFKA 1QSYA 4RQ0A 1KRPA 2HHTA 3HJ1A 4FHVA 1ZQDA 2RFFA 5D4BA 4BWJA 1XSPA 1NJYA 3E2EA 2KFZA 4NKUA 3BQ0A 4ECWA 1ZQSA 2UVVA 4WC4A 4FO6A 4Q44A 1HUOA 4DEZA 4Q43A 4QW9A 9ICKA 1BPXA 3PX6A 2JEFA 4JWNA 3NTUA 2RDIA 4PHDA 3GV8B 5L1KA 4I28A 5DQIA 2DFLA 3MBYA 5HHHA 5J2CA 4YG2A 3GV5B 4IQWA 2ZJ8A 4PGYA 4J9LA 4UQGA 4AT7A 1NK6A 4BWMA 3MDAA 7ICIA 4Z6CA 4ELUA 1RPLA 4UB1A 1TVAA 1UA0A 2JEJA 4R65A 5DKWA 4JV0A 1NK5A 4GXKA 1MC8A 3BJYA 3KHRA 1TFRA 4PGXA 2BGWA 2P6RA 4DSIA 3H7IA 8ICFA 3C18A 2FPLA 3HWTA 3T5LA 1IXRA 3T5JA 3AQNA 1SL1A 1KFSA 1MIWA 4Z6EA 5DG9A 5BOMA 5L9XA 4F93B 3NYBA 3UXOA 2KFNA 4NXZA 2W8LA 4UD5A 3PO5A 4TQRA 3MR3A 4YXMA 7ICVA 1XO1A 3MR6A 5HR9A 2NRZA 4ELVA 2HHSA 2C2EA 3G6XA 7ICQA 1Y88A 4M04A 1RZTA 5KG7A 5IIJA 3MGIA 2W9CB 8ICZA 4WCWA 2ZHAA 4UD4A 5DLFA 5J29A 9ICAA 5J2AA 2FMSA 4KLEA 5J0UA 2ZTCA 4J9KA 4KN7A 3OGUA 4AT8A 2MAXA 9ICFA
chains in the Genus database with same CATH superfamily
8ICCA 3I1YA 1ZRMA 1ZQTA 1NK0A 1TFWA 2A1JB 1K1QA 8ICAA 2BZFA 2ZH7A 2A3VA 4JB3A 3SV4A 3RRHA 3B0XA 4X0AA 2WF6A 5AKIA 2JRZA 1BPBA 4DQIA 4GXIA 3ISCA 9ICSA 3NASA 1IIPA 2C22A 5J2HA 2NRKA 1HUZA 4DLEA 4MFCA 2ESEA 1Z1BA 1X9WA 4J03A 2DR7A 4J9SA 4GFJA 2B4VA 3PO4A 3ZDCA 4P0PB 1N5XA 5CEHA 3MGHA 3NUQA 1SKWA 1BPZA 5A0LA 1OUQA 2RQ5A 3GQCA 3UPQA 4F5NA 4OJPA 3C2MA 7ICUA 4HYKA 3RB0A 3ZD9A 4O6AA 3EW9A 1ZETA 4CDGA 3BZKA 2D8CA 1FO4A 2A1JA 4FHWA 4B9LA 3UPSA 2FLPA 3WKAA 2KMDA 3RH6A 5DQHA 4P4OA 5KL1B 1ZQOA 3MCRA 1D9FA 8ICHA 1QCKA 2ZUBA 1TE2A 3E58A 5EOZA 2ZHBA 1TAMA 2XCAA 1CEZA 3GZFA 5J0WA 3C2LA 4DSFA 4IG8A 4Y2VA 2FI1A 4R8UB 5ALPA 2GAFD 2YMPA 5AKHA 3MDCA 3JPOA 2IOFA 7ICMA 1GPJA 3PX4A 1ZQBA 5AKGA 4O3NA 7ICPA 3H39A 5J0TA 2HW3A 5KFPA 2GLEA 5CP2A 1Q3VA 2HHXA 4O69A 2BR0A 2ZH8A 4QZGA 3V6KA 7ICLA 1N63A 5HREA 1U4BA 2BPCA 2PBEA 4RQ3A 2Z7JA 3IDWA 4TURA 7ICJA 1KTQA 4KM5A 1WWVA 2H3IA 3JYYA 2PFNA 3HP6A 4AT9B 4I0UA 1ZQKA 2ALZA 5ALZA 1VDVA 4F71A 7ICHA 4O3PA 1PVQA 1JXLA 3HRDD 3OVBA 4R8UA 4PGQA 2G08A 1O08A 4F72A 5CFSA 1J97A 5JU5A 4U6PA 1UPHA 2BE3A 2VJ4A 3PSTA 2ZIUA 4QNLA 9ICNA 4RNOA 3PW0A 3PSIA 3V7JA 4DFJA 2G0AA 5HRHA 3WK9A 4M9GA 4Y2XA 1ZQWA 3WKEA 4ED8A 4MEXA 5DBCA 5B5EU 1ZQHA 1WCLA 3RBDA 1NK8A 3RJIA 4MF2A 3C29A 3H0RB 4YR0A 3PMNA 8ICBA 2KZMA 2ZJ5A 2MU2A 2M0NA 2C28A 5ALUA 4O3RA 4KMOB 5L1LA 3EZ5A 4AT9A 2E1FA 2LKYA 4PL2A 9ICLA 3F5AA 3FC4A 5KAFU 5DDMA 3IG8A 4QWEA 3OSNA 2WF8A 2I1QA 4IR1A 4EBEA 2HHUA 1TK8A 4FFDA 3BQ2A 4RWNA 9ICOA 2ZIWB 4K8VA 1KFTA 4PZOA 2KN7A 5IIMA 1KL9A 1BNPA 1DGJA 3QU7A 1KQQA 8ICLA 1UEUA 4ECRA 3MFHA 4YCXA 2G09A 2HBLA 3AQFA 4X4QA 1TV9A 1N60A 3C2KA 5KFZA 3KTQA 3EWAA 1EXNA 5KG6A 3PNCA 4KLDA 3KZIU 4B9MA 4AT7B 4NJ8A 4Y2UA 1UCVA 3EPIA 3QUCA 2BHNA 2IHNA 2G5HB 1ZRNA 4Y2RA 5ALHA 1A6SA 2LYHA 1ZOLA 1N61A 3D2QA 3K7DA 5DBBA 4Y2QA 3QXGA 5ALQA 4I2AA 4FO1A 1XSLA 3N28A 1OXJA 5J8YC 1N5WA 2DR5A 2F1JA 4NXUA 2B56A 4NV0A 1UT5A 1HJPA 3PX0A 5ALEA 2W03A 2PFPA 2G07A 1TKDA 2Q0ZX 3PZPA 4PJ0U 1HIWA 2L5YA 2LHTA 5J2EA 5AKZA 3D2NA 1SXDA 2EAMA 3WFQE 5J0OA 3C21A 2KP7A 1MA7A 4PHPA 4ECUA 3OJUA 5J2BA 1SB3C 4YMMA 1PZNA 3FAHA 3K4GA 5F3XB 4CCHA 2AXTU 2J6SA 3TFRA 4M9HA 1NO5A 4B9VA 3T5HA 5HRGA 3I76A 5AI4A 5K4LA 3ZDDA 7ICTA 4FBUA 4IL6U 4QZ8A 3H8WA 3WFOA 4FZMA 4DQRA 4M6WB 3SMVA 5CA7A 4FS2A 4EBKA 4S3NA 1F0MA 4KLSA 2DVIA 1SZHA 2E8MA 2NRVA 5KFRA 1L3UA 4DOCA 4O3SA 9ICEA 4JLXA 2FLLA 1Z1VA 4I2CA 2R8HA 1ZQMA 2IUBA 2XIDA 8ICIA 4QWAA 4RZRA 3WU2U 4PZNA 2EAPA 3RJGA 3QUBA 5J2FA 9ICHA 2H3QA 4KLTA 4US8A 3H38A 7ICEA 2R8KA 3KKAC 3PSPA 2H3ZA 3ZDBA 1L7MA 3BDPA 3TARA 1X9SA 5HRBA 4C4SA 4MFFA 4EZ9A 4F2RA 1WOTA 1F44A 3RH5A 2AU0A 4K9AA 4C8OA 1L7NA 4K9BA 3V6JA 2W9MA 1XO0A 3C5GA 1BGXT 4M6WA 4XJEA 4DQSA 2HOIA 4RUCA 1RXVA 8ICEA 1SL0A 5J0SA 4BXOA 2HI0A 4ZOHC 1D8LA 2EZXA 5GTHU 2JZBB 5KFMA 4ED3A 9ICCA 2ZIXB 4PL1A 4QJFB 2VA8A 1S77D 3QEBZ 3JPSA 1H38A 5HC9A 2C2RA 3ER8C 4TUPA 1DK2A 4J9MA 5B3PA 8ICUA 1IM4A 5BOLA 5HRIA 2LI6A 3SR6A 3PHZA 4PH5A 1ZJNA 1C20A 3RB3A 2HHQA 3N97B 1NI3A 2JXJA 3TAPA 2ZH5A 2EDUA 2F44A 3Q8MA 1RYSA 3AQLA 4WOYA 3WK4A 1QSYA 5J8YA 3QX7A 5AKLA 1UHUA 3D6JA 4DFKA 3HJ1A 1RDFA 4Y2PA 1KRPA 2RFFA 1XSPA 2LMRA 5AM5A 4NKUA 4ICAA 4ECWA 4DFDA 3F53A 1HUOA 4Q43A 3PX6A 3NTUA 4PHDA 5L1KA 4I28A 3MBYA 5J2CA 3KZXA 4IQWA 2KE7A 1DRGA 7ICIA 4UB1A 2JEJA 4R65A 1MC8A 3KHRA 4PGXA 2FPLA 2ZG6A 3AQNA 3ETRA 2W8LA 2NRZA 2HHSA 2HOQA 5IIJA 3MGIA 4CRXA 4WCWA 1NKCA 3F2DA 2B6GA 4UASA 1Q3UA 1ZQCA 1Z4NA 3NVOA 1KFDA 2ASDA 1X2IA 3OHAA 3Q8SB 5AKEA 5KL8B 1PUZA 3N7PD 5AHXA 1KW4A 4C0ZA 5J2GA 4LZDA 4DSLA 4HX0A 1QQ5A 4C4RA 3LQCB 2EAOA 1D8BA 4ECTA 2G06A 2KKPA 4RU9A 2BCQA 4O3QA 1KDHA 5DB8A 3H8MA 3GIMA 3UQ2A 3N7RC 1SZPA 5B66U 2KIVA 4C4TA 4O5EA 2M2WA 3E0FA 2LM1A 3TADC 3ONNA 5KFBA 1ZQYA 1L3TA 4FHXA 3OHBA 4X0BA 2LBOA 4WQKA 2GOLA 4YMNA 5HHIA 2M9NA 4DQQA 2ZUCA 4Y2JA 5KFTA 3GILA 4UB4A 2N1RA 4C80A 2QB0B 9ICBA 4YQWA 2FE9A 5EWEA 5HR7A 8ICOA 4C8MA 1OW5A 2ZIVA 4YXJA 4UAWA 4OD0A 3PR4A 2UVRA 3V7KA 3L9DA 8ICPA 3OWGA 4DFMA 3OJSA 1Q78A 2MUTB 3AQEA 4ECZA 4GLXA 1KKXA 1ZQPA 2BPGA 9ICGA 4Y2SA 5AK6A 7ICFA 2AQ0A 3CNHA 4QIWF 2G5IB 2KTQA 3IM1A 4EBCA 4PHAA 4LT6A 1C7YA 1AROP 1QTMA 1MIYA 3PV8A 3AL0B 4KMUA 4DSKA 4Q45A 2NRTA 4YVZA 1JIHA 4NY8A 2HVHA 2W3RA 4QZBA 4JMUA 3KHLA 4RQ8A 1JX4A 4YFKA 3VC8A 1S97A 5DEDA 4I2JA 3ISBA 5CFTA 2ISOA 4FHPA 4GIBA 1KBUA 2B51A 3FDSA 3N7SC 2MUTA 5AM4A 2FLNA 2ZTEA 4R63A 2K89A 4UAVA 2PXIA 4LJXA 5ALGA 4C8KA 3BS5A 3H3AA 3HKZF 3IG5A 3FM9A 4EYHB 4M9JA 2P6UA 2I5HA 1BNOA 4WC7A 1JMSA 1ZQQA 2FCLA 9ICJA 4B9UA 2ZH2A 4WQLA 4X4PA 4F3OA 4QZDA 4M0AA 4F91B 4B9SA 2JMGA 2Q4TA 4DOBA 4CNQA 2M2UA 4NXVA 4X4UA 3H37A 4DL3A 3ETLA 5J2DA 1ZD2P 4X4OA 4A8EA 4RQ2A 3SAFA 1Z4OA 3MR5A 3NKUA 8ICQA 4CF4A 2ISPA 7ICNA 3NGDA 5KFHA 1PVRA 3TADA 2JHDA 2F77X 4GXJA 2ZTDA 1T7PA 4NXWA 5AM3A 2XY6A 4FE3A 1ZQJA 1ZQGA 3RRGA 4OJ5A 4KLJA 3CRXA 3D2SA 2KG5A 4KTQA 1VJ7A 2P35A 5CJ7A 9ICTA 3HX0A 2O5AA 4LEVA 2IBKA 2IMWP 2FMPA 4RNNA 2KSOB 4C8LA 2C2DA 2I9GA 4QZCA 4I2HA 5KFKA 2MRLA 1WUDA 4YD2A 3EPGA 4RPXA 2AGPA 4ED0A 3UMCA 3HIYA 5AIAA 4OJLA 3RB6A 4O5KA 1MN8A 3C1ZA 3PVXA 5ALNA 1SXEA 3SAHA 4P0PA 2IOHA 4R64A 2OXOA 2KNJA 5CB1A 1F5SA 5J0YA 2VA3A 2ZH1A 4DS4A 2HHPA 4X4RA 4Q8FA 5KT2A 4RUAA 2JV3A 4QIWC 3QEAZ 4WBYA 2PMZF 3KHHA 5ALFA 1MIVA 8ICWA 4LEYA 5AI6A 2KVCA 1ZQVA 1SKRA 3IV6A 5G5GA 2JGAA 2K4EA 2AH5A 2D6FC 3SYZA 4NKTA 3QU2A 2A1AA 5IIIA 1X66A 4KITB 4MFAA 1ZD4A 4ED7A 2Y0SF 5ALOA 1T8EA 5BPCA 4GC6A 4JV2A 3RH4A 4M9LA 8ICVA 3NRWA 4NL9A 1COOA 2JEGA 4ACOA 4FBTA 4BDPA 2BQUA 1O03A 1S0VA 5AM0A 1ZJMA 5KG3A 4M47A 4E0DA 3HT3A 2DPJA 1QQ7A 4AYBF 3HKZC 5TZVA 3T3FA 5KFQA 2CRXA 2ZH6A 1LV5A 3T5KA 2DRAA 3TANA 3IP4B 5KG0A 1ZQUA 3FYHA 2HDOA 3RR8A 5EE3A 2J6UA 4UAZA 1SWWA 2V9WA 4KLMA 5T14A 2UVWA 4F4YA 4EBDA 2FMQA 8ICYA 2XO7A 3OUYB 1V9PA 4RWQA 1SL2A 4UARA 2YB1A 5KTQA 4RQ6A 5ALJA 4KLQA 9ICRA 3LYSA 2JH1A 4NLZA 4WC2A 5J2KA 3HJEA 1PX5A 5J0PA 3MGVA 3UXPA 3NVYA 3C1YA 3Q8QB 4ED6A 4OJOA 3QZ8A 4DO9A 5AKKA 2E8PA 1LKYB 2B21A 4F5RA 4UAYA 1TK0A 2K8CB 8ICTA 5KFFA 5DECA 5FP0A 4CF3A 4JUZA 2NO5A 4OCZA 1S76D 4KB6A 1NJWA 3CYMA 3BS7A 1S9FA 3NS1A 3H0MB 5ALXA 3Q8PB 4ATBB 4IQTA 3M8RA 1XC9A 4O67A 2ASLA 1ZXIA 3DV9A 1JQRA 2O1PA 4WC0A 3OUYA 3Q8KA 4E8FA 2EWRA 1AQ6A 2FJ6A 4JV1A 2KOBA 5CRXA 5F9NA 3GIIA 4CGZA 2LM4A 2BCVA 1UQVA 2QLTA 2M2VA 3OSPA 3AU6A 2J6TA 2PMZC 2JR5A 1R8AA 2DPIA 2XY5A 2ZIWA 4WH5A 4DF8A 3LWMA 3TFSA 1T3QA 2KICA 3LVVA 4G9BA 2HHTA 2A19A 4BWJA 4HAIA 3L3FX 1ZQSA 4WC4A 4FO6A 2Y0SC 4QW9A 3WKDA 5ALTA 1BPXA 1V38A 2JEFA 3J81j 4JWNA 4YG2A 2BBHA 1L6NA 5TISU 4PGYA 2WF5A 4AT7A 3UM9A 4BWMA 4Z6CA 4ELUA 4CE6A 1TVAA 5DKWA 4JV0A 2P6RA 2AHOB 3NVWA 3BJYA 1TFRA 3WK7A 3HWTA 4K98A 3T5LA 1SL1A 1KFSA 5BOMA 4AYBC 3QYPA 4YXMA 2HBKA 2C2EA 5KG7A 2IHOA 2W04A 4UD4A 9ICAA 5J2AA 1PVPA 4QZHA 4KN7A 2E5SA 1F5AA 1RQLA 2DKXA 3SV3A 4DL5A 3ERCC 2R8IA 2Q66A 2R18A 4P4MA 3Q8RB 2BCSA 4K4IA 4KLGA 5DBAA 2WB1F 4UW9A 2QARB 3PMLA 3OVSA 1FIQA 3WK8A 7ICGA 2BCUA 3C23A 2OH2A 4KX3A 4DLGA 4F5OA 3AQMA 8ICGA 1L7OA 2DKZA 4ED1A 2K8AA 5AICA 1KN5A 1T94A 4XQ7A 3I28A 2KZ3A 3KOOA 1U49A 4EGWA 3TI0A 4F4WA 1B43A 5DB9A 3G6VA 2OYYA 4QZAA 4UB3A 1X42A 3BQTA 3R9KA 2HVIA 4IS7A 4C7YA 5KT6A 3M6ZA 3ICXA 4PHEA 5KFVA 2LYAA 3RJJA 5KFEA 5DGAA 2PFQA 2DR8A 5E79U 1JRPA 4M5DA 2W9BB 5DQGA 3KBBA 5DLGA 3GV7B 5KFAA 4DL2A 4F2SA 1L7PA 3JPNA 1KNYA 2HHVA 3WFPA 4Q8EA 2AGOA 2OCEA 2XVTA 4K4GA 3ISDA 3NWIA 4G3IA 2H5XA 4RQ7A 1WYGA 4E80A 1U45A 5HRLA 2I6XA 3GIJA 4UATA 5KG5A 4YR3A 4F8RA 4NLKA 5AI8A 1COKA 5ALLA 5ALDA 1ZQZA 4RQNA 4RT2A 1SV4A 4P0QB 4PPXA 4EZ6A 1DK3A 2PFOA 4I2DA 2PI5A 1U9LA 2JZBA 4ECSA 1VFGA 1JI7A 3H40A 2WF9A 2ZIXA 4NM2A 1Q46A 5AM2A 1ECWA 5CR0A 1UEVA 3F5EA 3PR5B 5KFCA 2PI4A 4RPYA 3Q8LA 3DDHA 1L3VA 4QZEA 9ICIA 5AK3A 3LVWA 5IIOA 1T3NA 4X4VA 3QNMA 3JZ0A 4Y2YA 1ZQEA 5C5JA 1N48A 4DOAA 3RB4A 4DQPA 5CHGA 3ZDAA 2K60A 4K99A 4NXXA 4DSEA 2WB1C 5CWRA 3V7LA 3AEVA 5ALKA 4EEBA 4UB8U 3G6YA 1Z3EB 2E8OA 3MFIA 3ALRA 4MEYA 2NYVA 4LZGA 1RG6A 3TAQA 1X6JA 4OAGA 3C28A 2E1EA 4B9TA 3KKAA 3QU9A 4OAFA 4X5VA 3AN1A 3M1YA 8ICKA 2JEIA 2BQ3A 5JTGA 2KHVA 2B0CA 4B9NA 3S6JA 2ATLA 2DGZA 5AI5A 4RNMA 3RBEA 4O5CA 1QH9A 1L3SA 4QZ9A 2HBMA 4J9QA 4DL6A 3RR7A 4FH5A 1VJ5A 2D3DA 2EANA 3RF9A 4I27A 4DFPA 4DWIA 5KT7A 3M7DA 3TACB 1K1SA 1TFYA 2HCFA 3AM9A 2DUYA 3RFAA 4EP7A 5D46A 5B3QA 2KV2A 3ORYA 2E8NA 3OVAA 2YY6A 4WC5A 3SEIA 4IRDA 2K8BB 3UXNA 5HMLA 2V4RA 1Q79A 1TAQA 4F4KA 1FEZA 4WC3A 2DWQA 4RWPA 1ZQXA 5KFGA 3K75D 3C5FA 1TK5A 3CK6A 4BX9C 5AKXA 4EELA 4KN4A 4AT8B 4DSJA 5HNKA 1WG8A 2BQRA 4BJQA 3PW4A 2DRBA 5HRFA 3RTVA 2QB0A 1M6YA 1QQ6A 4RQ5A 9ICWA 3QZ7A 4FS1A 2K4PA 4ED2A 1JAJA 4GC7A 1SIJA 3RAQA 5ALMA 8ICSA 3GU3A 1U47A 5AIBA 3GFKB 4TUSA 4IC9A 4WBZA 1XWLA 2FPMA 2W8KA 1RYRA 3PW7A 2ZXIA 3WFRE 4P4PA 5IINA 4JLZA 1U48A 3RJFA 3MC1A 1NZPA 4QWCA 4DL4A 3TQ1A 1L8LA 4QWBA 4K97A 2DF4B 1BPEA 2KKVA 1UETA 3WK6A 3QE9Y 9ICVA 4I2BA 4WC1A 2KZZA 2UVUA 2R8JA 1MSWD 3ZI4A 2VIXA 2QKQA 4K4HA 1NOMA 3CP8A 4IRCA 4NLNA 9ICQA 1NJXA 1HEKA 3JPPA 2V4QA 5DB6A 2GH1A 2YX8A 1LB2B 2YMQA 2XGQA 1YLQA 3OV7A 4YP3A 3IRUA 1KSPA 3AU2A 3ZD8A 3AMZA 3QUQA 1PK1B 1RYUA 5AM1A 2AQ4A 3GDXA 5KFOA 4F4XA 2HHWA 2BDUA 2ZH3A 5KT3A 4UB2A 2KJ8A 2NRXA 4E7XA 8ICMA 4US9A 3DEEA 3IHQB 4YMOA 4F50A 2XY7A 1QSLA 5ALRA 4UBCA 4IR9A 4EV6A 4DCCA 2MA1A 5KFJA 1D9DA 5CHEA 3UMBA 5KFUA 3SZ2A 2BPFA 4EEDA 1NNLA 3HILA 4KLHA 4TUQA 3LDAA 5D49A 4F5PA 1SV0C 1BVSA 5HR6A 1ZQLA 2OWOA 4EX7A 2DR9A 3SAGA 1S0OA 2HN1A 3H4BA 2F76X 5KFIA 4NXTA 1ZQ1C 4QWDA 1CUKA 3O0FA 4MKPA 1A77A 1S0NA 3WK5A 3MABA 2Y1JA 3OPXA 2NO4A 1PK1A 5KAIU 2VKQA 2ZH9A 1S10A 4BGDA 3BQ7A 1T4GA 1CI4A 3GIKA 1X9MA 3F2BA 2KIWA 2KHQA 2YMMA 2ZIUB 1ZQDA 4WJ3B 1NJYA 2XI9A 2E3TA 2KFZA 3BQ0A 4RQMA 4Q44A 2EQYA 2KSOA 2RDIA 3GV8B 2DFLA 5HHHA 4O3MA 5AI9A 2LYBA 2ZJ8A 1NK6A 1XNSA 1UA0A 1JALA 4GXKA 1S5LU 3NVZA 2BGWA 4DSIA 3H7IA 1IXRA 3UMGA 5L9XA 4F93B 5D62A 3QU4A 5G5HA 2KFNA 7ICVA 1XO1A 4ELVA 3G6XA 7ICQA 1JROA 4M04A 1RZTA 5D61A 2PKEA 2W9CB 8ICZA 2ZHAA 5DLFA 5J29A 5J0UA 2WAQF 3BQ1A 3OGUA 9ICFA 3HW8A 2XCPA 2NRWA 2ZH4A 3OTQA 1QSSA 3M9NB 5KG1A 3MR2A 2F2AB 1TAUA 3EF2A 4AP9A 2VA2A 2RDJA 2FDRA 1L5UA 1NKBA 1YT3A 4YR2A 3H4DA 2XGPA 5AK4A 1GO3F 3L4PA 4J9RA 3L5KA 5J2IA 9ICUA 2O6KA 1ZQFA 4C7ZA 3THVA 5L1JA 2YN4A 9ICXA 4J9OA 1MQ3A 1A0PA 5HP4A 2CPRA 4C8NA 1J2NA 9ICMA 2W9CA 2AGQA 2VJ5A 4EYIB 3WFSC 3HPOA 2EZZA 5DG7A 2P66A 1X40A 5ALVA 5JRTA 4JK1A 1FFVA 1SV0A 4LVSA 5EE9A 5KFNA 2H3FA 3LWLA 8ICXA 4ECQA 1NJZA 5H2FU 2AJQA 4LEZA 2W7OA 4YN4A 1B0XA 1WCNA 5JTIA 3WKBA 4DF4A 1B4FA 1KEJA 2H3VA 1KLNA 1JUDA 5J0XA 4ECVA 1DGSA 5DB7A 1LKYA 5HRKA 4IQUA 5KFXA 1BPYA 2RHFA 8ICRA 1N62A 1WWUA 2GWSA 4EEKA 1XS9D 4I2IA 1MQ2A 4NLCA 3PW2A 2W43A 7ICRA 3PY8A 4OJ6A 4FHYA 4ATBA 3KD3A 3TKAA 4M2YA 1NKEA 2R8GA 1QLNA 2GA9D 1UA1A 1JN3A 3M6KA 2YTUA 4Y2TA 2HMXA 3M8SA 4I2EA 2HSZA 4ELTA 2W3SA 5HRDA 2OEHA 3H0LB 1NZBA 2KJ9A 2OM6A 3U26A 4CF5A 4ECXA 4R66A 5KFSA 1YZ7A 9ICPA 3JPTA 2WAQC 4LEWA 1RQNA 2NV3A 1ZQIA 1FA0A 1XU4A 3V6HA 3WKCA 8ICNA 2BDPA 4EX6A 4OAIZ 1B22A 2XICA 2F1HA 3QUTA 2BKEA 5J0QA 4I29A 3SENA 1Q8KA 1N56A 5J0RA 4KLOA 1ZD3A 2YQEA 5DDYA 3RJHA 5IILA 4BXOB 2K4HA 3H8SA 5ALYA 1LVHA 1YZ6A 3KFUF 5AK5A 3LK9A 2DBYA 3AUOA 2DL0A 2ZJAA 4Z6FA 4J9PA 5KG2A 1R8BA 3K1RB 3K1ZA 4F4ZA 4FH3A 4KLFA 3ZDEA 3PW5A 5L1MA 4RT3A 2ODGA 2W7PA 1R8CA 2CN1A 2KJ5A 2W11A 1S0MA 4RWOA 3JCFA 1XSNA 4ECYA 3A0HU 3HJ4A 2QARA 5IIKA 5L1IA 2IA6A 4X4SA 2Y9UA 2HN2A 5ALSA 5DGBA 5KT5A 3PSFA 3V72A 4F5QA 1BPDA 4UB5A 2W55A 4RQ4A 1ZQRA 3B9JA 1ZD5A 2F1IA 2MSNA 5GTIU 5KFYA 3M9MB 1NK7A 3A0BU 3B0YA 5KFLA 4NWIA 5AI0A 4IQVA 1K5OA 4RPZA 1RXWA 4O3OA 4ZH4A 4RQ1A 1ZYQA 2VANA 3RJKA 2GO7A 5KT4A 3NRZA 4FZNA 3QU5A 3RJEA 2YMLA 1X6IA 1VLBA 1FFUA 5AKYA 2W9AA 1R89A 1X9XA 2W9BA 2F8LA 2EZYA 5EE1A 3C66A 2Y9TA 1DOQA 5KNIA 2LPEA 4XA5A 2KVSA 2M2TA 5J2JA 5EE0A 3RAXA 4X4TA 4EENA 5KFWA 5F9LA 2WTFA 4KLUA 5KG4A 5AKJA 5ALIA 3SI8A 4XUSA 3N4MB 3KHGA 7ICOA 3T79A 4NM1A 4X4NA 4FZLA 4JWMA 5C0YA 1S8OA 4KLLA 4Z6DA 4M9NA 4O9MA 3H8JA 1SKSA 3EYZA 4UBBA 7ICKA 4TQSA 4KX5A 4EEYA 4I2GA 2IOFK 3IN5A 1ZQNA 2K4IA 5F2VO 5KFDA 4O0IA 2Y1IA 1UT8A 4P0QA 1L8OA 1JXEA 3F2CA 4EBJA 1D8YA 3VCBA 2XC9A 2KD1A 1A76A 4IRKA 2RLTA 4OO1J 1V85A 4P2HA 2BCRA 5EWFA 1NK9A 7ICSA 2ES6A 1V4AA 2QB1A 2OHFA 2CXYA 1N2XA 3JPQA 1Z00B 2WF7A 5EWGA 2ZIVB 5DG8A 2W54A 2EH9A 4U7CA 1CRXA 5HMMA 2ZXHA 1RM6C 2RP5A 4K96A 3SD7A 3M9OB 1P7DA 4DL7A 2ASJA 4NLBA 4XRHA 2KEYA 4USAA 4QZIA 2RRDA 2JH7A 4WC6A 1ED1A 2YB4A 4F92B 4QZFA 4BUGA 1DXSA 4DS5A 4KLIA 3CW2C 1OU5A 2ID1A 2FPKA 1PK3A 4B6JA 4NLGA 2WHEA 3BZCA 4J9NA 1Z00A 4N7RA 1ZQAA 5JUMA 1IV8A 5D63A 1URJA 4OAHA 4UAUA 4YD1A 2IHMA 4I2FA 2DQNB 4XQ8A 1NK4A 3JPRA 3SQIA 4QW8A 3ED5A 3UQ0A 1SWVA 3AQKA 8ICJA 4MF8A 2ZUDA 4RQ0A 4FHVA 5ALWA 5D4BA 1SGGA 3E2EA 3BS5B 2UVVA 4DEZA 1Z19A 1IG6A 9ICKA 4MHVA 5DQIA 3GV5B 1J2MA 4J9LA 4UQGA 4UB6U 2WFAA 3MDAA 3ER9B 1RPLA 2F3NA 1NK5A 1V97A 2HOFA 2F8KA 8ICFA 3C18A 3T5JA 5CFUA 1MIWA 4Z6EA 5DG9A 2KK0A 3NYBA 3UXOA 4NXZA 4UD5A 3PO5A 4O68A 4TQRA 2HBJA 3MR3A 5HR9A 3MR6A 4NL9C 1Y88A 3NVVA 2BBJA 3EUB2 2FMSA 4KLEA 2ZTCA 4J9KA 4AT8A 2MAXA
chains in the Genus database with same CATH topology
3HW8A 2XCPA 8ICCA 1F5AA 4DL5A 1ZQCA 3SV3A 2NRWA 2R8IA 1ZQTA 2Q66A 1KFDA 1NK0A 2ZH4A 2ASDA 1TFWA 1X2IA 3OHAA 3Q8SB 2A1JB 1K1QA 8ICAA 4P4MA 3Q8RB 2BCSA 1QSSA 4K4IA 5DBAA 4KLGA 3M9NB 2ZH7A 3SV4A 5KG1A 3RRHA 3B0XA 3MR2A 4X0AA 1TAUA 2VA2A 3PMLA 2RDJA 3OVSA 1L5UA 1BPBA 1NKBA 4DQIA 5J2GA 4GXIA 4YR2A 3H4DA 3ISCA 2BCUA 7ICGA 9ICSA 2XGPA 4LZDA 4QZHA 2ZH9A 4DSLA 2C22A 3C23A 5J2HA 2NRKA 4DLGA 1HUZA 4F5OA 4DLEA 3AQMA 4MFCA 8ICGA 4J9RA 4ED1A 3LQCB 5J2IA 9ICUA 1X9WA 1ZQFA 4XQ7A 2KZ3A 4ECTA 3THVA 2DR7A 5L1JA 4J9SA 4RU9A 2BCQA 4O3QA 1U49A 1KDHA 5DB8A 3TI0A 4F4WA 3PO4A 3ZDCA 1B43A 5DB9A 9ICXA 3GIMA 3G6VA 3UQ2A 4QZAA 3MGHA 4UB3A 4J9OA 1BPZA 1SZPA 1SKWA 1MQ3A 3BQTA 2HVIA 4O5EA 2M2WA 5HP4A 4C8NA 5KT6A 3GQCA 9ICMA 3UPQA 4PHEA 5KFVA 2W9CA 5KFBA 1ZQYA 4F5NA 2AGQA 1L3TA 3RJJA 4FHXA 3OHBA 3C2MA 5KFEA 7ICUA 4X0BA 4HYKA 4EYIB 5DGAA 3RB0A 3WFSC 3ZD9A 3HPOA 2PFQA 2DR8A 3EW9A 5DG7A 1ZETA 2P66A 4YMNA 4M5DA 2W9BB 5DQGA 5HHIA 2M9NA 4JK1A 4DQQA 2ZUCA 2A1JA 4LVSA 4FHWA 4B9LA 3UPSA 2FLPA 5KFTA 5DLGA 5KFNA 3LWLA 5KFAA 3GILA 3GV7B 3RH6A 5DQHA 4UB4A 4ECQA 4P4OA 1NJZA 8ICXA 2AJQA 1ZQOA 9ICBA 4DL2A 4YN4A 1WCNA 4YQWA 5EWEA 4DF4A 1D9FA 4F2SA 8ICHA 8ICOA 2ZUBA 4C8MA 5EOZA 3JPNA 2HHVA 1KNYA 2XCAA 3WFPA 1CEZA 2ZHBA 1KEJA 4YXJA 4UAWA 5J0WA 3PR4A 1KLNA 3C2LA 2UVRA 4Q8EA 4DSFA 3V7KA 4IG8A 2AGOA 5J0XA 8ICPA 4ECVA 3L9DA 4K4GA 7ICKA 3ISDA 1DGSA 4R8UB 5DB7A 5HRKA 4DFMA 4G3IA 4IQUA 5KFXA 2H5XA 3OJSA 1BPYA 1Q78A 2MUTB 3MDCA 4RQ7A 3JPOA 4E80A 7ICMA 4ECZA 4GLXA 1U45A 5HRLA 1ZQPA 3PX4A 3GIJA 1ZQBA 2BPGA 8ICRA 4O3NA 7ICPA 2GWSA 3H39A 5KG5A 9ICGA 5J0TA 2HW3A 4YR3A 5KFPA 4F8RA 7ICFA 4NLKA 1XS9D 4I2IA 5CP2A 2AQ0A 1MQ2A 1ZQZA 4RT2A 2HHXA 3PW2A 2KTQA 2BR0A 3IM1A 4EBCA 4PPXA 4QZGA 4EZ6A 2ZH8A 7ICRA 1DK3A 3PY8A 4PHAA 2PFOA 1C7YA 3V6KA 4FHYA 1AROP 4M2YA 7ICLA 4LT6A 5HREA 4ATBA 4I2DA 1QTMA 1NKEA 2R8GA 2PI5A 3PV8A 1QLNA 1U9LA 1MIYA 1U4BA 2BPCA 4KMUA 2JZBA 4ECSA 1UA1A 4DSKA 2PBEA 1VFGA 4RQ3A 4Q45A 4TURA 7ICJA 3H40A 1KTQA 2NRTA 1JIHA 4YVZA 4NM2A 1JN3A 4NY8A 2HVHA 4QZBA 5CR0A 1UEVA 3JYYA 2PFNA 3HP6A 3PR5B 3M8SA 3KHLA 4I2EA 4AT9B 4RQ8A 5KFCA 2PI4A 4RPYA 4YFKA 2ALZA 1JX4A 1S97A 3Q8LA 1ZQKA 1L3VA 4ELTA 5DEDA 4I2JA 5HRDA 7ICHA 3ISBA 4QZEA 4O3PA 9ICIA 4ECXA 2ISOA 5IIOA 4R66A 5KFSA 4FHPA 1T3NA 9ICPA 4X4VA 1JXLA 3JZ0A 3JPTA 3OVBA 4R8UA 4PGQA 3FDSA 1ZQIA 1FA0A 1ZQEA 1XU4A 5C5JA 3V6HA 1N48A 2MUTA 2BE3A 4DOAA 2FLNA 3RB4A 9ICNA 8ICNA 2ZTEA 4DQPA 4R63A 2BDPA 2PXIA 4RNOA 3PW0A 5CHGA 3ZDAA 4C8KA 3V7JA 4DFJA 4DSEA 1B22A 3H3AA 4EYHB 5CWRA 4M9JA 4M9GA 2F1HA 3V7LA 2P6UA 5HRHA 2BKEA 5J0QA 1ZQWA 4I29A 1BNOA 3G6YA 4ED8A 4MEXA 1N56A 1Z3EB 4WC7A 5DBCA 3MFIA 1JMSA 1ZQQA 1ZQHA 9ICJA 1WCLA 5J0RA 3RBDA 4MEYA 1NK8A 4B9UA 3RJIA 4KLOA 2ZH2A 4LZGA 4MF2A 4X4PA 4YR0A 4F3OA 4QZDA 3TAQA 4KLLA 3PMNA 5DDYA 4M0AA 3RJHA 5IILA 4F91B 4B9SA 4B9TA 8ICBA 4BXOB 2ZJ5A 2KZMA 4DOBA 2M2UA 3H8SA 4X4UA 2C28A 3H37A 4O3RA 3LK9A 3AUOA 4DL3A 4X5VA 2ZJAA 3ETLA 4Z6FA 5J2DA 5L1LA 4X4OA 3EZ5A 4AT9A 8ICKA 2JEIA 2BQ3A 4RQ2A 4J9PA 3MR5A 5KG2A 1R8BA 9ICLA 8ICQA 4B9NA 2ISPA 5DDMA 7ICNA 3NGDA 5KFHA 4F4ZA 4QWEA 4FH3A 2ATLA 3ZDEA 3OSNA 3PW5A 4KLFA 2I1QA 4IR1A 4EBEA 2HHUA 4RT3A 2ZTDA 3BQ2A 4GXJA 4RNMA 3RBEA 1TK8A 2XY6A 1T7PA 9ICOA 1ZQJA 4RWNA 1ZQGA 4O5CA 3RRGA 1KFTA 4KLJA 1R8CA 1L3SA 4QZ9A 4J9QA 4DL6A 2KN7A 5IIMA 1BNPA 4KTQA 1VJ7A 3RR7A 4FH5A 1S0MA 4I27A 8ICLA 5CJ7A 4DFPA 3HX0A 4DWIA 9ICTA 5KT7A 4ECRA 1UEUA 3MFHA 1XSNA 2O5AA 4RWOA 4ECYA 4YCXA 3HJ4A 1K1SA 2IBKA 5IIKA 4X4QA 5L1IA 1TFYA 2IA6A 1TV9A 2IMWP 2FMPA 4X4SA 4RNNA 3C2KA 4C8LA 2C2DA 5KFZA 2I9GA 3KTQA 4QZCA 3EWAA 4EP7A 4I2HA 1EXNA 5KFKA 5DGBA 5KG6A 5D46A 5KT5A 4YD2A 3PNCA 3ORYA 3EPGA 4RPXA 3V72A 4F5QA 1BPDA 4UB5A 3OVAA 4RQ4A 4ED0A 2AGPA 1ZQRA 4KLDA 4B9MA 3HIYA 2F1IA 4WC5A 3RB6A 4IRDA 4AT7B 4M47A 4O5KA 3C1ZA 3UXNA 5HMLA 2V4RA 3EPIA 3PVXA 1Q79A 2BHNA 1TAQA 5KFYA 3M9MB 1NK7A 4F4KA 2IHNA 3B0YA 5KFLA 4R64A 4IQVA 1NKCA 4RPZA 5CB1A 1RXWA 5J0YA 4WC3A 2LYHA 2VA3A 2ZH1A 4O3OA 4DS4A 4RWPA 1ZQXA 2HHPA 4ZH4A 4RQ1A 1ZYQA 4Q8FA 2VANA 4X4RA 5KFGA 3RJKA 5KT2A 4RUAA 3K75D 5KT4A 3C5FA 3QEAZ 4WBYA 3KHHA 1MIVA 1TK5A 8ICWA 3RJEA 5DBBA 4KN4A 4I2AA 1ZQVA 1SKRA 2W9AA 5HNKA 1XSLA 4DSJA 2W9BA 1R89A 4AT8B 2F1JA 2DR5A 2BQRA 3SYZA 1UT5A 3PW4A 5HRFA 4NKTA 5IIIA 2DRBA 1HJPA 3C66A 3RTVA 3PX0A 1DOQA 2PFPA 4XA5A 4KITB 4MFAA 1TKDA 2M2TA 5J2JA 4ED7A 4RQ5A 1T8EA 3RAXA 3QZ7A 5BPCA 9ICWA 2Q0ZX 4GC6A 4X4TA 4FS1A 4ED2A 4JV2A 3RH4A 4M9LA 5KFWA 8ICVA 1JAJA 5F9LA 2WTFA 4GC7A 4KLUA 5J2EA 5KG4A 3RAQA 3SI8A 4XUSA 3N4MB 8ICSA 3KHGA 1COOA 7ICOA 5J0OA 1U47A 2JEGA 3C21A 3WFQE 4NM1A 2KP7A 3GFKB 4PHPA 4ECUA 4JWMA 4TUSA 4X4NA 4WBZA 4FBTA 3OJUA 1XWLA 4Z6DA 4BDPA 2BQUA 2FPMA 5J2BA 4M9NA 4YMMA 2W8KA 1RYRA 3PW7A 4O9MA 1S0VA 1PZNA 3H8JA 3K4GA 3WFRE 1ZJMA 5KG3A 3EYZA 4UBBA 4P4PA 5IINA 1SKSA 1U48A 3RJFA 4CCHA 4TQSA 2J6SA 4E0DA 3TFRA 4M9HA 1NO5A 3HT3A 4EEYA 2DPJA 4B9VA 3T5HA 5HRGA 5TZVA 1NZPA 4QWCA 3T3FA 4DL4A 3TQ1A 4QWBA 4I2GA 5KFQA 2ZH6A 1LV5A 3ZDDA 1ZQNA 7ICTA 3T5KA 4FBUA 2DRAA 3TANA 5F2VO 4QZ8A 5KFDA 3H8WA 3WFOA 5KG0A 1BPEA 4O0IA 4DQRA 2Y1IA 1UETA 1UT8A 1ZQUA 3FYHA 4M6WB 3QE9Y 5CA7A 9ICVA 3RR8A 4I2BA 2J6UA 1JXEA 4UAZA 4FS2A 4WC1A 4EBKA 2V9WA 4EBJA 1D8YA 4KLMA 2KZZA 2XC9A 2UVUA 4KLSA 4S3NA 2UVWA 2R8JA 2DVIA 4F4YA 1MSWD 1A76A 2NRVA 5KFRA 4EBDA 4IRKA 1L3UA 2FMQA 4K4HA 1NOMA 8ICYA 4P2HA 4DOCA 2BCRA 4O3SA 9ICEA 2XO7A 3BQ1A 4IRCA 3OUYB 5EWFA 1NK9A 1V9PA 4NLNA 7ICSA 4RWQA 9ICQA 1SL2A 1NJXA 2FLLA 4I2CA 5KTQA 4RQ6A 3JPPA 5DB6A 2V4QA 2R8HA 1LB2B 8ICTA 1ZQMA 1V4AA 3JPQA 8ICIA 4QWAA 4RZRA 2XGQA 4KLQA 9ICRA 1Z00B 1YLQA 3OV7A 4YP3A 5EWGA 3RJGA 4NLZA 5J2FA 1KSPA 9ICHA 3AU2A 3ZD8A 4WC2A 5J2KA 4KLTA 1PX5A 5DG8A 5J0PA 3UXPA 7ICEA 2R8KA 3H38A 3C1YA 3Q8QB 4ED6A 3ZDBA 3QZ8A 2AQ4A 3GDXA 5HMMA 3BDPA 5KFOA 4F4XA 4DO9A 3TARA 1X9SA 5HRBA 2B21A 4F5RA 1TK0A 4UAYA 4EZ9A 3M9OB 4F2RA 4MFFA 2HHWA 5KFFA 2ZH3A 5KT3A 4UB2A 5DECA 1WOTA 2NRXA 3RH5A 2AU0A 4E7XA 4C8OA 8ICMA 4DL7A 2ASJA 4JUZA 3IHQB 4YMOA 4F50A 4XRHA 2XY7A 4UBCA 1QSLA 3V6JA 2W9MA 4IR9A 1S76D 5KFJA 1D9DA 3C5GA 1BGXT 4M6WA 5KFUA 1NJWA 3SZ2A 4DQSA 4QZIA 4RUCA 1RXVA 4WC6A 8ICEA 1S9FA 2BPFA 1SL0A 5J0SA 4KLHA 3Q8PB 4ATBB 4IQTA 4TUQA 4BXOA 3LDAA 3M8RA 4F92B 1D8LA 5D49A 4QZFA 1XC9A 4F5PA 2ASLA 2JZBB 1BVSA 1JQRA 5KFMA 2O1PA 4DS5A 4KLIA 4WC0A 3OUYA 4ED3A 3Q8KA 2FPKA 1ZQLA 2OWOA 4NLGA 9ICCA 1OU5A 2ID1A 4JV1A 4E8FA 2DR9A 4J9NA 1S0OA 2VA8A 1S77D 3H4BA 5F9NA 3QEBZ 5KFIA 3JPSA 3GIIA 1H38A 4QWDA 2C2RA 2BCVA 5HC9A 4TUPA 1CUKA 1DK2A 1Z00A 4J9MA 2M2VA 8ICUA 1IM4A 5BOLA 3OSPA 3AU6A 1ZQAA 1A77A 5HRIA 1S0NA 5JUMA 2J6TA 3MABA 2Y1JA 4PH5A 1ZJNA 1R8AA 3RB3A 2HHQA 2DPIA 3N97B 2XY5A 3TAPA 2ZH5A 4YD1A 1S10A 2IHMA 4BGDA 3Q8MA 1RYSA 3AQLA 4I2FA 4XQ8A 1NK4A 4DF8A 3JPRA 4QW8A 3AQKA 3UQ0A 8ICJA 1T4GA 4MF8A 3GIKA 3LWMA 2ZUDA 3TFSA 1X9MA 4DFKA 1QSYA 4RQ0A 1KRPA 2HHTA 3HJ1A 4FHVA 1ZQDA 2RFFA 5D4BA 4BWJA 1XSPA 1NJYA 3E2EA 2KFZA 4NKUA 3BQ0A 4ECWA 1ZQSA 2UVVA 4WC4A 4FO6A 4Q44A 1HUOA 4DEZA 4Q43A 4QW9A 9ICKA 1BPXA 3PX6A 2JEFA 4JWNA 3NTUA 2RDIA 4PHDA 3GV8B 5L1KA 4I28A 5DQIA 2DFLA 3MBYA 5HHHA 5J2CA 4YG2A 3GV5B 4IQWA 2ZJ8A 4PGYA 4J9LA 4UQGA 4AT7A 1NK6A 4BWMA 3MDAA 7ICIA 4Z6CA 4ELUA 1RPLA 4UB1A 1TVAA 1UA0A 2JEJA 4R65A 5DKWA 4JV0A 1NK5A 4GXKA 1MC8A 3BJYA 3KHRA 1TFRA 4PGXA 2BGWA 2P6RA 4DSIA 3H7IA 8ICFA 3C18A 2FPLA 3HWTA 3T5LA 1IXRA 3T5JA 3AQNA 1SL1A 1KFSA 1MIWA 4Z6EA 5DG9A 5BOMA 5L9XA 4F93B 3NYBA 3UXOA 2KFNA 4NXZA 2W8LA 4UD5A 3PO5A 4TQRA 3MR3A 4YXMA 7ICVA 1XO1A 3MR6A 5HR9A 2NRZA 4ELVA 2HHSA 2C2EA 3G6XA 7ICQA 1Y88A 4M04A 1RZTA 5KG7A 5IIJA 3MGIA 2W9CB 8ICZA 4WCWA 2ZHAA 4UD4A 5DLFA 5J29A 9ICAA 5J2AA 2FMSA 4KLEA 5J0UA 2ZTCA 4J9KA 4KN7A 3OGUA 4AT8A 2MAXA 9ICFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HW8 A;  2XCP A;  8ICC A;  1F5A A;  4DL5 A;  1ZQC A;  3SV3 A;  2NRW A;  2R8I A;  1ZQT A;  2Q66 A;  1KFD A;  1NK0 A;  2ZH4 A;  2ASD A;  1TFW A;  1X2I A;  3OHA A;  3Q8S B;  2A1J B;  1K1Q A;  8ICA A;  4P4M A;  3Q8R B;  2BCS A;  1QSS A;  4K4I A;  5DBA A;  4KLG A;  3M9N B;  2ZH7 A;  3SV4 A;  5KG1 A;  3RRH A;  3B0X A;  3MR2 A;  4X0A A;  1TAU A;  2VA2 A;  3PML A;  2RDJ A;  3OVS A;  1L5U A;  1BPB A;  1NKB A;  4DQI A;  5J2G A;  4GXI A;  4YR2 A;  3H4D A;  3ISC A;  2BCU A;  7ICG A;  9ICS A;  2XGP A;  4LZD A;  4QZH A;  2ZH9 A;  4DSL A;  2C22 A;  3C23 A;  5J2H A;  2NRK A;  4DLG A;  1HUZ A;  4F5O A;  4DLE A;  3AQM A;  4MFC A;  8ICG A;  4J9R A;  4ED1 A;  3LQC B;  5J2I A;  9ICU A;  1X9W A;  1ZQF A;  4XQ7 A;  2KZ3 A;  4ECT A;  3THV A;  2DR7 A;  5L1J A;  4J9S A;  4RU9 A;  2BCQ A;  4O3Q A;  1U49 A;  1KDH A;  5DB8 A;  3TI0 A;  4F4W A;  3PO4 A;  3ZDC A;  1B43 A;  5DB9 A;  9ICX A;  3GIM A;  3G6V A;  3UQ2 A;  4QZA A;  3MGH A;  4UB3 A;  4J9O A;  1BPZ A;  1SZP A;  1SKW A;  1MQ3 A;  3BQT A;  2HVI A;  4O5E A;  2M2W A;  5HP4 A;  4C8N A;  5KT6 A;  3GQC A;  9ICM A;  3UPQ A;  4PHE A;  5KFV A;  2W9C A;  5KFB A;  1ZQY A;  4F5N A;  2AGQ A;  1L3T A;  3RJJ A;  4FHX A;  3OHB A;  3C2M A;  5KFE A;  7ICU A;  4X0B A;  4HYK A;  4EYI B;  5DGA A;  3RB0 A;  3WFS C;  3ZD9 A;  3HPO A;  2PFQ A;  2DR8 A;  3EW9 A;  5DG7 A;  1ZET A;  2P66 A;  4YMN A;  4M5D A;  2W9B B;  5DQG A;  5HHI A;  2M9N A;  4JK1 A;  4DQQ A;  2ZUC A;  2A1J A;  4LVS A;  4FHW A;  4B9L A;  3UPS A;  2FLP A;  5KFT A;  5DLG A;  5KFN A;  3LWL A;  5KFA A;  3GIL A;  3GV7 B;  3RH6 A;  5DQH A;  4UB4 A;  4ECQ A;  4P4O A;  1NJZ A;  8ICX A;  2AJQ A;  1ZQO A;  9ICB A;  4DL2 A;  4YN4 A;  1WCN A;  4YQW A;  5EWE A;  4DF4 A;  1D9F A;  4F2S A;  8ICH A;  8ICO A;  2ZUB A;  4C8M A;  5EOZ A;  3JPN A;  2HHV A;  1KNY A;  2XCA A;  3WFP A;  1CEZ A;  2ZHB A;  1KEJ A;  4YXJ A;  4UAW A;  5J0W A;  3PR4 A;  1KLN A;  3C2L A;  2UVR A;  4Q8E A;  4DSF A;  3V7K A;  4IG8 A;  2AGO A;  5J0X A;  8ICP A;  4ECV A;  3L9D A;  4K4G A;  7ICK A;  3ISD A;  1DGS A;  4R8U B;  5DB7 A;  5HRK A;  4DFM A;  4G3I A;  4IQU A;  5KFX A;  2H5X A;  3OJS A;  1BPY A;  1Q78 A;  2MUT B;  3MDC A;  4RQ7 A;  3JPO A;  4E80 A;  7ICM A;  4ECZ A;  4GLX A;  1U45 A;  5HRL A;  1ZQP A;  3PX4 A;  3GIJ A;  1ZQB A;  2BPG A;  8ICR A;  4O3N A;  7ICP A;  2GWS A;  3H39 A;  5KG5 A;  9ICG A;  5J0T A;  2HW3 A;  4YR3 A;  5KFP A;  4F8R A;  7ICF A;  4NLK A;  1XS9 D;  4I2I A;  5CP2 A;  2AQ0 A;  1MQ2 A;  1ZQZ A;  4RT2 A;  2HHX A;  3PW2 A;  2KTQ A;  2BR0 A;  3IM1 A;  4EBC A;  4PPX A;  4QZG A;  4EZ6 A;  2ZH8 A;  7ICR A;  1DK3 A;  3PY8 A;  4PHA A;  2PFO A;  1C7Y A;  3V6K A;  4FHY A;  1ARO P;  4M2Y A;  7ICL A;  4LT6 A;  5HRE A;  4ATB A;  4I2D A;  1QTM A;  1NKE A;  2R8G A;  2PI5 A;  3PV8 A;  1QLN A;  1U9L A;  1MIY A;  1U4B A;  2BPC A;  4KMU A;  2JZB A;  4ECS A;  1UA1 A;  4DSK A;  2PBE A;  1VFG A;  4RQ3 A;  4Q45 A;  4TUR A;  7ICJ A;  3H40 A;  1KTQ A;  2NRT A;  1JIH A;  4YVZ A;  4NM2 A;  1JN3 A;  4NY8 A;  2HVH A;  4QZB A;  5CR0 A;  1UEV A;  3JYY A;  2PFN A;  3HP6 A;  3PR5 B;  3M8S A;  3KHL A;  4I2E A;  4AT9 B;  4RQ8 A;  5KFC A;  2PI4 A;  4RPY A;  4YFK A;  2ALZ A;  1JX4 A;  1S97 A;  3Q8L A;  1ZQK A;  1L3V A;  4ELT A;  5DED A;  4I2J A;  5HRD A;  7ICH A;  3ISB A;  4QZE A;  4O3P A;  9ICI A;  4ECX A;  2ISO A;  5IIO A;  4R66 A;  5KFS A;  4FHP A;  1T3N A;  9ICP A;  4X4V A;  1JXL A;  3JZ0 A;  3JPT A;  3OVB A;  4R8U A;  4PGQ A;  3FDS A;  1ZQI A;  1FA0 A;  1ZQE A;  1XU4 A;  5C5J A;  3V6H A;  1N48 A;  2MUT A;  2BE3 A;  4DOA A;  2FLN A;  3RB4 A;  9ICN A;  8ICN A;  2ZTE A;  4DQP A;  4R63 A;  2BDP A;  2PXI A;  4RNO A;  3PW0 A;  5CHG A;  3ZDA A;  4C8K A;  3V7J A;  4DFJ A;  4DSE A;  1B22 A;  3H3A A;  4EYH B;  5CWR A;  4M9J A;  4M9G A;  2F1H A;  3V7L A;  2P6U A;  5HRH A;  2BKE A;  5J0Q A;  1ZQW A;  4I29 A;  1BNO A;  3G6Y A;  4ED8 A;  4MEX A;  1N56 A;  1Z3E B;  4WC7 A;  5DBC A;  3MFI A;  1JMS A;  1ZQQ A;  1ZQH A;  9ICJ A;  1WCL A;  5J0R A;  3RBD A;  4MEY A;  1NK8 A;  4B9U A;  3RJI A;  4KLO A;  2ZH2 A;  4LZG A;  4MF2 A;  4X4P A;  4YR0 A;  4F3O A;  4QZD A;  3TAQ A;  4KLL A;  3PMN A;  5DDY A;  4M0A A;  3RJH A;  5IIL A;  4F91 B;  4B9S A;  4B9T A;  8ICB A;  4BXO B;  2ZJ5 A;  2KZM A;  4DOB A;  2M2U A;  3H8S A;  4X4U A;  2C28 A;  3H37 A;  4O3R A;  3LK9 A;  3AUO A;  4DL3 A;  4X5V A;  2ZJA A;  3ETL A;  4Z6F A;  5J2D A;  5L1L A;  4X4O A;  3EZ5 A;  4AT9 A;  8ICK A;  2JEI A;  2BQ3 A;  4RQ2 A;  4J9P A;  3MR5 A;  5KG2 A;  1R8B A;  9ICL A;  8ICQ A;  4B9N A;  2ISP A;  5DDM A;  7ICN A;  3NGD A;  5KFH A;  4F4Z A;  4QWE A;  4FH3 A;  2ATL A;  3ZDE A;  3OSN A;  3PW5 A;  4KLF A;  2I1Q A;  4IR1 A;  4EBE A;  2HHU A;  4RT3 A;  2ZTD A;  3BQ2 A;  4GXJ A;  4RNM A;  3RBE A;  1TK8 A;  2XY6 A;  1T7P A;  9ICO A;  1ZQJ A;  4RWN A;  1ZQG A;  4O5C A;  3RRG A;  1KFT A;  4KLJ A;  1R8C A;  1L3S A;  4QZ9 A;  4J9Q A;  4DL6 A;  2KN7 A;  5IIM A;  1BNP A;  4KTQ A;  1VJ7 A;  3RR7 A;  4FH5 A;  1S0M A;  4I27 A;  8ICL A;  5CJ7 A;  4DFP A;  3HX0 A;  4DWI A;  9ICT A;  5KT7 A;  4ECR A;  1UEU A;  3MFH A;  1XSN A;  2O5A A;  4RWO A;  4ECY A;  4YCX A;  3HJ4 A;  1K1S A;  2IBK A;  5IIK A;  4X4Q A;  5L1I A;  1TFY A;  2IA6 A;  1TV9 A;  2IMW P;  2FMP A;  4X4S A;  4RNN A;  3C2K A;  4C8L A;  2C2D A;  5KFZ A;  2I9G A;  3KTQ A;  4QZC A;  3EWA A;  4EP7 A;  4I2H A;  1EXN A;  5KFK A;  5DGB A;  5KG6 A;  5D46 A;  5KT5 A;  4YD2 A;  3PNC A;  3ORY A;  3EPG A;  4RPX A;  3V72 A;  4F5Q A;  1BPD A;  4UB5 A;  3OVA A;  4RQ4 A;  4ED0 A;  2AGP A;  1ZQR A;  4KLD A;  4B9M A;  3HIY A;  2F1I A;  4WC5 A;  3RB6 A;  4IRD A;  4AT7 B;  4M47 A;  4O5K A;  3C1Z A;  3UXN A;  5HML A;  2V4R A;  3EPI A;  3PVX A;  1Q79 A;  2BHN A;  1TAQ A;  5KFY A;  3M9M B;  1NK7 A;  4F4K A;  2IHN A;  3B0Y A;  5KFL A;  4R64 A;  4IQV A;  1NKC A;  4RPZ A;  5CB1 A;  1RXW A;  5J0Y A;  4WC3 A;  2LYH A;  2VA3 A;  2ZH1 A;  4O3O A;  4DS4 A;  4RWP A;  1ZQX A;  2HHP A;  4ZH4 A;  4RQ1 A;  1ZYQ A;  4Q8F A;  2VAN A;  4X4R A;  5KFG A;  3RJK A;  5KT2 A;  4RUA A;  3K75 D;  5KT4 A;  3C5F A;  3QEA Z;  4WBY A;  3KHH A;  1MIV A;  1TK5 A;  8ICW A;  3RJE A;  5DBB A;  4KN4 A;  4I2A A;  1ZQV A;  1SKR A;  2W9A A;  5HNK A;  1XSL A;  4DSJ A;  2W9B A;  1R89 A;  4AT8 B;  2F1J A;  2DR5 A;  2BQR A;  3SYZ A;  1UT5 A;  3PW4 A;  5HRF A;  4NKT A;  5III A;  2DRB A;  1HJP A;  3C66 A;  3RTV A;  3PX0 A;  1DOQ A;  2PFP A;  4XA5 A;  4KIT B;  4MFA A;  1TKD A;  2M2T A;  5J2J A;  4ED7 A;  4RQ5 A;  1T8E A;  3RAX A;  3QZ7 A;  5BPC A;  9ICW A;  2Q0Z X;  4GC6 A;  4X4T A;  4FS1 A;  4ED2 A;  4JV2 A;  3RH4 A;  4M9L A;  5KFW A;  8ICV A;  1JAJ A;  5F9L A;  2WTF A;  4GC7 A;  4KLU A;  5J2E A;  5KG4 A;  3RAQ A;  3SI8 A;  4XUS A;  3N4M B;  8ICS A;  3KHG A;  1COO A;  7ICO A;  5J0O A;  1U47 A;  2JEG A;  3C21 A;  3WFQ E;  4NM1 A;  2KP7 A;  3GFK B;  4PHP A;  4ECU A;  4JWM A;  4TUS A;  4X4N A;  4WBZ A;  4FBT A;  3OJU A;  1XWL A;  4Z6D A;  4BDP A;  2BQU A;  2FPM A;  5J2B A;  4M9N A;  4YMM A;  2W8K A;  1RYR A;  3PW7 A;  4O9M A;  1S0V A;  1PZN A;  3H8J A;  3K4G A;  3WFR E;  1ZJM A;  5KG3 A;  3EYZ A;  4UBB A;  4P4P A;  5IIN A;  1SKS A;  1U48 A;  3RJF A;  4CCH A;  4TQS A;  2J6S A;  4E0D A;  3TFR A;  4M9H A;  1NO5 A;  3HT3 A;  4EEY A;  2DPJ A;  4B9V A;  3T5H A;  5HRG A;  5TZV A;  1NZP A;  4QWC A;  3T3F A;  4DL4 A;  3TQ1 A;  4QWB A;  4I2G A;  5KFQ A;  2ZH6 A;  1LV5 A;  3ZDD A;  1ZQN A;  7ICT A;  3T5K A;  4FBU A;  2DRA A;  3TAN A;  5F2V O;  4QZ8 A;  5KFD A;  3H8W A;  3WFO A;  5KG0 A;  1BPE A;  4O0I A;  4DQR A;  2Y1I A;  1UET A;  1UT8 A;  1ZQU A;  3FYH A;  4M6W B;  3QE9 Y;  5CA7 A;  9ICV A;  3RR8 A;  4I2B A;  2J6U A;  1JXE A;  4UAZ A;  4FS2 A;  4WC1 A;  4EBK A;  2V9W A;  4EBJ A;  1D8Y A;  4KLM A;  2KZZ A;  2XC9 A;  2UVU A;  4KLS A;  4S3N A;  2UVW A;  2R8J A;  2DVI A;  4F4Y A;  1MSW D;  1A76 A;  2NRV A;  5KFR A;  4EBD A;  4IRK A;  1L3U A;  2FMQ A;  4K4H A;  1NOM A;  8ICY A;  4P2H A;  4DOC A;  2BCR A;  4O3S A;  9ICE A;  2XO7 A;  3BQ1 A;  4IRC A;  3OUY B;  5EWF A;  1NK9 A;  1V9P A;  4NLN A;  7ICS A;  4RWQ A;  9ICQ A;  1SL2 A;  1NJX A;  2FLL A;  4I2C A;  5KTQ A;  4RQ6 A;  3JPP A;  5DB6 A;  2V4Q A;  2R8H A;  1LB2 B;  8ICT A;  1ZQM A;  1V4A A;  3JPQ A;  8ICI A;  4QWA A;  4RZR A;  2XGQ A;  4KLQ A;  9ICR A;  1Z00 B;  1YLQ A;  3OV7 A;  4YP3 A;  5EWG A;  3RJG A;  4NLZ A;  5J2F A;  1KSP A;  9ICH A;  3AU2 A;  3ZD8 A;  4WC2 A;  5J2K A;  4KLT A;  1PX5 A;  5DG8 A;  5J0P A;  3UXP A;  7ICE A;  2R8K A;  3H38 A;  3C1Y A;  3Q8Q B;  4ED6 A;  3ZDB A;  3QZ8 A;  2AQ4 A;  3GDX A;  5HMM A;  3BDP A;  5KFO A;  4F4X A;  4DO9 A;  3TAR A;  1X9S A;  5HRB A;  2B21 A;  4F5R A;  1TK0 A;  4UAY A;  4EZ9 A;  3M9O B;  4F2R A;  4MFF A;  2HHW A;  5KFF A;  2ZH3 A;  5KT3 A;  4UB2 A;  5DEC A;  1WOT A;  2NRX A;  3RH5 A;  2AU0 A;  4E7X A;  4C8O A;  8ICM A;  4DL7 A;  2ASJ A;  4JUZ A;  3IHQ B;  4YMO A;  4F50 A;  4XRH A;  2XY7 A;  4UBC A;  1QSL A;  3V6J A;  2W9M A;  4IR9 A;  1S76 D;  5KFJ A;  1D9D A;  3C5G A;  1BGX T;  4M6W A;  5KFU A;  1NJW A;  3SZ2 A;  4DQS A;  4QZI A;  4RUC A;  1RXV A;  4WC6 A;  8ICE A;  1S9F A;  2BPF A;  1SL0 A;  5J0S A;  4KLH A;  3Q8P B;  4ATB B;  4IQT A;  4TUQ A;  4BXO A;  3LDA A;  3M8R A;  4F92 B;  1D8L A;  5D49 A;  4QZF A;  1XC9 A;  4F5P A;  2ASL A;  2JZB B;  1BVS A;  1JQR A;  5KFM A;  2O1P A;  4DS5 A;  4KLI A;  4WC0 A;  3OUY A;  4ED3 A;  3Q8K A;  2FPK A;  1ZQL A;  2OWO A;  4NLG A;  9ICC A;  1OU5 A;  2ID1 A;  4JV1 A;  4E8F A;  2DR9 A;  4J9N A;  1S0O A;  2VA8 A;  1S77 D;  3H4B A;  5F9N A;  3QEB Z;  5KFI A;  3JPS A;  3GII A;  1H38 A;  4QWD A;  2C2R A;  2BCV A;  5HC9 A;  4TUP A;  1CUK A;  1DK2 A;  1Z00 A;  4J9M A;  2M2V A;  8ICU A;  1IM4 A;  5BOL A;  3OSP A;  3AU6 A;  1ZQA A;  1A77 A;  5HRI A;  1S0N A;  5JUM A;  2J6T A;  3MAB A;  2Y1J A;  4PH5 A;  1ZJN A;  1R8A A;  3RB3 A;  2HHQ A;  2DPI A;  3N97 B;  2XY5 A;  3TAP A;  2ZH5 A;  4YD1 A;  1S10 A;  2IHM A;  4BGD A;  3Q8M A;  1RYS A;  3AQL A;  4I2F A;  4XQ8 A;  1NK4 A;  4DF8 A;  3JPR A;  4QW8 A;  3AQK A;  3UQ0 A;  8ICJ A;  1T4G A;  4MF8 A;  3GIK A;  3LWM A;  2ZUD A;  3TFS A;  1X9M A;  4DFK A;  1QSY A;  4RQ0 A;  1KRP A;  2HHT A;  3HJ1 A;  4FHV A;  1ZQD A;  2RFF A;  5D4B A;  4BWJ A;  1XSP A;  1NJY A;  3E2E A;  2KFZ A;  4NKU A;  3BQ0 A;  4ECW A;  1ZQS A;  2UVV A;  4WC4 A;  4FO6 A;  4Q44 A;  1HUO A;  4DEZ A;  4Q43 A;  4QW9 A;  9ICK A;  1BPX A;  3PX6 A;  2JEF A;  4JWN A;  3NTU A;  2RDI A;  4PHD A;  3GV8 B;  5L1K A;  4I28 A;  5DQI A;  2DFL A;  3MBY A;  5HHH A;  5J2C A;  4YG2 A;  3GV5 B;  4IQW A;  2ZJ8 A;  4PGY A;  4J9L A;  4UQG A;  4AT7 A;  1NK6 A;  4BWM A;  3MDA A;  7ICI A;  4Z6C A;  4ELU A;  1RPL A;  4UB1 A;  1TVA A;  1UA0 A;  2JEJ A;  4R65 A;  5DKW A;  4JV0 A;  1NK5 A;  4GXK A;  1MC8 A;  3BJY A;  3KHR A;  1TFR A;  4PGX A;  2BGW A;  2P6R A;  4DSI A;  3H7I A;  8ICF A;  3C18 A;  2FPL A;  3HWT A;  3T5L A;  1IXR A;  3T5J A;  3AQN A;  1SL1 A;  1KFS A;  1MIW A;  4Z6E A;  5DG9 A;  5BOM A;  5L9X A;  4F93 B;  3NYB A;  3UXO A;  2KFN A;  4NXZ A;  2W8L A;  4UD5 A;  3PO5 A;  4TQR A;  3MR3 A;  4YXM A;  7ICV A;  1XO1 A;  3MR6 A;  5HR9 A;  2NRZ A;  4ELV A;  2HHS A;  2C2E A;  3G6X A;  7ICQ A;  1Y88 A;  4M04 A;  1RZT A;  5KG7 A;  5IIJ A;  3MGI A;  2W9C B;  8ICZ A;  4WCW A;  2ZHA A;  4UD4 A;  5DLF A;  5J29 A;  9ICA A;  5J2A A;  2FMS A;  4KLE A;  5J0U A;  2ZTC A;  4J9K A;  4KN7 A;  3OGU A;  4AT8 A;  2MAX A;  9ICF A; 
#chains in the Genus database with same CATH topology
 8ICC A;  3I1Y A;  1ZRM A;  1ZQT A;  1NK0 A;  1TFW A;  2A1J B;  1K1Q A;  8ICA A;  2BZF A;  2ZH7 A;  2A3V A;  4JB3 A;  3SV4 A;  3RRH A;  3B0X A;  4X0A A;  2WF6 A;  5AKI A;  2JRZ A;  1BPB A;  4DQI A;  4GXI A;  3ISC A;  9ICS A;  3NAS A;  1IIP A;  2C22 A;  5J2H A;  2NRK A;  1HUZ A;  4DLE A;  4MFC A;  2ESE A;  1Z1B A;  1X9W A;  4J03 A;  2DR7 A;  4J9S A;  4GFJ A;  2B4V A;  3PO4 A;  3ZDC A;  4P0P B;  1N5X A;  5CEH A;  3MGH A;  3NUQ A;  1SKW A;  1BPZ A;  5A0L A;  1OUQ A;  2RQ5 A;  3GQC A;  3UPQ A;  4F5N A;  4OJP A;  3C2M A;  7ICU A;  4HYK A;  3RB0 A;  3ZD9 A;  4O6A A;  3EW9 A;  1ZET A;  4CDG A;  3BZK A;  2D8C A;  1FO4 A;  2A1J A;  4FHW A;  4B9L A;  3UPS A;  2FLP A;  3WKA A;  2KMD A;  3RH6 A;  5DQH A;  4P4O A;  5KL1 B;  1ZQO A;  3MCR A;  1D9F A;  8ICH A;  1QCK A;  2ZUB A;  1TE2 A;  3E58 A;  5EOZ A;  2ZHB A;  1TAM A;  2XCA A;  1CEZ A;  3GZF A;  5J0W A;  3C2L A;  4DSF A;  4IG8 A;  4Y2V A;  2FI1 A;  4R8U B;  5ALP A;  2GAF D;  2YMP A;  5AKH A;  3MDC A;  3JPO A;  2IOF A;  7ICM A;  1GPJ A;  3PX4 A;  1ZQB A;  5AKG A;  4O3N A;  7ICP A;  3H39 A;  5J0T A;  2HW3 A;  5KFP A;  2GLE A;  5CP2 A;  1Q3V A;  2HHX A;  4O69 A;  2BR0 A;  2ZH8 A;  4QZG A;  3V6K A;  7ICL A;  1N63 A;  5HRE A;  1U4B A;  2BPC A;  2PBE A;  4RQ3 A;  2Z7J A;  3IDW A;  4TUR A;  7ICJ A;  1KTQ A;  4KM5 A;  1WWV A;  2H3I A;  3JYY A;  2PFN A;  3HP6 A;  4AT9 B;  4I0U A;  1ZQK A;  2ALZ A;  5ALZ A;  1VDV A;  4F71 A;  7ICH A;  4O3P A;  1PVQ A;  1JXL A;  3HRD D;  3OVB A;  4R8U A;  4PGQ A;  2G08 A;  1O08 A;  4F72 A;  5CFS A;  1J97 A;  5JU5 A;  4U6P A;  1UPH A;  2BE3 A;  2VJ4 A;  3PST A;  2ZIU A;  4QNL A;  9ICN A;  4RNO A;  3PW0 A;  3PSI A;  3V7J A;  4DFJ A;  2G0A A;  5HRH A;  3WK9 A;  4M9G A;  4Y2X A;  1ZQW A;  3WKE A;  4ED8 A;  4MEX A;  5DBC A;  5B5E U;  1ZQH A;  1WCL A;  3RBD A;  1NK8 A;  3RJI A;  4MF2 A;  3C29 A;  3H0R B;  4YR0 A;  3PMN A;  8ICB A;  2KZM A;  2ZJ5 A;  2MU2 A;  2M0N A;  2C28 A;  5ALU A;  4O3R A;  4KMO B;  5L1L A;  3EZ5 A;  4AT9 A;  2E1F A;  2LKY A;  4PL2 A;  9ICL A;  3F5A A;  3FC4 A;  5KAF U;  5DDM A;  3IG8 A;  4QWE A;  3OSN A;  2WF8 A;  2I1Q A;  4IR1 A;  4EBE A;  2HHU A;  1TK8 A;  4FFD A;  3BQ2 A;  4RWN A;  9ICO A;  2ZIW B;  4K8V A;  1KFT A;  4PZO A;  2KN7 A;  5IIM A;  1KL9 A;  1BNP A;  1DGJ A;  3QU7 A;  1KQQ A;  8ICL A;  1UEU A;  4ECR A;  3MFH A;  4YCX A;  2G09 A;  2HBL A;  3AQF A;  4X4Q A;  1TV9 A;  1N60 A;  3C2K A;  5KFZ A;  3KTQ A;  3EWA A;  1EXN A;  5KG6 A;  3PNC A;  4KLD A;  3KZI U;  4B9M A;  4AT7 B;  4NJ8 A;  4Y2U A;  1UCV A;  3EPI A;  3QUC A;  2BHN A;  2IHN A;  2G5H B;  1ZRN A;  4Y2R A;  5ALH A;  1A6S A;  2LYH A;  1ZOL A;  1N61 A;  3D2Q A;  3K7D A;  5DBB A;  4Y2Q A;  3QXG A;  5ALQ A;  4I2A A;  4FO1 A;  1XSL A;  3N28 A;  1OXJ A;  5J8Y C;  1N5W A;  2DR5 A;  2F1J A;  4NXU A;  2B56 A;  4NV0 A;  1UT5 A;  1HJP A;  3PX0 A;  5ALE A;  2W03 A;  2PFP A;  2G07 A;  1TKD A;  2Q0Z X;  3PZP A;  4PJ0 U;  1HIW A;  2L5Y A;  2LHT A;  5J2E A;  5AKZ A;  3D2N A;  1SXD A;  2EAM A;  3WFQ E;  5J0O A;  3C21 A;  2KP7 A;  1MA7 A;  4PHP A;  4ECU A;  3OJU A;  5J2B A;  1SB3 C;  4YMM A;  1PZN A;  3FAH A;  3K4G A;  5F3X B;  4CCH A;  2AXT U;  2J6S A;  3TFR A;  4M9H A;  1NO5 A;  4B9V A;  3T5H A;  5HRG A;  3I76 A;  5AI4 A;  5K4L A;  3ZDD A;  7ICT A;  4FBU A;  4IL6 U;  4QZ8 A;  3H8W A;  3WFO A;  4FZM A;  4DQR A;  4M6W B;  3SMV A;  5CA7 A;  4FS2 A;  4EBK A;  4S3N A;  1F0M A;  4KLS A;  2DVI A;  1SZH A;  2E8M A;  2NRV A;  5KFR A;  1L3U A;  4DOC A;  4O3S A;  9ICE A;  4JLX A;  2FLL A;  1Z1V A;  4I2C A;  2R8H A;  1ZQM A;  2IUB A;  2XID A;  8ICI A;  4QWA A;  4RZR A;  3WU2 U;  4PZN A;  2EAP A;  3RJG A;  3QUB A;  5J2F A;  9ICH A;  2H3Q A;  4KLT A;  4US8 A;  3H38 A;  7ICE A;  2R8K A;  3KKA C;  3PSP A;  2H3Z A;  3ZDB A;  1L7M A;  3BDP A;  3TAR A;  1X9S A;  5HRB A;  4C4S A;  4MFF A;  4EZ9 A;  4F2R A;  1WOT A;  1F44 A;  3RH5 A;  2AU0 A;  4K9A A;  4C8O A;  1L7N A;  4K9B A;  3V6J A;  2W9M A;  1XO0 A;  3C5G A;  1BGX T;  4M6W A;  4XJE A;  4DQS A;  2HOI A;  4RUC A;  1RXV A;  8ICE A;  1SL0 A;  5J0S A;  4BXO A;  2HI0 A;  4ZOH C;  1D8L A;  2EZX A;  5GTH U;  2JZB B;  5KFM A;  4ED3 A;  9ICC A;  2ZIX B;  4PL1 A;  4QJF B;  2VA8 A;  1S77 D;  3QEB Z;  3JPS A;  1H38 A;  5HC9 A;  2C2R A;  3ER8 C;  4TUP A;  1DK2 A;  4J9M A;  5B3P A;  8ICU A;  1IM4 A;  5BOL A;  5HRI A;  2LI6 A;  3SR6 A;  3PHZ A;  4PH5 A;  1ZJN A;  1C20 A;  3RB3 A;  2HHQ A;  3N97 B;  1NI3 A;  2JXJ A;  3TAP A;  2ZH5 A;  2EDU A;  2F44 A;  3Q8M A;  1RYS A;  3AQL A;  4WOY A;  3WK4 A;  1QSY A;  5J8Y A;  3QX7 A;  5AKL A;  1UHU A;  3D6J A;  4DFK A;  3HJ1 A;  1RDF A;  4Y2P A;  1KRP A;  2RFF A;  1XSP A;  2LMR A;  5AM5 A;  4NKU A;  4ICA A;  4ECW A;  4DFD A;  3F53 A;  1HUO A;  4Q43 A;  3PX6 A;  3NTU A;  4PHD A;  5L1K A;  4I28 A;  3MBY A;  5J2C A;  3KZX A;  4IQW A;  2KE7 A;  1DRG A;  7ICI A;  4UB1 A;  2JEJ A;  4R65 A;  1MC8 A;  3KHR A;  4PGX A;  2FPL A;  2ZG6 A;  3AQN A;  3ETR A;  2W8L A;  2NRZ A;  2HHS A;  2HOQ A;  5IIJ A;  3MGI A;  4CRX A;  4WCW A;  1NKC A;  3F2D A;  2B6G A;  4UAS A;  1Q3U A;  1ZQC A;  1Z4N A;  3NVO A;  1KFD A;  2ASD A;  1X2I A;  3OHA A;  3Q8S B;  5AKE A;  5KL8 B;  1PUZ A;  3N7P D;  5AHX A;  1KW4 A;  4C0Z A;  5J2G A;  4LZD A;  4DSL A;  4HX0 A;  1QQ5 A;  4C4R A;  3LQC B;  2EAO A;  1D8B A;  4ECT A;  2G06 A;  2KKP A;  4RU9 A;  2BCQ A;  4O3Q A;  1KDH A;  5DB8 A;  3H8M A;  3GIM A;  3UQ2 A;  3N7R C;  1SZP A;  5B66 U;  2KIV A;  4C4T A;  4O5E A;  2M2W A;  3E0F A;  2LM1 A;  3TAD C;  3ONN A;  5KFB A;  1ZQY A;  1L3T A;  4FHX A;  3OHB A;  4X0B A;  2LBO A;  4WQK A;  2GOL A;  4YMN A;  5HHI A;  2M9N A;  4DQQ A;  2ZUC A;  4Y2J A;  5KFT A;  3GIL A;  4UB4 A;  2N1R A;  4C80 A;  2QB0 B;  9ICB A;  4YQW A;  2FE9 A;  5EWE A;  5HR7 A;  8ICO A;  4C8M A;  1OW5 A;  2ZIV A;  4YXJ A;  4UAW A;  4OD0 A;  3PR4 A;  2UVR A;  3V7K A;  3L9D A;  8ICP A;  3OWG A;  4DFM A;  3OJS A;  1Q78 A;  2MUT B;  3AQE A;  4ECZ A;  4GLX A;  1KKX A;  1ZQP A;  2BPG A;  9ICG A;  4Y2S A;  5AK6 A;  7ICF A;  2AQ0 A;  3CNH A;  4QIW F;  2G5I B;  2KTQ A;  3IM1 A;  4EBC A;  4PHA A;  4LT6 A;  1C7Y A;  1ARO P;  1QTM A;  1MIY A;  3PV8 A;  3AL0 B;  4KMU A;  4DSK A;  4Q45 A;  2NRT A;  4YVZ A;  1JIH A;  4NY8 A;  2HVH A;  2W3R A;  4QZB A;  4JMU A;  3KHL A;  4RQ8 A;  1JX4 A;  4YFK A;  3VC8 A;  1S97 A;  5DED A;  4I2J A;  3ISB A;  5CFT A;  2ISO A;  4FHP A;  4GIB A;  1KBU A;  2B51 A;  3FDS A;  3N7S C;  2MUT A;  5AM4 A;  2FLN A;  2ZTE A;  4R63 A;  2K89 A;  4UAV A;  2PXI A;  4LJX A;  5ALG A;  4C8K A;  3BS5 A;  3H3A A;  3HKZ F;  3IG5 A;  3FM9 A;  4EYH B;  4M9J A;  2P6U A;  2I5H A;  1BNO A;  4WC7 A;  1JMS A;  1ZQQ A;  2FCL A;  9ICJ A;  4B9U A;  2ZH2 A;  4WQL A;  4X4P A;  4F3O A;  4QZD A;  4M0A A;  4F91 B;  4B9S A;  2JMG A;  2Q4T A;  4DOB A;  4CNQ A;  2M2U A;  4NXV A;  4X4U A;  3H37 A;  4DL3 A;  3ETL A;  5J2D A;  1ZD2 P;  4X4O A;  4A8E A;  4RQ2 A;  3SAF A;  1Z4O A;  3MR5 A;  3NKU A;  8ICQ A;  4CF4 A;  2ISP A;  7ICN A;  3NGD A;  5KFH A;  1PVR A;  3TAD A;  2JHD A;  2F77 X;  4GXJ A;  2ZTD A;  1T7P A;  4NXW A;  5AM3 A;  2XY6 A;  4FE3 A;  1ZQJ A;  1ZQG A;  3RRG A;  4OJ5 A;  4KLJ A;  3CRX A;  3D2S A;  2KG5 A;  4KTQ A;  1VJ7 A;  2P35 A;  5CJ7 A;  9ICT A;  3HX0 A;  2O5A A;  4LEV A;  2IBK A;  2IMW P;  2FMP A;  4RNN A;  2KSO B;  4C8L A;  2C2D A;  2I9G A;  4QZC A;  4I2H A;  5KFK A;  2MRL A;  1WUD A;  4YD2 A;  3EPG A;  4RPX A;  2AGP A;  4ED0 A;  3UMC A;  3HIY A;  5AIA A;  4OJL A;  3RB6 A;  4O5K A;  1MN8 A;  3C1Z A;  3PVX A;  5ALN A;  1SXE A;  3SAH A;  4P0P A;  2IOH A;  4R64 A;  2OXO A;  2KNJ A;  5CB1 A;  1F5S A;  5J0Y A;  2VA3 A;  2ZH1 A;  4DS4 A;  2HHP A;  4X4R A;  4Q8F A;  5KT2 A;  4RUA A;  2JV3 A;  4QIW C;  3QEA Z;  4WBY A;  2PMZ F;  3KHH A;  5ALF A;  1MIV A;  8ICW A;  4LEY A;  5AI6 A;  2KVC A;  1ZQV A;  1SKR A;  3IV6 A;  5G5G A;  2JGA A;  2K4E A;  2AH5 A;  2D6F C;  3SYZ A;  4NKT A;  3QU2 A;  2A1A A;  5III A;  1X66 A;  4KIT B;  4MFA A;  1ZD4 A;  4ED7 A;  2Y0S F;  5ALO A;  1T8E A;  5BPC A;  4GC6 A;  4JV2 A;  3RH4 A;  4M9L A;  8ICV A;  3NRW A;  4NL9 A;  1COO A;  2JEG A;  4ACO A;  4FBT A;  4BDP A;  2BQU A;  1O03 A;  1S0V A;  5AM0 A;  1ZJM A;  5KG3 A;  4M47 A;  4E0D A;  3HT3 A;  2DPJ A;  1QQ7 A;  4AYB F;  3HKZ C;  5TZV A;  3T3F A;  5KFQ A;  2CRX A;  2ZH6 A;  1LV5 A;  3T5K A;  2DRA A;  3TAN A;  3IP4 B;  5KG0 A;  1ZQU A;  3FYH A;  2HDO A;  3RR8 A;  5EE3 A;  2J6U A;  4UAZ A;  1SWW A;  2V9W A;  4KLM A;  5T14 A;  2UVW A;  4F4Y A;  4EBD A;  2FMQ A;  8ICY A;  2XO7 A;  3OUY B;  1V9P A;  4RWQ A;  1SL2 A;  4UAR A;  2YB1 A;  5KTQ A;  4RQ6 A;  5ALJ A;  4KLQ A;  9ICR A;  3LYS A;  2JH1 A;  4NLZ A;  4WC2 A;  5J2K A;  3HJE A;  1PX5 A;  5J0P A;  3MGV A;  3UXP A;  3NVY A;  3C1Y A;  3Q8Q B;  4ED6 A;  4OJO A;  3QZ8 A;  4DO9 A;  5AKK A;  2E8P A;  1LKY B;  2B21 A;  4F5R A;  4UAY A;  1TK0 A;  2K8C B;  8ICT A;  5KFF A;  5DEC A;  5FP0 A;  4CF3 A;  4JUZ A;  2NO5 A;  4OCZ A;  1S76 D;  4KB6 A;  1NJW A;  3CYM A;  3BS7 A;  1S9F A;  3NS1 A;  3H0M B;  5ALX A;  3Q8P B;  4ATB B;  4IQT A;  3M8R A;  1XC9 A;  4O67 A;  2ASL A;  1ZXI A;  3DV9 A;  1JQR A;  2O1P A;  4WC0 A;  3OUY A;  3Q8K A;  4E8F A;  2EWR A;  1AQ6 A;  2FJ6 A;  4JV1 A;  2KOB A;  5CRX A;  5F9N A;  3GII A;  4CGZ A;  2LM4 A;  2BCV A;  1UQV A;  2QLT A;  2M2V A;  3OSP A;  3AU6 A;  2J6T A;  2PMZ C;  2JR5 A;  1R8A A;  2DPI A;  2XY5 A;  2ZIW A;  4WH5 A;  4DF8 A;  3LWM A;  3TFS A;  1T3Q A;  2KIC A;  3LVV A;  4G9B A;  2HHT A;  2A19 A;  4BWJ A;  4HAI A;  3L3F X;  1ZQS A;  4WC4 A;  4FO6 A;  2Y0S C;  4QW9 A;  3WKD A;  5ALT A;  1BPX A;  1V38 A;  2JEF A;  3J81 j;  4JWN A;  4YG2 A;  2BBH A;  1L6N A;  5TIS U;  4PGY A;  2WF5 A;  4AT7 A;  3UM9 A;  4BWM A;  4Z6C A;  4ELU A;  4CE6 A;  1TVA A;  5DKW A;  4JV0 A;  2P6R A;  2AHO B;  3NVW A;  3BJY A;  1TFR A;  3WK7 A;  3HWT A;  4K98 A;  3T5L A;  1SL1 A;  1KFS A;  5BOM A;  4AYB C;  3QYP A;  4YXM A;  2HBK A;  2C2E A;  5KG7 A;  2IHO A;  2W04 A;  4UD4 A;  9ICA A;  5J2A A;  1PVP A;  4QZH A;  4KN7 A;  2E5S A;  1F5A A;  1RQL A;  2DKX A;  3SV3 A;  4DL5 A;  3ERC C;  2R8I A;  2Q66 A;  2R18 A;  4P4M A;  3Q8R B;  2BCS A;  4K4I A;  4KLG A;  5DBA A;  2WB1 F;  4UW9 A;  2QAR B;  3PML A;  3OVS A;  1FIQ A;  3WK8 A;  7ICG A;  2BCU A;  3C23 A;  2OH2 A;  4KX3 A;  4DLG A;  4F5O A;  3AQM A;  8ICG A;  1L7O A;  2DKZ A;  4ED1 A;  2K8A A;  5AIC A;  1KN5 A;  1T94 A;  4XQ7 A;  3I28 A;  2KZ3 A;  3KOO A;  1U49 A;  4EGW A;  3TI0 A;  4F4W A;  1B43 A;  5DB9 A;  3G6V A;  2OYY A;  4QZA A;  4UB3 A;  1X42 A;  3BQT A;  3R9K A;  2HVI A;  4IS7 A;  4C7Y A;  5KT6 A;  3M6Z A;  3ICX A;  4PHE A;  5KFV A;  2LYA A;  3RJJ A;  5KFE A;  5DGA A;  2PFQ A;  2DR8 A;  5E79 U;  1JRP A;  4M5D A;  2W9B B;  5DQG A;  3KBB A;  5DLG A;  3GV7 B;  5KFA A;  4DL2 A;  4F2S A;  1L7P A;  3JPN A;  1KNY A;  2HHV A;  3WFP A;  4Q8E A;  2AGO A;  2OCE A;  2XVT A;  4K4G A;  3ISD A;  3NWI A;  4G3I A;  2H5X A;  4RQ7 A;  1WYG A;  4E80 A;  1U45 A;  5HRL A;  2I6X A;  3GIJ A;  4UAT A;  5KG5 A;  4YR3 A;  4F8R A;  4NLK A;  5AI8 A;  1COK A;  5ALL A;  5ALD A;  1ZQZ A;  4RQN A;  4RT2 A;  1SV4 A;  4P0Q B;  4PPX A;  4EZ6 A;  1DK3 A;  2PFO A;  4I2D A;  2PI5 A;  1U9L A;  2JZB A;  4ECS A;  1VFG A;  1JI7 A;  3H40 A;  2WF9 A;  2ZIX A;  4NM2 A;  1Q46 A;  5AM2 A;  1ECW A;  5CR0 A;  1UEV A;  3F5E A;  3PR5 B;  5KFC A;  2PI4 A;  4RPY A;  3Q8L A;  3DDH A;  1L3V A;  4QZE A;  9ICI A;  5AK3 A;  3LVW A;  5IIO A;  1T3N A;  4X4V A;  3QNM A;  3JZ0 A;  4Y2Y A;  1ZQE A;  5C5J A;  1N48 A;  4DOA A;  3RB4 A;  4DQP A;  5CHG A;  3ZDA A;  2K60 A;  4K99 A;  4NXX A;  4DSE A;  2WB1 C;  5CWR A;  3V7L A;  3AEV A;  5ALK A;  4EEB A;  4UB8 U;  3G6Y A;  1Z3E B;  2E8O A;  3MFI A;  3ALR A;  4MEY A;  2NYV A;  4LZG A;  1RG6 A;  3TAQ A;  1X6J A;  4OAG A;  3C28 A;  2E1E A;  4B9T A;  3KKA A;  3QU9 A;  4OAF A;  4X5V A;  3AN1 A;  3M1Y A;  8ICK A;  2JEI A;  2BQ3 A;  5JTG A;  2KHV A;  2B0C A;  4B9N A;  3S6J A;  2ATL A;  2DGZ A;  5AI5 A;  4RNM A;  3RBE A;  4O5C A;  1QH9 A;  1L3S A;  4QZ9 A;  2HBM A;  4J9Q A;  4DL6 A;  3RR7 A;  4FH5 A;  1VJ5 A;  2D3D A;  2EAN A;  3RF9 A;  4I27 A;  4DFP A;  4DWI A;  5KT7 A;  3M7D A;  3TAC B;  1K1S A;  1TFY A;  2HCF A;  3AM9 A;  2DUY A;  3RFA A;  4EP7 A;  5D46 A;  5B3Q A;  2KV2 A;  3ORY A;  2E8N A;  3OVA A;  2YY6 A;  4WC5 A;  3SEI A;  4IRD A;  2K8B B;  3UXN A;  5HML A;  2V4R A;  1Q79 A;  1TAQ A;  4F4K A;  1FEZ A;  4WC3 A;  2DWQ A;  4RWP A;  1ZQX A;  5KFG A;  3K75 D;  3C5F A;  1TK5 A;  3CK6 A;  4BX9 C;  5AKX A;  4EEL A;  4KN4 A;  4AT8 B;  4DSJ A;  5HNK A;  1WG8 A;  2BQR A;  4BJQ A;  3PW4 A;  2DRB A;  5HRF A;  3RTV A;  2QB0 A;  1M6Y A;  1QQ6 A;  4RQ5 A;  9ICW A;  3QZ7 A;  4FS1 A;  2K4P A;  4ED2 A;  1JAJ A;  4GC7 A;  1SIJ A;  3RAQ A;  5ALM A;  8ICS A;  3GU3 A;  1U47 A;  5AIB A;  3GFK B;  4TUS A;  4IC9 A;  4WBZ A;  1XWL A;  2FPM A;  2W8K A;  1RYR A;  3PW7 A;  2ZXI A;  3WFR E;  4P4P A;  5IIN A;  4JLZ A;  1U48 A;  3RJF A;  3MC1 A;  1NZP A;  4QWC A;  4DL4 A;  3TQ1 A;  1L8L A;  4QWB A;  4K97 A;  2DF4 B;  1BPE A;  2KKV A;  1UET A;  3WK6 A;  3QE9 Y;  9ICV A;  4I2B A;  4WC1 A;  2KZZ A;  2UVU A;  2R8J A;  1MSW D;  3ZI4 A;  2VIX A;  2QKQ A;  4K4H A;  1NOM A;  3CP8 A;  4IRC A;  4NLN A;  9ICQ A;  1NJX A;  1HEK A;  3JPP A;  2V4Q A;  5DB6 A;  2GH1 A;  2YX8 A;  1LB2 B;  2YMQ A;  2XGQ A;  1YLQ A;  3OV7 A;  4YP3 A;  3IRU A;  1KSP A;  3AU2 A;  3ZD8 A;  3AMZ A;  3QUQ A;  1PK1 B;  1RYU A;  5AM1 A;  2AQ4 A;  3GDX A;  5KFO A;  4F4X A;  2HHW A;  2BDU A;  2ZH3 A;  5KT3 A;  4UB2 A;  2KJ8 A;  2NRX A;  4E7X A;  8ICM A;  4US9 A;  3DEE A;  3IHQ B;  4YMO A;  4F50 A;  2XY7 A;  1QSL A;  5ALR A;  4UBC A;  4IR9 A;  4EV6 A;  4DCC A;  2MA1 A;  5KFJ A;  1D9D A;  5CHE A;  3UMB A;  5KFU A;  3SZ2 A;  2BPF A;  4EED A;  1NNL A;  3HIL A;  4KLH A;  4TUQ A;  3LDA A;  5D49 A;  4F5P A;  1SV0 C;  1BVS A;  5HR6 A;  1ZQL A;  2OWO A;  4EX7 A;  2DR9 A;  3SAG A;  1S0O A;  2HN1 A;  3H4B A;  2F76 X;  5KFI A;  4NXT A;  1ZQ1 C;  4QWD A;  1CUK A;  3O0F A;  4MKP A;  1A77 A;  1S0N A;  3WK5 A;  3MAB A;  2Y1J A;  3OPX A;  2NO4 A;  1PK1 A;  5KAI U;  2VKQ A;  2ZH9 A;  1S10 A;  4BGD A;  3BQ7 A;  1T4G A;  1CI4 A;  3GIK A;  1X9M A;  3F2B A;  2KIW A;  2KHQ A;  2YMM A;  2ZIU B;  1ZQD A;  4WJ3 B;  1NJY A;  2XI9 A;  2E3T A;  2KFZ A;  3BQ0 A;  4RQM A;  4Q44 A;  2EQY A;  2KSO A;  2RDI A;  3GV8 B;  2DFL A;  5HHH A;  4O3M A;  5AI9 A;  2LYB A;  2ZJ8 A;  1NK6 A;  1XNS A;  1UA0 A;  1JAL A;  4GXK A;  1S5L U;  3NVZ A;  2BGW A;  4DSI A;  3H7I A;  1IXR A;  3UMG A;  5L9X A;  4F93 B;  5D62 A;  3QU4 A;  5G5H A;  2KFN A;  7ICV A;  1XO1 A;  4ELV A;  3G6X A;  7ICQ A;  1JRO A;  4M04 A;  1RZT A;  5D61 A;  2PKE A;  2W9C B;  8ICZ A;  2ZHA A;  5DLF A;  5J29 A;  5J0U A;  2WAQ F;  3BQ1 A;  3OGU A;  9ICF A;  3HW8 A;  2XCP A;  2NRW A;  2ZH4 A;  3OTQ A;  1QSS A;  3M9N B;  5KG1 A;  3MR2 A;  2F2A B;  1TAU A;  3EF2 A;  4AP9 A;  2VA2 A;  2RDJ A;  2FDR A;  1L5U A;  1NKB A;  1YT3 A;  4YR2 A;  3H4D A;  2XGP A;  5AK4 A;  1GO3 F;  3L4P A;  4J9R A;  3L5K A;  5J2I A;  9ICU A;  2O6K A;  1ZQF A;  4C7Z A;  3THV A;  5L1J A;  2YN4 A;  9ICX A;  4J9O A;  1MQ3 A;  1A0P A;  5HP4 A;  2CPR A;  4C8N A;  1J2N A;  9ICM A;  2W9C A;  2AGQ A;  2VJ5 A;  4EYI B;  3WFS C;  3HPO A;  2EZZ A;  5DG7 A;  2P66 A;  1X40 A;  5ALV A;  5JRT A;  4JK1 A;  1FFV A;  1SV0 A;  4LVS A;  5EE9 A;  5KFN A;  2H3F A;  3LWL A;  8ICX A;  4ECQ A;  1NJZ A;  5H2F U;  2AJQ A;  4LEZ A;  2W7O A;  4YN4 A;  1B0X A;  1WCN A;  5JTI A;  3WKB A;  4DF4 A;  1B4F A;  1KEJ A;  2H3V A;  1KLN A;  1JUD A;  5J0X A;  4ECV A;  1DGS A;  5DB7 A;  1LKY A;  5HRK A;  4IQU A;  5KFX A;  1BPY A;  2RHF A;  8ICR A;  1N62 A;  1WWU A;  2GWS A;  4EEK A;  1XS9 D;  4I2I A;  1MQ2 A;  4NLC A;  3PW2 A;  2W43 A;  7ICR A;  3PY8 A;  4OJ6 A;  4FHY A;  4ATB A;  3KD3 A;  3TKA A;  4M2Y A;  1NKE A;  2R8G A;  1QLN A;  2GA9 D;  1UA1 A;  1JN3 A;  3M6K A;  2YTU A;  4Y2T A;  2HMX A;  3M8S A;  4I2E A;  2HSZ A;  4ELT A;  2W3S A;  5HRD A;  2OEH A;  3H0L B;  1NZB A;  2KJ9 A;  2OM6 A;  3U26 A;  4CF5 A;  4ECX A;  4R66 A;  5KFS A;  1YZ7 A;  9ICP A;  3JPT A;  2WAQ C;  4LEW A;  1RQN A;  2NV3 A;  1ZQI A;  1FA0 A;  1XU4 A;  3V6H A;  3WKC A;  8ICN A;  2BDP A;  4EX6 A;  4OAI Z;  1B22 A;  2XIC A;  2F1H A;  3QUT A;  2BKE A;  5J0Q A;  4I29 A;  3SEN A;  1Q8K A;  1N56 A;  5J0R A;  4KLO A;  1ZD3 A;  2YQE A;  5DDY A;  3RJH A;  5IIL A;  4BXO B;  2K4H A;  3H8S A;  5ALY A;  1LVH A;  1YZ6 A;  3KFU F;  5AK5 A;  3LK9 A;  2DBY A;  3AUO A;  2DL0 A;  2ZJA A;  4Z6F A;  4J9P A;  5KG2 A;  1R8B A;  3K1R B;  3K1Z A;  4F4Z A;  4FH3 A;  4KLF A;  3ZDE A;  3PW5 A;  5L1M A;  4RT3 A;  2ODG A;  2W7P A;  1R8C A;  2CN1 A;  2KJ5 A;  2W11 A;  1S0M A;  4RWO A;  3JCF A;  1XSN A;  4ECY A;  3A0H U;  3HJ4 A;  2QAR A;  5IIK A;  5L1I A;  2IA6 A;  4X4S A;  2Y9U A;  2HN2 A;  5ALS A;  5DGB A;  5KT5 A;  3PSF A;  3V72 A;  4F5Q A;  1BPD A;  4UB5 A;  2W55 A;  4RQ4 A;  1ZQR A;  3B9J A;  1ZD5 A;  2F1I A;  2MSN A;  5GTI U;  5KFY A;  3M9M B;  1NK7 A;  3A0B U;  3B0Y A;  5KFL A;  4NWI A;  5AI0 A;  4IQV A;  1K5O A;  4RPZ A;  1RXW A;  4O3O A;  4ZH4 A;  4RQ1 A;  1ZYQ A;  2VAN A;  3RJK A;  2GO7 A;  5KT4 A;  3NRZ A;  4FZN A;  3QU5 A;  3RJE A;  2YML A;  1X6I A;  1VLB A;  1FFU A;  5AKY A;  2W9A A;  1R89 A;  1X9X A;  2W9B A;  2F8L A;  2EZY A;  5EE1 A;  3C66 A;  2Y9T A;  1DOQ A;  5KNI A;  2LPE A;  4XA5 A;  2KVS A;  2M2T A;  5J2J A;  5EE0 A;  3RAX A;  4X4T A;  4EEN A;  5KFW A;  5F9L A;  2WTF A;  4KLU A;  5KG4 A;  5AKJ A;  5ALI A;  3SI8 A;  4XUS A;  3N4M B;  3KHG A;  7ICO A;  3T79 A;  4NM1 A;  4X4N A;  4FZL A;  4JWM A;  5C0Y A;  1S8O A;  4KLL A;  4Z6D A;  4M9N A;  4O9M A;  3H8J A;  1SKS A;  3EYZ A;  4UBB A;  7ICK A;  4TQS A;  4KX5 A;  4EEY A;  4I2G A;  2IOF K;  3IN5 A;  1ZQN A;  2K4I A;  5F2V O;  5KFD A;  4O0I A;  2Y1I A;  1UT8 A;  4P0Q A;  1L8O A;  1JXE A;  3F2C A;  4EBJ A;  1D8Y A;  3VCB A;  2XC9 A;  2KD1 A;  1A76 A;  4IRK A;  2RLT A;  4OO1 J;  1V85 A;  4P2H A;  2BCR A;  5EWF A;  1NK9 A;  7ICS A;  2ES6 A;  1V4A A;  2QB1 A;  2OHF A;  2CXY A;  1N2X A;  3JPQ A;  1Z00 B;  2WF7 A;  5EWG A;  2ZIV B;  5DG8 A;  2W54 A;  2EH9 A;  4U7C A;  1CRX A;  5HMM A;  2ZXH A;  1RM6 C;  2RP5 A;  4K96 A;  3SD7 A;  3M9O B;  1P7D A;  4DL7 A;  2ASJ A;  4NLB A;  4XRH A;  2KEY A;  4USA A;  4QZI A;  2RRD A;  2JH7 A;  4WC6 A;  1ED1 A;  2YB4 A;  4F92 B;  4QZF A;  4BUG A;  1DXS A;  4DS5 A;  4KLI A;  3CW2 C;  1OU5 A;  2ID1 A;  2FPK A;  1PK3 A;  4B6J A;  4NLG A;  2WHE A;  3BZC A;  4J9N A;  1Z00 A;  4N7R A;  1ZQA A;  5JUM A;  1IV8 A;  5D63 A;  1URJ A;  4OAH A;  4UAU A;  4YD1 A;  2IHM A;  4I2F A;  2DQN B;  4XQ8 A;  1NK4 A;  3JPR A;  3SQI A;  4QW8 A;  3ED5 A;  3UQ0 A;  1SWV A;  3AQK A;  8ICJ A;  4MF8 A;  2ZUD A;  4RQ0 A;  4FHV A;  5ALW A;  5D4B A;  1SGG A;  3E2E A;  3BS5 B;  2UVV A;  4DEZ A;  1Z19 A;  1IG6 A;  9ICK A;  4MHV A;  5DQI A;  3GV5 B;  1J2M A;  4J9L A;  4UQG A;  4UB6 U;  2WFA A;  3MDA A;  3ER9 B;  1RPL A;  2F3N A;  1NK5 A;  1V97 A;  2HOF A;  2F8K A;  8ICF A;  3C18 A;  3T5J A;  5CFU A;  1MIW A;  4Z6E A;  5DG9 A;  2KK0 A;  3NYB A;  3UXO A;  4NXZ A;  4UD5 A;  3PO5 A;  4O68 A;  4TQR A;  2HBJ A;  3MR3 A;  5HR9 A;  3MR6 A;  4NL9 C;  1Y88 A;  3NVV A;  2BBJ A;  3EUB 2;  2FMS A;  4KLE A;  2ZTC A;  4J9K A;  4AT8 A;  2MAX A; 
#chains in the Genus database with same CATH homology
 3HW8 A;  2XCP A;  8ICC A;  1F5A A;  4DL5 A;  1ZQC A;  3SV3 A;  2NRW A;  2R8I A;  1ZQT A;  2Q66 A;  1KFD A;  1NK0 A;  2ZH4 A;  2ASD A;  1TFW A;  1X2I A;  3OHA A;  3Q8S B;  2A1J B;  1K1Q A;  8ICA A;  4P4M A;  3Q8R B;  2BCS A;  1QSS A;  4K4I A;  5DBA A;  4KLG A;  3M9N B;  2ZH7 A;  3SV4 A;  5KG1 A;  3RRH A;  3B0X A;  3MR2 A;  4X0A A;  1TAU A;  2VA2 A;  3PML A;  2RDJ A;  3OVS A;  1L5U A;  1BPB A;  1NKB A;  4DQI A;  5J2G A;  4GXI A;  4YR2 A;  3H4D A;  3ISC A;  2BCU A;  7ICG A;  9ICS A;  2XGP A;  4LZD A;  4QZH A;  2ZH9 A;  4DSL A;  2C22 A;  3C23 A;  5J2H A;  2NRK A;  4DLG A;  1HUZ A;  4F5O A;  4DLE A;  3AQM A;  4MFC A;  8ICG A;  4J9R A;  4ED1 A;  3LQC B;  5J2I A;  9ICU A;  1X9W A;  1ZQF A;  4XQ7 A;  2KZ3 A;  4ECT A;  3THV A;  2DR7 A;  5L1J A;  4J9S A;  4RU9 A;  2BCQ A;  4O3Q A;  1U49 A;  1KDH A;  5DB8 A;  3TI0 A;  4F4W A;  3PO4 A;  3ZDC A;  1B43 A;  5DB9 A;  9ICX A;  3GIM A;  3G6V A;  3UQ2 A;  4QZA A;  3MGH A;  4UB3 A;  4J9O A;  1BPZ A;  1SZP A;  1SKW A;  1MQ3 A;  3BQT A;  2HVI A;  4O5E A;  2M2W A;  5HP4 A;  4C8N A;  5KT6 A;  3GQC A;  9ICM A;  3UPQ A;  4PHE A;  5KFV A;  2W9C A;  5KFB A;  1ZQY A;  4F5N A;  2AGQ A;  1L3T A;  3RJJ A;  4FHX A;  3OHB A;  3C2M A;  5KFE A;  7ICU A;  4X0B A;  4HYK A;  4EYI B;  5DGA A;  3RB0 A;  3WFS C;  3ZD9 A;  3HPO A;  2PFQ A;  2DR8 A;  3EW9 A;  5DG7 A;  1ZET A;  2P66 A;  4YMN A;  4M5D A;  2W9B B;  5DQG A;  5HHI A;  2M9N A;  4JK1 A;  4DQQ A;  2ZUC A;  2A1J A;  4LVS A;  4FHW A;  4B9L A;  3UPS A;  2FLP A;  5KFT A;  5DLG A;  5KFN A;  3LWL A;  5KFA A;  3GIL A;  3GV7 B;  3RH6 A;  5DQH A;  4UB4 A;  4ECQ A;  4P4O A;  1NJZ A;  8ICX A;  2AJQ A;  1ZQO A;  9ICB A;  4DL2 A;  4YN4 A;  1WCN A;  4YQW A;  5EWE A;  4DF4 A;  1D9F A;  4F2S A;  8ICH A;  8ICO A;  2ZUB A;  4C8M A;  5EOZ A;  3JPN A;  2HHV A;  1KNY A;  2XCA A;  3WFP A;  1CEZ A;  2ZHB A;  1KEJ A;  4YXJ A;  4UAW A;  5J0W A;  3PR4 A;  1KLN A;  3C2L A;  2UVR A;  4Q8E A;  4DSF A;  3V7K A;  4IG8 A;  2AGO A;  5J0X A;  8ICP A;  4ECV A;  3L9D A;  4K4G A;  7ICK A;  3ISD A;  1DGS A;  4R8U B;  5DB7 A;  5HRK A;  4DFM A;  4G3I A;  4IQU A;  5KFX A;  2H5X A;  3OJS A;  1BPY A;  1Q78 A;  2MUT B;  3MDC A;  4RQ7 A;  3JPO A;  4E80 A;  7ICM A;  4ECZ A;  4GLX A;  1U45 A;  5HRL A;  1ZQP A;  3PX4 A;  3GIJ A;  1ZQB A;  2BPG A;  8ICR A;  4O3N A;  7ICP A;  2GWS A;  3H39 A;  5KG5 A;  9ICG A;  5J0T A;  2HW3 A;  4YR3 A;  5KFP A;  4F8R A;  7ICF A;  4NLK A;  1XS9 D;  4I2I A;  5CP2 A;  2AQ0 A;  1MQ2 A;  1ZQZ A;  4RT2 A;  2HHX A;  3PW2 A;  2KTQ A;  2BR0 A;  3IM1 A;  4EBC A;  4PPX A;  4QZG A;  4EZ6 A;  2ZH8 A;  7ICR A;  1DK3 A;  3PY8 A;  4PHA A;  2PFO A;  1C7Y A;  3V6K A;  4FHY A;  1ARO P;  4M2Y A;  7ICL A;  4LT6 A;  5HRE A;  4ATB A;  4I2D A;  1QTM A;  1NKE A;  2R8G A;  2PI5 A;  3PV8 A;  1QLN A;  1U9L A;  1MIY A;  1U4B A;  2BPC A;  4KMU A;  2JZB A;  4ECS A;  1UA1 A;  4DSK A;  2PBE A;  1VFG A;  4RQ3 A;  4Q45 A;  4TUR A;  7ICJ A;  3H40 A;  1KTQ A;  2NRT A;  1JIH A;  4YVZ A;  4NM2 A;  1JN3 A;  4NY8 A;  2HVH A;  4QZB A;  5CR0 A;  1UEV A;  3JYY A;  2PFN A;  3HP6 A;  3PR5 B;  3M8S A;  3KHL A;  4I2E A;  4AT9 B;  4RQ8 A;  5KFC A;  2PI4 A;  4RPY A;  4YFK A;  2ALZ A;  1JX4 A;  1S97 A;  3Q8L A;  1ZQK A;  1L3V A;  4ELT A;  5DED A;  4I2J A;  5HRD A;  7ICH A;  3ISB A;  4QZE A;  4O3P A;  9ICI A;  4ECX A;  2ISO A;  5IIO A;  4R66 A;  5KFS A;  4FHP A;  1T3N A;  9ICP A;  4X4V A;  1JXL A;  3JZ0 A;  3JPT A;  3OVB A;  4R8U A;  4PGQ A;  3FDS A;  1ZQI A;  1FA0 A;  1ZQE A;  1XU4 A;  5C5J A;  3V6H A;  1N48 A;  2MUT A;  2BE3 A;  4DOA A;  2FLN A;  3RB4 A;  9ICN A;  8ICN A;  2ZTE A;  4DQP A;  4R63 A;  2BDP A;  2PXI A;  4RNO A;  3PW0 A;  5CHG A;  3ZDA A;  4C8K A;  3V7J A;  4DFJ A;  4DSE A;  1B22 A;  3H3A A;  4EYH B;  5CWR A;  4M9J A;  4M9G A;  2F1H A;  3V7L A;  2P6U A;  5HRH A;  2BKE A;  5J0Q A;  1ZQW A;  4I29 A;  1BNO A;  3G6Y A;  4ED8 A;  4MEX A;  1N56 A;  1Z3E B;  4WC7 A;  5DBC A;  3MFI A;  1JMS A;  1ZQQ A;  1ZQH A;  9ICJ A;  1WCL A;  5J0R A;  3RBD A;  4MEY A;  1NK8 A;  4B9U A;  3RJI A;  4KLO A;  2ZH2 A;  4LZG A;  4MF2 A;  4X4P A;  4YR0 A;  4F3O A;  4QZD A;  3TAQ A;  4KLL A;  3PMN A;  5DDY A;  4M0A A;  3RJH A;  5IIL A;  4F91 B;  4B9S A;  4B9T A;  8ICB A;  4BXO B;  2ZJ5 A;  2KZM A;  4DOB A;  2M2U A;  3H8S A;  4X4U A;  2C28 A;  3H37 A;  4O3R A;  3LK9 A;  3AUO A;  4DL3 A;  4X5V A;  2ZJA A;  3ETL A;  4Z6F A;  5J2D A;  5L1L A;  4X4O A;  3EZ5 A;  4AT9 A;  8ICK A;  2JEI A;  2BQ3 A;  4RQ2 A;  4J9P A;  3MR5 A;  5KG2 A;  1R8B A;  9ICL A;  8ICQ A;  4B9N A;  2ISP A;  5DDM A;  7ICN A;  3NGD A;  5KFH A;  4F4Z A;  4QWE A;  4FH3 A;  2ATL A;  3ZDE A;  3OSN A;  3PW5 A;  4KLF A;  2I1Q A;  4IR1 A;  4EBE A;  2HHU A;  4RT3 A;  2ZTD A;  3BQ2 A;  4GXJ A;  4RNM A;  3RBE A;  1TK8 A;  2XY6 A;  1T7P A;  9ICO A;  1ZQJ A;  4RWN A;  1ZQG A;  4O5C A;  3RRG A;  1KFT A;  4KLJ A;  1R8C A;  1L3S A;  4QZ9 A;  4J9Q A;  4DL6 A;  2KN7 A;  5IIM A;  1BNP A;  4KTQ A;  1VJ7 A;  3RR7 A;  4FH5 A;  1S0M A;  4I27 A;  8ICL A;  5CJ7 A;  4DFP A;  3HX0 A;  4DWI A;  9ICT A;  5KT7 A;  4ECR A;  1UEU A;  3MFH A;  1XSN A;  2O5A A;  4RWO A;  4ECY A;  4YCX A;  3HJ4 A;  1K1S A;  2IBK A;  5IIK A;  4X4Q A;  5L1I A;  1TFY A;  2IA6 A;  1TV9 A;  2IMW P;  2FMP A;  4X4S A;  4RNN A;  3C2K A;  4C8L A;  2C2D A;  5KFZ A;  2I9G A;  3KTQ A;  4QZC A;  3EWA A;  4EP7 A;  4I2H A;  1EXN A;  5KFK A;  5DGB A;  5KG6 A;  5D46 A;  5KT5 A;  4YD2 A;  3PNC A;  3ORY A;  3EPG A;  4RPX A;  3V72 A;  4F5Q A;  1BPD A;  4UB5 A;  3OVA A;  4RQ4 A;  4ED0 A;  2AGP A;  1ZQR A;  4KLD A;  4B9M A;  3HIY A;  2F1I A;  4WC5 A;  3RB6 A;  4IRD A;  4AT7 B;  4M47 A;  4O5K A;  3C1Z A;  3UXN A;  5HML A;  2V4R A;  3EPI A;  3PVX A;  1Q79 A;  2BHN A;  1TAQ A;  5KFY A;  3M9M B;  1NK7 A;  4F4K A;  2IHN A;  3B0Y A;  5KFL A;  4R64 A;  4IQV A;  1NKC A;  4RPZ A;  5CB1 A;  1RXW A;  5J0Y A;  4WC3 A;  2LYH A;  2VA3 A;  2ZH1 A;  4O3O A;  4DS4 A;  4RWP A;  1ZQX A;  2HHP A;  4ZH4 A;  4RQ1 A;  1ZYQ A;  4Q8F A;  2VAN A;  4X4R A;  5KFG A;  3RJK A;  5KT2 A;  4RUA A;  3K75 D;  5KT4 A;  3C5F A;  3QEA Z;  4WBY A;  3KHH A;  1MIV A;  1TK5 A;  8ICW A;  3RJE A;  5DBB A;  4KN4 A;  4I2A A;  1ZQV A;  1SKR A;  2W9A A;  5HNK A;  1XSL A;  4DSJ A;  2W9B A;  1R89 A;  4AT8 B;  2F1J A;  2DR5 A;  2BQR A;  3SYZ A;  1UT5 A;  3PW4 A;  5HRF A;  4NKT A;  5III A;  2DRB A;  1HJP A;  3C66 A;  3RTV A;  3PX0 A;  1DOQ A;  2PFP A;  4XA5 A;  4KIT B;  4MFA A;  1TKD A;  2M2T A;  5J2J A;  4ED7 A;  4RQ5 A;  1T8E A;  3RAX A;  3QZ7 A;  5BPC A;  9ICW A;  2Q0Z X;  4GC6 A;  4X4T A;  4FS1 A;  4ED2 A;  4JV2 A;  3RH4 A;  4M9L A;  5KFW A;  8ICV A;  1JAJ A;  5F9L A;  2WTF A;  4GC7 A;  4KLU A;  5J2E A;  5KG4 A;  3RAQ A;  3SI8 A;  4XUS A;  3N4M B;  8ICS A;  3KHG A;  1COO A;  7ICO A;  5J0O A;  1U47 A;  2JEG A;  3C21 A;  3WFQ E;  4NM1 A;  2KP7 A;  3GFK B;  4PHP A;  4ECU A;  4JWM A;  4TUS A;  4X4N A;  4WBZ A;  4FBT A;  3OJU A;  1XWL A;  4Z6D A;  4BDP A;  2BQU A;  2FPM A;  5J2B A;  4M9N A;  4YMM A;  2W8K A;  1RYR A;  3PW7 A;  4O9M A;  1S0V A;  1PZN A;  3H8J A;  3K4G A;  3WFR E;  1ZJM A;  5KG3 A;  3EYZ A;  4UBB A;  4P4P A;  5IIN A;  1SKS A;  1U48 A;  3RJF A;  4CCH A;  4TQS A;  2J6S A;  4E0D A;  3TFR A;  4M9H A;  1NO5 A;  3HT3 A;  4EEY A;  2DPJ A;  4B9V A;  3T5H A;  5HRG A;  5TZV A;  1NZP A;  4QWC A;  3T3F A;  4DL4 A;  3TQ1 A;  4QWB A;  4I2G A;  5KFQ A;  2ZH6 A;  1LV5 A;  3ZDD A;  1ZQN A;  7ICT A;  3T5K A;  4FBU A;  2DRA A;  3TAN A;  5F2V O;  4QZ8 A;  5KFD A;  3H8W A;  3WFO A;  5KG0 A;  1BPE A;  4O0I A;  4DQR A;  2Y1I A;  1UET A;  1UT8 A;  1ZQU A;  3FYH A;  4M6W B;  3QE9 Y;  5CA7 A;  9ICV A;  3RR8 A;  4I2B A;  2J6U A;  1JXE A;  4UAZ A;  4FS2 A;  4WC1 A;  4EBK A;  2V9W A;  4EBJ A;  1D8Y A;  4KLM A;  2KZZ A;  2XC9 A;  2UVU A;  4KLS A;  4S3N A;  2UVW A;  2R8J A;  2DVI A;  4F4Y A;  1MSW D;  1A76 A;  2NRV A;  5KFR A;  4EBD A;  4IRK A;  1L3U A;  2FMQ A;  4K4H A;  1NOM A;  8ICY A;  4P2H A;  4DOC A;  2BCR A;  4O3S A;  9ICE A;  2XO7 A;  3BQ1 A;  4IRC A;  3OUY B;  5EWF A;  1NK9 A;  1V9P A;  4NLN A;  7ICS A;  4RWQ A;  9ICQ A;  1SL2 A;  1NJX A;  2FLL A;  4I2C A;  5KTQ A;  4RQ6 A;  3JPP A;  5DB6 A;  2V4Q A;  2R8H A;  1LB2 B;  8ICT A;  1ZQM A;  1V4A A;  3JPQ A;  8ICI A;  4QWA A;  4RZR A;  2XGQ A;  4KLQ A;  9ICR A;  1Z00 B;  1YLQ A;  3OV7 A;  4YP3 A;  5EWG A;  3RJG A;  4NLZ A;  5J2F A;  1KSP A;  9ICH A;  3AU2 A;  3ZD8 A;  4WC2 A;  5J2K A;  4KLT A;  1PX5 A;  5DG8 A;  5J0P A;  3UXP A;  7ICE A;  2R8K A;  3H38 A;  3C1Y A;  3Q8Q B;  4ED6 A;  3ZDB A;  3QZ8 A;  2AQ4 A;  3GDX A;  5HMM A;  3BDP A;  5KFO A;  4F4X A;  4DO9 A;  3TAR A;  1X9S A;  5HRB A;  2B21 A;  4F5R A;  1TK0 A;  4UAY A;  4EZ9 A;  3M9O B;  4F2R A;  4MFF A;  2HHW A;  5KFF A;  2ZH3 A;  5KT3 A;  4UB2 A;  5DEC A;  1WOT A;  2NRX A;  3RH5 A;  2AU0 A;  4E7X A;  4C8O A;  8ICM A;  4DL7 A;  2ASJ A;  4JUZ A;  3IHQ B;  4YMO A;  4F50 A;  4XRH A;  2XY7 A;  4UBC A;  1QSL A;  3V6J A;  2W9M A;  4IR9 A;  1S76 D;  5KFJ A;  1D9D A;  3C5G A;  1BGX T;  4M6W A;  5KFU A;  1NJW A;  3SZ2 A;  4DQS A;  4QZI A;  4RUC A;  1RXV A;  4WC6 A;  8ICE A;  1S9F A;  2BPF A;  1SL0 A;  5J0S A;  4KLH A;  3Q8P B;  4ATB B;  4IQT A;  4TUQ A;  4BXO A;  3LDA A;  3M8R A;  4F92 B;  1D8L A;  5D49 A;  4QZF A;  1XC9 A;  4F5P A;  2ASL A;  2JZB B;  1BVS A;  1JQR A;  5KFM A;  2O1P A;  4DS5 A;  4KLI A;  4WC0 A;  3OUY A;  4ED3 A;  3Q8K A;  2FPK A;  1ZQL A;  2OWO A;  4NLG A;  9ICC A;  1OU5 A;  2ID1 A;  4JV1 A;  4E8F A;  2DR9 A;  4J9N A;  1S0O A;  2VA8 A;  1S77 D;  3H4B A;  5F9N A;  3QEB Z;  5KFI A;  3JPS A;  3GII A;  1H38 A;  4QWD A;  2C2R A;  2BCV A;  5HC9 A;  4TUP A;  1CUK A;  1DK2 A;  1Z00 A;  4J9M A;  2M2V A;  8ICU A;  1IM4 A;  5BOL A;  3OSP A;  3AU6 A;  1ZQA A;  1A77 A;  5HRI A;  1S0N A;  5JUM A;  2J6T A;  3MAB A;  2Y1J A;  4PH5 A;  1ZJN A;  1R8A A;  3RB3 A;  2HHQ A;  2DPI A;  3N97 B;  2XY5 A;  3TAP A;  2ZH5 A;  4YD1 A;  1S10 A;  2IHM A;  4BGD A;  3Q8M A;  1RYS A;  3AQL A;  4I2F A;  4XQ8 A;  1NK4 A;  4DF8 A;  3JPR A;  4QW8 A;  3AQK A;  3UQ0 A;  8ICJ A;  1T4G A;  4MF8 A;  3GIK A;  3LWM A;  2ZUD A;  3TFS A;  1X9M A;  4DFK A;  1QSY A;  4RQ0 A;  1KRP A;  2HHT A;  3HJ1 A;  4FHV A;  1ZQD A;  2RFF A;  5D4B A;  4BWJ A;  1XSP A;  1NJY A;  3E2E A;  2KFZ A;  4NKU A;  3BQ0 A;  4ECW A;  1ZQS A;  2UVV A;  4WC4 A;  4FO6 A;  4Q44 A;  1HUO A;  4DEZ A;  4Q43 A;  4QW9 A;  9ICK A;  1BPX A;  3PX6 A;  2JEF A;  4JWN A;  3NTU A;  2RDI A;  4PHD A;  3GV8 B;  5L1K A;  4I28 A;  5DQI A;  2DFL A;  3MBY A;  5HHH A;  5J2C A;  4YG2 A;  3GV5 B;  4IQW A;  2ZJ8 A;  4PGY A;  4J9L A;  4UQG A;  4AT7 A;  1NK6 A;  4BWM A;  3MDA A;  7ICI A;  4Z6C A;  4ELU A;  1RPL A;  4UB1 A;  1TVA A;  1UA0 A;  2JEJ A;  4R65 A;  5DKW A;  4JV0 A;  1NK5 A;  4GXK A;  1MC8 A;  3BJY A;  3KHR A;  1TFR A;  4PGX A;  2BGW A;  2P6R A;  4DSI A;  3H7I A;  8ICF A;  3C18 A;  2FPL A;  3HWT A;  3T5L A;  1IXR A;  3T5J A;  3AQN A;  1SL1 A;  1KFS A;  1MIW A;  4Z6E A;  5DG9 A;  5BOM A;  5L9X A;  4F93 B;  3NYB A;  3UXO A;  2KFN A;  4NXZ A;  2W8L A;  4UD5 A;  3PO5 A;  4TQR A;  3MR3 A;  4YXM A;  7ICV A;  1XO1 A;  3MR6 A;  5HR9 A;  2NRZ A;  4ELV A;  2HHS A;  2C2E A;  3G6X A;  7ICQ A;  1Y88 A;  4M04 A;  1RZT A;  5KG7 A;  5IIJ A;  3MGI A;  2W9C B;  8ICZ A;  4WCW A;  2ZHA A;  4UD4 A;  5DLF A;  5J29 A;  9ICA A;  5J2A A;  2FMS A;  4KLE A;  5J0U A;  2ZTC A;  4J9K A;  4KN7 A;  3OGU A;  4AT8 A;  2MAX A;  9ICF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...