4UB2A

Dna polymerase beta product complex with a templating cytosine and 8-oxodgmp, 120 s
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
319
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
molecule keywords DNA polymerase beta
molecule tags Transferase, lyase/dna
source organism Homo sapiens
total genus 104
structure length 319
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub2A03
1RXWA 1ZQSA 2ZH2A 2FPKA 2JEIA 2BCRA 3UXNA 4RUCA 4F5OA 4KLGA 9ICEA 9ICKA 3Q8QB 2NRZA 3BQTA 3ZD8A 1UEVA 1RXVA 1L5UA 3QZ8A 3NTUA 9ICOA 1S0OA 1S76D 3WFOA 8ICIA 4Q43A 4ECWA 5DB6A 2PBEA 2M2WA 2DRBA 4PGXA 3OJSA 1U45A 2FPMA 2XY7A 3GIJA 1BPYA 1B22A 3UQ2A 5KFZA 9ICSA 3ZDCA 4RWNA 4YXJA 3C1YA 1TK5A 1QTMA 3KHGA 3MR6A 1CUKA 4UB3A 4QWAA 4ECYA 4QZ8A 2BPFA 4KLJA 2KP7A 7ICOA 5DBCA 7ICEA 3LWMA 1K1QA 3PMNA 3TAPA 4X4QA 5HRHA 4DF4A 2PFNA 5HMLA 3OVAA 1UA1A 3HP6A 4UD5A 4IQTA 3UPQA 8ICLA 4ECUA 2H5XA 1KEJA 2BCQA 4I2DA 4ELVA 1KFTA 4F93B 5KFFA 4LVSA 8ICVA 7ICTA 4X4SA 2IA6A 2KFZA 4ED1A 4F3OA 8ICZA 4EBKA 4DOBA 4F4WA 2MUTA 7ICRA 2ZHAA 4QZBA 5DGBA 5HRFA 3GV7B 2O1PA 2V4QA 8ICOA 3V6KA 2C22A 1IXRA 4DSJA 7ICQA 2W9CB 4O3PA 1BVSA 4RPZA 3H8JA 5DQIA 3MGHA 2RDIA 1D9DA 3TI0A 4C8NA 2FMSA 4F5PA 4NLZA 1F5AA 8ICTA 4E7XA 5DEDA 4GC7A 4KLTA 5DG7A 4M9HA 3RBEA 5J0TA 7ICHA 1JAJA 3RJJA 4RQ0A 3MBYA 3OHBA 4DL7A 1NK7A 2BPCA 1MIVA 4J9SA 2KTQA 4AT8B 1TAQA 4ECRA 8ICHA 2HHWA 8ICPA 2AU0A 1A76A 3OJUA 4JUZA 3V7LA 4F91B 1JXLA 1PZNA 5KFAA 4DFPA 3UPSA 4F50A 3SZ2A 2M2VA 5C5JA 5L1KA 4DL3A 9ICJA 1NOMA 3QZ7A 4RQ8A 1Y88A 5BPCA 2W8LA 4FHYA 2RDJA 5DQGA 4IQUA 3ORYA 2UVVA 5IIJA 1ZQHA 4C8KA 5EOZA 4F2RA 1OU5A 3MDCA 5D46A 4I2FA 2AJQA 4JK1A 1BGXT 2HVHA 3ZD9A 4JWNA 1YLQA 4Z6EA 2BCUA 5KG2A 1SL1A 4C8MA 4RQ7A 2ZH1A 5KFSA 2W9BA 3TAQA 4B9TA 4O3OA 5IILA 5J0RA 4NXZA 4J9QA 4DOCA 4MEYA 3MFIA 3PX0A 4I2JA 2Q0ZX 5J0WA 3OSNA 1TK8A 4DS5A 1L3VA 4MFFA 5KFDA 4ECQA 4MEXA 2AQ4A 5DG9A 2BPGA 4CCHA 4X0AA 4BXOA 4NLNA 4P4PA 2F1IA 3QEBZ 1SKRA 4Q8EA 4E80A 3MFHA 3RAXA 5KFKA 4FHPA 2JEGA 5KFGA 3WFQE 4UB4A 3RJGA 1KRPA 1ZJNA 2HHTA 4MF2A 5KFBA 1MIYA 1Q79A 4B9MA 4DL4A 5KT2A 3GIMA 3Q8MA 1Z00B 5HREA 7ICSA 4UAYA 4XUSA 7ICLA 3B0XA 3KHHA 4ECZA 3JPOA 1T4GA 3T5KA 4B9VA 1NZPA 1D8YA 4PHAA 3RH6A 5CA7A 3H4DA 4RU9A 4TQRA 4F4YA 4DL5A 1ZQAA 1ZQTA 2FLNA 2ZH6A 4WC7A 5F2VO 2WTFA 5KFCA 5J29A 3ZDBA 3V6HA 4YCXA 4IQWA 4ATBA 2OWOA 3C66A 4AT7B 4FS1A 4DF8A 2BQRA 1ZYQA 3MR5A 4XA5A 3TANA 4KLQA 3RBDA 1D9FA 4JV2A 4O9MA 2I1QA 1MSWD 8ICGA 3H39A 3PR5B 1A77A 3FYHA 1JXEA 4YP3A 4X0BA 1BPXA 1ZQVA 3UXOA 3M8RA 3RRHA 4I2BA 8ICCA 8ICAA 5HRDA 3OUYA 1SL0A 5DGAA 4YMMA 4ECXA 4QZAA 3BQ0A 4F5NA 2HHXA 4I2IA 2V9WA 3LWLA 1TAUA 4YG2A 2XGQA 1COOA 4RPYA 4P4MA 5EWGA 4TQSA 3ETLA 4FBUA 4I2CA 2ISOA 4R63A 4QW9A 1NKCA 4DLEA 1XSLA 4E8FA 4X4OA 4NM2A 9ICVA 1MC8A 8ICKA 9ICWA 3M8SA 2IHMA 3PY8A 4O3NA 4RWQA 1XO1A 4J9KA 3EPGA 4F4ZA 5HRLA 1U47A 3M9NB 4I29A 4ED0A 3HJ4A 5DLGA 3Q8PB 4RZRA 8ICUA 2XGPA 4FHVA 4YN4A 5DBAA 4UBCA 4DFKA 4NM1A 4UB5A 3RJEA 1NJXA 4F5QA 4ED8A 1ZQJA 3HT3A 4B9SA 9ICMA 3C18A 4M9LA 2W8KA 5IIOA 5J2IA 4B9NA 4J9OA 5J2AA 1ZQQA 8ICXA 8ICBA 5HNKA 1SKSA 3RR7A 3RB4A 1ZQWA 4TUSA 2ID1A 3H7IA 4BDPA 4RNOA 1RZTA 1ZQGA 4R8UB 5KTQA 5KFQA 3OHAA 2XO7A 3PR4A 5HHIA 1S97A 1ZQFA 9ICPA 5J0UA 5D49A 2JZBA 3GDXA 4RWPA 4QWBA 4S3NA 3GFKB 2KZZA 9ICIA 3Q8LA 4QZHA 4AT9A 4EBDA 3M9OB 1S0MA 4QW8A 1H38A 2IBKA 2DRAA 4EYIB 2A1JA 5CP2A 5CWRA 2M2UA 5J0XA 3LK9A 4M2YA 4DSEA 5J2CA 4DSIA 3TFRA 1KSPA 5IIIA 4IG8A 4R65A 3V7JA 3RH5A 2IHNA 5KFHA 3RJIA 2W9AA 3JPRA 3EPIA 4ED3A 3E2EA 5J2FA 3G6YA 3Q8KA 7ICMA 4DWIA 1UT5A 3EZ5A 4IQVA 1FA0A 1WCNA 1TK0A 1ZQBA 4UD4A 4WC2A 2M2TA 5KT3A 1V9PA 4GXIA 2ZJ8A 1ZQIA 4KN7A 3GILA 1R8BA 5DB9A 1ZQKA 4RNMA 4MFAA 1UT8A 1X9SA 5KFIA 4DSFA 1V4AA 1RYSA 4I2EA 4WCWA 4GLXA 4PHEA 9ICAA 1S0NA 4X4VA 1QSLA 1QSSA 4Q44A 1BPBA 2VANA 4DL6A 5CJ7A 7ICPA 1NO5A 1R8CA 2KFNA 3NYBA 4KLIA 1ZQUA 3RRGA 4IRKA 2ZH7A 5KG6A 2R8JA 4K4IA 4DFMA 2R8IA 1XS9D 4RUAA 4EEYA 9ICXA 3PW7A 3SV3A 4EZ9A 1C7YA 2I9GA 1S0VA 1PX5A 4UQGA 3V7KA 8ICJA 3H38A 4RPXA 4LZDA 9ICFA 2J6TA 2XCAA 1NJYA 5DDYA 4KLDA 9ICGA 1NJWA 1ZQNA 3EW9A 5J2BA 4RWOA 2DPJA 3KHRA 2ZH9A 1U9LA 4C8LA 4M6WB 1ZQMA 1DK2A 5CB1A 3N97B 8ICMA 5IIKA 5HRGA 8ICQA 3HW8A 4RNNA 3ZDDA 1VJ7A 9ICLA 9ICHA 1ZQOA 3G6VA 1UA0A 4X5VA 4F92B 1NKEA 4QWCA 1BNOA 5DG8A 3JPPA 4BGDA 4Z6CA 4X4NA 9ICRA 4G3IA 2VA3A 1S77D 4YFKA 5KFUA 5L9XA 5KFXA 4P4OA 4YD1A 2P6RA 2BQUA 5KG7A 1ZQYA 1X9WA 5KFNA 4J9LA 2ASLA 1N48A 5DB7A 2V4RA 4UB2A 2R8HA 5J0QA 4K4HA 2PFQA 3L9DA 4QWEA 3TQ1A 3PX6A 4WC1A 4PHPA 1ZQLA 1SZPA 4FBTA 1XC9A 1QSYA 9ICNA 2BQ3A 1HUZA 3H4BA 2ZJ5A 4YD2A 4FS2A 2ASJA 2W9CA 1NK5A 4DO9A 3RAQA 2HHVA 4EBCA 1TFWA 1BPEA 3BDPA 5J2GA 3MR3A 2Y1JA 5KFJA 2UVUA 4X4RA 5KT4A 2HHUA 4UBBA 8ICSA 2MAXA 5IINA 2UVRA 4DL2A 7ICKA 2PFPA 1WCLA 5KG3A 1LV5A 4AT8A 2W9MA 2DPIA 4YMOA 1JQRA 2BKEA 2R8KA 1UETA 2ZTDA 4PGQA 8ICNA 3PMLA 4TUQA 3WFRE 1X2IA 5J2EA 1BPDA 4DQRA 5KFLA 5HHHA 1TVAA 2C2RA 2NRKA 3HPOA 2O5AA 2KZMA 3AU6A 3THVA 3JZ0A 3V6JA 3AQNA 4EBJA 3QE9Y 3LDAA 5KFMA 3PV8A 4F4KA 4MF8A 1LB2B 3GV8B 1TFRA 2NRVA 1AROP 4YQWA 5DB8A 2AGOA 1T3NA 2J6UA 3IHQB 2AGPA 4HYKA 3MABA 4J9RA 1S10A 4WC4A 2DR8A 1U49A 3MDAA 3TFSA 8ICRA 1MIWA 4M47A 3SV4A 3PVXA 1RYRA 2KZ3A 4LZGA 4M04A 4WC0A 2LYHA 1ZJMA 4PH5A 1BNPA 2B21A 5L1IA 4QZGA 5L1LA 1NK8A 2ZJAA 2F1JA 4IR1A 2XC9A 4ECSA 3TARA 5KT7A 3B0YA 3OV7A 5F9LA 4KLFA 2AGQA 2MUTB 3H8WA 2ZUCA 5J2KA 2JEJA 4NLKA 3ZDEA 3SI8A 5KFPA 5EWFA 2VA2A 4DQIA 7ICNA 4IRCA 8ICFA 1Z00A 4FH3A 4WC3A 8ICYA 4PGYA 4YVZA 1KLNA 2NRXA 3ISBA 3C21A 2ZTCA 5J0OA 4I2HA 4O5KA 2XCPA 3V72A 4ECVA 2PI4A 3HIYA 4O5EA 4DLGA 3H3AA 3M9MB 7ICFA 3T5LA 4AT7A 4M9NA 4MFCA 4UAZA 2C2DA 5HRKA 4FHXA 1TV9A 3BQ1A 2BHNA 4IR9A 3ISCA 4DS4A 1U48A 1QLNA 4JV1A 7ICUA 2P66A 8ICWA 4WC5A 2J6SA 1JN3A 3H8SA 3C2MA 1KNYA 4RQ3A 4B9UA 1Z3EB 2FLPA 3PO4A 5KFYA 3PW0A 2PI5A 4TUPA 5HRIA 2ZHBA 1T8EA 1IM4A 5KT6A 1ZQCA 2HW3A 2AQ0A 5D4BA 2DFLA 4QZ9A 1ZQZA 4UAWA 4KLSA 3FDSA 1ZQXA 5KFTA 4DQPA 3T5HA 3OVSA 2W9BB 4I28A 9ICCA 1N56A 2P6UA 1XSNA 5KG4A 1SL2A 2VA8A 4KITB 4ELTA 3AU2A 4C8OA 4X4UA 5KFVA 4DFJA 2Y1IA 3RB3A 2C2EA 4DEZA 3KTQA 4BWJA 3GV5B 9ICBA 2BR0A 4BXOB 2UVWA 2HHPA 3C2LA 1K1SA 4BWMA 3RB0A 4KTQA 2BCSA 4E0DA 4QWDA 4ED7A 3OGUA 4F4XA 5J2DA 5KT5A 4F2SA 4QZIA 2HVIA 1DK3A 7ICVA 4WBZA 3HX0A 4WBYA 3T3FA 1CEZA 3K4GA 4O5CA 2BE3A 4GXJA 3RH4A 2FMQA 4Q8FA 5KG5A 3RTVA 4DSKA 4PPXA 1U4BA 2BCVA 4R64A 9ICQA 4WC6A 4QZFA 4RT3A 5KFOA 5TZVA 3QEAZ 5DKWA 1L3UA 5HC9A 3G6XA 2ALZA 5HRBA 1B43A 3PNCA 5DQHA 1JX4A 4R8UA 3C1ZA 4ATBB 3RJKA 4DSLA 4XQ7A 4YXMA 4RQ1A 3JPNA 4NY8A 2ZH4A 3PO5A 4KLOA 1NK9A 3JYYA 5J0SA 3HWTA 2M9NA 4M9GA 4FO6A 4XRHA 4P2HA 2FLLA 3OUYB 3H37A 2Q66A 3BQ2A 2ASDA 1KFSA 1TKDA 5BOLA 3EYZA 1XSPA 4NKTA 4O3SA 3ISDA 3RJHA 5HMMA 4DQSA 7ICIA 4EYHB 2ZTEA 4J9PA 3SYZA 5DLFA 1KDHA 3RJFA 4EZ6A 3Q8SB 8ICEA 3AUOA 5J0PA 3JPQA 3C5GA 2JEFA 4YMNA 5KFEA 3Q8RB 2BDPA 2FPLA 2C28A 1NJZA 5EWEA 1R89A 9ICUA 4M5DA 1KTQA 2ZH5A 4FHWA 3MGIA 3UXPA 1DOQA 3EWAA 1DGSA 1VFGA 4ED6A 5KFRA 4JV0A 7ICJA 4QZCA 4RQ6A 1BPZA 3RB6A 3AQMA 2F1HA 3H40A 4EP7A 3AQLA 5KG0A 2DR7A 4Z6DA 5HR9A 1WOTA 4O3QA 3WFSC 3GIKA 3C23A 4YR3A 3LQCB 2ZH8A 1NK6A 4KLEA 2KN7A 3JPTA 1XU4A 3N4MB 4K4GA 7ICGA 2DR5A 3WFPA 4IRDA 1XWLA 4DQQA 4FH5A 5KG1A 4J9NA 1ZQPA 1R8AA 4EBEA 3NGDA 4KLLA 5J2JA 2ZH3A 4M6WA 3K75D 3OSPA 4O0IA 3AQKA 5BOMA 4J9MA 3PW2A 3IM1A 4YR0A 2BGWA 2JZBB 1L3SA 4NLGA 4X4PA 4RT2A 3BJYA 2HHSA 1TFYA 4NKUA 3KHLA 1Q78A 4AT9B 4ED2A 4PHDA 4YR2A 5J2HA 4B9LA 2A1JB 2FMPA 3PX4A 4M9JA 3PW5A 5IIMA 2ZUDA 1ZQEA 4RQ2A 4DOAA 2NRWA 3OVBA 1NK4A 5DECA 2DVIA 2DR9A 4I2GA 4UB1A 3ZDAA 1ZQDA 4GXKA 2HHQA 4KLHA 4ZH4A 4Z6FA 2XY5A 1SKWA 1MQ3A 3RR8A 3T5JA 4F8RA 4RQ5A 4QZEA 3UQ0A 1NKBA 4TURA 1L3TA 5DBBA 5KFWA 2IMWP 1EXNA 1HJPA 3GQCA 1JIHA 5F9NA 4KLUA 2ZUBA 4KN4A 5HP4A 2PXIA 2XY6A 2RFFA 4ELUA 1D8LA 1RPLA 1UEUA 4LT6A 5DDMA 4I27A 1HUOA 4RQ4A 3JPSA 5CR0A 1KFDA 1JMSA 4KMUA 1ZQRA 4F5RA 1S9FA 4I2AA 3GIIA 2ATLA 4M0AA 4Q45A 4XQ8A 5J0YA 4R66A 3C5FA 9ICTA 4X4TA 5JUMA 2GWSA 4O3RA 4ECTA 2PFOA 2R8GA 4JWMA 3MR2A 3C2KA 1ZETA 4QZDA 2ISPA 1MQ2A 4KLMA 3HJ1A 2NRTA 1NK0A 5CHGA 1T7PA 1X9MA 5L1JA 4GC6A 3PW4A
chains in the Genus database with same CATH superfamily
3HKZC 2FPKA 3UXNA 4RUCA 9ICKA 2H3QA 3Q8QB 2NRZA 5AKKA 9ICOA 3GZFA 8ICIA 3F5EA 5DB6A 3GIJA 2F76X 3ZDCA 4QIWC 2KP7A 4Y2PA 3LWMA 3PMNA 3OVAA 5HRHA 2PFNA 1UA1A 4ECUA 2KICA 2B51A 4I2DA 1KFTA 2MUTA 2WB1F 1SV0C 2F3NA 3GV7B 1A6SA 4DSJA 7ICQA 2EAPA 1MA7A 4F5PA 8ICTA 4E7XA 5DEDA 4GC7A 7ICHA 1JAJA 1MIVA 3OHBA 4DL7A 2KTQA 1TAQA 8ICPA 3H0MB 2G07A 3SAHA 2WB1C 3OJUA 4JUZA 4F91B 1YZ6A 3UPSA 4F50A 1B0XA 3QZ7A 3AN1A 2RDJA 5DQGA 3ORYA 2QB0A 4JWNA 1SL1A 4RQ7A 1LKYB 2W9BA 3TAQA 5J0RA 4MEYA 2YTUA 4MFFA 5AICA 2BPGA 4Q8EA 2KE7A 3MFHA 1IG6A 5KFKA 1KRPA 4B9MA 5KT2A 3GIMA 5HREA 4ECZA 3RH6A 4K9AA 5CA7A 4RU9A 2ZH6A 4WC7A 5KFCA 3ZDBA 3V6HA 4AT7B 1ZD3A 5C0YA 2D3DA 1ZYQA 2B56A 4Y2UA 3C28A 1D9FA 4O9MA 4I0UA 2F77X 3PR5B 3FYHA 4YP3A 1BPXA 4EEBA 3UXOA 4I2BA 2HHXA 4QZAA 4YG2A 4P4MA 4R63A 4QW9A 3EUB2 3EPGA 3QUCA 1U47A 1AQ6A 1PVPA 3KKAC 4OAIZ 4UB5A 3LYSA 4AYBF 2ODGA 2ZG6A 3C18A 4M9LA 2GO7A 5J2AA 5HNKA 2HBMA 3RR7A 3RB4A 4TUSA 3H0RB 4IL6U 1RZTA 2JH1A 2YN4A 4R8UB 5KTQA 5KFQA 1S97A 1ZQFA 9ICPA 5D49A 1S8OA 4ZOHC 3GDXA 4QWBA 4CF5A 4O67A 2KZZA 3Q8LA 4EBDA 2HN2A 4AYBC 4QW8A 2KHQA 2DRAA 4EYIB 5EE1A 5CP2A 4DSEA 5J2CA 2HOIA 4ED3A 4NXVA 4DWIA 1UT5A 1UPHA 1ZQ1C 5KT3A 2ZJ8A 3WK7A 4KN7A 1ZQIA 4MFAA 1UT8A 5CFTA 4OCZA 4UASA 3F2CA 4DL6A 7ICPA 4KLIA 3WK4A 2ZH7A 4NV0A 4K4IA 3WU2U 2PMZF 4EEYA 1PX5A 2FE9A 1PVQA 2J6TA 4KLDA 9ICGA 1VJ5A 3EW9A 2ZH9A 5CB1A 8ICQA 5ALJA 3VC8A 3HW8A 2MA1A 3G6VA 1KBUA 3JPPA 4Z6CA 2VA3A 2PMZC 3QX7A 2W3SA 5ALGA 4P4OA 4YD1A 2BQUA 5KG7A 2OEHA 2PFQA 3PSIA 4QWEA 3TQ1A 1QQ6A 4PZNA 1SZPA 9ICNA 2VJ5A 3QU9A 1HUZA 4CF4A 4LEVA 2E1FA 4UW9A 4X4RA 5J2GA 1IIPA 4Y2XA 2CN1A 2UVRA 3E58A 1WCLA 5KG3A 2LYAA 2DPIA 4TUQA 4DQRA 2OH2A 2H3ZA 1JRPA 5HHHA 2O5AA 3THVA 3LDAA 5KFMA 3PV8A 4O69A 3WK8A 4MF8A 3GV8B 1TFRA 4Y2TA 1T3NA 2AGOA 3IHQB 1S10A 3MABA 1X42A 3TFSA 8ICRA 3SV4A 1RYRA 2KZ3A 4M04A 1KL9A 4WC0A 4PH5A 1BNPA 2K89A 5L1IA 3N28A 3RF9A 1NK8A 4Y2RA 3MGVA 3IP4B 1X66A 2YQEA 2D8CA 1X6JA 3D2NA 3ERCC 1B4FA 2ZUCA 2JEJA 3ZDEA 2VA2A 7ICNA 1Z00A 4WC3A 2WFAA 1N5XA 4PGYA 5G5HA 4NL9C 4PJ0U 4HX0A 5D62A 3M9MB 2LBOA 4M9NA 5HRKA 2BHNA 3ISCA 7ICUA 2G09A 1JN3A 3C2MA 1KNYA 4B9UA 3PO4A 2PI5A 2BZFA 2LHTA 4K98A 5D4BA 4UAWA 2Z7JA 2YX8A 2JH7A 5AKEA 4I28A 2ZIVB 5KG4A 1Z1BA 4ELTA 3AU2A 4C4SA 2C2EA 9ICBA 4BXOB 1FFVA 4G9BA 4KTQA 4E0DA 3OGUA 4F4XA 2HVIA 2G5IB 4O5CA 4DSKA 1HIWA 4F71A 4PPXA 4WC6A 1RYUA 1L3UA 2FDRA 4P0QB 1JX4A 5D61A 3C1ZA 4ATBB 4XQ7A 4NY8A 4C7ZA 1NK9A 2FI1A 3JYYA 3HWTA 2M9NA 2ZXHA 4FO6A 2QB1A 2Y0SF 1Q8KA 2K8AA 2M0NA 4O68A 4O3SA 3ISDA 3RJHA 7ICIA 5DLFA 3RJFA 3Q8SB 1ZXIA 5J0PA 2WF7A 4P0PB 1R89A 9ICUA 3MGIA 1VFGA 4JV0A 4RQ6A 1BPZA 4EP7A 2F1HA 1WOTA 3WFSC 2DR5A 3N4MB 1XWLA 4DQQA 4IC9A 4FH5A 2E8MA 5KG1A 1R8AA 1ZRNA 4EBEA 3NGDA 2ZH3A 3OSPA 3AQKA 2BBJA 3PW2A 3IM1A 1TAMA 4X4PA 1L3SA 4RT2A 3I28A 3DEEA 3KHLA 4CNQA 3PX4A 2ZUDA 3OVBA 4NXUA 2DVIA 3BS5B 1PVRA 1SKWA 3WK5A 3T5JA 3RR8A 3HILA 3UQ0A 1L3TA 2P35A 1N5WA 3D2QA 3U26A 3GQCA 4KN4A 5L1MA 5HP4A 2RFFA 2CPRA 4ELUA 1UEUA 2LM4A 4LT6A 4NXXA 5DDMA 5JU5A 2G06A 3IG8A 1S9FA 2ATLA 3C5FA 2BBHA 4O3RA 2R8GA 4EELA 2W3RA 3NS1A 3C2KA 4Y2QA 4KLMA 1RQNA 5CHGA 4GC6A 1ZQSA 4GFJA 2JEIA 4KLGA 3BQTA 5F3XB 1UEVA 4KB6A 3NTUA 3WFOA 2EAMA 1S76D 3M7DA 2KKPA 4Q43A 4YXJA 2LMRA 3KHGA 5JTGA 5D63A 4UB3A 4ECYA 1PK1B 4U7CA 5DBCA 7ICEA 4KM5A 3OTQA 5EE3A 2H5XA 5AM2A 2BCQA 5ALOA 8ICVA 7ICTA 4X4SA 4F3OA 4DOBA 4F4WA 3KKAA 4QZBA 5DGBA 5HRFA 2LPEA 2V4QA 2W9CB 4O3PA 4RPZA 2W7OA 2WF5A 3H8JA 1D9DA 2RDIA 4NLZA 2KKVA 4UB6U 5DG7A 3RJJA 3MBYA 1NK7A 4AT8B 2MRLA 4OAHA 3DV9A 8ICHA 1A76A 2QKQA 1JXLA 1PZNA 3SQIA 4DFPA 3SZ2A 5L1KA 5AI0A 4RQ8A 2W8LA 2GAFD 4C8KA 4F2RA 1ZRMA 4I2FA 2AJQA 4JK1A 3K1ZA 2HVHA 3ZD9A 2ZH1A 5IILA 3AQLA 4I2JA 2Q0ZX 4DS5A 4DFDA 2KG5A 4X0AA 4MKPA 2OM6A 4NLNA 3QEBZ 3RAXA 3WFQE 5KFGA 1RM6C 2OCEA 2A3VA 1ZJNA 2HHTA 2EZYA 3Q8MA 7ICSA 1ZD5A 4UAYA 3ETRA 4XUSA 7ICLA 3JPOA 1NZPA 2JHDA 1D8YA 4TQRA 1ZQAA 1ZQTA 4FO1A 2VJ4A 4FS1A 2BQRA 2HSZA 2B6GA 4JV2A 2I1QA 4X0BA 2GOLA 5AK3A 8ICAA 3OUYA 5H2FU 5DGAA 4YMMA 3NVWA 2WF9A 4ECXA 1TAUA 4F5NA 1V97A 3R9KA 2ZIXA 4TQSA 4FBUA 3QU4A 1Q3UA 4NM2A 8ICKA 4RWQA 2IHMA 1XO1A 3LVVA 5DLGA 3Q8PB 2KNJA 4RZRA 2XGPA 1O08A 1QH9A 5DBAA 4UBCA 3WKCA 4RQMA 2JRZA 4F5QA 1QCKA 2KJ9A 1FO4A 1ZQJA 5IIOA 8ICXA 1SKSA 1PK3A 5KAIU 4US8A 4BDPA 3CRXA 3PR4A 2JZBA 4S3NA 4QZHA 5EE0A 1H38A 2A1JA 2KSOB 5ALWA 3KD3A 4R65A 3V7JA 3CNHA 5AK6A 3RH5A 3G6YA 3Q8KA 4UD4A 3HJEA 1WCNA 2M2TA 4DCCA 1MN8A 3GILA 5DB9A 4RNMA 1X9SA 4B6JA 1RYSA 1QQ5A 4PHEA 1QSLA 5AK4A 1ZQUA 2R8JA 1XS9D 1WWVA 3PW7A 3UMGA 4EZ9A 5ALSA 1C7YA 4UQGA 3V7KA 8ICJA 4LZDA 1NJWA 1ZQNA 3KHRA 4C8LA 4M6WB 5HRGA 3N97B 8ICMA 5IIKA 4PL1A 1SXDA 4RNNA 5KAFU 9ICLA 1ZQOA 4X5VA 4F92B 4QWCA 4LEZA 4G3IA 1PUZA 3EF2A 3N7RC 5ALUA 3BS7A 2LYBA 5KFXA 2E3TA 3F5AA 4EV6A 5KFNA 1J2NA 2ASLA 1WG8A 4UB2A 2R8HA 5J0QA 2HBLA 3NRWA 4K4HA 2KD1A 3O0FA 1ZQLA 4CGZA 1QSYA 2ZJ5A 1S5LU 2I6XA 4FS2A 2ASJA 5AKXA 1NK5A 4DO9A 3RAQA 2HHVA 1D8BA 1TFWA 1K5OA 3BDPA 3MR3A 2HHUA 2IOFA 4UBBA 8ICSA 2MAXA 1UHUA 5GTHU 4DL2A 2PFPA 4YMOA 2K4HA 4WQLA 3WFRE 2W54A 3CW2C 3H0LB 1TVAA 5HR6A 5KFLA 2C2RA 2KZMA 3AU6A 2G0AA 3AQNA 3QE9Y 4YQWA 1AROP 5AM5A 5DB8A 2AGPA 3MDAA 1LKYA 3PVXA 2HOFA 4WJ3B 5J8YA 1Z1VA 3I1YA 2ZJAA 2F1JA 4ACOA 5KT7A 2H3FA 3B0YA 2KIWA 3PZPA 5F9LA 3BZKA 3QUTA 5J2KA 4NLKA 4DQIA 5EWFA 2E5SA 2RP5A 4JLZA 3ER9B 3ISBA 3HRDD 3V72A 4ECVA 3M1YA 3H3AA 4AT7A 7ICFA 4IS7A 4NJ8A 5ALZA 4FHXA 2C2DA 1TV9A 1J97A 3BQ1A 4DS4A 2P66A 4WC5A 4RQ3A 2FLPA 1L8OA 4TUPA 2NO4A 5KT6A 2AQ0A 5AIBA 3QU5A 2DL0A 5KFTA 4DQPA 2EANA 9ICCA 4UATA 1N56A 2P6UA 1XSNA 1SL2A 4C8OA 1L6NA 3M6KA 4DFJA 3RB3A 4DEZA 4BWJA 4NWIA 4U6PA 2HHPA 3QU7A 3C2LA 1YZ7A 3RB0A 5KNIA 2BCSA 1DK3A 5KT5A 3K4GA 2BE3A 1WWUA 3RH4A 2FMQA 4Q8FA 2HCFA 3RTVA 9ICQA 4R64A 2GA9D 1L7NA 5DKWA 1ZD4A 1B43A 5DQHA 2IOHA 4R8UA 3RJKA 4YXMA 4RQ1A 4KLOA 4NLBA 4N7RA 2F2AB 2YY6A 3SD7A 3SAGA 3CYMA 4XRHA 2FLLA 2KK0A 1XSPA 3SMVA 4FZLA 3JCFA 4J9PA 4EZ6A 3SYZA 5K4LA 4OAFA 3JPQA 3C5GA 5KFEA 3ICXA 2MU2A 4OJ5A 4J03A 4M5DA 1KTQA 4FHWA 4OD0A 4C4TA 4ED6A 5KFRA 5ALPA 5KG0A 1T3QA 3GIKA 4YR3A 3LQCB 3SAFA 2ZH8A 4KLEA 4JB3A 7ICGA 3WFPA 2KMDA 2YMQA 5AHXA 2F8LA 4YR0A 4WQKA 5HR7A 3NKUA 4XJEA 4AT9B 4YR2A 3KBBA 4EX7A 2DKXA 4JMUA 4DOAA 1NK4A 4UB1A 3A0HU 4GXKA 2HHQA 4Z6FA 2HBJA 4A8EA 4RQ5A 1EXNA 5F9NA 4OJPA 2PXIA 1D8LA 2H3IA 4RQ4A 3JPSA 1JMSA 4M0AA 4R66A 1T7PA 5JUMA 4EEDA 4JWMA 1MQ2A 1DGJA 2ZIUB 3SEIA 3AEVA 3PW4A 2ZH2A 2BCRA 9ICEA 2DUYA 1T94A 3ZD8A 2YMLA 3QZ8A 1S0OA 4PL2A 4ECWA 2PBEA 4USAA 2M2WA 1U45A 4CF3A 3OJSA 2FPMA 2XY7A 1B22A 4RWNA 3KZXA 3C1YA 2F44A 3MR6A 4KLJA 2MSNA 1F44A 2ESEA 2DGZA 4WH5A 3L3FX 4IQTA 8ICLA 2KHVA 2DWQA 5KFFA 2KFZA 4ED1A 1L7PA 7ICRA 1KW4A 2W11A 2EH9A 8ICOA 3NVOA 1BVSA 5DQIA 3TI0A 4C8NA 3KZIU 1F5AA 2IUBA 3DDHA 4NXTA 3RBEA 1N63A 4Y2SA 4RQ0A 2BPCA 4J9SA 4GIBA 2ZIUA 2HHWA 2AU0A 3NVZA 3V7LA 5KFAA 5C5JA 4DL3A 1Y88A 2LKYA 4FHYA 2K8CB 2UVVA 5IIJA 1ZQHA 1OU5A 5D46A 2BCUA 5CFSA 4O3OA 1SV0A 4K4GA 4NXZA 3H37A 5AKGA 3MFIA 2ZIVA 1TK8A 1L3VA 2ISOA 5ALLA 5KFDA 4ECQA 4MEXA 2AQ4A 5DG9A 4BXOA 4E80A 1SKRA 3PSTA 2JEGA 4UB4A 5AI4A 1Q79A 5KFBA 3B0XA 1T4GA 2XIDA 3T5KA 4B9VA 1X40A 4PHAA 4Y2VA 3H4DA 4DL5A 4P0QA 2FLNA 2WTFA 5J29A 4IQWA 4YCXA 4ATBA 3QUQA 2FCLA 4KMOB 4KLQA 1XO0A 1MSWD 8ICGA 1A77A 1JXEA 1RQLA 2K8BB 3NRZA 8ICCA 2RRDA 5HRDA 1SL0A 4EGWA 3WK9A 3NVYA 4CE6A 5ALFA 3LWLA 3IRUA 4RPYA 5CRXA 2KOBA 4X4OA 1MC8A 1HEKA 4P0PA 3M8SA 4O3NA 4F4ZA 5HRLA 4I29A 5B3QA 1N61A 4CDGA 2K4EA 1F5SA 5GTIU 1ZOLA 3RJEA 2KVCA 2Q4TA 1NJXA 1NI3A 9ICMA 4B9SA 2W8KA 5J2IA 4B9NA 1IV8A 1ZQWA 1V38A 3SR6A 3H7IA 5EE9A 1JUDA 5AM4A 2XO7A 2JV3A 5HHIA 5J0UA 2NV3A 4RWPA 4OAGA 3GFKB 9ICIA 4QJFB 3D6JA 2KEYA 3LK9A 4DSIA 5KFHA 3RJIA 2W9AA 2ES6A 3BS5A 4FFDA 3EZ5A 1TK0A 1VDVA 1R8BA 1ZQKA 4K8VA 5KFIA 4DSFA 4I2EA 4WCWA 4GLXA 3OPXA 9ICAA 1S0NA 4X4VA 1QSSA 4Q44A 2VANA 2ZIWB 1NO5A 2KFNA 3NYBA 4IRKA 4DFMA 1S0VA 2HN1A 3H38A 4RPXA 1TE2A 1SGGA 5DDYA 1WYGA 3TKAA 2N1RA 4RWOA 1U9LA 1KKXA 4CRXA 3QUBA 9ICHA 4PZOA 5DG8A 4BGDA 2R18A 4X4NA 9ICRA 4BJQA 1PK1A 2P6RA 1YT3A 2AHOB 1X9WA 1Q46A 2KV2A 5DB7A 2QARB 1L7OA 3PX6A 1UQVA 3L5KA 5AI9A 5ALIA 1XC9A 2W04A 2BQ3A 2YB1A 3H4BA 2YMPA 3PHZA 4YD2A 5ALYA 2W9CA 4EBCA 1BPEA 2Y1JA 3GU3A 4AT8A 5JRTA 2R8KA 2ZTDA 3RFAA 3PMLA 2NRKA 1A0PA 2Y9TA 3JZ0A 3ALRA 2NRVA 2J6UA 1SXEA 4HYKA 1MIWA 4M47A 3NVVA 5AI5A 2A1AA 2B21A 5CFUA 4QZGA 2JXJA 3OV7A 2MUTB 3CP8A 3H8WA 3ZI4A 3SI8A 1SWWA 4IRCA 3E0FA 8ICFA 4FH3A 8ICYA 1KLNA 4YVZA 3C21A 3WKAA 4I2HA 4O5KA 3HIYA 2E8NA 4DLGA 2IOFK 3T5LA 4MFCA 3QU2A 1U48A 2KVSA 4BUGA 4JV1A 3AM9A 2J6SA 3H8SA 5HRIA 2HW3A 1SB3C 1X9XA 2DFLA 2QB0B 3IDWA 2QLTA 4KLSA 1ZQXA 4AP9A 2W9BB 4Y2JA 4KITB 1QQ7A 4X4UA 5KFVA 2Y1IA 3GV5B 4NL9A 3N7PD 4K99A 3IV6A 4BWMA 4F2SA 3S6JA 4QZIA 4WBZA 3HX0A 3T3FA 4GXJA 2BCVA 3M6ZA 4RT3A 5HC9A 2KIVA 3AQEA 3G6XA 3PNCA 4DSLA 1FFUA 2ZH4A 2VKQA 3PO5A 1N62A 5J0SA 4M9GA 1ED1A 3PSFA 4P2HA 2KSOA 1VLBA 1DXSA 1KFSA 5BOLA 4NKTA 1L8LA 4EYHB 1SIJA 2ZTEA 8ICEA 3AUOA 4YMNA 2BDPA 3Q8RB 3C29A 1FEZA 1NJZA 5EWEA 5ALXA 2OYYA 3UXPA 1DOQA 3EWAA 2EAOA 2WF8A 4QZCA 3RB6A 2DR7A 4Z6DA 1NK6A 4WOYA 1SZHA 2KN7A 1XU4A 1OUQA 1F0MA 4IRDA 2WF6A 3WK6A 1ZQPA 3AMZA 2NYVA 5J2JA 4M6WA 4O0IA 5BOMA 5CEHA 2E1EA 3ED5A 3BJYA 4KX3A 2HHSA 1TFYA 3NWIA 4ED2A 4PHDA 4K97A 5J2HA 3N7SC 3QXGA 3UM9A 4M9JA 3PW5A 4UB8U 1ZQEA 2NRWA 3B9JA 5DECA 1ZQDA 4KLHA 2OHFA 1MQ3A 4F8RA 5T14A 2H3VA 1JIHA 3K1RB 4KLUA 2ZUBA 2D6FC 5CR0A 4KMUA 5ALTA 4F5RA 4Q45A 4X4TA 1OW5A 1ZETA 3HJ1A 2NRTA 3OWGA 1NK0A 2W03A 5L1JA 1RXWA 2HMXA 2DF4B 4F5OA 4FZMA 1RXVA 1L5UA 2HDOA 1NNLA 3QNMA 2DRBA 4PGXA 1BPYA 3UQ2A 5KFZA 9ICSA 1TK5A 5AM0A 1QTMA 1CUKA 4QWAA 3TADC 4QZ8A 2BPFA 7ICOA 3TAPA 1K1QA 4X4QA 4DF4A 5HMLA 1GO3F 3HP6A 4UD5A 3UPQA 3WKDA 1KEJA 2AXTU 5ALEA 3TACB 4ELVA 4F93B 4LVSA 2Q66A 2IA6A 8ICZA 4EBKA 2ZHAA 2DQNB 2EZZA 2O1PA 3A0BU 3V6KA 2C22A 1IXRA 3MGHA 4OJ6A 2FMSA 2Y9UA 4KLTA 4M9HA 1OXJA 5J0TA 2EWRA 3UMCA 4ECRA 1RG6A 2M2VA 9ICJA 1NOMA 2EQYA 5BPCA 4IQUA 5ALKA 4EENA 5EOZA 3MDCA 1YLQA 1BGXT 5ALDA 1URJA 4Z6EA 5KG2A 4C8MA 2DBYA 5KFSA 4B9TA 4DOCA 4J9QA 3PX0A 5J0WA 3OSNA 1C20A 4CCHA 2WAQF 4P4PA 2F1IA 4FHPA 2W55A 4EEKA 3RJGA 1MIYA 2PKEA 4MF2A 4DL4A 1Z00B 3KHHA 2E8PA 3H8MA 1V85A 2NO5A 1JALA 4F4YA 1J2MA 5F2VO 5ALHA 2OWOA 3C66A 2WAQC 4DF8A 2RLTA 3MR5A 4XA5A 3F2DA 3TANA 3RBDA 3H39A 4BX9C 5ALQA 3BZCA 1Z4OA 1ZQVA 3M8RA 5E79U 3RRHA 1N2XA 4OJOA 2KJ8A 3BQ0A 4I2IA 2V9WA 2XGQA 1COOA 3FM9A 5EWGA 3ETLA 4I2CA 2BDUA 2E8OA 1NKCA 4DLEA 1LVHA 1XSLA 4E8FA 1SV4A 9ICVA 4FZNA 9ICWA 3PY8A 5G5GA 4J9KA 3M9NB 2YB4A 4ED0A 3HJ4A 4NXWA 4LEYA 8ICUA 2JMGA 3IN5A 4YN4A 3AL0B 4DFKA 4NM1A 2L5YA 4ED8A 3HT3A 4J9OA 1ZQQA 8ICBA 2ID1A 5B5EU 4RNOA 1ZQGA 3OHAA 4AT9A 2KJ5A 3M9OB 1S0MA 4EX6A 5ALRA 2CXYA 2IBKA 5CWRA 2M2UA 5J0XA 4M2YA 3TFRA 2ZXIA 5IIIA 1KSPA 4IG8A 2IHNA 3JPRA 2I5HA 4Y2YA 3EPIA 3E2EA 5J2FA 7ICMA 2IHOA 5KL1B 3FC4A 4IQVA 1FA0A 1ZQBA 4WC2A 4ICAA 1V9PA 3AQFA 4GXIA 4OO1J 2XICA 2DKZA 1V4AA 3F53A 1BPBA 5CJ7A 5KL8B 5A0LA 1Z4NA 2G08A 1R8CA 4UAVA 3NASA 3RRGA 3PSPA 5KG6A 4K9BA 2R8IA 4RUAA 9ICXA 3SV3A 2I9GA 1DRGA 9ICFA 2XCAA 2K4IA 1NJYA 3SENA 1CI4A 5J2BA 2LM1A 1X6IA 2DPJA 2K60A 1DK2A 1ZQMA 3ZDDA 1VJ7A 2B4VA 3MCRA 5AKZA 4UAUA 1UA0A 1BNOA 5ALMA 1NKEA 4C0ZA 1JI7A 3I76A 1S77D 4YFKA 5KFUA 3QYPA 4F72A 5L9XA 3T79A 2G5HB 1ZQYA 4HAIA 4J9LA 2YMMA 1N48A 2V4RA 5AKHA 1Z19A 3L9DA 4K96A 4WC1A 4PHPA 5J8YC 4FBTA 1SWVA 1UCVA 3VCBA 2Y0SC 5AIAA 5KFJA 2UVUA 5KT4A 2K4PA 5IINA 5JTIA 7ICKA 1ZD2P 5ALNA 1LV5A 1KQQA 3NUQA 2W9MA 1JQRA 3D2SA 2BKEA 1UETA 4PGQA 8ICNA 1X2IA 5J2EA 1BPDA 3HPOA 1JROA 3V6JA 4EBJA 2AH5A 4F4KA 4NLCA 2WHEA 1LB2B 3BQ7A 5CHEA 2HBKA 2DR8A 4J9RA 4O3MA 4WC4A 4LJXA 1U49A 5B3PA 4LZGA 2LYHA 1ZJMA 5L1LA 5B66U 2FJ6A 4IR1A 2XC9A 4ECSA 3TARA 4KLFA 2AGQA 3WKEA 3K7DA 5AKJA 5KFPA 2W43A 2NRXA 2ZTCA 2HOQA 5J0OA 4UARA 2XCPA 5TISU 2PI4A 4O5EA 4LEWA 4O6AA 5AKYA 4UAZA 3MC1A 4IR9A 1QLNA 8ICWA 1ECWA 4RQNA 3IG5A 1Z3EB 5KFYA 3PW0A 2ZHBA 1RDFA 1T8EA 1IM4A 1ZQCA 3FAHA 2LI6A 4QZ9A 1ZQZA 1Q3VA 3FDSA 5ALVA 3T5HA 3OVSA 2RHFA 3ER8C 3CK6A 2JGAA 2VA8A 5AM3A 3KTQA 2GH1A 2BR0A 2UVWA 4JLXA 1K1SA 4QWDA 4ED7A 5J2DA 5FP0A 5AI8A 7ICVA 4WBYA 1CEZA 4FHVA 5KG5A 2XI9A 1U4BA 4QZFA 3QEAZ 5KFOA 1KN5A 5TZVA 5AK5A 2ALZA 1P7DA 5HRBA 2VIXA 3JPNA 2RQ5A 2W7PA 3KFUF 3OUYB 3BQ2A 4C7YA 2ASDA 1O03A 1TKDA 3EYZA 2B0CA 2OXOA 3TADA 3J81j 5HMMA 4DQSA 2ZIXB 1KDHA 1CRXA 2JEFA 1WUDA 2HI0A 2FPLA 1GPJA 2C28A 2XVTA 2ZH5A 4QNLA 1DGSA 1FIQA 2ZIWA 7ICJA 2GLEA 2A19A 3AQMA 4C4RA 3H40A 3WKBA 4US9A 5HR9A 1NZBA 1M6YA 3KOOA 4O3QA 5AKLA 3C23A 3JPTA 4MHVA 2O6KA 4J9NA 4KLLA 3K75D 4J9MA 4NLGA 2BGWA 1XNSA 2JZBB 2CRXA 1N60A 5AI6A 4NKUA 1Q78A 2F8KA 4B9LA 2A1JB 2FMPA 5IIMA 4RQ2A 1COKA 3ONNA 2DR9A 4I2GA 3ZDAA 5AM1A 4ZH4A 2XY5A 2QARA 4FE3A 4QZEA 1NKBA 4TURA 5DBBA 3UMBA 5KFWA 2IMWP 1HJPA 3HKZF 3L4PA 2XY6A 1RPLA 4KX5A 4I27A 1HUOA 2EDUA 1KFDA 1ZQRA 4I2AA 3GIIA 9ICTA 4XQ8A 4C80A 5J0YA 5AKIA 2GWSA 2EZXA 4ECTA 2PFOA 3MR2A 3F2BA 4QZDA 1L7MA 3LVWA 4OJLA 4QIWF 1X9MA 2ISPA 2JR5A
chains in the Genus database with same CATH topology
1RXWA 1ZQSA 2ZH2A 2FPKA 2JEIA 2BCRA 3UXNA 4RUCA 4F5OA 4KLGA 9ICEA 9ICKA 3Q8QB 2NRZA 3BQTA 3ZD8A 1UEVA 1RXVA 1L5UA 3QZ8A 3NTUA 9ICOA 1S0OA 1S76D 3WFOA 8ICIA 4Q43A 4ECWA 5DB6A 2PBEA 2M2WA 2DRBA 4PGXA 3OJSA 1U45A 2FPMA 2XY7A 3GIJA 1BPYA 1B22A 3UQ2A 5KFZA 9ICSA 3ZDCA 4RWNA 4YXJA 3C1YA 1TK5A 1QTMA 3KHGA 3MR6A 1CUKA 4UB3A 4QWAA 4ECYA 4QZ8A 2BPFA 4KLJA 2KP7A 7ICOA 5DBCA 7ICEA 3LWMA 1K1QA 3PMNA 3TAPA 4X4QA 5HRHA 4DF4A 2PFNA 5HMLA 3OVAA 1UA1A 3HP6A 4UD5A 4IQTA 3UPQA 8ICLA 4ECUA 2H5XA 1KEJA 2BCQA 4I2DA 4ELVA 1KFTA 4F93B 5KFFA 4LVSA 8ICVA 7ICTA 4X4SA 2IA6A 2KFZA 4ED1A 4F3OA 8ICZA 4EBKA 4DOBA 4F4WA 2MUTA 7ICRA 2ZHAA 4QZBA 5DGBA 5HRFA 3GV7B 2O1PA 2V4QA 8ICOA 3V6KA 2C22A 1IXRA 4DSJA 7ICQA 2W9CB 4O3PA 1BVSA 4RPZA 3H8JA 5DQIA 3MGHA 2RDIA 1D9DA 3TI0A 4C8NA 2FMSA 4F5PA 4NLZA 1F5AA 8ICTA 4E7XA 5DEDA 4GC7A 4KLTA 5DG7A 4M9HA 3RBEA 5J0TA 7ICHA 1JAJA 3RJJA 4RQ0A 3MBYA 3OHBA 4DL7A 1NK7A 2BPCA 1MIVA 4J9SA 2KTQA 4AT8B 1TAQA 4ECRA 8ICHA 2HHWA 8ICPA 2AU0A 1A76A 3OJUA 4JUZA 3V7LA 4F91B 1JXLA 1PZNA 5KFAA 4DFPA 3UPSA 4F50A 3SZ2A 2M2VA 5C5JA 5L1KA 4DL3A 9ICJA 1NOMA 3QZ7A 4RQ8A 1Y88A 5BPCA 2W8LA 4FHYA 2RDJA 5DQGA 4IQUA 3ORYA 2UVVA 5IIJA 1ZQHA 4C8KA 5EOZA 4F2RA 1OU5A 3MDCA 5D46A 4I2FA 2AJQA 4JK1A 1BGXT 2HVHA 3ZD9A 4JWNA 1YLQA 4Z6EA 2BCUA 5KG2A 1SL1A 4C8MA 4RQ7A 2ZH1A 5KFSA 2W9BA 3TAQA 4B9TA 4O3OA 5IILA 5J0RA 4NXZA 4J9QA 4DOCA 4MEYA 3MFIA 3PX0A 4I2JA 2Q0ZX 5J0WA 3OSNA 1TK8A 4DS5A 1L3VA 4MFFA 5KFDA 4ECQA 4MEXA 2AQ4A 5DG9A 2BPGA 4CCHA 4X0AA 4BXOA 4NLNA 4P4PA 2F1IA 3QEBZ 1SKRA 4Q8EA 4E80A 3MFHA 3RAXA 5KFKA 4FHPA 2JEGA 5KFGA 3WFQE 4UB4A 3RJGA 1KRPA 1ZJNA 2HHTA 4MF2A 5KFBA 1MIYA 1Q79A 4B9MA 4DL4A 5KT2A 3GIMA 3Q8MA 1Z00B 5HREA 7ICSA 4UAYA 4XUSA 7ICLA 3B0XA 3KHHA 4ECZA 3JPOA 1T4GA 3T5KA 4B9VA 1NZPA 1D8YA 4PHAA 3RH6A 5CA7A 3H4DA 4RU9A 4TQRA 4F4YA 4DL5A 1ZQAA 1ZQTA 2FLNA 2ZH6A 4WC7A 5F2VO 2WTFA 5KFCA 5J29A 3ZDBA 3V6HA 4YCXA 4IQWA 4ATBA 2OWOA 3C66A 4AT7B 4FS1A 4DF8A 2BQRA 1ZYQA 3MR5A 4XA5A 3TANA 4KLQA 3RBDA 1D9FA 4JV2A 4O9MA 2I1QA 1MSWD 8ICGA 3H39A 3PR5B 1A77A 3FYHA 1JXEA 4YP3A 4X0BA 1BPXA 1ZQVA 3UXOA 3M8RA 3RRHA 4I2BA 8ICCA 8ICAA 5HRDA 3OUYA 1SL0A 5DGAA 4YMMA 4ECXA 4QZAA 3BQ0A 4F5NA 2HHXA 4I2IA 2V9WA 3LWLA 1TAUA 4YG2A 2XGQA 1COOA 4RPYA 4P4MA 5EWGA 4TQSA 3ETLA 4FBUA 4I2CA 2ISOA 4R63A 4QW9A 1NKCA 4DLEA 1XSLA 4E8FA 4X4OA 4NM2A 9ICVA 1MC8A 8ICKA 9ICWA 3M8SA 2IHMA 3PY8A 4O3NA 4RWQA 1XO1A 4J9KA 3EPGA 4F4ZA 5HRLA 1U47A 3M9NB 4I29A 4ED0A 3HJ4A 5DLGA 3Q8PB 4RZRA 8ICUA 2XGPA 4FHVA 4YN4A 5DBAA 4UBCA 4DFKA 4NM1A 4UB5A 3RJEA 1NJXA 4F5QA 4ED8A 1ZQJA 3HT3A 4B9SA 9ICMA 3C18A 4M9LA 2W8KA 5IIOA 5J2IA 4B9NA 4J9OA 5J2AA 1ZQQA 8ICXA 8ICBA 5HNKA 1SKSA 3RR7A 3RB4A 1ZQWA 4TUSA 2ID1A 3H7IA 4BDPA 4RNOA 1RZTA 1ZQGA 4R8UB 5KTQA 5KFQA 3OHAA 2XO7A 3PR4A 5HHIA 1S97A 1ZQFA 9ICPA 5J0UA 5D49A 2JZBA 3GDXA 4RWPA 4QWBA 4S3NA 3GFKB 2KZZA 9ICIA 3Q8LA 4QZHA 4AT9A 4EBDA 3M9OB 1S0MA 4QW8A 1H38A 2IBKA 2DRAA 4EYIB 2A1JA 5CP2A 5CWRA 2M2UA 5J0XA 3LK9A 4M2YA 4DSEA 5J2CA 4DSIA 3TFRA 1KSPA 5IIIA 4IG8A 4R65A 3V7JA 3RH5A 2IHNA 5KFHA 3RJIA 2W9AA 3JPRA 3EPIA 4ED3A 3E2EA 5J2FA 3G6YA 3Q8KA 7ICMA 4DWIA 1UT5A 3EZ5A 4IQVA 1FA0A 1WCNA 1TK0A 1ZQBA 4UD4A 4WC2A 2M2TA 5KT3A 1V9PA 4GXIA 2ZJ8A 1ZQIA 4KN7A 3GILA 1R8BA 5DB9A 1ZQKA 4RNMA 4MFAA 1UT8A 1X9SA 5KFIA 4DSFA 1V4AA 1RYSA 4I2EA 4WCWA 4GLXA 4PHEA 9ICAA 1S0NA 4X4VA 1QSLA 1QSSA 4Q44A 1BPBA 2VANA 4DL6A 5CJ7A 7ICPA 1NO5A 1R8CA 2KFNA 3NYBA 4KLIA 1ZQUA 3RRGA 4IRKA 2ZH7A 5KG6A 2R8JA 4K4IA 4DFMA 2R8IA 1XS9D 4RUAA 4EEYA 9ICXA 3PW7A 3SV3A 4EZ9A 1C7YA 2I9GA 1S0VA 1PX5A 4UQGA 3V7KA 8ICJA 3H38A 4RPXA 4LZDA 9ICFA 2J6TA 2XCAA 1NJYA 5DDYA 4KLDA 9ICGA 1NJWA 1ZQNA 3EW9A 5J2BA 4RWOA 2DPJA 3KHRA 2ZH9A 1U9LA 4C8LA 4M6WB 1ZQMA 1DK2A 5CB1A 3N97B 8ICMA 5IIKA 5HRGA 8ICQA 3HW8A 4RNNA 3ZDDA 1VJ7A 9ICLA 9ICHA 1ZQOA 3G6VA 1UA0A 4X5VA 4F92B 1NKEA 4QWCA 1BNOA 5DG8A 3JPPA 4BGDA 4Z6CA 4X4NA 9ICRA 4G3IA 2VA3A 1S77D 4YFKA 5KFUA 5L9XA 5KFXA 4P4OA 4YD1A 2P6RA 2BQUA 5KG7A 1ZQYA 1X9WA 5KFNA 4J9LA 2ASLA 1N48A 5DB7A 2V4RA 4UB2A 2R8HA 5J0QA 4K4HA 2PFQA 3L9DA 4QWEA 3TQ1A 3PX6A 4WC1A 4PHPA 1ZQLA 1SZPA 4FBTA 1XC9A 1QSYA 9ICNA 2BQ3A 1HUZA 3H4BA 2ZJ5A 4YD2A 4FS2A 2ASJA 2W9CA 1NK5A 4DO9A 3RAQA 2HHVA 4EBCA 1TFWA 1BPEA 3BDPA 5J2GA 3MR3A 2Y1JA 5KFJA 2UVUA 4X4RA 5KT4A 2HHUA 4UBBA 8ICSA 2MAXA 5IINA 2UVRA 4DL2A 7ICKA 2PFPA 1WCLA 5KG3A 1LV5A 4AT8A 2W9MA 2DPIA 4YMOA 1JQRA 2BKEA 2R8KA 1UETA 2ZTDA 4PGQA 8ICNA 3PMLA 4TUQA 3WFRE 1X2IA 5J2EA 1BPDA 4DQRA 5KFLA 5HHHA 1TVAA 2C2RA 2NRKA 3HPOA 2O5AA 2KZMA 3AU6A 3THVA 3JZ0A 3V6JA 3AQNA 4EBJA 3QE9Y 3LDAA 5KFMA 3PV8A 4F4KA 4MF8A 1LB2B 3GV8B 1TFRA 2NRVA 1AROP 4YQWA 5DB8A 2AGOA 1T3NA 2J6UA 3IHQB 2AGPA 4HYKA 3MABA 4J9RA 1S10A 4WC4A 2DR8A 1U49A 3MDAA 3TFSA 8ICRA 1MIWA 4M47A 3SV4A 3PVXA 1RYRA 2KZ3A 4LZGA 4M04A 4WC0A 2LYHA 1ZJMA 4PH5A 1BNPA 2B21A 5L1IA 4QZGA 5L1LA 1NK8A 2ZJAA 2F1JA 4IR1A 2XC9A 4ECSA 3TARA 5KT7A 3B0YA 3OV7A 5F9LA 4KLFA 2AGQA 2MUTB 3H8WA 2ZUCA 5J2KA 2JEJA 4NLKA 3ZDEA 3SI8A 5KFPA 5EWFA 2VA2A 4DQIA 7ICNA 4IRCA 8ICFA 1Z00A 4FH3A 4WC3A 8ICYA 4PGYA 4YVZA 1KLNA 2NRXA 3ISBA 3C21A 2ZTCA 5J0OA 4I2HA 4O5KA 2XCPA 3V72A 4ECVA 2PI4A 3HIYA 4O5EA 4DLGA 3H3AA 3M9MB 7ICFA 3T5LA 4AT7A 4M9NA 4MFCA 4UAZA 2C2DA 5HRKA 4FHXA 1TV9A 3BQ1A 2BHNA 4IR9A 3ISCA 4DS4A 1U48A 1QLNA 4JV1A 7ICUA 2P66A 8ICWA 4WC5A 2J6SA 1JN3A 3H8SA 3C2MA 1KNYA 4RQ3A 4B9UA 1Z3EB 2FLPA 3PO4A 5KFYA 3PW0A 2PI5A 4TUPA 5HRIA 2ZHBA 1T8EA 1IM4A 5KT6A 1ZQCA 2HW3A 2AQ0A 5D4BA 2DFLA 4QZ9A 1ZQZA 4UAWA 4KLSA 3FDSA 1ZQXA 5KFTA 4DQPA 3T5HA 3OVSA 2W9BB 4I28A 9ICCA 1N56A 2P6UA 1XSNA 5KG4A 1SL2A 2VA8A 4KITB 4ELTA 3AU2A 4C8OA 4X4UA 5KFVA 4DFJA 2Y1IA 3RB3A 2C2EA 4DEZA 3KTQA 4BWJA 3GV5B 9ICBA 2BR0A 4BXOB 2UVWA 2HHPA 3C2LA 1K1SA 4BWMA 3RB0A 4KTQA 2BCSA 4E0DA 4QWDA 4ED7A 3OGUA 4F4XA 5J2DA 5KT5A 4F2SA 4QZIA 2HVIA 1DK3A 7ICVA 4WBZA 3HX0A 4WBYA 3T3FA 1CEZA 3K4GA 4O5CA 2BE3A 4GXJA 3RH4A 2FMQA 4Q8FA 5KG5A 3RTVA 4DSKA 4PPXA 1U4BA 2BCVA 4R64A 9ICQA 4WC6A 4QZFA 4RT3A 5KFOA 5TZVA 3QEAZ 5DKWA 1L3UA 5HC9A 3G6XA 2ALZA 5HRBA 1B43A 3PNCA 5DQHA 1JX4A 4R8UA 3C1ZA 4ATBB 3RJKA 4DSLA 4XQ7A 4YXMA 4RQ1A 3JPNA 4NY8A 2ZH4A 3PO5A 4KLOA 1NK9A 3JYYA 5J0SA 3HWTA 2M9NA 4M9GA 4FO6A 4XRHA 4P2HA 2FLLA 3OUYB 3H37A 2Q66A 3BQ2A 2ASDA 1KFSA 1TKDA 5BOLA 3EYZA 1XSPA 4NKTA 4O3SA 3ISDA 3RJHA 5HMMA 4DQSA 7ICIA 4EYHB 2ZTEA 4J9PA 3SYZA 5DLFA 1KDHA 3RJFA 4EZ6A 3Q8SB 8ICEA 3AUOA 5J0PA 3JPQA 3C5GA 2JEFA 4YMNA 5KFEA 3Q8RB 2BDPA 2FPLA 2C28A 1NJZA 5EWEA 1R89A 9ICUA 4M5DA 1KTQA 2ZH5A 4FHWA 3MGIA 3UXPA 1DOQA 3EWAA 1DGSA 1VFGA 4ED6A 5KFRA 4JV0A 7ICJA 4QZCA 4RQ6A 1BPZA 3RB6A 3AQMA 2F1HA 3H40A 4EP7A 3AQLA 5KG0A 2DR7A 4Z6DA 5HR9A 1WOTA 4O3QA 3WFSC 3GIKA 3C23A 4YR3A 3LQCB 2ZH8A 1NK6A 4KLEA 2KN7A 3JPTA 1XU4A 3N4MB 4K4GA 7ICGA 2DR5A 3WFPA 4IRDA 1XWLA 4DQQA 4FH5A 5KG1A 4J9NA 1ZQPA 1R8AA 4EBEA 3NGDA 4KLLA 5J2JA 2ZH3A 4M6WA 3K75D 3OSPA 4O0IA 3AQKA 5BOMA 4J9MA 3PW2A 3IM1A 4YR0A 2BGWA 2JZBB 1L3SA 4NLGA 4X4PA 4RT2A 3BJYA 2HHSA 1TFYA 4NKUA 3KHLA 1Q78A 4AT9B 4ED2A 4PHDA 4YR2A 5J2HA 4B9LA 2A1JB 2FMPA 3PX4A 4M9JA 3PW5A 5IIMA 2ZUDA 1ZQEA 4RQ2A 4DOAA 2NRWA 3OVBA 1NK4A 5DECA 2DVIA 2DR9A 4I2GA 4UB1A 3ZDAA 1ZQDA 4GXKA 2HHQA 4KLHA 4ZH4A 4Z6FA 2XY5A 1SKWA 1MQ3A 3RR8A 3T5JA 4F8RA 4RQ5A 4QZEA 3UQ0A 1NKBA 4TURA 1L3TA 5DBBA 5KFWA 2IMWP 1EXNA 1HJPA 3GQCA 1JIHA 5F9NA 4KLUA 2ZUBA 4KN4A 5HP4A 2PXIA 2XY6A 2RFFA 4ELUA 1D8LA 1RPLA 1UEUA 4LT6A 5DDMA 4I27A 1HUOA 4RQ4A 3JPSA 5CR0A 1KFDA 1JMSA 4KMUA 1ZQRA 4F5RA 1S9FA 4I2AA 3GIIA 2ATLA 4M0AA 4Q45A 4XQ8A 5J0YA 4R66A 3C5FA 9ICTA 4X4TA 5JUMA 2GWSA 4O3RA 4ECTA 2PFOA 2R8GA 4JWMA 3MR2A 3C2KA 1ZETA 4QZDA 2ISPA 1MQ2A 4KLMA 3HJ1A 2NRTA 1NK0A 5CHGA 1T7PA 1X9MA 5L1JA 4GC6A 3PW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXW A;  1ZQS A;  2ZH2 A;  2FPK A;  2JEI A;  2BCR A;  3UXN A;  4RUC A;  4F5O A;  4KLG A;  9ICE A;  9ICK A;  3Q8Q B;  2NRZ A;  3BQT A;  3ZD8 A;  1UEV A;  1RXV A;  1L5U A;  3QZ8 A;  3NTU A;  9ICO A;  1S0O A;  1S76 D;  3WFO A;  8ICI A;  4Q43 A;  4ECW A;  5DB6 A;  2PBE A;  2M2W A;  2DRB A;  4PGX A;  3OJS A;  1U45 A;  2FPM A;  2XY7 A;  3GIJ A;  1BPY A;  1B22 A;  3UQ2 A;  5KFZ A;  9ICS A;  3ZDC A;  4RWN A;  4YXJ A;  3C1Y A;  1TK5 A;  1QTM A;  3KHG A;  3MR6 A;  1CUK A;  4UB3 A;  4QWA A;  4ECY A;  4QZ8 A;  2BPF A;  4KLJ A;  2KP7 A;  7ICO A;  5DBC A;  7ICE A;  3LWM A;  1K1Q A;  3PMN A;  3TAP A;  4X4Q A;  5HRH A;  4DF4 A;  2PFN A;  5HML A;  3OVA A;  1UA1 A;  3HP6 A;  4UD5 A;  4IQT A;  3UPQ A;  8ICL A;  4ECU A;  2H5X A;  1KEJ A;  2BCQ A;  4I2D A;  4ELV A;  1KFT A;  4F93 B;  5KFF A;  4LVS A;  8ICV A;  7ICT A;  4X4S A;  2IA6 A;  2KFZ A;  4ED1 A;  4F3O A;  8ICZ A;  4EBK A;  4DOB A;  4F4W A;  2MUT A;  7ICR A;  2ZHA A;  4QZB A;  5DGB A;  5HRF A;  3GV7 B;  2O1P A;  2V4Q A;  8ICO A;  3V6K A;  2C22 A;  1IXR A;  4DSJ A;  7ICQ A;  2W9C B;  4O3P A;  1BVS A;  4RPZ A;  3H8J A;  5DQI A;  3MGH A;  2RDI A;  1D9D A;  3TI0 A;  4C8N A;  2FMS A;  4F5P A;  4NLZ A;  1F5A A;  8ICT A;  4E7X A;  5DED A;  4GC7 A;  4KLT A;  5DG7 A;  4M9H A;  3RBE A;  5J0T A;  7ICH A;  1JAJ A;  3RJJ A;  4RQ0 A;  3MBY A;  3OHB A;  4DL7 A;  1NK7 A;  2BPC A;  1MIV A;  4J9S A;  2KTQ A;  4AT8 B;  1TAQ A;  4ECR A;  8ICH A;  2HHW A;  8ICP A;  2AU0 A;  1A76 A;  3OJU A;  4JUZ A;  3V7L A;  4F91 B;  1JXL A;  1PZN A;  5KFA A;  4DFP A;  3UPS A;  4F50 A;  3SZ2 A;  2M2V A;  5C5J A;  5L1K A;  4DL3 A;  9ICJ A;  1NOM A;  3QZ7 A;  4RQ8 A;  1Y88 A;  5BPC A;  2W8L A;  4FHY A;  2RDJ A;  5DQG A;  4IQU A;  3ORY A;  2UVV A;  5IIJ A;  1ZQH A;  4C8K A;  5EOZ A;  4F2R A;  1OU5 A;  3MDC A;  5D46 A;  4I2F A;  2AJQ A;  4JK1 A;  1BGX T;  2HVH A;  3ZD9 A;  4JWN A;  1YLQ A;  4Z6E A;  2BCU A;  5KG2 A;  1SL1 A;  4C8M A;  4RQ7 A;  2ZH1 A;  5KFS A;  2W9B A;  3TAQ A;  4B9T A;  4O3O A;  5IIL A;  5J0R A;  4NXZ A;  4J9Q A;  4DOC A;  4MEY A;  3MFI A;  3PX0 A;  4I2J A;  2Q0Z X;  5J0W A;  3OSN A;  1TK8 A;  4DS5 A;  1L3V A;  4MFF A;  5KFD A;  4ECQ A;  4MEX A;  2AQ4 A;  5DG9 A;  2BPG A;  4CCH A;  4X0A A;  4BXO A;  4NLN A;  4P4P A;  2F1I A;  3QEB Z;  1SKR A;  4Q8E A;  4E80 A;  3MFH A;  3RAX A;  5KFK A;  4FHP A;  2JEG A;  5KFG A;  3WFQ E;  4UB4 A;  3RJG A;  1KRP A;  1ZJN A;  2HHT A;  4MF2 A;  5KFB A;  1MIY A;  1Q79 A;  4B9M A;  4DL4 A;  5KT2 A;  3GIM A;  3Q8M A;  1Z00 B;  5HRE A;  7ICS A;  4UAY A;  4XUS A;  7ICL A;  3B0X A;  3KHH A;  4ECZ A;  3JPO A;  1T4G A;  3T5K A;  4B9V A;  1NZP A;  1D8Y A;  4PHA A;  3RH6 A;  5CA7 A;  3H4D A;  4RU9 A;  4TQR A;  4F4Y A;  4DL5 A;  1ZQA A;  1ZQT A;  2FLN A;  2ZH6 A;  4WC7 A;  5F2V O;  2WTF A;  5KFC A;  5J29 A;  3ZDB A;  3V6H A;  4YCX A;  4IQW A;  4ATB A;  2OWO A;  3C66 A;  4AT7 B;  4FS1 A;  4DF8 A;  2BQR A;  1ZYQ A;  3MR5 A;  4XA5 A;  3TAN A;  4KLQ A;  3RBD A;  1D9F A;  4JV2 A;  4O9M A;  2I1Q A;  1MSW D;  8ICG A;  3H39 A;  3PR5 B;  1A77 A;  3FYH A;  1JXE A;  4YP3 A;  4X0B A;  1BPX A;  1ZQV A;  3UXO A;  3M8R A;  3RRH A;  4I2B A;  8ICC A;  8ICA A;  5HRD A;  3OUY A;  1SL0 A;  5DGA A;  4YMM A;  4ECX A;  4QZA A;  3BQ0 A;  4F5N A;  2HHX A;  4I2I A;  2V9W A;  3LWL A;  1TAU A;  4YG2 A;  2XGQ A;  1COO A;  4RPY A;  4P4M A;  5EWG A;  4TQS A;  3ETL A;  4FBU A;  4I2C A;  2ISO A;  4R63 A;  4QW9 A;  1NKC A;  4DLE A;  1XSL A;  4E8F A;  4X4O A;  4NM2 A;  9ICV A;  1MC8 A;  8ICK A;  9ICW A;  3M8S A;  2IHM A;  3PY8 A;  4O3N A;  4RWQ A;  1XO1 A;  4J9K A;  3EPG A;  4F4Z A;  5HRL A;  1U47 A;  3M9N B;  4I29 A;  4ED0 A;  3HJ4 A;  5DLG A;  3Q8P B;  4RZR A;  8ICU A;  2XGP A;  4FHV A;  4YN4 A;  5DBA A;  4UBC A;  4DFK A;  4NM1 A;  4UB5 A;  3RJE A;  1NJX A;  4F5Q A;  4ED8 A;  1ZQJ A;  3HT3 A;  4B9S A;  9ICM A;  3C18 A;  4M9L A;  2W8K A;  5IIO A;  5J2I A;  4B9N A;  4J9O A;  5J2A A;  1ZQQ A;  8ICX A;  8ICB A;  5HNK A;  1SKS A;  3RR7 A;  3RB4 A;  1ZQW A;  4TUS A;  2ID1 A;  3H7I A;  4BDP A;  4RNO A;  1RZT A;  1ZQG A;  4R8U B;  5KTQ A;  5KFQ A;  3OHA A;  2XO7 A;  3PR4 A;  5HHI A;  1S97 A;  1ZQF A;  9ICP A;  5J0U A;  5D49 A;  2JZB A;  3GDX A;  4RWP A;  4QWB A;  4S3N A;  3GFK B;  2KZZ A;  9ICI A;  3Q8L A;  4QZH A;  4AT9 A;  4EBD A;  3M9O B;  1S0M A;  4QW8 A;  1H38 A;  2IBK A;  2DRA A;  4EYI B;  2A1J A;  5CP2 A;  5CWR A;  2M2U A;  5J0X A;  3LK9 A;  4M2Y A;  4DSE A;  5J2C A;  4DSI A;  3TFR A;  1KSP A;  5III A;  4IG8 A;  4R65 A;  3V7J A;  3RH5 A;  2IHN A;  5KFH A;  3RJI A;  2W9A A;  3JPR A;  3EPI A;  4ED3 A;  3E2E A;  5J2F A;  3G6Y A;  3Q8K A;  7ICM A;  4DWI A;  1UT5 A;  3EZ5 A;  4IQV A;  1FA0 A;  1WCN A;  1TK0 A;  1ZQB A;  4UD4 A;  4WC2 A;  2M2T A;  5KT3 A;  1V9P A;  4GXI A;  2ZJ8 A;  1ZQI A;  4KN7 A;  3GIL A;  1R8B A;  5DB9 A;  1ZQK A;  4RNM A;  4MFA A;  1UT8 A;  1X9S A;  5KFI A;  4DSF A;  1V4A A;  1RYS A;  4I2E A;  4WCW A;  4GLX A;  4PHE A;  9ICA A;  1S0N A;  4X4V A;  1QSL A;  1QSS A;  4Q44 A;  1BPB A;  2VAN A;  4DL6 A;  5CJ7 A;  7ICP A;  1NO5 A;  1R8C A;  2KFN A;  3NYB A;  4KLI A;  1ZQU A;  3RRG A;  4IRK A;  2ZH7 A;  5KG6 A;  2R8J A;  4K4I A;  4DFM A;  2R8I A;  1XS9 D;  4RUA A;  4EEY A;  9ICX A;  3PW7 A;  3SV3 A;  4EZ9 A;  1C7Y A;  2I9G A;  1S0V A;  1PX5 A;  4UQG A;  3V7K A;  8ICJ A;  3H38 A;  4RPX A;  4LZD A;  9ICF A;  2J6T A;  2XCA A;  1NJY A;  5DDY A;  4KLD A;  9ICG A;  1NJW A;  1ZQN A;  3EW9 A;  5J2B A;  4RWO A;  2DPJ A;  3KHR A;  2ZH9 A;  1U9L A;  4C8L A;  4M6W B;  1ZQM A;  1DK2 A;  5CB1 A;  3N97 B;  8ICM A;  5IIK A;  5HRG A;  8ICQ A;  3HW8 A;  4RNN A;  3ZDD A;  1VJ7 A;  9ICL A;  9ICH A;  1ZQO A;  3G6V A;  1UA0 A;  4X5V A;  4F92 B;  1NKE A;  4QWC A;  1BNO A;  5DG8 A;  3JPP A;  4BGD A;  4Z6C A;  4X4N A;  9ICR A;  4G3I A;  2VA3 A;  1S77 D;  4YFK A;  5KFU A;  5L9X A;  5KFX A;  4P4O A;  4YD1 A;  2P6R A;  2BQU A;  5KG7 A;  1ZQY A;  1X9W A;  5KFN A;  4J9L A;  2ASL A;  1N48 A;  5DB7 A;  2V4R A;  4UB2 A;  2R8H A;  5J0Q A;  4K4H A;  2PFQ A;  3L9D A;  4QWE A;  3TQ1 A;  3PX6 A;  4WC1 A;  4PHP A;  1ZQL A;  1SZP A;  4FBT A;  1XC9 A;  1QSY A;  9ICN A;  2BQ3 A;  1HUZ A;  3H4B A;  2ZJ5 A;  4YD2 A;  4FS2 A;  2ASJ A;  2W9C A;  1NK5 A;  4DO9 A;  3RAQ A;  2HHV A;  4EBC A;  1TFW A;  1BPE A;  3BDP A;  5J2G A;  3MR3 A;  2Y1J A;  5KFJ A;  2UVU A;  4X4R A;  5KT4 A;  2HHU A;  4UBB A;  8ICS A;  2MAX A;  5IIN A;  2UVR A;  4DL2 A;  7ICK A;  2PFP A;  1WCL A;  5KG3 A;  1LV5 A;  4AT8 A;  2W9M A;  2DPI A;  4YMO A;  1JQR A;  2BKE A;  2R8K A;  1UET A;  2ZTD A;  4PGQ A;  8ICN A;  3PML A;  4TUQ A;  3WFR E;  1X2I A;  5J2E A;  1BPD A;  4DQR A;  5KFL A;  5HHH A;  1TVA A;  2C2R A;  2NRK A;  3HPO A;  2O5A A;  2KZM A;  3AU6 A;  3THV A;  3JZ0 A;  3V6J A;  3AQN A;  4EBJ A;  3QE9 Y;  3LDA A;  5KFM A;  3PV8 A;  4F4K A;  4MF8 A;  1LB2 B;  3GV8 B;  1TFR A;  2NRV A;  1ARO P;  4YQW A;  5DB8 A;  2AGO A;  1T3N A;  2J6U A;  3IHQ B;  2AGP A;  4HYK A;  3MAB A;  4J9R A;  1S10 A;  4WC4 A;  2DR8 A;  1U49 A;  3MDA A;  3TFS A;  8ICR A;  1MIW A;  4M47 A;  3SV4 A;  3PVX A;  1RYR A;  2KZ3 A;  4LZG A;  4M04 A;  4WC0 A;  2LYH A;  1ZJM A;  4PH5 A;  1BNP A;  2B21 A;  5L1I A;  4QZG A;  5L1L A;  1NK8 A;  2ZJA A;  2F1J A;  4IR1 A;  2XC9 A;  4ECS A;  3TAR A;  5KT7 A;  3B0Y A;  3OV7 A;  5F9L A;  4KLF A;  2AGQ A;  2MUT B;  3H8W A;  2ZUC A;  5J2K A;  2JEJ A;  4NLK A;  3ZDE A;  3SI8 A;  5KFP A;  5EWF A;  2VA2 A;  4DQI A;  7ICN A;  4IRC A;  8ICF A;  1Z00 A;  4FH3 A;  4WC3 A;  8ICY A;  4PGY A;  4YVZ A;  1KLN A;  2NRX A;  3ISB A;  3C21 A;  2ZTC A;  5J0O A;  4I2H A;  4O5K A;  2XCP A;  3V72 A;  4ECV A;  2PI4 A;  3HIY A;  4O5E A;  4DLG A;  3H3A A;  3M9M B;  7ICF A;  3T5L A;  4AT7 A;  4M9N A;  4MFC A;  4UAZ A;  2C2D A;  5HRK A;  4FHX A;  1TV9 A;  3BQ1 A;  2BHN A;  4IR9 A;  3ISC A;  4DS4 A;  1U48 A;  1QLN A;  4JV1 A;  7ICU A;  2P66 A;  8ICW A;  4WC5 A;  2J6S A;  1JN3 A;  3H8S A;  3C2M A;  1KNY A;  4RQ3 A;  4B9U A;  1Z3E B;  2FLP A;  3PO4 A;  5KFY A;  3PW0 A;  2PI5 A;  4TUP A;  5HRI A;  2ZHB A;  1T8E A;  1IM4 A;  5KT6 A;  1ZQC A;  2HW3 A;  2AQ0 A;  5D4B A;  2DFL A;  4QZ9 A;  1ZQZ A;  4UAW A;  4KLS A;  3FDS A;  1ZQX A;  5KFT A;  4DQP A;  3T5H A;  3OVS A;  2W9B B;  4I28 A;  9ICC A;  1N56 A;  2P6U A;  1XSN A;  5KG4 A;  1SL2 A;  2VA8 A;  4KIT B;  4ELT A;  3AU2 A;  4C8O A;  4X4U A;  5KFV A;  4DFJ A;  2Y1I A;  3RB3 A;  2C2E A;  4DEZ A;  3KTQ A;  4BWJ A;  3GV5 B;  9ICB A;  2BR0 A;  4BXO B;  2UVW A;  2HHP A;  3C2L A;  1K1S A;  4BWM A;  3RB0 A;  4KTQ A;  2BCS A;  4E0D A;  4QWD A;  4ED7 A;  3OGU A;  4F4X A;  5J2D A;  5KT5 A;  4F2S A;  4QZI A;  2HVI A;  1DK3 A;  7ICV A;  4WBZ A;  3HX0 A;  4WBY A;  3T3F A;  1CEZ A;  3K4G A;  4O5C A;  2BE3 A;  4GXJ A;  3RH4 A;  2FMQ A;  4Q8F A;  5KG5 A;  3RTV A;  4DSK A;  4PPX A;  1U4B A;  2BCV A;  4R64 A;  9ICQ A;  4WC6 A;  4QZF A;  4RT3 A;  5KFO A;  5TZV A;  3QEA Z;  5DKW A;  1L3U A;  5HC9 A;  3G6X A;  2ALZ A;  5HRB A;  1B43 A;  3PNC A;  5DQH A;  1JX4 A;  4R8U A;  3C1Z A;  4ATB B;  3RJK A;  4DSL A;  4XQ7 A;  4YXM A;  4RQ1 A;  3JPN A;  4NY8 A;  2ZH4 A;  3PO5 A;  4KLO A;  1NK9 A;  3JYY A;  5J0S A;  3HWT A;  2M9N A;  4M9G A;  4FO6 A;  4XRH A;  4P2H A;  2FLL A;  3OUY B;  3H37 A;  2Q66 A;  3BQ2 A;  2ASD A;  1KFS A;  1TKD A;  5BOL A;  3EYZ A;  1XSP A;  4NKT A;  4O3S A;  3ISD A;  3RJH A;  5HMM A;  4DQS A;  7ICI A;  4EYH B;  2ZTE A;  4J9P A;  3SYZ A;  5DLF A;  1KDH A;  3RJF A;  4EZ6 A;  3Q8S B;  8ICE A;  3AUO A;  5J0P A;  3JPQ A;  3C5G A;  2JEF A;  4YMN A;  5KFE A;  3Q8R B;  2BDP A;  2FPL A;  2C28 A;  1NJZ A;  5EWE A;  1R89 A;  9ICU A;  4M5D A;  1KTQ A;  2ZH5 A;  4FHW A;  3MGI A;  3UXP A;  1DOQ A;  3EWA A;  1DGS A;  1VFG A;  4ED6 A;  5KFR A;  4JV0 A;  7ICJ A;  4QZC A;  4RQ6 A;  1BPZ A;  3RB6 A;  3AQM A;  2F1H A;  3H40 A;  4EP7 A;  3AQL A;  5KG0 A;  2DR7 A;  4Z6D A;  5HR9 A;  1WOT A;  4O3Q A;  3WFS C;  3GIK A;  3C23 A;  4YR3 A;  3LQC B;  2ZH8 A;  1NK6 A;  4KLE A;  2KN7 A;  3JPT A;  1XU4 A;  3N4M B;  4K4G A;  7ICG A;  2DR5 A;  3WFP A;  4IRD A;  1XWL A;  4DQQ A;  4FH5 A;  5KG1 A;  4J9N A;  1ZQP A;  1R8A A;  4EBE A;  3NGD A;  4KLL A;  5J2J A;  2ZH3 A;  4M6W A;  3K75 D;  3OSP A;  4O0I A;  3AQK A;  5BOM A;  4J9M A;  3PW2 A;  3IM1 A;  4YR0 A;  2BGW A;  2JZB B;  1L3S A;  4NLG A;  4X4P A;  4RT2 A;  3BJY A;  2HHS A;  1TFY A;  4NKU A;  3KHL A;  1Q78 A;  4AT9 B;  4ED2 A;  4PHD A;  4YR2 A;  5J2H A;  4B9L A;  2A1J B;  2FMP A;  3PX4 A;  4M9J A;  3PW5 A;  5IIM A;  2ZUD A;  1ZQE A;  4RQ2 A;  4DOA A;  2NRW A;  3OVB A;  1NK4 A;  5DEC A;  2DVI A;  2DR9 A;  4I2G A;  4UB1 A;  3ZDA A;  1ZQD A;  4GXK A;  2HHQ A;  4KLH A;  4ZH4 A;  4Z6F A;  2XY5 A;  1SKW A;  1MQ3 A;  3RR8 A;  3T5J A;  4F8R A;  4RQ5 A;  4QZE A;  3UQ0 A;  1NKB A;  4TUR A;  1L3T A;  5DBB A;  5KFW A;  2IMW P;  1EXN A;  1HJP A;  3GQC A;  1JIH A;  5F9N A;  4KLU A;  2ZUB A;  4KN4 A;  5HP4 A;  2PXI A;  2XY6 A;  2RFF A;  4ELU A;  1D8L A;  1RPL A;  1UEU A;  4LT6 A;  5DDM A;  4I27 A;  1HUO A;  4RQ4 A;  3JPS A;  5CR0 A;  1KFD A;  1JMS A;  4KMU A;  1ZQR A;  4F5R A;  1S9F A;  4I2A A;  3GII A;  2ATL A;  4M0A A;  4Q45 A;  4XQ8 A;  5J0Y A;  4R66 A;  3C5F A;  9ICT A;  4X4T A;  5JUM A;  2GWS A;  4O3R A;  4ECT A;  2PFO A;  2R8G A;  4JWM A;  3MR2 A;  3C2K A;  1ZET A;  4QZD A;  2ISP A;  1MQ2 A;  4KLM A;  3HJ1 A;  2NRT A;  1NK0 A;  5CHG A;  1T7P A;  1X9M A;  5L1J A;  4GC6 A;  3PW4 A; 
#chains in the Genus database with same CATH topology
 3HKZ C;  2FPK A;  3UXN A;  4RUC A;  9ICK A;  2H3Q A;  3Q8Q B;  2NRZ A;  5AKK A;  9ICO A;  3GZF A;  8ICI A;  3F5E A;  5DB6 A;  3GIJ A;  2F76 X;  3ZDC A;  4QIW C;  2KP7 A;  4Y2P A;  3LWM A;  3PMN A;  3OVA A;  5HRH A;  2PFN A;  1UA1 A;  4ECU A;  2KIC A;  2B51 A;  4I2D A;  1KFT A;  2MUT A;  2WB1 F;  1SV0 C;  2F3N A;  3GV7 B;  1A6S A;  4DSJ A;  7ICQ A;  2EAP A;  1MA7 A;  4F5P A;  8ICT A;  4E7X A;  5DED A;  4GC7 A;  7ICH A;  1JAJ A;  1MIV A;  3OHB A;  4DL7 A;  2KTQ A;  1TAQ A;  8ICP A;  3H0M B;  2G07 A;  3SAH A;  2WB1 C;  3OJU A;  4JUZ A;  4F91 B;  1YZ6 A;  3UPS A;  4F50 A;  1B0X A;  3QZ7 A;  3AN1 A;  2RDJ A;  5DQG A;  3ORY A;  2QB0 A;  4JWN A;  1SL1 A;  4RQ7 A;  1LKY B;  2W9B A;  3TAQ A;  5J0R A;  4MEY A;  2YTU A;  4MFF A;  5AIC A;  2BPG A;  4Q8E A;  2KE7 A;  3MFH A;  1IG6 A;  5KFK A;  1KRP A;  4B9M A;  5KT2 A;  3GIM A;  5HRE A;  4ECZ A;  3RH6 A;  4K9A A;  5CA7 A;  4RU9 A;  2ZH6 A;  4WC7 A;  5KFC A;  3ZDB A;  3V6H A;  4AT7 B;  1ZD3 A;  5C0Y A;  2D3D A;  1ZYQ A;  2B56 A;  4Y2U A;  3C28 A;  1D9F A;  4O9M A;  4I0U A;  2F77 X;  3PR5 B;  3FYH A;  4YP3 A;  1BPX A;  4EEB A;  3UXO A;  4I2B A;  2HHX A;  4QZA A;  4YG2 A;  4P4M A;  4R63 A;  4QW9 A;  3EUB 2;  3EPG A;  3QUC A;  1U47 A;  1AQ6 A;  1PVP A;  3KKA C;  4OAI Z;  4UB5 A;  3LYS A;  4AYB F;  2ODG A;  2ZG6 A;  3C18 A;  4M9L A;  2GO7 A;  5J2A A;  5HNK A;  2HBM A;  3RR7 A;  3RB4 A;  4TUS A;  3H0R B;  4IL6 U;  1RZT A;  2JH1 A;  2YN4 A;  4R8U B;  5KTQ A;  5KFQ A;  1S97 A;  1ZQF A;  9ICP A;  5D49 A;  1S8O A;  4ZOH C;  3GDX A;  4QWB A;  4CF5 A;  4O67 A;  2KZZ A;  3Q8L A;  4EBD A;  2HN2 A;  4AYB C;  4QW8 A;  2KHQ A;  2DRA A;  4EYI B;  5EE1 A;  5CP2 A;  4DSE A;  5J2C A;  2HOI A;  4ED3 A;  4NXV A;  4DWI A;  1UT5 A;  1UPH A;  1ZQ1 C;  5KT3 A;  2ZJ8 A;  3WK7 A;  4KN7 A;  1ZQI A;  4MFA A;  1UT8 A;  5CFT A;  4OCZ A;  4UAS A;  3F2C A;  4DL6 A;  7ICP A;  4KLI A;  3WK4 A;  2ZH7 A;  4NV0 A;  4K4I A;  3WU2 U;  2PMZ F;  4EEY A;  1PX5 A;  2FE9 A;  1PVQ A;  2J6T A;  4KLD A;  9ICG A;  1VJ5 A;  3EW9 A;  2ZH9 A;  5CB1 A;  8ICQ A;  5ALJ A;  3VC8 A;  3HW8 A;  2MA1 A;  3G6V A;  1KBU A;  3JPP A;  4Z6C A;  2VA3 A;  2PMZ C;  3QX7 A;  2W3S A;  5ALG A;  4P4O A;  4YD1 A;  2BQU A;  5KG7 A;  2OEH A;  2PFQ A;  3PSI A;  4QWE A;  3TQ1 A;  1QQ6 A;  4PZN A;  1SZP A;  9ICN A;  2VJ5 A;  3QU9 A;  1HUZ A;  4CF4 A;  4LEV A;  2E1F A;  4UW9 A;  4X4R A;  5J2G A;  1IIP A;  4Y2X A;  2CN1 A;  2UVR A;  3E58 A;  1WCL A;  5KG3 A;  2LYA A;  2DPI A;  4TUQ A;  4DQR A;  2OH2 A;  2H3Z A;  1JRP A;  5HHH A;  2O5A A;  3THV A;  3LDA A;  5KFM A;  3PV8 A;  4O69 A;  3WK8 A;  4MF8 A;  3GV8 B;  1TFR A;  4Y2T A;  1T3N A;  2AGO A;  3IHQ B;  1S10 A;  3MAB A;  1X42 A;  3TFS A;  8ICR A;  3SV4 A;  1RYR A;  2KZ3 A;  4M04 A;  1KL9 A;  4WC0 A;  4PH5 A;  1BNP A;  2K89 A;  5L1I A;  3N28 A;  3RF9 A;  1NK8 A;  4Y2R A;  3MGV A;  3IP4 B;  1X66 A;  2YQE A;  2D8C A;  1X6J A;  3D2N A;  3ERC C;  1B4F A;  2ZUC A;  2JEJ A;  3ZDE A;  2VA2 A;  7ICN A;  1Z00 A;  4WC3 A;  2WFA A;  1N5X A;  4PGY A;  5G5H A;  4NL9 C;  4PJ0 U;  4HX0 A;  5D62 A;  3M9M B;  2LBO A;  4M9N A;  5HRK A;  2BHN A;  3ISC A;  7ICU A;  2G09 A;  1JN3 A;  3C2M A;  1KNY A;  4B9U A;  3PO4 A;  2PI5 A;  2BZF A;  2LHT A;  4K98 A;  5D4B A;  4UAW A;  2Z7J A;  2YX8 A;  2JH7 A;  5AKE A;  4I28 A;  2ZIV B;  5KG4 A;  1Z1B A;  4ELT A;  3AU2 A;  4C4S A;  2C2E A;  9ICB A;  4BXO B;  1FFV A;  4G9B A;  4KTQ A;  4E0D A;  3OGU A;  4F4X A;  2HVI A;  2G5I B;  4O5C A;  4DSK A;  1HIW A;  4F71 A;  4PPX A;  4WC6 A;  1RYU A;  1L3U A;  2FDR A;  4P0Q B;  1JX4 A;  5D61 A;  3C1Z A;  4ATB B;  4XQ7 A;  4NY8 A;  4C7Z A;  1NK9 A;  2FI1 A;  3JYY A;  3HWT A;  2M9N A;  2ZXH A;  4FO6 A;  2QB1 A;  2Y0S F;  1Q8K A;  2K8A A;  2M0N A;  4O68 A;  4O3S A;  3ISD A;  3RJH A;  7ICI A;  5DLF A;  3RJF A;  3Q8S B;  1ZXI A;  5J0P A;  2WF7 A;  4P0P B;  1R89 A;  9ICU A;  3MGI A;  1VFG A;  4JV0 A;  4RQ6 A;  1BPZ A;  4EP7 A;  2F1H A;  1WOT A;  3WFS C;  2DR5 A;  3N4M B;  1XWL A;  4DQQ A;  4IC9 A;  4FH5 A;  2E8M A;  5KG1 A;  1R8A A;  1ZRN A;  4EBE A;  3NGD A;  2ZH3 A;  3OSP A;  3AQK A;  2BBJ A;  3PW2 A;  3IM1 A;  1TAM A;  4X4P A;  1L3S A;  4RT2 A;  3I28 A;  3DEE A;  3KHL A;  4CNQ A;  3PX4 A;  2ZUD A;  3OVB A;  4NXU A;  2DVI A;  3BS5 B;  1PVR A;  1SKW A;  3WK5 A;  3T5J A;  3RR8 A;  3HIL A;  3UQ0 A;  1L3T A;  2P35 A;  1N5W A;  3D2Q A;  3U26 A;  3GQC A;  4KN4 A;  5L1M A;  5HP4 A;  2RFF A;  2CPR A;  4ELU A;  1UEU A;  2LM4 A;  4LT6 A;  4NXX A;  5DDM A;  5JU5 A;  2G06 A;  3IG8 A;  1S9F A;  2ATL A;  3C5F A;  2BBH A;  4O3R A;  2R8G A;  4EEL A;  2W3R A;  3NS1 A;  3C2K A;  4Y2Q A;  4KLM A;  1RQN A;  5CHG A;  4GC6 A;  1ZQS A;  4GFJ A;  2JEI A;  4KLG A;  3BQT A;  5F3X B;  1UEV A;  4KB6 A;  3NTU A;  3WFO A;  2EAM A;  1S76 D;  3M7D A;  2KKP A;  4Q43 A;  4YXJ A;  2LMR A;  3KHG A;  5JTG A;  5D63 A;  4UB3 A;  4ECY A;  1PK1 B;  4U7C A;  5DBC A;  7ICE A;  4KM5 A;  3OTQ A;  5EE3 A;  2H5X A;  5AM2 A;  2BCQ A;  5ALO A;  8ICV A;  7ICT A;  4X4S A;  4F3O A;  4DOB A;  4F4W A;  3KKA A;  4QZB A;  5DGB A;  5HRF A;  2LPE A;  2V4Q A;  2W9C B;  4O3P A;  4RPZ A;  2W7O A;  2WF5 A;  3H8J A;  1D9D A;  2RDI A;  4NLZ A;  2KKV A;  4UB6 U;  5DG7 A;  3RJJ A;  3MBY A;  1NK7 A;  4AT8 B;  2MRL A;  4OAH A;  3DV9 A;  8ICH A;  1A76 A;  2QKQ A;  1JXL A;  1PZN A;  3SQI A;  4DFP A;  3SZ2 A;  5L1K A;  5AI0 A;  4RQ8 A;  2W8L A;  2GAF D;  4C8K A;  4F2R A;  1ZRM A;  4I2F A;  2AJQ A;  4JK1 A;  3K1Z A;  2HVH A;  3ZD9 A;  2ZH1 A;  5IIL A;  3AQL A;  4I2J A;  2Q0Z X;  4DS5 A;  4DFD A;  2KG5 A;  4X0A A;  4MKP A;  2OM6 A;  4NLN A;  3QEB Z;  3RAX A;  3WFQ E;  5KFG A;  1RM6 C;  2OCE A;  2A3V A;  1ZJN A;  2HHT A;  2EZY A;  3Q8M A;  7ICS A;  1ZD5 A;  4UAY A;  3ETR A;  4XUS A;  7ICL A;  3JPO A;  1NZP A;  2JHD A;  1D8Y A;  4TQR A;  1ZQA A;  1ZQT A;  4FO1 A;  2VJ4 A;  4FS1 A;  2BQR A;  2HSZ A;  2B6G A;  4JV2 A;  2I1Q A;  4X0B A;  2GOL A;  5AK3 A;  8ICA A;  3OUY A;  5H2F U;  5DGA A;  4YMM A;  3NVW A;  2WF9 A;  4ECX A;  1TAU A;  4F5N A;  1V97 A;  3R9K A;  2ZIX A;  4TQS A;  4FBU A;  3QU4 A;  1Q3U A;  4NM2 A;  8ICK A;  4RWQ A;  2IHM A;  1XO1 A;  3LVV A;  5DLG A;  3Q8P B;  2KNJ A;  4RZR A;  2XGP A;  1O08 A;  1QH9 A;  5DBA A;  4UBC A;  3WKC A;  4RQM A;  2JRZ A;  4F5Q A;  1QCK A;  2KJ9 A;  1FO4 A;  1ZQJ A;  5IIO A;  8ICX A;  1SKS A;  1PK3 A;  5KAI U;  4US8 A;  4BDP A;  3CRX A;  3PR4 A;  2JZB A;  4S3N A;  4QZH A;  5EE0 A;  1H38 A;  2A1J A;  2KSO B;  5ALW A;  3KD3 A;  4R65 A;  3V7J A;  3CNH A;  5AK6 A;  3RH5 A;  3G6Y A;  3Q8K A;  4UD4 A;  3HJE A;  1WCN A;  2M2T A;  4DCC A;  1MN8 A;  3GIL A;  5DB9 A;  4RNM A;  1X9S A;  4B6J A;  1RYS A;  1QQ5 A;  4PHE A;  1QSL A;  5AK4 A;  1ZQU A;  2R8J A;  1XS9 D;  1WWV A;  3PW7 A;  3UMG A;  4EZ9 A;  5ALS A;  1C7Y A;  4UQG A;  3V7K A;  8ICJ A;  4LZD A;  1NJW A;  1ZQN A;  3KHR A;  4C8L A;  4M6W B;  5HRG A;  3N97 B;  8ICM A;  5IIK A;  4PL1 A;  1SXD A;  4RNN A;  5KAF U;  9ICL A;  1ZQO A;  4X5V A;  4F92 B;  4QWC A;  4LEZ A;  4G3I A;  1PUZ A;  3EF2 A;  3N7R C;  5ALU A;  3BS7 A;  2LYB A;  5KFX A;  2E3T A;  3F5A A;  4EV6 A;  5KFN A;  1J2N A;  2ASL A;  1WG8 A;  4UB2 A;  2R8H A;  5J0Q A;  2HBL A;  3NRW A;  4K4H A;  2KD1 A;  3O0F A;  1ZQL A;  4CGZ A;  1QSY A;  2ZJ5 A;  1S5L U;  2I6X A;  4FS2 A;  2ASJ A;  5AKX A;  1NK5 A;  4DO9 A;  3RAQ A;  2HHV A;  1D8B A;  1TFW A;  1K5O A;  3BDP A;  3MR3 A;  2HHU A;  2IOF A;  4UBB A;  8ICS A;  2MAX A;  1UHU A;  5GTH U;  4DL2 A;  2PFP A;  4YMO A;  2K4H A;  4WQL A;  3WFR E;  2W54 A;  3CW2 C;  3H0L B;  1TVA A;  5HR6 A;  5KFL A;  2C2R A;  2KZM A;  3AU6 A;  2G0A A;  3AQN A;  3QE9 Y;  4YQW A;  1ARO P;  5AM5 A;  5DB8 A;  2AGP A;  3MDA A;  1LKY A;  3PVX A;  2HOF A;  4WJ3 B;  5J8Y A;  1Z1V A;  3I1Y A;  2ZJA A;  2F1J A;  4ACO A;  5KT7 A;  2H3F A;  3B0Y A;  2KIW A;  3PZP A;  5F9L A;  3BZK A;  3QUT A;  5J2K A;  4NLK A;  4DQI A;  5EWF A;  2E5S A;  2RP5 A;  4JLZ A;  3ER9 B;  3ISB A;  3HRD D;  3V72 A;  4ECV A;  3M1Y A;  3H3A A;  4AT7 A;  7ICF A;  4IS7 A;  4NJ8 A;  5ALZ A;  4FHX A;  2C2D A;  1TV9 A;  1J97 A;  3BQ1 A;  4DS4 A;  2P66 A;  4WC5 A;  4RQ3 A;  2FLP A;  1L8O A;  4TUP A;  2NO4 A;  5KT6 A;  2AQ0 A;  5AIB A;  3QU5 A;  2DL0 A;  5KFT A;  4DQP A;  2EAN A;  9ICC A;  4UAT A;  1N56 A;  2P6U A;  1XSN A;  1SL2 A;  4C8O A;  1L6N A;  3M6K A;  4DFJ A;  3RB3 A;  4DEZ A;  4BWJ A;  4NWI A;  4U6P A;  2HHP A;  3QU7 A;  3C2L A;  1YZ7 A;  3RB0 A;  5KNI A;  2BCS A;  1DK3 A;  5KT5 A;  3K4G A;  2BE3 A;  1WWU A;  3RH4 A;  2FMQ A;  4Q8F A;  2HCF A;  3RTV A;  9ICQ A;  4R64 A;  2GA9 D;  1L7N A;  5DKW A;  1ZD4 A;  1B43 A;  5DQH A;  2IOH A;  4R8U A;  3RJK A;  4YXM A;  4RQ1 A;  4KLO A;  4NLB A;  4N7R A;  2F2A B;  2YY6 A;  3SD7 A;  3SAG A;  3CYM A;  4XRH A;  2FLL A;  2KK0 A;  1XSP A;  3SMV A;  4FZL A;  3JCF A;  4J9P A;  4EZ6 A;  3SYZ A;  5K4L A;  4OAF A;  3JPQ A;  3C5G A;  5KFE A;  3ICX A;  2MU2 A;  4OJ5 A;  4J03 A;  4M5D A;  1KTQ A;  4FHW A;  4OD0 A;  4C4T A;  4ED6 A;  5KFR A;  5ALP A;  5KG0 A;  1T3Q A;  3GIK A;  4YR3 A;  3LQC B;  3SAF A;  2ZH8 A;  4KLE A;  4JB3 A;  7ICG A;  3WFP A;  2KMD A;  2YMQ A;  5AHX A;  2F8L A;  4YR0 A;  4WQK A;  5HR7 A;  3NKU A;  4XJE A;  4AT9 B;  4YR2 A;  3KBB A;  4EX7 A;  2DKX A;  4JMU A;  4DOA A;  1NK4 A;  4UB1 A;  3A0H U;  4GXK A;  2HHQ A;  4Z6F A;  2HBJ A;  4A8E A;  4RQ5 A;  1EXN A;  5F9N A;  4OJP A;  2PXI A;  1D8L A;  2H3I A;  4RQ4 A;  3JPS A;  1JMS A;  4M0A A;  4R66 A;  1T7P A;  5JUM A;  4EED A;  4JWM A;  1MQ2 A;  1DGJ A;  2ZIU B;  3SEI A;  3AEV A;  3PW4 A;  2ZH2 A;  2BCR A;  9ICE A;  2DUY A;  1T94 A;  3ZD8 A;  2YML A;  3QZ8 A;  1S0O A;  4PL2 A;  4ECW A;  2PBE A;  4USA A;  2M2W A;  1U45 A;  4CF3 A;  3OJS A;  2FPM A;  2XY7 A;  1B22 A;  4RWN A;  3KZX A;  3C1Y A;  2F44 A;  3MR6 A;  4KLJ A;  2MSN A;  1F44 A;  2ESE A;  2DGZ A;  4WH5 A;  3L3F X;  4IQT A;  8ICL A;  2KHV A;  2DWQ A;  5KFF A;  2KFZ A;  4ED1 A;  1L7P A;  7ICR A;  1KW4 A;  2W11 A;  2EH9 A;  8ICO A;  3NVO A;  1BVS A;  5DQI A;  3TI0 A;  4C8N A;  3KZI U;  1F5A A;  2IUB A;  3DDH A;  4NXT A;  3RBE A;  1N63 A;  4Y2S A;  4RQ0 A;  2BPC A;  4J9S A;  4GIB A;  2ZIU A;  2HHW A;  2AU0 A;  3NVZ A;  3V7L A;  5KFA A;  5C5J A;  4DL3 A;  1Y88 A;  2LKY A;  4FHY A;  2K8C B;  2UVV A;  5IIJ A;  1ZQH A;  1OU5 A;  5D46 A;  2BCU A;  5CFS A;  4O3O A;  1SV0 A;  4K4G A;  4NXZ A;  3H37 A;  5AKG A;  3MFI A;  2ZIV A;  1TK8 A;  1L3V A;  2ISO A;  5ALL A;  5KFD A;  4ECQ A;  4MEX A;  2AQ4 A;  5DG9 A;  4BXO A;  4E80 A;  1SKR A;  3PST A;  2JEG A;  4UB4 A;  5AI4 A;  1Q79 A;  5KFB A;  3B0X A;  1T4G A;  2XID A;  3T5K A;  4B9V A;  1X40 A;  4PHA A;  4Y2V A;  3H4D A;  4DL5 A;  4P0Q A;  2FLN A;  2WTF A;  5J29 A;  4IQW A;  4YCX A;  4ATB A;  3QUQ A;  2FCL A;  4KMO B;  4KLQ A;  1XO0 A;  1MSW D;  8ICG A;  1A77 A;  1JXE A;  1RQL A;  2K8B B;  3NRZ A;  8ICC A;  2RRD A;  5HRD A;  1SL0 A;  4EGW A;  3WK9 A;  3NVY A;  4CE6 A;  5ALF A;  3LWL A;  3IRU A;  4RPY A;  5CRX A;  2KOB A;  4X4O A;  1MC8 A;  1HEK A;  4P0P A;  3M8S A;  4O3N A;  4F4Z A;  5HRL A;  4I29 A;  5B3Q A;  1N61 A;  4CDG A;  2K4E A;  1F5S A;  5GTI U;  1ZOL A;  3RJE A;  2KVC A;  2Q4T A;  1NJX A;  1NI3 A;  9ICM A;  4B9S A;  2W8K A;  5J2I A;  4B9N A;  1IV8 A;  1ZQW A;  1V38 A;  3SR6 A;  3H7I A;  5EE9 A;  1JUD A;  5AM4 A;  2XO7 A;  2JV3 A;  5HHI A;  5J0U A;  2NV3 A;  4RWP A;  4OAG A;  3GFK B;  9ICI A;  4QJF B;  3D6J A;  2KEY A;  3LK9 A;  4DSI A;  5KFH A;  3RJI A;  2W9A A;  2ES6 A;  3BS5 A;  4FFD A;  3EZ5 A;  1TK0 A;  1VDV A;  1R8B A;  1ZQK A;  4K8V A;  5KFI A;  4DSF A;  4I2E A;  4WCW A;  4GLX A;  3OPX A;  9ICA A;  1S0N A;  4X4V A;  1QSS A;  4Q44 A;  2VAN A;  2ZIW B;  1NO5 A;  2KFN A;  3NYB A;  4IRK A;  4DFM A;  1S0V A;  2HN1 A;  3H38 A;  4RPX A;  1TE2 A;  1SGG A;  5DDY A;  1WYG A;  3TKA A;  2N1R A;  4RWO A;  1U9L A;  1KKX A;  4CRX A;  3QUB A;  9ICH A;  4PZO A;  5DG8 A;  4BGD A;  2R18 A;  4X4N A;  9ICR A;  4BJQ A;  1PK1 A;  2P6R A;  1YT3 A;  2AHO B;  1X9W A;  1Q46 A;  2KV2 A;  5DB7 A;  2QAR B;  1L7O A;  3PX6 A;  1UQV A;  3L5K A;  5AI9 A;  5ALI A;  1XC9 A;  2W04 A;  2BQ3 A;  2YB1 A;  3H4B A;  2YMP A;  3PHZ A;  4YD2 A;  5ALY A;  2W9C A;  4EBC A;  1BPE A;  2Y1J A;  3GU3 A;  4AT8 A;  5JRT A;  2R8K A;  2ZTD A;  3RFA A;  3PML A;  2NRK A;  1A0P A;  2Y9T A;  3JZ0 A;  3ALR A;  2NRV A;  2J6U A;  1SXE A;  4HYK A;  1MIW A;  4M47 A;  3NVV A;  5AI5 A;  2A1A A;  2B21 A;  5CFU A;  4QZG A;  2JXJ A;  3OV7 A;  2MUT B;  3CP8 A;  3H8W A;  3ZI4 A;  3SI8 A;  1SWW A;  4IRC A;  3E0F A;  8ICF A;  4FH3 A;  8ICY A;  1KLN A;  4YVZ A;  3C21 A;  3WKA A;  4I2H A;  4O5K A;  3HIY A;  2E8N A;  4DLG A;  2IOF K;  3T5L A;  4MFC A;  3QU2 A;  1U48 A;  2KVS A;  4BUG A;  4JV1 A;  3AM9 A;  2J6S A;  3H8S A;  5HRI A;  2HW3 A;  1SB3 C;  1X9X A;  2DFL A;  2QB0 B;  3IDW A;  2QLT A;  4KLS A;  1ZQX A;  4AP9 A;  2W9B B;  4Y2J A;  4KIT B;  1QQ7 A;  4X4U A;  5KFV A;  2Y1I A;  3GV5 B;  4NL9 A;  3N7P D;  4K99 A;  3IV6 A;  4BWM A;  4F2S A;  3S6J A;  4QZI A;  4WBZ A;  3HX0 A;  3T3F A;  4GXJ A;  2BCV A;  3M6Z A;  4RT3 A;  5HC9 A;  2KIV A;  3AQE A;  3G6X A;  3PNC A;  4DSL A;  1FFU A;  2ZH4 A;  2VKQ A;  3PO5 A;  1N62 A;  5J0S A;  4M9G A;  1ED1 A;  3PSF A;  4P2H A;  2KSO A;  1VLB A;  1DXS A;  1KFS A;  5BOL A;  4NKT A;  1L8L A;  4EYH B;  1SIJ A;  2ZTE A;  8ICE A;  3AUO A;  4YMN A;  2BDP A;  3Q8R B;  3C29 A;  1FEZ A;  1NJZ A;  5EWE A;  5ALX A;  2OYY A;  3UXP A;  1DOQ A;  3EWA A;  2EAO A;  2WF8 A;  4QZC A;  3RB6 A;  2DR7 A;  4Z6D A;  1NK6 A;  4WOY A;  1SZH A;  2KN7 A;  1XU4 A;  1OUQ A;  1F0M A;  4IRD A;  2WF6 A;  3WK6 A;  1ZQP A;  3AMZ A;  2NYV A;  5J2J A;  4M6W A;  4O0I A;  5BOM A;  5CEH A;  2E1E A;  3ED5 A;  3BJY A;  4KX3 A;  2HHS A;  1TFY A;  3NWI A;  4ED2 A;  4PHD A;  4K97 A;  5J2H A;  3N7S C;  3QXG A;  3UM9 A;  4M9J A;  3PW5 A;  4UB8 U;  1ZQE A;  2NRW A;  3B9J A;  5DEC A;  1ZQD A;  4KLH A;  2OHF A;  1MQ3 A;  4F8R A;  5T14 A;  2H3V A;  1JIH A;  3K1R B;  4KLU A;  2ZUB A;  2D6F C;  5CR0 A;  4KMU A;  5ALT A;  4F5R A;  4Q45 A;  4X4T A;  1OW5 A;  1ZET A;  3HJ1 A;  2NRT A;  3OWG A;  1NK0 A;  2W03 A;  5L1J A;  1RXW A;  2HMX A;  2DF4 B;  4F5O A;  4FZM A;  1RXV A;  1L5U A;  2HDO A;  1NNL A;  3QNM A;  2DRB A;  4PGX A;  1BPY A;  3UQ2 A;  5KFZ A;  9ICS A;  1TK5 A;  5AM0 A;  1QTM A;  1CUK A;  4QWA A;  3TAD C;  4QZ8 A;  2BPF A;  7ICO A;  3TAP A;  1K1Q A;  4X4Q A;  4DF4 A;  5HML A;  1GO3 F;  3HP6 A;  4UD5 A;  3UPQ A;  3WKD A;  1KEJ A;  2AXT U;  5ALE A;  3TAC B;  4ELV A;  4F93 B;  4LVS A;  2Q66 A;  2IA6 A;  8ICZ A;  4EBK A;  2ZHA A;  2DQN B;  2EZZ A;  2O1P A;  3A0B U;  3V6K A;  2C22 A;  1IXR A;  3MGH A;  4OJ6 A;  2FMS A;  2Y9U A;  4KLT A;  4M9H A;  1OXJ A;  5J0T A;  2EWR A;  3UMC A;  4ECR A;  1RG6 A;  2M2V A;  9ICJ A;  1NOM A;  2EQY A;  5BPC A;  4IQU A;  5ALK A;  4EEN A;  5EOZ A;  3MDC A;  1YLQ A;  1BGX T;  5ALD A;  1URJ A;  4Z6E A;  5KG2 A;  4C8M A;  2DBY A;  5KFS A;  4B9T A;  4DOC A;  4J9Q A;  3PX0 A;  5J0W A;  3OSN A;  1C20 A;  4CCH A;  2WAQ F;  4P4P A;  2F1I A;  4FHP A;  2W55 A;  4EEK A;  3RJG A;  1MIY A;  2PKE A;  4MF2 A;  4DL4 A;  1Z00 B;  3KHH A;  2E8P A;  3H8M A;  1V85 A;  2NO5 A;  1JAL A;  4F4Y A;  1J2M A;  5F2V O;  5ALH A;  2OWO A;  3C66 A;  2WAQ C;  4DF8 A;  2RLT A;  3MR5 A;  4XA5 A;  3F2D A;  3TAN A;  3RBD A;  3H39 A;  4BX9 C;  5ALQ A;  3BZC A;  1Z4O A;  1ZQV A;  3M8R A;  5E79 U;  3RRH A;  1N2X A;  4OJO A;  2KJ8 A;  3BQ0 A;  4I2I A;  2V9W A;  2XGQ A;  1COO A;  3FM9 A;  5EWG A;  3ETL A;  4I2C A;  2BDU A;  2E8O A;  1NKC A;  4DLE A;  1LVH A;  1XSL A;  4E8F A;  1SV4 A;  9ICV A;  4FZN A;  9ICW A;  3PY8 A;  5G5G A;  4J9K A;  3M9N B;  2YB4 A;  4ED0 A;  3HJ4 A;  4NXW A;  4LEY A;  8ICU A;  2JMG A;  3IN5 A;  4YN4 A;  3AL0 B;  4DFK A;  4NM1 A;  2L5Y A;  4ED8 A;  3HT3 A;  4J9O A;  1ZQQ A;  8ICB A;  2ID1 A;  5B5E U;  4RNO A;  1ZQG A;  3OHA A;  4AT9 A;  2KJ5 A;  3M9O B;  1S0M A;  4EX6 A;  5ALR A;  2CXY A;  2IBK A;  5CWR A;  2M2U A;  5J0X A;  4M2Y A;  3TFR A;  2ZXI A;  5III A;  1KSP A;  4IG8 A;  2IHN A;  3JPR A;  2I5H A;  4Y2Y A;  3EPI A;  3E2E A;  5J2F A;  7ICM A;  2IHO A;  5KL1 B;  3FC4 A;  4IQV A;  1FA0 A;  1ZQB A;  4WC2 A;  4ICA A;  1V9P A;  3AQF A;  4GXI A;  4OO1 J;  2XIC A;  2DKZ A;  1V4A A;  3F53 A;  1BPB A;  5CJ7 A;  5KL8 B;  5A0L A;  1Z4N A;  2G08 A;  1R8C A;  4UAV A;  3NAS A;  3RRG A;  3PSP A;  5KG6 A;  4K9B A;  2R8I A;  4RUA A;  9ICX A;  3SV3 A;  2I9G A;  1DRG A;  9ICF A;  2XCA A;  2K4I A;  1NJY A;  3SEN A;  1CI4 A;  5J2B A;  2LM1 A;  1X6I A;  2DPJ A;  2K60 A;  1DK2 A;  1ZQM A;  3ZDD A;  1VJ7 A;  2B4V A;  3MCR A;  5AKZ A;  4UAU A;  1UA0 A;  1BNO A;  5ALM A;  1NKE A;  4C0Z A;  1JI7 A;  3I76 A;  1S77 D;  4YFK A;  5KFU A;  3QYP A;  4F72 A;  5L9X A;  3T79 A;  2G5H B;  1ZQY A;  4HAI A;  4J9L A;  2YMM A;  1N48 A;  2V4R A;  5AKH A;  1Z19 A;  3L9D A;  4K96 A;  4WC1 A;  4PHP A;  5J8Y C;  4FBT A;  1SWV A;  1UCV A;  3VCB A;  2Y0S C;  5AIA A;  5KFJ A;  2UVU A;  5KT4 A;  2K4P A;  5IIN A;  5JTI A;  7ICK A;  1ZD2 P;  5ALN A;  1LV5 A;  1KQQ A;  3NUQ A;  2W9M A;  1JQR A;  3D2S A;  2BKE A;  1UET A;  4PGQ A;  8ICN A;  1X2I A;  5J2E A;  1BPD A;  3HPO A;  1JRO A;  3V6J A;  4EBJ A;  2AH5 A;  4F4K A;  4NLC A;  2WHE A;  1LB2 B;  3BQ7 A;  5CHE A;  2HBK A;  2DR8 A;  4J9R A;  4O3M A;  4WC4 A;  4LJX A;  1U49 A;  5B3P A;  4LZG A;  2LYH A;  1ZJM A;  5L1L A;  5B66 U;  2FJ6 A;  4IR1 A;  2XC9 A;  4ECS A;  3TAR A;  4KLF A;  2AGQ A;  3WKE A;  3K7D A;  5AKJ A;  5KFP A;  2W43 A;  2NRX A;  2ZTC A;  2HOQ A;  5J0O A;  4UAR A;  2XCP A;  5TIS U;  2PI4 A;  4O5E A;  4LEW A;  4O6A A;  5AKY A;  4UAZ A;  3MC1 A;  4IR9 A;  1QLN A;  8ICW A;  1ECW A;  4RQN A;  3IG5 A;  1Z3E B;  5KFY A;  3PW0 A;  2ZHB A;  1RDF A;  1T8E A;  1IM4 A;  1ZQC A;  3FAH A;  2LI6 A;  4QZ9 A;  1ZQZ A;  1Q3V A;  3FDS A;  5ALV A;  3T5H A;  3OVS A;  2RHF A;  3ER8 C;  3CK6 A;  2JGA A;  2VA8 A;  5AM3 A;  3KTQ A;  2GH1 A;  2BR0 A;  2UVW A;  4JLX A;  1K1S A;  4QWD A;  4ED7 A;  5J2D A;  5FP0 A;  5AI8 A;  7ICV A;  4WBY A;  1CEZ A;  4FHV A;  5KG5 A;  2XI9 A;  1U4B A;  4QZF A;  3QEA Z;  5KFO A;  1KN5 A;  5TZV A;  5AK5 A;  2ALZ A;  1P7D A;  5HRB A;  2VIX A;  3JPN A;  2RQ5 A;  2W7P A;  3KFU F;  3OUY B;  3BQ2 A;  4C7Y A;  2ASD A;  1O03 A;  1TKD A;  3EYZ A;  2B0C A;  2OXO A;  3TAD A;  3J81 j;  5HMM A;  4DQS A;  2ZIX B;  1KDH A;  1CRX A;  2JEF A;  1WUD A;  2HI0 A;  2FPL A;  1GPJ A;  2C28 A;  2XVT A;  2ZH5 A;  4QNL A;  1DGS A;  1FIQ A;  2ZIW A;  7ICJ A;  2GLE A;  2A19 A;  3AQM A;  4C4R A;  3H40 A;  3WKB A;  4US9 A;  5HR9 A;  1NZB A;  1M6Y A;  3KOO A;  4O3Q A;  5AKL A;  3C23 A;  3JPT A;  4MHV A;  2O6K A;  4J9N A;  4KLL A;  3K75 D;  4J9M A;  4NLG A;  2BGW A;  1XNS A;  2JZB B;  2CRX A;  1N60 A;  5AI6 A;  4NKU A;  1Q78 A;  2F8K A;  4B9L A;  2A1J B;  2FMP A;  5IIM A;  4RQ2 A;  1COK A;  3ONN A;  2DR9 A;  4I2G A;  3ZDA A;  5AM1 A;  4ZH4 A;  2XY5 A;  2QAR A;  4FE3 A;  4QZE A;  1NKB A;  4TUR A;  5DBB A;  3UMB A;  5KFW A;  2IMW P;  1HJP A;  3HKZ F;  3L4P A;  2XY6 A;  1RPL A;  4KX5 A;  4I27 A;  1HUO A;  2EDU A;  1KFD A;  1ZQR A;  4I2A A;  3GII A;  9ICT A;  4XQ8 A;  4C80 A;  5J0Y A;  5AKI A;  2GWS A;  2EZX A;  4ECT A;  2PFO A;  3MR2 A;  3F2B A;  4QZD A;  1L7M A;  3LVW A;  4OJL A;  4QIW F;  1X9M A;  2ISP A;  2JR5 A; 
#chains in the Genus database with same CATH homology
 1RXW A;  1ZQS A;  2ZH2 A;  2FPK A;  2JEI A;  2BCR A;  3UXN A;  4RUC A;  4F5O A;  4KLG A;  9ICE A;  9ICK A;  3Q8Q B;  2NRZ A;  3BQT A;  3ZD8 A;  1UEV A;  1RXV A;  1L5U A;  3QZ8 A;  3NTU A;  9ICO A;  1S0O A;  1S76 D;  3WFO A;  8ICI A;  4Q43 A;  4ECW A;  5DB6 A;  2PBE A;  2M2W A;  2DRB A;  4PGX A;  3OJS A;  1U45 A;  2FPM A;  2XY7 A;  3GIJ A;  1BPY A;  1B22 A;  3UQ2 A;  5KFZ A;  9ICS A;  3ZDC A;  4RWN A;  4YXJ A;  3C1Y A;  1TK5 A;  1QTM A;  3KHG A;  3MR6 A;  1CUK A;  4UB3 A;  4QWA A;  4ECY A;  4QZ8 A;  2BPF A;  4KLJ A;  2KP7 A;  7ICO A;  5DBC A;  7ICE A;  3LWM A;  1K1Q A;  3PMN A;  3TAP A;  4X4Q A;  5HRH A;  4DF4 A;  2PFN A;  5HML A;  3OVA A;  1UA1 A;  3HP6 A;  4UD5 A;  4IQT A;  3UPQ A;  8ICL A;  4ECU A;  2H5X A;  1KEJ A;  2BCQ A;  4I2D A;  4ELV A;  1KFT A;  4F93 B;  5KFF A;  4LVS A;  8ICV A;  7ICT A;  4X4S A;  2IA6 A;  2KFZ A;  4ED1 A;  4F3O A;  8ICZ A;  4EBK A;  4DOB A;  4F4W A;  2MUT A;  7ICR A;  2ZHA A;  4QZB A;  5DGB A;  5HRF A;  3GV7 B;  2O1P A;  2V4Q A;  8ICO A;  3V6K A;  2C22 A;  1IXR A;  4DSJ A;  7ICQ A;  2W9C B;  4O3P A;  1BVS A;  4RPZ A;  3H8J A;  5DQI A;  3MGH A;  2RDI A;  1D9D A;  3TI0 A;  4C8N A;  2FMS A;  4F5P A;  4NLZ A;  1F5A A;  8ICT A;  4E7X A;  5DED A;  4GC7 A;  4KLT A;  5DG7 A;  4M9H A;  3RBE A;  5J0T A;  7ICH A;  1JAJ A;  3RJJ A;  4RQ0 A;  3MBY A;  3OHB A;  4DL7 A;  1NK7 A;  2BPC A;  1MIV A;  4J9S A;  2KTQ A;  4AT8 B;  1TAQ A;  4ECR A;  8ICH A;  2HHW A;  8ICP A;  2AU0 A;  1A76 A;  3OJU A;  4JUZ A;  3V7L A;  4F91 B;  1JXL A;  1PZN A;  5KFA A;  4DFP A;  3UPS A;  4F50 A;  3SZ2 A;  2M2V A;  5C5J A;  5L1K A;  4DL3 A;  9ICJ A;  1NOM A;  3QZ7 A;  4RQ8 A;  1Y88 A;  5BPC A;  2W8L A;  4FHY A;  2RDJ A;  5DQG A;  4IQU A;  3ORY A;  2UVV A;  5IIJ A;  1ZQH A;  4C8K A;  5EOZ A;  4F2R A;  1OU5 A;  3MDC A;  5D46 A;  4I2F A;  2AJQ A;  4JK1 A;  1BGX T;  2HVH A;  3ZD9 A;  4JWN A;  1YLQ A;  4Z6E A;  2BCU A;  5KG2 A;  1SL1 A;  4C8M A;  4RQ7 A;  2ZH1 A;  5KFS A;  2W9B A;  3TAQ A;  4B9T A;  4O3O A;  5IIL A;  5J0R A;  4NXZ A;  4J9Q A;  4DOC A;  4MEY A;  3MFI A;  3PX0 A;  4I2J A;  2Q0Z X;  5J0W A;  3OSN A;  1TK8 A;  4DS5 A;  1L3V A;  4MFF A;  5KFD A;  4ECQ A;  4MEX A;  2AQ4 A;  5DG9 A;  2BPG A;  4CCH A;  4X0A A;  4BXO A;  4NLN A;  4P4P A;  2F1I A;  3QEB Z;  1SKR A;  4Q8E A;  4E80 A;  3MFH A;  3RAX A;  5KFK A;  4FHP A;  2JEG A;  5KFG A;  3WFQ E;  4UB4 A;  3RJG A;  1KRP A;  1ZJN A;  2HHT A;  4MF2 A;  5KFB A;  1MIY A;  1Q79 A;  4B9M A;  4DL4 A;  5KT2 A;  3GIM A;  3Q8M A;  1Z00 B;  5HRE A;  7ICS A;  4UAY A;  4XUS A;  7ICL A;  3B0X A;  3KHH A;  4ECZ A;  3JPO A;  1T4G A;  3T5K A;  4B9V A;  1NZP A;  1D8Y A;  4PHA A;  3RH6 A;  5CA7 A;  3H4D A;  4RU9 A;  4TQR A;  4F4Y A;  4DL5 A;  1ZQA A;  1ZQT A;  2FLN A;  2ZH6 A;  4WC7 A;  5F2V O;  2WTF A;  5KFC A;  5J29 A;  3ZDB A;  3V6H A;  4YCX A;  4IQW A;  4ATB A;  2OWO A;  3C66 A;  4AT7 B;  4FS1 A;  4DF8 A;  2BQR A;  1ZYQ A;  3MR5 A;  4XA5 A;  3TAN A;  4KLQ A;  3RBD A;  1D9F A;  4JV2 A;  4O9M A;  2I1Q A;  1MSW D;  8ICG A;  3H39 A;  3PR5 B;  1A77 A;  3FYH A;  1JXE A;  4YP3 A;  4X0B A;  1BPX A;  1ZQV A;  3UXO A;  3M8R A;  3RRH A;  4I2B A;  8ICC A;  8ICA A;  5HRD A;  3OUY A;  1SL0 A;  5DGA A;  4YMM A;  4ECX A;  4QZA A;  3BQ0 A;  4F5N A;  2HHX A;  4I2I A;  2V9W A;  3LWL A;  1TAU A;  4YG2 A;  2XGQ A;  1COO A;  4RPY A;  4P4M A;  5EWG A;  4TQS A;  3ETL A;  4FBU A;  4I2C A;  2ISO A;  4R63 A;  4QW9 A;  1NKC A;  4DLE A;  1XSL A;  4E8F A;  4X4O A;  4NM2 A;  9ICV A;  1MC8 A;  8ICK A;  9ICW A;  3M8S A;  2IHM A;  3PY8 A;  4O3N A;  4RWQ A;  1XO1 A;  4J9K A;  3EPG A;  4F4Z A;  5HRL A;  1U47 A;  3M9N B;  4I29 A;  4ED0 A;  3HJ4 A;  5DLG A;  3Q8P B;  4RZR A;  8ICU A;  2XGP A;  4FHV A;  4YN4 A;  5DBA A;  4UBC A;  4DFK A;  4NM1 A;  4UB5 A;  3RJE A;  1NJX A;  4F5Q A;  4ED8 A;  1ZQJ A;  3HT3 A;  4B9S A;  9ICM A;  3C18 A;  4M9L A;  2W8K A;  5IIO A;  5J2I A;  4B9N A;  4J9O A;  5J2A A;  1ZQQ A;  8ICX A;  8ICB A;  5HNK A;  1SKS A;  3RR7 A;  3RB4 A;  1ZQW A;  4TUS A;  2ID1 A;  3H7I A;  4BDP A;  4RNO A;  1RZT A;  1ZQG A;  4R8U B;  5KTQ A;  5KFQ A;  3OHA A;  2XO7 A;  3PR4 A;  5HHI A;  1S97 A;  1ZQF A;  9ICP A;  5J0U A;  5D49 A;  2JZB A;  3GDX A;  4RWP A;  4QWB A;  4S3N A;  3GFK B;  2KZZ A;  9ICI A;  3Q8L A;  4QZH A;  4AT9 A;  4EBD A;  3M9O B;  1S0M A;  4QW8 A;  1H38 A;  2IBK A;  2DRA A;  4EYI B;  2A1J A;  5CP2 A;  5CWR A;  2M2U A;  5J0X A;  3LK9 A;  4M2Y A;  4DSE A;  5J2C A;  4DSI A;  3TFR A;  1KSP A;  5III A;  4IG8 A;  4R65 A;  3V7J A;  3RH5 A;  2IHN A;  5KFH A;  3RJI A;  2W9A A;  3JPR A;  3EPI A;  4ED3 A;  3E2E A;  5J2F A;  3G6Y A;  3Q8K A;  7ICM A;  4DWI A;  1UT5 A;  3EZ5 A;  4IQV A;  1FA0 A;  1WCN A;  1TK0 A;  1ZQB A;  4UD4 A;  4WC2 A;  2M2T A;  5KT3 A;  1V9P A;  4GXI A;  2ZJ8 A;  1ZQI A;  4KN7 A;  3GIL A;  1R8B A;  5DB9 A;  1ZQK A;  4RNM A;  4MFA A;  1UT8 A;  1X9S A;  5KFI A;  4DSF A;  1V4A A;  1RYS A;  4I2E A;  4WCW A;  4GLX A;  4PHE A;  9ICA A;  1S0N A;  4X4V A;  1QSL A;  1QSS A;  4Q44 A;  1BPB A;  2VAN A;  4DL6 A;  5CJ7 A;  7ICP A;  1NO5 A;  1R8C A;  2KFN A;  3NYB A;  4KLI A;  1ZQU A;  3RRG A;  4IRK A;  2ZH7 A;  5KG6 A;  2R8J A;  4K4I A;  4DFM A;  2R8I A;  1XS9 D;  4RUA A;  4EEY A;  9ICX A;  3PW7 A;  3SV3 A;  4EZ9 A;  1C7Y A;  2I9G A;  1S0V A;  1PX5 A;  4UQG A;  3V7K A;  8ICJ A;  3H38 A;  4RPX A;  4LZD A;  9ICF A;  2J6T A;  2XCA A;  1NJY A;  5DDY A;  4KLD A;  9ICG A;  1NJW A;  1ZQN A;  3EW9 A;  5J2B A;  4RWO A;  2DPJ A;  3KHR A;  2ZH9 A;  1U9L A;  4C8L A;  4M6W B;  1ZQM A;  1DK2 A;  5CB1 A;  3N97 B;  8ICM A;  5IIK A;  5HRG A;  8ICQ A;  3HW8 A;  4RNN A;  3ZDD A;  1VJ7 A;  9ICL A;  9ICH A;  1ZQO A;  3G6V A;  1UA0 A;  4X5V A;  4F92 B;  1NKE A;  4QWC A;  1BNO A;  5DG8 A;  3JPP A;  4BGD A;  4Z6C A;  4X4N A;  9ICR A;  4G3I A;  2VA3 A;  1S77 D;  4YFK A;  5KFU A;  5L9X A;  5KFX A;  4P4O A;  4YD1 A;  2P6R A;  2BQU A;  5KG7 A;  1ZQY A;  1X9W A;  5KFN A;  4J9L A;  2ASL A;  1N48 A;  5DB7 A;  2V4R A;  4UB2 A;  2R8H A;  5J0Q A;  4K4H A;  2PFQ A;  3L9D A;  4QWE A;  3TQ1 A;  3PX6 A;  4WC1 A;  4PHP A;  1ZQL A;  1SZP A;  4FBT A;  1XC9 A;  1QSY A;  9ICN A;  2BQ3 A;  1HUZ A;  3H4B A;  2ZJ5 A;  4YD2 A;  4FS2 A;  2ASJ A;  2W9C A;  1NK5 A;  4DO9 A;  3RAQ A;  2HHV A;  4EBC A;  1TFW A;  1BPE A;  3BDP A;  5J2G A;  3MR3 A;  2Y1J A;  5KFJ A;  2UVU A;  4X4R A;  5KT4 A;  2HHU A;  4UBB A;  8ICS A;  2MAX A;  5IIN A;  2UVR A;  4DL2 A;  7ICK A;  2PFP A;  1WCL A;  5KG3 A;  1LV5 A;  4AT8 A;  2W9M A;  2DPI A;  4YMO A;  1JQR A;  2BKE A;  2R8K A;  1UET A;  2ZTD A;  4PGQ A;  8ICN A;  3PML A;  4TUQ A;  3WFR E;  1X2I A;  5J2E A;  1BPD A;  4DQR A;  5KFL A;  5HHH A;  1TVA A;  2C2R A;  2NRK A;  3HPO A;  2O5A A;  2KZM A;  3AU6 A;  3THV A;  3JZ0 A;  3V6J A;  3AQN A;  4EBJ A;  3QE9 Y;  3LDA A;  5KFM A;  3PV8 A;  4F4K A;  4MF8 A;  1LB2 B;  3GV8 B;  1TFR A;  2NRV A;  1ARO P;  4YQW A;  5DB8 A;  2AGO A;  1T3N A;  2J6U A;  3IHQ B;  2AGP A;  4HYK A;  3MAB A;  4J9R A;  1S10 A;  4WC4 A;  2DR8 A;  1U49 A;  3MDA A;  3TFS A;  8ICR A;  1MIW A;  4M47 A;  3SV4 A;  3PVX A;  1RYR A;  2KZ3 A;  4LZG A;  4M04 A;  4WC0 A;  2LYH A;  1ZJM A;  4PH5 A;  1BNP A;  2B21 A;  5L1I A;  4QZG A;  5L1L A;  1NK8 A;  2ZJA A;  2F1J A;  4IR1 A;  2XC9 A;  4ECS A;  3TAR A;  5KT7 A;  3B0Y A;  3OV7 A;  5F9L A;  4KLF A;  2AGQ A;  2MUT B;  3H8W A;  2ZUC A;  5J2K A;  2JEJ A;  4NLK A;  3ZDE A;  3SI8 A;  5KFP A;  5EWF A;  2VA2 A;  4DQI A;  7ICN A;  4IRC A;  8ICF A;  1Z00 A;  4FH3 A;  4WC3 A;  8ICY A;  4PGY A;  4YVZ A;  1KLN A;  2NRX A;  3ISB A;  3C21 A;  2ZTC A;  5J0O A;  4I2H A;  4O5K A;  2XCP A;  3V72 A;  4ECV A;  2PI4 A;  3HIY A;  4O5E A;  4DLG A;  3H3A A;  3M9M B;  7ICF A;  3T5L A;  4AT7 A;  4M9N A;  4MFC A;  4UAZ A;  2C2D A;  5HRK A;  4FHX A;  1TV9 A;  3BQ1 A;  2BHN A;  4IR9 A;  3ISC A;  4DS4 A;  1U48 A;  1QLN A;  4JV1 A;  7ICU A;  2P66 A;  8ICW A;  4WC5 A;  2J6S A;  1JN3 A;  3H8S A;  3C2M A;  1KNY A;  4RQ3 A;  4B9U A;  1Z3E B;  2FLP A;  3PO4 A;  5KFY A;  3PW0 A;  2PI5 A;  4TUP A;  5HRI A;  2ZHB A;  1T8E A;  1IM4 A;  5KT6 A;  1ZQC A;  2HW3 A;  2AQ0 A;  5D4B A;  2DFL A;  4QZ9 A;  1ZQZ A;  4UAW A;  4KLS A;  3FDS A;  1ZQX A;  5KFT A;  4DQP A;  3T5H A;  3OVS A;  2W9B B;  4I28 A;  9ICC A;  1N56 A;  2P6U A;  1XSN A;  5KG4 A;  1SL2 A;  2VA8 A;  4KIT B;  4ELT A;  3AU2 A;  4C8O A;  4X4U A;  5KFV A;  4DFJ A;  2Y1I A;  3RB3 A;  2C2E A;  4DEZ A;  3KTQ A;  4BWJ A;  3GV5 B;  9ICB A;  2BR0 A;  4BXO B;  2UVW A;  2HHP A;  3C2L A;  1K1S A;  4BWM A;  3RB0 A;  4KTQ A;  2BCS A;  4E0D A;  4QWD A;  4ED7 A;  3OGU A;  4F4X A;  5J2D A;  5KT5 A;  4F2S A;  4QZI A;  2HVI A;  1DK3 A;  7ICV A;  4WBZ A;  3HX0 A;  4WBY A;  3T3F A;  1CEZ A;  3K4G A;  4O5C A;  2BE3 A;  4GXJ A;  3RH4 A;  2FMQ A;  4Q8F A;  5KG5 A;  3RTV A;  4DSK A;  4PPX A;  1U4B A;  2BCV A;  4R64 A;  9ICQ A;  4WC6 A;  4QZF A;  4RT3 A;  5KFO A;  5TZV A;  3QEA Z;  5DKW A;  1L3U A;  5HC9 A;  3G6X A;  2ALZ A;  5HRB A;  1B43 A;  3PNC A;  5DQH A;  1JX4 A;  4R8U A;  3C1Z A;  4ATB B;  3RJK A;  4DSL A;  4XQ7 A;  4YXM A;  4RQ1 A;  3JPN A;  4NY8 A;  2ZH4 A;  3PO5 A;  4KLO A;  1NK9 A;  3JYY A;  5J0S A;  3HWT A;  2M9N A;  4M9G A;  4FO6 A;  4XRH A;  4P2H A;  2FLL A;  3OUY B;  3H37 A;  2Q66 A;  3BQ2 A;  2ASD A;  1KFS A;  1TKD A;  5BOL A;  3EYZ A;  1XSP A;  4NKT A;  4O3S A;  3ISD A;  3RJH A;  5HMM A;  4DQS A;  7ICI A;  4EYH B;  2ZTE A;  4J9P A;  3SYZ A;  5DLF A;  1KDH A;  3RJF A;  4EZ6 A;  3Q8S B;  8ICE A;  3AUO A;  5J0P A;  3JPQ A;  3C5G A;  2JEF A;  4YMN A;  5KFE A;  3Q8R B;  2BDP A;  2FPL A;  2C28 A;  1NJZ A;  5EWE A;  1R89 A;  9ICU A;  4M5D A;  1KTQ A;  2ZH5 A;  4FHW A;  3MGI A;  3UXP A;  1DOQ A;  3EWA A;  1DGS A;  1VFG A;  4ED6 A;  5KFR A;  4JV0 A;  7ICJ A;  4QZC A;  4RQ6 A;  1BPZ A;  3RB6 A;  3AQM A;  2F1H A;  3H40 A;  4EP7 A;  3AQL A;  5KG0 A;  2DR7 A;  4Z6D A;  5HR9 A;  1WOT A;  4O3Q A;  3WFS C;  3GIK A;  3C23 A;  4YR3 A;  3LQC B;  2ZH8 A;  1NK6 A;  4KLE A;  2KN7 A;  3JPT A;  1XU4 A;  3N4M B;  4K4G A;  7ICG A;  2DR5 A;  3WFP A;  4IRD A;  1XWL A;  4DQQ A;  4FH5 A;  5KG1 A;  4J9N A;  1ZQP A;  1R8A A;  4EBE A;  3NGD A;  4KLL A;  5J2J A;  2ZH3 A;  4M6W A;  3K75 D;  3OSP A;  4O0I A;  3AQK A;  5BOM A;  4J9M A;  3PW2 A;  3IM1 A;  4YR0 A;  2BGW A;  2JZB B;  1L3S A;  4NLG A;  4X4P A;  4RT2 A;  3BJY A;  2HHS A;  1TFY A;  4NKU A;  3KHL A;  1Q78 A;  4AT9 B;  4ED2 A;  4PHD A;  4YR2 A;  5J2H A;  4B9L A;  2A1J B;  2FMP A;  3PX4 A;  4M9J A;  3PW5 A;  5IIM A;  2ZUD A;  1ZQE A;  4RQ2 A;  4DOA A;  2NRW A;  3OVB A;  1NK4 A;  5DEC A;  2DVI A;  2DR9 A;  4I2G A;  4UB1 A;  3ZDA A;  1ZQD A;  4GXK A;  2HHQ A;  4KLH A;  4ZH4 A;  4Z6F A;  2XY5 A;  1SKW A;  1MQ3 A;  3RR8 A;  3T5J A;  4F8R A;  4RQ5 A;  4QZE A;  3UQ0 A;  1NKB A;  4TUR A;  1L3T A;  5DBB A;  5KFW A;  2IMW P;  1EXN A;  1HJP A;  3GQC A;  1JIH A;  5F9N A;  4KLU A;  2ZUB A;  4KN4 A;  5HP4 A;  2PXI A;  2XY6 A;  2RFF A;  4ELU A;  1D8L A;  1RPL A;  1UEU A;  4LT6 A;  5DDM A;  4I27 A;  1HUO A;  4RQ4 A;  3JPS A;  5CR0 A;  1KFD A;  1JMS A;  4KMU A;  1ZQR A;  4F5R A;  1S9F A;  4I2A A;  3GII A;  2ATL A;  4M0A A;  4Q45 A;  4XQ8 A;  5J0Y A;  4R66 A;  3C5F A;  9ICT A;  4X4T A;  5JUM A;  2GWS A;  4O3R A;  4ECT A;  2PFO A;  2R8G A;  4JWM A;  3MR2 A;  3C2K A;  1ZET A;  4QZD A;  2ISP A;  1MQ2 A;  4KLM A;  3HJ1 A;  2NRT A;  1NK0 A;  5CHG A;  1T7P A;  1X9M A;  5L1J A;  4GC6 A;  3PW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...