4UB2A

Dna polymerase beta product complex with a templating cytosine and 8-oxodgmp, 120 s
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
319
Chain Sequence
b'LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
molecule keywords DNA polymerase beta
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 104
structure length 319
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub2A03
5D46A 2J6SA 3RJHA 4ELTA 2Y1JA 4EEYA 4FBUA 3THVA 3H4DA 2C2RA 2BCRA 3H38A 2BDPA 4TQSA 5J0SA 4B9SA 5HRIA 4TUSA 4DQIA 1MSWD 2O5AA 4DFMA 3MR2A 5DKWA 4UB4A 5L9XA 4WC1A 5KFFA 4QWEA 1NJZA 4WC2A 2ASJA 4X4RA 1TFYA 3RJIA 3RJGA 5KFSA 1L3SA 5KG3A 5HRDA 4DOCA 4M9HA 1BNOA 3QZ8A 2VA3A 4YCXA 2FMQA 4I2BA 2NRXA 1T4GA 5KFAA 4PHDA 1TAQA 4RNNA 4GXJA 3SZ2A 1NJWA 1SL1A 5HRLA 4X4UA 5BPCA 3C2LA 3UQ2A 5DLFA 8ICYA 3TI0A 4QZ9A 4RQ5A 2IMWP 5JUMA 4C8OA 1NJXA 3BQTA 2ZJ8A 4MF2A 5EWFA 4WCWA 3PO4A 4M0AA 9ICTA 2F1HA 8ICHA 2J6UA 1BPZA 8ICOA 9ICBA 5KT6A 8ICFA 1QSYA 3PMNA 5J0OA 4YD2A 2XCPA 4F93B 3JPTA 1NK6A 3RRGA 5HREA 1MIVA 4YR2A 1QTMA 4HYKA 1BNPA 3GV5B 1WCLA 4RQ4A 2KP7A 3G6VA 9ICNA 5DGAA 3OJUA 1S9FA 5HMMA 2W9CB 4GLXA 2V9WA 1XSNA 1SKRA 5KT7A 2HHTA 4X4TA 3JPRA 8ICSA 4DSKA 2C28A 4B9MA 3ZDDA 3ZD9A 4C8KA 4AT7A 8ICNA 1UEUA 4EBJA 2NRZA 8ICPA 2KN7A 5CP2A 3M9MB 4J9QA 3T5JA 2Q0ZX 1NK7A 1MQ3A 1NK0A 3JYYA 2H5XA 3OVBA 4QWAA 4AT8B 4YP3A 7ICHA 1S97A 3ISCA 4RQ6A 1JX4A 4BXOB 1BPXA 4B9UA 1BPBA 1FA0A 1ZQJA 4DL5A 2ZUCA 4E0DA 1NK8A 2ZH9A 2KZMA 7ICTA 3K75D 3TARA 4MF8A 5HRFA 4NLZA 3HWTA 4QZ8A 1BGXT 4O3NA 4UBBA 2ATLA 1XSLA 3PW5A 3TANA 2BQ3A 5J0UA 3HPOA 2UVUA 4RWOA 4XQ7A 4PHEA 2W8KA 3PW7A 4PHPA 3GIIA 5J2IA 1S77D 1NZPA 4NLNA 3AU2A 4DLGA 1T3NA 8ICAA 5HRKA 4TQRA 1JAJA 2C22A 4DSLA 4PH5A 5DG9A 2PFOA 4F2RA 4J9MA 4RQ8A 4X0AA 3MR5A 3MGIA 4KLEA 2BCUA 7ICRA 4QWCA 4S3NA 5J2CA 3RB4A 2JEIA 4DSEA 5KFZA 3AQNA 4UB3A 4Q44A 4RZRA 5DB6A 4KLQA 3FYHA 5J2HA 1SL2A 3H40A 3H4BA 5KFTA 5J2GA 7ICPA 2PBEA 7ICSA 5DLGA 5J2KA 3HX0A 1ZQSA 4NY8A 4WC4A 5KFRA 4O3OA 4B9TA 4JV2A 9ICUA 4IQTA 1WCNA 4I2JA 2W9CA 2XGPA 3EW9A 9ICKA 4WC6A 4Q43A 1NKBA 3ZDCA 4C8LA 1R8BA 1QSSA 3C18A 1S10A 5F9NA 2VANA 3AU6A 5KG0A 1JN3A 5J0PA 1DK3A 4I2EA 1PX5A 4ECRA 1KNYA 1VJ7A 2M2TA 3RB0A 4O5CA 3HW8A 1L3VA 4KLIA 3GIKA 4ECUA 7ICMA 4AT8A 3QEBZ 3H8JA 3ETLA 1BVSA 3OJSA 2KZZA 3EPIA 9ICRA 1B22A 1ZQBA 5KG7A 1JMSA 3RH5A 1D8LA 4QW8A 4KITB 1ZQTA 3PO5A 9ICAA 1YLQA 8ICQA 2NRTA 3JPPA 4KLSA 4KN4A 3MABA 4YG2A 1MIWA 1V9PA 3ISBA 2GWSA 4WC7A 1LV5A 5KG1A 4EBCA 4RQ2A 3M8SA 4I2FA 1WOTA 1N56A 1ZQRA 2PI4A 1Z00B 2DPJA 4ED8A 1A77A 3PX0A 1HJPA 1QSLA 4MFAA 3V7KA 2AJQA 2ZH1A 3OGUA 3TFRA 3HP6A 5KFDA 2AQ0A 2MAXA 4ED3A 1NK4A 1H38A 3H37A 4GC6A 4FS1A 3NGDA 1SKWA 4B9VA 4QZAA 1N48A 4IQVA 2KTQA 4WC5A 2DR5A 2XY7A 1XS9D 3RJFA 1Y88A 1ZQWA 3TQ1A 1S0OA 7ICLA 3UXPA 3MFHA 3PVXA 3H39A 3JPSA 2XY6A 3Q8PB 4DF4A 3ZDEA 1ZYQA 4YFKA 1RYRA 4WBYA 5KFYA 4JV1A 2DFLA 4XRHA 5HP4A 5CR0A 3UXOA 3RH6A 2FMPA 4WBZA 5TZVA 4IR9A 5KFUA 3SV4A 5KFWA 2V4RA 2ASLA 1ZQKA 4JWNA 5KFBA 1SKSA 3AQKA 5KFHA 4F4XA 3RBEA 1RXVA 9ICFA 7ICVA 1RPLA 4FHPA 4QZGA 8ICVA 2W9BB 2PXIA 3B0YA 3BJYA 3C2KA 1NOMA 4K4IA 5KG4A 1ZQLA 4M9LA 4I2DA 3GV7B 1L3UA 3RR8A 2I9GA 3KHRA 1IXRA 4I2IA 4IR1A 2DVIA 4I2AA 5J0RA 4DL2A 1ZQOA 3ZDAA 4KTQA 9ICPA 2ZH5A 8ICGA 3V72A 4DO9A 3TFSA 2HHXA 3G6YA 4F5NA 4G3IA 3LK9A 4EBEA 2AQ4A 5J29A 3E2EA 3K4GA 4JK1A 4PGYA 3OHBA 5L1LA 4YMOA 4YR0A 3SI8A 2AGOA 2BCVA 4RWPA 8ICEA 4FHXA 3HT3A 5DGBA 2IHNA 1Z00A 4ED6A 4F4WA 4YR3A 1K1SA 1Z3EB 2ZJ5A 4J9PA 1L3TA 2ZH4A 4P2HA 4Z6FA 5HRGA 1JQRA 5DDYA 1R89A 5KT2A 3KHGA 5KFCA 1ZQCA 3OSNA 3GQCA 4K4HA 4NLGA 2XY5A 5DECA 1ZQAA 4R8UB 4X0BA 3GIJA 1KDHA 4UAZA 3MR3A 2NRWA 1X9SA 1T7PA 5L1KA 4I27A 4RWNA 2BPCA 3PR4A 4MFFA 2HHVA 5J0YA 5CJ7A 4QW9A 3B0XA 4EYHB 2ZH6A 1CEZA 4PGQA 2ASDA 7ICNA 2XGQA 2PI5A 4EBDA 8ICWA 3WFOA 2C2DA 5KFXA 4M9JA 3MDCA 1NK9A 1QLNA 4NKTA 3BDPA 4M9GA 1MQ2A 1UETA 4RQ7A 4GXIA 5DEDA 4ATBB 4X4VA 4UQGA 9ICSA 3M9NB 4NLKA 4FBTA 1DOQA 3RAXA 2AU0A 1U4BA 1X9MA 2HVHA 2FPKA 4J9SA 5IIMA 1NKEA 3C2MA 3C21A 1AROP 3RBDA 2W9BA 1LB2B 1HUZA 2UVWA 1ZQFA 1PZNA 9ICWA 4ECZA 4KN7A 3HIYA 3FDSA 3LWMA 3T5LA 3OHAA 1Q78A 3C66A 1ZJMA 3OVSA 2PFPA 4QZFA 3RJJA 7ICOA 3PY8A 4FH3A 3AUOA 4M6WB 4F3OA 1RYSA 8ICJA 4RNOA 5KFKA 4RPZA 2ISOA 1S0NA 3RJKA 2HHQA 3JPOA 4IQWA 3EPGA 4B9LA 4J9LA 2ZTDA 1ZQNA 2Y1IA 1KLNA 3MDAA 1COOA 2VA2A 4O9MA 1EXNA 3T5HA 1TAUA 4UAWA 1F5AA 2DRAA 2ID1A 1KEJA 2ZUDA 5KG6A 4J9OA 5KFQA 4CCHA 4O5KA 3GILA 1NK5A 3PNCA 4RNMA 1BPYA 5KFEA 4RT2A 4UB1A 5KFGA 5KFNA 2KZ3A 2ZHAA 3QZ7A 1U48A 5DG7A 2PFNA 9ICVA 3Q8QB 1TFWA 4QZHA 2WTFA 2RDIA 8ICLA 4MEXA 3AQLA 2C2EA 2UVVA 2M2WA 1DGSA 4XA5A 4YN4A 3N97B 4P4OA 4R8UA 3KHLA 3BQ2A 2W9AA 9ICJA 4EZ6A 4TUQA 4F5QA 3RJEA 2HVIA 3WFPA 4WC3A 5J2DA 9ICQA 2KFNA 8ICCA 2HHSA 1BPDA 4LZGA 4J9RA 3MR6A 5HNKA 3QEAZ 4QZIA 4M9NA 1KFDA 3GIMA 5IINA 4KLUA 4NXZA 4Q8EA 1XC9A 4DL6A 4LT6A 3ZDBA 2ZHBA 4RQ1A 3EZ5A 4AT9B 4ECWA 4EBKA 7ICKA 4ATBA 4MEYA 4ED0A 3H3AA 4KLDA 3LQCB 2M9NA 2AGQA 4BWMA 4DSFA 4F92B 3GFKB 4Z6CA 2XC9A 9ICLA 1C7YA 4UD5A 5DB7A 3WFQE 4NKUA 5KG2A 2W9MA 4DF8A 1UT8A 3RTVA 4R63A 4F5OA 2R8JA 4KLFA 4M6WA 2R8IA 2R8KA 5DQGA 2M2UA 1TV9A 5J2AA 1KFSA 2ZTCA 1Q79A 1R8AA 4XUSA 4TURA 4X4OA 9ICMA 3T5KA 4XQ8A 3JPQA 5EOZA 4MFCA 4LZDA 1MC8A 5DDMA 2P6UA 4GXKA 8ICBA 3C5FA 3WFRE 4RPYA 2BE3A 2V4QA 5KT5A 1X9WA 1ZQPA 9ICIA 2HHPA 3ZD8A 4X4PA 3L9DA 3M9OB 1ZQZA 4ED2A 3RH4A 2ZH7A 5EWGA 2JZBB 4O3PA 4M47A 2UVRA 2HHUA 2BGWA 3NTUA 2KFZA 1ZQUA 5IIJA 4O3SA 5IIKA 2JEJA 4I2HA 3HJ4A 1UT5A 3Q8KA 2BCSA 4F4KA 4F5RA 4I2CA 5HRHA 3OVAA 1U9LA 7ICUA 2AGPA 4DL3A 2MUTB 2XO7A 5DB8A 4BDPA 2JEFA 3HJ1A 1U45A 5HRBA 5HR9A 4ECYA 1TFRA 4DL4A 3KTQA 5KFVA 1D9FA 4DFKA 8ICXA 1JXLA 1T8EA 1U49A 5F9LA 4DQSA 8ICRA 4DS5A 4ECSA 3PV8A 4DQRA 4AT9A 5J0XA 2ZH2A 5F2VO 4RU9A 4RQ0A 4UD4A 3JZ0A 1SZPA 5J2JA 1NO5A 5KFIA 1KRPA 4KLMA 1X2IA 3OSPA 1TK5A 2IHMA 4YMMA 5BOLA 1ZETA 4RUCA 4DOAA 3UQ0A 1ZJNA 3WFSC 4F4ZA 3OUYA 1SL0A 2HHWA 1DK2A 4F4YA 3BQ1A 3V7LA 5KFMA 5HC9A 5D49A 4IQUA 4DSJA 1R8CA 4E8FA 2VA8A 4RUAA 4ED1A 5KTQA 3RR7A 4J9NA 4YXMA 4Z6EA 4YQWA 1RZTA 1NKCA 4KLJA 4QZCA 1VFGA 9ICEA 1MIYA 4FHYA 1ZQYA 1ZQVA 3PW2A 2IBKA 5DBAA 4FS2A 3PX6A 5BOMA 4YD1A 8ICMA 4Q45A 4EYIB 4ECQA 3BQ0A 4J9KA 4DOBA 2BQRA 4IRCA 5DBCA 1UEVA 4PGXA 3GV8B 1UA0A 5J0TA 3M8RA 3IHQB 4I2GA 7ICEA 2JZBA 5DG8A 9ICXA 1KFTA 2FPMA 4QZBA 4O0IA 1XO1A 3V6HA 3TAPA 7ICJA 2FMSA 8ICIA 2RDJA 5L1JA 4DS4A 2F1JA 3SYZA 4X4SA 4P4MA 1KSPA 5KFJA 4ED7A 1U47A 5DBBA 2R8GA 2B21A 5J2BA 2ZJAA 4ECXA 2MUTA 4E80A 5J0QA 3H8SA 1XWLA 1TK0A 3EYZA 3G6XA 2DR9A 2LYHA 3PW0A 9ICOA 3V6JA 2W8LA 3TAQA 4X5VA 1D8YA 2HW3A 2I1QA 4IRDA 1TKDA 4KLHA 4DQQA 4B9NA 4QZDA 1B43A 4RPXA 3RAQA 8ICTA 4IG8A 4DSIA 5CWRA 5HHHA 2R8HA 1ZQDA 4O3RA 4KMUA 4JUZA 5IIOA 3UPSA 5KFOA 1ZQEA 2NRKA 1IM4A 3Q8LA 3LDAA 2FLLA 1ZQIA 5KFLA 4R64A 4DL7A 4DLEA 4BGDA 2FPLA 4UBCA 2A1JB 4F5PA 9ICGA 4JWMA 5DQHA 2DRBA 2Q66A 5C5JA 3Q8RB 2ISPA 3UXNA 3AQMA 4X4NA 4E7XA 7ICIA 4Q8FA 4C8NA 4YXJA 4QZEA 4LVSA 4UB2A 4PPXA 4C8MA 2F1IA 3PR5B 2FLNA 4RQ3A 5KT3A 1ZQGA 1KTQA 5J2FA 5KT4A 3N4MB 1K1QA 4P4PA 4TUPA 4FHVA 1CUKA 4FHWA 2DPIA 2BR0A 2OWOA 4YVZA 4UB5A 3PX4A 3QE9Y 1JXEA 3SV3A 4JV0A 4IRKA 4KLTA 1ZQXA 4QWBA 3JPNA 4KLGA 4K4GA 1S0VA 2ZH3A 2FLPA 1NJYA 3LWLA 8ICZA 2O1PA 3C1ZA 5HMLA 2J6TA 2RFFA 2IA6A 3C23A 4M2YA 8ICKA 3OUYB 1TVAA 3GDXA 3RB6A 2JEGA 4M04A 1XU4A 2ZUBA 4UAYA 2M2VA 5CA7A 3ISDA 4RT3A 3PW4A 9ICHA 2BKEA 2ALZA 1OU5A 4NM1A 4Z6DA 5KG5A 4ZH4A 5DQIA 5HHIA 4KLLA 3PMLA 4WC0A 4EP7A 7ICFA 4QWDA 9ICCA 1TK8A 4O5EA 4ELUA 3Q8SB 4BXOA 1ZQQA 4KLOA 3MBYA 1ZQHA 1S76D 3RRHA 4DWIA 2BHNA 1XSPA 4I28A 4R66A 1RXWA 1HUOA 4R65A 8ICUA 2DR7A 4BWJA 2P6RA 5IIIA 4GC7A 3EWAA 2XCAA 1V4AA 4FH5A 2ZH8A 3H8WA 2PFQA 4I29A 4O3QA 3H7IA 1A76A 5L1IA 2BCQA 5IILA 3Q8MA 4DQPA 4X4QA 3KHHA 4ECTA 3ORYA 3V7JA 4FO6A 3V6KA 1ZQMA 1BPEA 5CHGA 4PHAA 5DB9A 4DEZA 2A1JA 3MFIA 5D4BA 3IM1A 4EZ9A 5EWEA 3MGHA 2NRVA 3C5GA 7ICQA 4DFJA 2BPGA 4F2SA 5CB1A 5J0WA 3C1YA 1UA1A 4ELVA 5J2EA 4DFPA 1JIHA 4NM2A 4F8RA 5KFPA 3T3FA 4F91B 3RB3A 2BPFA 4YMNA 1D9DA 4ECVA 4M5DA 4AT7B 2BQUA 1L5UA 4RWQA 3OV7A 2DR8A 1S0MA 3UPQA 4F50A 2P66A 7ICGA 3NYBA 2ZTEA
chains in the Genus database with same CATH superfamily
4LEVA 4WQLA 3AL0B 4EEYA 5HRIA 1MSWD 1PK1A 5DKWA 4WC1A 4WC2A 4OO1J 3RJIA 1L3SA 2W3RA 4DOCA 1BNOA 4M9HA 5KL1B 3QZ8A 2NRXA 5KFAA 1TAQA 4RNNA 4GXJA 1SL1A 1SV4A 3I28A 3BQTA 3SAGA 4WCWA 3BS5A 2HCFA 8ICFA 3DV9A 3HJEA 4YD2A 3NVVA 4RQ4A 1COKA 2GH1A 4F72A 5KNIA 1FO4A 5HMMA 3SD7A 1XSNA 8ICSA 5ALNA 2C28A 3ZDDA 8ICPA 2W55A 4NLBA 3ONNA 2Q0ZX 5ALKA 3F2BA 3OVBA 4YP3A 1S97A 4EX6A 4BXOB 1BPXA 1ZQJA 2ZUCA 3N7RC 1NK8A 2ZH9A 2JR5A 2HN2A 4MF8A 5HRFA 1BGXT 1ZOLA 2ATLA 3M6ZA 3TADC 3E58A 2UVUA 1NZPA 4OJLA 5CFUA 3NRZA 4PH5A 5DG9A 3AQEA 2DQNB 4P0PB 5J2CA 3F2DA 3MGVA 3H4BA 5J2KA 1ZD4A 4B9TA 4JV2A 2W9CA 4Q43A 1NKBA 1QSSA 2WF6A 5KG0A 5GTHU 5ALUA 1GO3F 4ECRA 2M2TA 4O5CA 4CRXA 2HI0A 5C0YA 7ICMA 3GU3A 1RDFA 4ICAA 5ALVA 1BVSA 2KZZA 3R9KA 3EPIA 1B22A 3CK6A 1QCKA 1JMSA 1ZQTA 9ICAA 4KITB 1YLQA 2B51A 2MU2A 2NRTA 3JPPA 4FZLA 1MIWA 1V9PA 1RG6A 4I2FA 4NXXA 4U7CA 1X6JA 3HP6A 3IDWA 2CRXA 3H37A 3PSIA 3NGDA 4B9VA 2KTQA 2DR5A 1XS9D 2KSOA 3L5KA 7ICLA 3PVXA 5AK6A 4UAVA 2XY6A 2AH5A 3ZDEA 2PMZC 3KZXA 4DF4A 3I1YA 5ALHA 2EAMA 4JV1A 1V38A 2FMPA 1JRPA 5JRTA 5TZVA 5KFUA 3SV4A 5KFWA 2ASLA 2KJ5A 7ICVA 4QZGA 4KX3A 2W9BB 2OHFA 3B0YA 1NOMA 2KK0A 4K4IA 1ZQLA 3K7DA 2DVIA 1JROA 4I2AA 4DL2A 4KTQA 9ICPA 3TFSA 3UMCA 4U6PA 4EBEA 3K4GA 5AKKA 4O6AA 4YMOA 2AGOA 3IRUA 8ICEA 2KJ9A 2KICA 4YR3A 2ZJ5A 2ZH4A 5HRGA 4NLGA 2IUBA 4Y2XA 3OSNA 2XY5A 2BBHA 4X0BA 1WWVA 3H0RB 3GIJA 1KDHA 4I27A 2BPCA 3PR4A 4MFFA 4OAHA 5CJ7A 5B5EU 5AIAA 4PGQA 5AKJA 4EBDA 2ESEA 1SGGA 4M9JA 3SEIA 1MQ2A 4UQGA 9ICSA 3M9NB 1RQNA 2AU0A 2ZIUA 3C2MA 3C21A 2UVWA 1NI3A 3OVSA 3T5LA 3C66A 5A0LA 1ZJMA 2KV2A 4FH3A 3AUOA 4F3OA 4RNOA 1RM6C 4RPZA 1S0NA 2Y9UA 2KSOB 2XICA 3EPGA 4B9LA 1COOA 1SWWA 1N63A 3HKZF 2DRAA 2ZUDA 2G08A 4FZNA 4J9OA 2FDRA 2KIVA 5KFGA 1U48A 2CXYA 3Q8QB 8ICLA 3AQLA 2UVVA 1DGSA 3AQMA 3BQ2A 3WFPA 9ICJA 5AI0A 9ICQA 2RLTA 4J9RA 3GIMA 1PK3A 4LT6A 3KZIU 1OUQA 3ZDBA 3D6JA 4RQ1A 4AT9B 4KM5A 1L7OA 4ATBA 2ES6A 3LQCB 4DSFA 4F92B 4UB8U 2K4PA 2KHQA 4UD5A 3WFQE 4NKUA 1UT8A 4KLFA 4M6WA 4C80A 1Q79A 3OTQA 1TV9A 5J2AA 4X4OA 9ICMA 3UM9A 3T5KA 4MFCA 4LZDA 4O69A 1X9WA 9ICIA 4X4PA 2H3VA 1ZQZA 5F3XB 3SAFA 4M47A 4O3SA 2JEJA 4US8A 2WF5A 1UT5A 3D2QA 4IS7A 4F4KA 2MRLA 3OVAA 4NJ8A 4DL3A 3HJ1A 5HRBA 5KFVA 1D9FA 2BZFA 8ICXA 1T8EA 1U49A 4DQSA 3QNMA 4ECSA 5F2VO 2FCLA 5J2JA 3CRXA 4JLZA 5JTIA 2VJ5A 5BOLA 3DEEA 4RUCA 5AM1A 4OJ6A 4DSJA 4E8FA 2VA8A 4PJ0U 3QU9A 1L8LA 4J9NA 4Z6EA 1RZTA 1NKCA 1C20A 2IBKA 4K8VA 4FS2A 2W11A 4NLCA 4Q45A 5AK5A 2K4IA 1L6NA 3WK5A 4IRCA 1OW5A 4PGXA 4QNLA 5J0TA 9ICXA 4PL1A 5D61A 4C4SA 1XO1A 2AHOB 3F2CA 4DS4A 5AKZA 1KSPA 4ED7A 2B21A 4Y2JA 2OYYA 5J0QA 2OCEA 1OXJA 3V6JA 3TAQA 2B56A 3D2NA 5KL8B 3E0FA 5ALDA 4QZDA 3QX7A 5HHHA 5CWRA 2R8HA 5KFOA 1ZQEA 2NRKA 1S5LU 3LDAA 1N62A 5KFLA 4DL7A 5E79U 3AMZA 4DLEA 5AICA 3SAHA 9ICGA 1A0PA 5DQHA 2Q66A 5C5JA 2ISPA 4X4NA 4E7XA 3NVOA 7ICIA 5KAFU 3PR5B 3NASA 2FLNA 3C29A 1T94A 1ZQGA 4Y2QA 2EZYA 5KT4A 1K1QA 2IHOA 1CUKA 3ICXA 1S0VA 2LKYA 2BBJA 3LWLA 4PZNA 2O1PA 3C1ZA 2DWQA 3F5EA 1P7DA 2IA6A 3N7SC 2KIWA 4LJXA 3GDXA 3RB6A 4M04A 1XU4A 2E8PA 2ZUBA 4DCCA 4UAYA 4NM1A 3QU2A 5HHIA 1FIQA 4QWDA 1ZQQA 3HILA 2LHTA 1O03A 3RRHA 1XSPA 5CRXA 2DR7A 1RXWA 2K8AA 1SV0C 5D62A 2XCAA 4USAA 1V4AA 4FH5A 1YZ6A 2AXTU 1PVRA 5IILA 3Q8MA 2H3QA 4Y2RA 4FO6A 1MA7A 5DB9A 5D4BA 2A1JA 3IM1A 3QUCA 4DFJA 3C1YA 1VDVA 1UA1A 4ELVA 5J2EA 7ICPA 4KLDA 4F8RA 5KFPA 3RB3A 4F91B 1D9DA 4ECVA 5AKGA 4F50A 4OCZA 2DKZA 3RJHA 4FBUA 4ELTA 2Y1JA 2C2RA 4TQSA 4B9SA 2O5AA 4TUSA 4DQIA 1B0XA 4RQNA 5ALJA 4DFMA 4CF4A 4P0QA 1LVHA 5L9XA 5KFFA 4QWEA 1NJZA 1TFYA 4IL6U 5HRDA 3WKBA 1Q8KA 2VA3A 2FMQA 1T4GA 5HRLA 2JXJA 3ER9B 5BPCA 3UQ2A 5DLFA 2P35A 2IMWP 2H3IA 3A0BU 5JUMA 4MF2A 4NXVA 2E5SA 8ICOA 4C7YA 1QSYA 4K9BA 3JPTA 1NK6A 1MIVA 3GV5B 1WCLA 2EH9A 9ICNA 1NZBA 2YTUA 1S9FA 2V9WA 1SKRA 2GA9D 3JPRA 2ODGA 2L5YA 4B9MA 3ZD9A 4K99A 8ICNA 3I76A 2NYVA 4CE6A 4EBJA 5CP2A 3M9MB 3T5JA 4WQKA 2H5XA 4AT8B 2Y0SC 3ISCA 1JX4A 2HBMA 1BPBA 1FA0A 5B3PA 4DL5A 4E0DA 1VLBA 2KZMA 4C7ZA 3SQIA 2E1FA 2FE9A 3K75D 2A3VA 3QUQA 4QZ8A 3HPOA 5ALTA 4XQ7A 2W8KA 2B0CA 3AU2A 5HRKA 5G5GA 4QIWF 2PFOA 3MR5A 1SIJA 4QWCA 4S3NA 1J2NA 4DSEA 2ZG6A 1J97A 2KKVA 4Q44A 5ALGA 2WAQC 1SL2A 1Q46A 4Y2TA 5KFTA 7ICSA 3HX0A 4NY8A 4WC4A 5KFRA 3LVVA 4IQTA 1DRGA 4I2JA 4P0QB 9ICKA 2HBKA 3ZDCA 2DBYA 2VANA 1ZRMA 1JN3A 1DK3A 1PX5A 1WG8A 4NL9A 4KLIA 2KG5A 4RQMA 3OJSA 2VJ4A 3PO5A 3RH5A 4QW8A 2JV3A 4J03A 4KN4A 4YG2A 2GWSA 5KG1A 1N56A 4EENA 1ZQRA 2PI4A 1HJPA 4MFAA 5KFDA 2MAXA 1NK4A 2HDOA 2LPEA 1SKWA 3FM9A 4P0PA 4IQVA 3K1ZA 3RJFA 1ZQWA 3TQ1A 3H39A 2NO4A 5AM0A 1ZYQA 5L1MA 1ZD3A 5HP4A 3RH6A 5ALOA 4WBZA 4Y2VA 4JWNA 3FAHA 4NXUA 3AQKA 5KFHA 2CPRA 4UW9A 4C4RA 1RPLA 3BJYA 3C2KA 4OJ5A 1L7PA 1IIPA 2YMPA 4I2IA 2ZH5A 4CF5A 2HHXA 3G6YA 1RQLA 5ALLA 3LYSA 5J29A 3E2EA 4JK1A 2BCVA 5L1LA 4RWPA 4FHXA 3HT3A 5DGBA 2DL0A 4F4WA 4J9PA 1PVQA 4Z6FA 1ZQAA 2YMMA 4R8UB 2VKQA 4Y2SA 2NRWA 3MR3A 5L1KA 1VJ5A 3B0XA 2RP5A 5AHXA 2E1EA 1CEZA 4N7RA 2PI5A 2C2DA 3MDCA 4NKTA 1QLNA 5DEDA 3BDPA 3LVWA 5J8YA 5CFSA 1DOQA 1U4BA 2EZZA 2G0AA 4J9SA 3WKAA 2W9BA 1ZQFA 4KN7A 3HIYA 1Q78A 4LEWA 4QZFA 1RYSA 5KFKA 4UAUA 3M1YA 3SENA 2IOHA 1EXNA 3T5HA 5GTIU 3RFAA 3KKAA 2HMXA 1X9XA 5KFEA 4RT2A 5KFNA 2PFNA 5DG7A 9ICVA 4Y2UA 4MEXA 1UQVA 2PMZF 2W9AA 4EZ6A 4F5QA 3RJEA 4WC3A 1N5WA 1JALA 2G09A 5J2DA 1Q3VA 2KFNA 1BPDA 3J81j 5HNKA 3QEAZ 4Q8EA 5IINA 2W7OA 2XIDA 2ZHBA 3EZ5A 2KHVA 4ACOA 4ED0A 4Z6CA 2F2AB 5DB7A 4K9AA 3QYPA 2DF4B 5KG2A 3RTVA 1QQ7A 1KFSA 1R8AA 2ZTCA 4B6JA 4XUSA 4TURA 4XQ8A 5EOZA 3SMVA 1PUZA 1MC8A 1YT3A 4GXKA 3C5FA 3WFRE 4CGZA 1ZQPA 2EDUA 3HRDD 5ALRA 4ED2A 3RH4A 1UHUA 2JZBB 3NTUA 1ZQUA 5IIJA 2KE7A 5IIKA 2LM1A 4I2HA 3Q8KA 2BCSA 3L4PA 1WYGA 5HRHA 1U9LA 7ICUA 4HX0A 2AGPA 4ECYA 4DL4A 2F8KA 5F9LA 8ICRA 2ZH2A 4DQRA 4AT9A 4RQ0A 5KFIA 2KEYA 3UMBA 2IHMA 1SZHA 1ZETA 4AYBC 4F4ZA 3OUYA 2HHWA 3BQ1A 5D49A 4RUAA 4YXMA 5ALYA 4KLJA 4EV6A 1VFGA 2WF9A 1MIYA 4FHYA 2KNJA 3PW2A 3ER8C 5ALMA 8ICMA 4YD1A 3QU7A 5AKYA 4DOBA 2BQRA 5DBCA 1IG6A 2G06A 2FPMA 4QZBA 3V6HA 7ICJA 8ICIA 4NXWA 5EE9A 3SYZA 5DBBA 5J2BA 2ZJAA 3H8SA 3BZCA 3GZFA 2LYHA 9ICOA 5AK4A 2FJ6A 2HW3A 1TKDA 5AKIA 4DQQA 1B43A 4RPXA 1ZQDA 2JGAA 4O3RA 4KMUA 1X40A 4JUZA 3ZI4A 2F77X 2YY6A 2JRZA 4MKPA 4BGDA 2FPLA 2M0NA 4F5PA 1URJA 4JWMA 4AP9A 2G5HB 5AKLA 3QUTA 5EE3A 4YXJA 2A19A 3MC1A 4UB5A 3PX4A 3QE9Y 3SV3A 4JV0A 4K4GA 1NJYA 1SWVA 8ICZA 2RHFA 5ALSA 8ICKA 3OUYB 3CYMA 1FFUA 5CA7A 4RT3A 3PW4A 1OU5A 5KG5A 4ZH4A 5DQIA 3AM9A 2W3SA 4WC0A 7ICFA 9ICCA 1TK8A 3Q8SB 1S76D 4KLOA 4I28A 2BHNA 4R65A 4BWJA 2P6RA 4FO1A 3H8WA 4O3QA 3H7IA 5L1IA 3M7DA 3KHHA 3AEVA 1BPEA 3HKZC 4DEZA 3QU4A 5AI4A 5EWEA 3MGHA 2NRVA 5J0WA 4DFPA 5ALQA 4AT7B 3UPQA 4O68A 2ZTEA 4UASA 1O08A 2Y9TA 4FFDA 3THVA 3H4DA 2BCRA 3H38A 2BDPA 4X4RA 2ASJA 3RJGA 4Y2PA 2D6FC 4YCXA 4I2BA 4X4UA 2ZIVB 5AI5A 8ICYA 3TI0A 4RQ5A 1UCVA 5H2FU 5ALZA 1NJXA 2ZJ8A 9ICTA 1BPZA 2XVTA 2EAOA 2EAPA 3PMNA 5J0OA 2XCPA 4BJQA 4F93B 1QTMA 1ZRNA 2KP7A 5AI9A 3IG5A 2E3TA 4X4TA 2HHTA 5AI6A 4DSKA 4EX7A 1UEUA 2NRZA 2YX8A 4J9QA 3JYYA 1M6YA 1MQ3A 1Z4OA 1NK0A 4QWAA 7ICHA 3F5AA 3TARA 2W03A 3HWTA 3OWGA 4UBBA 2VIXA 2BQ3A 1X6IA 3PW7A 4KX5A 1S77D 4NLNA 4DLGA 8ICAA 1JUDA 1JAJA 2C22A 3VC8A 4X0AA 3MGIA 2E8OA 4O3MA 7ICRA 3UMGA 2JEIA 2DUYA 1F0MA 2JH1A 5KFZA 3AQNA 4UB3A 5CHEA 3WKEA 2Z7JA 5J2HA 2PBEA 4F71A 3H40A 5DLGA 2ZIXA 3IG8A 2JMGA 4O3OA 1WCNA 2XGPA 3EW9A 4C8LA 3C18A 3AU6A 1IV8A 4I0UA 3RB0A 3HW8A 1L3VA 3GIKA 4ECUA 4AT8A 5EE0A 2MA1A 3QEBZ 3H8JA 3ETLA 1L7NA 4K98A 9ICRA 3UPSA 1D8LA 2LM4A 1N5XA 2F44A 8ICQA 3OPXA 2HOQA 1LV5A 4EBCA 4RQ2A 2YB4A 1WOTA 2OM6A 1Z00B 2W04A 2DPJA 1TE2A 1QSLA 2ZH1A 2AJQA 2AQ0A 1H38A 2LYBA 4EEKA 4FS1A 4WC5A 1N48A 2XY7A 4OAFA 4CNQA 1Y88A 3K1RB 4G9BA 3MFHA 3JPSA 3PSTA 3Q8PB 2QARB 2W54A 4YFKA 3NKUA 4OJPA 2DFLA 2LI6A 3UXOA 3AN1A 3QU5A 4IR9A 5KAIU 1ZQKA 1HEKA 5KFBA 1SKSA 3RBEA 1RXVA 1L7MA 2RQ5A 2Y0SF 1N2XA 2H3ZA 8ICVA 2PXIA 2DKXA 1N60A 4M9LA 4I2DA 3GV7B 1L3UA 2I9GA 2LBOA 4IR1A 1ZQ1C 5J0RA 1KBUA 3V72A 4DO9A 5ALPA 4F5NA 5AK3A 4K96A 1DXSA 3SI8A 4OAIZ 2IHNA 3NUQA 2WB1F 4NL9C 2ZIXB 1K1SA 1L3TA 1WWUA 2XI9A 5KT2A 3KHGA 5KFCA 1AQ6A 2ZIWB 3AQFA 2WAQF 4UAZA 1T7PA 1S8OA 1UPHA 1A6SA 4RWNA 3QUBA 2HHVA 2EZXA 4QW9A 2JHDA 2PKEA 2K89A 2ASDA 8ICWA 2XGQA 4Y2YA 1F44A 5ALXA 1KL9A 1UETA 4GXIA 4X4VA 4FBTA 3RAXA 2HVHA 2FPKA 3RBDA 1HUZA 1AROP 2GLEA 3ED5A 2KKPA 3C28A 9ICWA 2N1RA 2WF7A 4ECZA 3FDSA 2KOBA 4OD0A 2PFPA 2K8BB 1WUDA 2ISOA 3RJKA 4IQWA 2K8CB 4J9LA 2ZTDA 1TAUA 3MDAA 3NRWA 4UAWA 1F5AA 2ID1A 4WJ3B 5KG6A 4O5KA 3GILA 1NK5A 4UB1A 2ZHAA 3QZ7A 3TKAA 2W43A 4QZHA 2GO7A 5FP0A 2C2EA 2M2WA 1J2MA 4XA5A 1MN8A 4P4OA 4R8UA 3KHLA 4K97A 4TUQA 2HVIA 4KMOB 1FFVA 2CN1A 8ICCA 2HBLA 4LZGA 4M9NA 1KFDA 4NXZA 2Q4TA 1XC9A 2QB0B 1XO0A 2ZXIA 4MEYA 2HBJA 2AGQA 3IP4B 3GFKB 9ICLA 3RF9A 2B6GA 2K4HA 4R63A 4F5OA 2R8JA 2R8IA 2R8KA 5DQGA 3O0FA 1N61A 3JPQA 5B3QA 5J8YC 5DDMA 2P6UA 8ICBA 2BE3A 2KVSA 4EEDA 2YMLA 2YB1A 2BGWA 2KFZA 5HR6A 3H8MA 3HJ4A 4FE3A 4FZMA 2MUTB 2XO7A 5DB8A 4BDPA 2JEFA 3EF2A 5HR9A 2OH2A 3KKAC 4DFKA 1JXLA 4DS5A 3PV8A 2YN4A 4RU9A 1CRXA 3NVZA 4JB3A 4KLMA 3OSPA 1TK5A 4YMMA 4DOAA 1ZJNA 2H3FA 4C4TA 2WF8A 2E8MA 1DK2A 5HC9A 4JMUA 4IQUA 2D3DA 4ED1A 5KTQA 5EE1A 4YQWA 1QQ6A 5AM4A 4QZCA 9ICEA 3PX6A 1UEVA 4I2GA 3GV8B 1JQRA 7ICEA 1KFTA 2JZBA 2ZXHA 4O0IA 4IC9A 2RDJA 2IOFA 2F1JA 5KFJA 4ECXA 1YZ7A 1XWLA 3EYZA 3G6XA 3PW0A 4QJFB 4IRDA 3NVWA 1LKYA 8ICTA 1T3QA 3WK6A 3WK9A 4C0ZA 4US9A 3H0LB 3Q8LA 2FLLA 2DGZA 1SB3C 4UBCA 2KVCA 2DRBA 2MSNA 2YQEA 4NXTA 3UXNA 4Q8FA 4C8NA 4QZEA 4LVSA 4C8MA 4RQ3A 5KT3A 2QKQA 3PHZA 5ALIA 2E8NA 3N4MB 4FHWA 2DPIA 2BR0A 4YVZA 2RFFA 4KLTA 4IRKA 1ZQXA 3JPNA 4KLGA 1PK1B 2WHEA 2FLPA 2W7PA 5HMLA 2J6TA 3C23A 4M2YA 4WH5A 4UARA 5JU5A 2JEGA 2F3NA 2BKEA 2ALZA 3IV6A 4KLLA 3PMLA 4HAIA 2HN1A 1FEZA 4O5EA 4ELUA 3MBYA 1KQQA 4AYBF 4DWIA 3M6KA 3BS7A 1KN5A 3BS5B 1HUOA 2HSZA 3WU2U 4GC7A 1K5OA 3EWAA 3N7PD 2PFQA 4I29A 2BCQA 2A1AA 1GPJA 4DQPA 4ECTA 3ORYA 3B9JA 1ZQMA 4LEYA 1ECWA 3MFIA 5CHGA 1V85A 7ICQA 2BPGA 4GIBA 5CB1A 3TADA 1JIHA 4YMNA 4M5DA 1L5UA 1S0MA 3NYBA 7ICGA 7ICKA 1ZQIA 2KJ8A 5D46A 2J6SA 1X42A 5J0SA 1LKYB 3MR2A 4UB4A 1NNLA 3ALRA 2RRDA 5KFSA 5KG3A 2HOIA 4PHDA 2OXOA 3SZ2A 1NJWA 3C2LA 4DFDA 4QZ9A 2I6XA 4C8OA 2OEHA 5EWFA 3PO4A 4M0AA 2F1HA 5AKXA 2J6UA 8ICHA 9ICBA 5KT6A 3RRGA 5HREA 5G5HA 4YR2A 1BNPA 4HYKA 3G6VA 5DGAA 3BQ7A 3OJUA 2W9CB 4GLXA 5KT7A 4C8KA 4AT7A 3L3FX 2KN7A 1NK7A 4RWOA 1V97A 4RQ6A 4B9UA 4XJEA 1JI7A 2G5IB 7ICTA 4LEZA 4NLZA 4O3NA 1XSLA 3PW5A 3TANA 5J0UA 4PHEA 4PHPA 3GIIA 5J2IA 1T3NA 4TQRA 4DSLA 4EEBA 2ZIVA 4F2RA 4J9MA 4RQ8A 4KLEA 2BCUA 1ZD5A 3RB4A 2R18A 1KKXA 5AM2A 4RZRA 2FI1A 5DB6A 2EANA 4KLQA 3FYHA 2D8CA 3CNHA 1L8OA 3NWIA 5J2GA 1Z1VA 4UATA 4ZOHC 1ZQSA 2EWRA 9ICUA 1PVPA 4WC6A 1R8BA 1S10A 5AM5A 5F9NA 5J0PA 1VJ7A 4I2EA 1KNYA 4NWIA 2HOFA 3NS1A 1ZQBA 5KG7A 3U26A 3NVYA 3FC4A 4KLSA 3MABA 3ISBA 3DDHA 4WC7A 3M8SA 4ED8A 1A77A 3PX0A 5ALWA 3V7KA 3OGUA 3TFRA 4ED3A 4GC6A 4QZAA 3EUB2 1SXDA 1S0OA 3UXPA 5AKEA 1RYRA 4WBYA 5KFYA 4BUGA 4XRHA 3PSFA 5CR0A 3H0MB 1Z4NA 2V4RA 3IN5A 5B66U 1SXEA 4F4XA 9ICFA 2ZIUB 4FHPA 5KG4A 3RR8A 3KHRA 1IXRA 1ZQOA 3ZDAA 4JLXA 4GFJA 8ICGA 4G3IA 3LK9A 4PL2A 3ETRA 2AQ4A 4PGYA 3OHBA 4YR0A 5CFTA 1Z00A 4ED6A 3CP8A 1Z3EB 2EQYA 4P2HA 1R89A 5DDYA 2F8LA 1ZQCA 4K4HA 3GQCA 3WK4A 5DECA 1X9SA 5CEHA 2QARA 5J0YA 4EYHB 2ZH6A 3BZKA 7ICNA 3WFOA 5KFXA 1NK9A 4M9GA 4ATBB 4RQ7A 4NLKA 4BX9C 1X9MA 1NKEA 5IIMA 1LB2B 4PZOA 1PZNA 3LWMA 3OHAA 3RJJA 7ICOA 3PY8A 3KBBA 2K60A 4M6WB 8ICJA 2HHQA 3WK8A 3JPOA 1D8BA 1KLNA 1ZQNA 4O9MA 2Y1IA 4FHVA 2VA2A 2QB1A 1KEJA 5KFQA 4CCHA 3PNCA 3CW2C 4RNMA 1BPYA 2KZ3A 3N28A 1TFWA 2WTFA 2RDIA 4YN4A 3S6JA 3VCBA 3N97B 2ZIWA 1KW4A 4EGWA 1Z19A 2HHSA 3MR6A 4QZIA 2B4VA 4KLUA 4DL6A 3SR6A 4ECWA 2GOLA 4EBKA 5TISU 3H3AA 2M9NA 2JH7A 4BWMA 1TAMA 2XC9A 3PZPA 1C7YA 3KFUF 2W9MA 4DF8A 2M2UA 4CDGA 2BDUA 2LYAA 5ALFA 1QH9A 5K4LA 4RPYA 2V4QA 5KT5A 2HHPA 3ZD8A 3L9DA 3M9OB 2O6KA 2I5HA 2ZH7A 5EWGA 4O3PA 2UVRA 2HHUA 4F5RA 4I2CA 5AIBA 1U45A 3WKCA 1TFRA 3KTQA 3D2SA 1ED1A 2QB0A 4EELA 2F76X 5J0XA 4UD4A 3JZ0A 1SZPA 2IOFK 2WFAA 1KRPA 2KD1A 1X2IA 2KMDA 4MHVA 3UQ0A 3WFSC 1SL0A 2QLTA 4F4YA 3T79A 3V7LA 5KFMA 1R8CA 3RR7A 5AI8A 3PSPA 1ZQYA 1ZQVA 5DBAA 5BOMA 1ZD2P 5AM3A 2NO5A 3BQ0A 4EYIB 4ECQA 4J9KA 4OJOA 5HR7A 1X66A 1UA0A 3M8RA 1NO5A 3IHQB 5DG8A 3JCFA 3TAPA 1HIWA 2FMSA 1SV0A 5L1JA 4KB6A 3A0HU 4X4SA 4P4MA 1U47A 2R8GA 1B4FA 2MUTA 4WOYA 4E80A 1TK0A 5D63A 2DR9A 3WK7A 2W8LA 4X5VA 1D8YA 2G07A 2I1QA 5AKHA 2K4EA 4KLHA 4B9NA 3RAQA 4IG8A 4DSIA 5ALEA 5IIOA 1IM4A 4R64A 2A1JB 3KD3A 3Q8RB 4UB6U 2WB1C 4UB2A 4PPXA 2YMQA 2F1IA 1Z1BA 1KTQA 5J2FA 2GAFD 4P4PA 4TUPA 3F53A 3WKDA 2OWOA 3TACB 1JXEA 4QWBA 1XNSA 1DGJA 2ZH3A 1TVAA 2M2VA 5JTGA 3ISDA 3ERCC 1CI4A 9ICHA 3QXGA 4Z6DA 4EP7A 4BXOA 1ZQHA 1RYUA 4A8EA 4QIWC 8ICUA 4R66A 4NV0A 1QQ5A 1ZXIA 5IIIA 2ZH8A 4X4QA 1A76A 5T14A 3KOOA 3V7JA 3V6KA 4PHAA 2LMRA 2NV3A 4EZ9A 1F5SA 3C5GA 4O67A 4F2SA 4OAGA 3MCRA 4NM2A 3T3FA 2BPFA 4CF3A 2BQUA 4RWQA 3OV7A 2DR8A 2P66A 1Q3UA
chains in the Genus database with same CATH topology
5D46A 2J6SA 3RJHA 4ELTA 2Y1JA 4EEYA 4FBUA 3THVA 3H4DA 2C2RA 2BCRA 3H38A 2BDPA 4TQSA 5J0SA 4B9SA 5HRIA 4TUSA 4DQIA 1MSWD 2O5AA 4DFMA 3MR2A 5DKWA 4UB4A 5L9XA 4WC1A 5KFFA 4QWEA 1NJZA 4WC2A 2ASJA 4X4RA 1TFYA 3RJIA 3RJGA 5KFSA 1L3SA 5KG3A 5HRDA 4DOCA 4M9HA 1BNOA 3QZ8A 2VA3A 4YCXA 2FMQA 4I2BA 2NRXA 1T4GA 5KFAA 4PHDA 1TAQA 4RNNA 4GXJA 3SZ2A 1NJWA 1SL1A 5HRLA 4X4UA 5BPCA 3C2LA 3UQ2A 5DLFA 8ICYA 3TI0A 4QZ9A 4RQ5A 2IMWP 5JUMA 4C8OA 1NJXA 3BQTA 2ZJ8A 4MF2A 5EWFA 4WCWA 3PO4A 4M0AA 9ICTA 2F1HA 8ICHA 2J6UA 1BPZA 8ICOA 9ICBA 5KT6A 8ICFA 1QSYA 3PMNA 5J0OA 4YD2A 2XCPA 4F93B 3JPTA 1NK6A 3RRGA 5HREA 1MIVA 4YR2A 1QTMA 4HYKA 1BNPA 3GV5B 1WCLA 4RQ4A 2KP7A 3G6VA 9ICNA 5DGAA 3OJUA 1S9FA 5HMMA 2W9CB 4GLXA 2V9WA 1XSNA 1SKRA 5KT7A 2HHTA 4X4TA 3JPRA 8ICSA 4DSKA 2C28A 4B9MA 3ZDDA 3ZD9A 4C8KA 4AT7A 8ICNA 1UEUA 4EBJA 2NRZA 8ICPA 2KN7A 5CP2A 3M9MB 4J9QA 3T5JA 2Q0ZX 1NK7A 1MQ3A 1NK0A 3JYYA 2H5XA 3OVBA 4QWAA 4AT8B 4YP3A 7ICHA 1S97A 3ISCA 4RQ6A 1JX4A 4BXOB 1BPXA 4B9UA 1BPBA 1FA0A 1ZQJA 4DL5A 2ZUCA 4E0DA 1NK8A 2ZH9A 2KZMA 7ICTA 3K75D 3TARA 4MF8A 5HRFA 4NLZA 3HWTA 4QZ8A 1BGXT 4O3NA 4UBBA 2ATLA 1XSLA 3PW5A 3TANA 2BQ3A 5J0UA 3HPOA 2UVUA 4RWOA 4XQ7A 4PHEA 2W8KA 3PW7A 4PHPA 3GIIA 5J2IA 1S77D 1NZPA 4NLNA 3AU2A 4DLGA 1T3NA 8ICAA 5HRKA 4TQRA 1JAJA 2C22A 4DSLA 4PH5A 5DG9A 2PFOA 4F2RA 4J9MA 4RQ8A 4X0AA 3MR5A 3MGIA 4KLEA 2BCUA 7ICRA 4QWCA 4S3NA 5J2CA 3RB4A 2JEIA 4DSEA 5KFZA 3AQNA 4UB3A 4Q44A 4RZRA 5DB6A 4KLQA 3FYHA 5J2HA 1SL2A 3H40A 3H4BA 5KFTA 5J2GA 7ICPA 2PBEA 7ICSA 5DLGA 5J2KA 3HX0A 1ZQSA 4NY8A 4WC4A 5KFRA 4O3OA 4B9TA 4JV2A 9ICUA 4IQTA 1WCNA 4I2JA 2W9CA 2XGPA 3EW9A 9ICKA 4WC6A 4Q43A 1NKBA 3ZDCA 4C8LA 1R8BA 1QSSA 3C18A 1S10A 5F9NA 2VANA 3AU6A 5KG0A 1JN3A 5J0PA 1DK3A 4I2EA 1PX5A 4ECRA 1KNYA 1VJ7A 2M2TA 3RB0A 4O5CA 3HW8A 1L3VA 4KLIA 3GIKA 4ECUA 7ICMA 4AT8A 3QEBZ 3H8JA 3ETLA 1BVSA 3OJSA 2KZZA 3EPIA 9ICRA 1B22A 1ZQBA 5KG7A 1JMSA 3RH5A 1D8LA 4QW8A 4KITB 1ZQTA 3PO5A 9ICAA 1YLQA 8ICQA 2NRTA 3JPPA 4KLSA 4KN4A 3MABA 4YG2A 1MIWA 1V9PA 3ISBA 2GWSA 4WC7A 1LV5A 5KG1A 4EBCA 4RQ2A 3M8SA 4I2FA 1WOTA 1N56A 1ZQRA 2PI4A 1Z00B 2DPJA 4ED8A 1A77A 3PX0A 1HJPA 1QSLA 4MFAA 3V7KA 2AJQA 2ZH1A 3OGUA 3TFRA 3HP6A 5KFDA 2AQ0A 2MAXA 4ED3A 1NK4A 1H38A 3H37A 4GC6A 4FS1A 3NGDA 1SKWA 4B9VA 4QZAA 1N48A 4IQVA 2KTQA 4WC5A 2DR5A 2XY7A 1XS9D 3RJFA 1Y88A 1ZQWA 3TQ1A 1S0OA 7ICLA 3UXPA 3MFHA 3PVXA 3H39A 3JPSA 2XY6A 3Q8PB 4DF4A 3ZDEA 1ZYQA 4YFKA 1RYRA 4WBYA 5KFYA 4JV1A 2DFLA 4XRHA 5HP4A 5CR0A 3UXOA 3RH6A 2FMPA 4WBZA 5TZVA 4IR9A 5KFUA 3SV4A 5KFWA 2V4RA 2ASLA 1ZQKA 4JWNA 5KFBA 1SKSA 3AQKA 5KFHA 4F4XA 3RBEA 1RXVA 9ICFA 7ICVA 1RPLA 4FHPA 4QZGA 8ICVA 2W9BB 2PXIA 3B0YA 3BJYA 3C2KA 1NOMA 4K4IA 5KG4A 1ZQLA 4M9LA 4I2DA 3GV7B 1L3UA 3RR8A 2I9GA 3KHRA 1IXRA 4I2IA 4IR1A 2DVIA 4I2AA 5J0RA 4DL2A 1ZQOA 3ZDAA 4KTQA 9ICPA 2ZH5A 8ICGA 3V72A 4DO9A 3TFSA 2HHXA 3G6YA 4F5NA 4G3IA 3LK9A 4EBEA 2AQ4A 5J29A 3E2EA 3K4GA 4JK1A 4PGYA 3OHBA 5L1LA 4YMOA 4YR0A 3SI8A 2AGOA 2BCVA 4RWPA 8ICEA 4FHXA 3HT3A 5DGBA 2IHNA 1Z00A 4ED6A 4F4WA 4YR3A 1K1SA 1Z3EB 2ZJ5A 4J9PA 1L3TA 2ZH4A 4P2HA 4Z6FA 5HRGA 1JQRA 5DDYA 1R89A 5KT2A 3KHGA 5KFCA 1ZQCA 3OSNA 3GQCA 4K4HA 4NLGA 2XY5A 5DECA 1ZQAA 4R8UB 4X0BA 3GIJA 1KDHA 4UAZA 3MR3A 2NRWA 1X9SA 1T7PA 5L1KA 4I27A 4RWNA 2BPCA 3PR4A 4MFFA 2HHVA 5J0YA 5CJ7A 4QW9A 3B0XA 4EYHB 2ZH6A 1CEZA 4PGQA 2ASDA 7ICNA 2XGQA 2PI5A 4EBDA 8ICWA 3WFOA 2C2DA 5KFXA 4M9JA 3MDCA 1NK9A 1QLNA 4NKTA 3BDPA 4M9GA 1MQ2A 1UETA 4RQ7A 4GXIA 5DEDA 4ATBB 4X4VA 4UQGA 9ICSA 3M9NB 4NLKA 4FBTA 1DOQA 3RAXA 2AU0A 1U4BA 1X9MA 2HVHA 2FPKA 4J9SA 5IIMA 1NKEA 3C2MA 3C21A 1AROP 3RBDA 2W9BA 1LB2B 1HUZA 2UVWA 1ZQFA 1PZNA 9ICWA 4ECZA 4KN7A 3HIYA 3FDSA 3LWMA 3T5LA 3OHAA 1Q78A 3C66A 1ZJMA 3OVSA 2PFPA 4QZFA 3RJJA 7ICOA 3PY8A 4FH3A 3AUOA 4M6WB 4F3OA 1RYSA 8ICJA 4RNOA 5KFKA 4RPZA 2ISOA 1S0NA 3RJKA 2HHQA 3JPOA 4IQWA 3EPGA 4B9LA 4J9LA 2ZTDA 1ZQNA 2Y1IA 1KLNA 3MDAA 1COOA 2VA2A 4O9MA 1EXNA 3T5HA 1TAUA 4UAWA 1F5AA 2DRAA 2ID1A 1KEJA 2ZUDA 5KG6A 4J9OA 5KFQA 4CCHA 4O5KA 3GILA 1NK5A 3PNCA 4RNMA 1BPYA 5KFEA 4RT2A 4UB1A 5KFGA 5KFNA 2KZ3A 2ZHAA 3QZ7A 1U48A 5DG7A 2PFNA 9ICVA 3Q8QB 1TFWA 4QZHA 2WTFA 2RDIA 8ICLA 4MEXA 3AQLA 2C2EA 2UVVA 2M2WA 1DGSA 4XA5A 4YN4A 3N97B 4P4OA 4R8UA 3KHLA 3BQ2A 2W9AA 9ICJA 4EZ6A 4TUQA 4F5QA 3RJEA 2HVIA 3WFPA 4WC3A 5J2DA 9ICQA 2KFNA 8ICCA 2HHSA 1BPDA 4LZGA 4J9RA 3MR6A 5HNKA 3QEAZ 4QZIA 4M9NA 1KFDA 3GIMA 5IINA 4KLUA 4NXZA 4Q8EA 1XC9A 4DL6A 4LT6A 3ZDBA 2ZHBA 4RQ1A 3EZ5A 4AT9B 4ECWA 4EBKA 7ICKA 4ATBA 4MEYA 4ED0A 3H3AA 4KLDA 3LQCB 2M9NA 2AGQA 4BWMA 4DSFA 4F92B 3GFKB 4Z6CA 2XC9A 9ICLA 1C7YA 4UD5A 5DB7A 3WFQE 4NKUA 5KG2A 2W9MA 4DF8A 1UT8A 3RTVA 4R63A 4F5OA 2R8JA 4KLFA 4M6WA 2R8IA 2R8KA 5DQGA 2M2UA 1TV9A 5J2AA 1KFSA 2ZTCA 1Q79A 1R8AA 4XUSA 4TURA 4X4OA 9ICMA 3T5KA 4XQ8A 3JPQA 5EOZA 4MFCA 4LZDA 1MC8A 5DDMA 2P6UA 4GXKA 8ICBA 3C5FA 3WFRE 4RPYA 2BE3A 2V4QA 5KT5A 1X9WA 1ZQPA 9ICIA 2HHPA 3ZD8A 4X4PA 3L9DA 3M9OB 1ZQZA 4ED2A 3RH4A 2ZH7A 5EWGA 2JZBB 4O3PA 4M47A 2UVRA 2HHUA 2BGWA 3NTUA 2KFZA 1ZQUA 5IIJA 4O3SA 5IIKA 2JEJA 4I2HA 3HJ4A 1UT5A 3Q8KA 2BCSA 4F4KA 4F5RA 4I2CA 5HRHA 3OVAA 1U9LA 7ICUA 2AGPA 4DL3A 2MUTB 2XO7A 5DB8A 4BDPA 2JEFA 3HJ1A 1U45A 5HRBA 5HR9A 4ECYA 1TFRA 4DL4A 3KTQA 5KFVA 1D9FA 4DFKA 8ICXA 1JXLA 1T8EA 1U49A 5F9LA 4DQSA 8ICRA 4DS5A 4ECSA 3PV8A 4DQRA 4AT9A 5J0XA 2ZH2A 5F2VO 4RU9A 4RQ0A 4UD4A 3JZ0A 1SZPA 5J2JA 1NO5A 5KFIA 1KRPA 4KLMA 1X2IA 3OSPA 1TK5A 2IHMA 4YMMA 5BOLA 1ZETA 4RUCA 4DOAA 3UQ0A 1ZJNA 3WFSC 4F4ZA 3OUYA 1SL0A 2HHWA 1DK2A 4F4YA 3BQ1A 3V7LA 5KFMA 5HC9A 5D49A 4IQUA 4DSJA 1R8CA 4E8FA 2VA8A 4RUAA 4ED1A 5KTQA 3RR7A 4J9NA 4YXMA 4Z6EA 4YQWA 1RZTA 1NKCA 4KLJA 4QZCA 1VFGA 9ICEA 1MIYA 4FHYA 1ZQYA 1ZQVA 3PW2A 2IBKA 5DBAA 4FS2A 3PX6A 5BOMA 4YD1A 8ICMA 4Q45A 4EYIB 4ECQA 3BQ0A 4J9KA 4DOBA 2BQRA 4IRCA 5DBCA 1UEVA 4PGXA 3GV8B 1UA0A 5J0TA 3M8RA 3IHQB 4I2GA 7ICEA 2JZBA 5DG8A 9ICXA 1KFTA 2FPMA 4QZBA 4O0IA 1XO1A 3V6HA 3TAPA 7ICJA 2FMSA 8ICIA 2RDJA 5L1JA 4DS4A 2F1JA 3SYZA 4X4SA 4P4MA 1KSPA 5KFJA 4ED7A 1U47A 5DBBA 2R8GA 2B21A 5J2BA 2ZJAA 4ECXA 2MUTA 4E80A 5J0QA 3H8SA 1XWLA 1TK0A 3EYZA 3G6XA 2DR9A 2LYHA 3PW0A 9ICOA 3V6JA 2W8LA 3TAQA 4X5VA 1D8YA 2HW3A 2I1QA 4IRDA 1TKDA 4KLHA 4DQQA 4B9NA 4QZDA 1B43A 4RPXA 3RAQA 8ICTA 4IG8A 4DSIA 5CWRA 5HHHA 2R8HA 1ZQDA 4O3RA 4KMUA 4JUZA 5IIOA 3UPSA 5KFOA 1ZQEA 2NRKA 1IM4A 3Q8LA 3LDAA 2FLLA 1ZQIA 5KFLA 4R64A 4DL7A 4DLEA 4BGDA 2FPLA 4UBCA 2A1JB 4F5PA 9ICGA 4JWMA 5DQHA 2DRBA 2Q66A 5C5JA 3Q8RB 2ISPA 3UXNA 3AQMA 4X4NA 4E7XA 7ICIA 4Q8FA 4C8NA 4YXJA 4QZEA 4LVSA 4UB2A 4PPXA 4C8MA 2F1IA 3PR5B 2FLNA 4RQ3A 5KT3A 1ZQGA 1KTQA 5J2FA 5KT4A 3N4MB 1K1QA 4P4PA 4TUPA 4FHVA 1CUKA 4FHWA 2DPIA 2BR0A 2OWOA 4YVZA 4UB5A 3PX4A 3QE9Y 1JXEA 3SV3A 4JV0A 4IRKA 4KLTA 1ZQXA 4QWBA 3JPNA 4KLGA 4K4GA 1S0VA 2ZH3A 2FLPA 1NJYA 3LWLA 8ICZA 2O1PA 3C1ZA 5HMLA 2J6TA 2RFFA 2IA6A 3C23A 4M2YA 8ICKA 3OUYB 1TVAA 3GDXA 3RB6A 2JEGA 4M04A 1XU4A 2ZUBA 4UAYA 2M2VA 5CA7A 3ISDA 4RT3A 3PW4A 9ICHA 2BKEA 2ALZA 1OU5A 4NM1A 4Z6DA 5KG5A 4ZH4A 5DQIA 5HHIA 4KLLA 3PMLA 4WC0A 4EP7A 7ICFA 4QWDA 9ICCA 1TK8A 4O5EA 4ELUA 3Q8SB 4BXOA 1ZQQA 4KLOA 3MBYA 1ZQHA 1S76D 3RRHA 4DWIA 2BHNA 1XSPA 4I28A 4R66A 1RXWA 1HUOA 4R65A 8ICUA 2DR7A 4BWJA 2P6RA 5IIIA 4GC7A 3EWAA 2XCAA 1V4AA 4FH5A 2ZH8A 3H8WA 2PFQA 4I29A 4O3QA 3H7IA 1A76A 5L1IA 2BCQA 5IILA 3Q8MA 4DQPA 4X4QA 3KHHA 4ECTA 3ORYA 3V7JA 4FO6A 3V6KA 1ZQMA 1BPEA 5CHGA 4PHAA 5DB9A 4DEZA 2A1JA 3MFIA 5D4BA 3IM1A 4EZ9A 5EWEA 3MGHA 2NRVA 3C5GA 7ICQA 4DFJA 2BPGA 4F2SA 5CB1A 5J0WA 3C1YA 1UA1A 4ELVA 5J2EA 4DFPA 1JIHA 4NM2A 4F8RA 5KFPA 3T3FA 4F91B 3RB3A 2BPFA 4YMNA 1D9DA 4ECVA 4M5DA 4AT7B 2BQUA 1L5UA 4RWQA 3OV7A 2DR8A 1S0MA 3UPQA 4F50A 2P66A 7ICGA 3NYBA 2ZTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D46 A;  2J6S A;  3RJH A;  4ELT A;  2Y1J A;  4EEY A;  4FBU A;  3THV A;  3H4D A;  2C2R A;  2BCR A;  3H38 A;  2BDP A;  4TQS A;  5J0S A;  4B9S A;  5HRI A;  4TUS A;  4DQI A;  1MSW D;  2O5A A;  4DFM A;  3MR2 A;  5DKW A;  4UB4 A;  5L9X A;  4WC1 A;  5KFF A;  4QWE A;  1NJZ A;  4WC2 A;  2ASJ A;  4X4R A;  1TFY A;  3RJI A;  3RJG A;  5KFS A;  1L3S A;  5KG3 A;  5HRD A;  4DOC A;  4M9H A;  1BNO A;  3QZ8 A;  2VA3 A;  4YCX A;  2FMQ A;  4I2B A;  2NRX A;  1T4G A;  5KFA A;  4PHD A;  1TAQ A;  4RNN A;  4GXJ A;  3SZ2 A;  1NJW A;  1SL1 A;  5HRL A;  4X4U A;  5BPC A;  3C2L A;  3UQ2 A;  5DLF A;  8ICY A;  3TI0 A;  4QZ9 A;  4RQ5 A;  2IMW P;  5JUM A;  4C8O A;  1NJX A;  3BQT A;  2ZJ8 A;  4MF2 A;  5EWF A;  4WCW A;  3PO4 A;  4M0A A;  9ICT A;  2F1H A;  8ICH A;  2J6U A;  1BPZ A;  8ICO A;  9ICB A;  5KT6 A;  8ICF A;  1QSY A;  3PMN A;  5J0O A;  4YD2 A;  2XCP A;  4F93 B;  3JPT A;  1NK6 A;  3RRG A;  5HRE A;  1MIV A;  4YR2 A;  1QTM A;  4HYK A;  1BNP A;  3GV5 B;  1WCL A;  4RQ4 A;  2KP7 A;  3G6V A;  9ICN A;  5DGA A;  3OJU A;  1S9F A;  5HMM A;  2W9C B;  4GLX A;  2V9W A;  1XSN A;  1SKR A;  5KT7 A;  2HHT A;  4X4T A;  3JPR A;  8ICS A;  4DSK A;  2C28 A;  4B9M A;  3ZDD A;  3ZD9 A;  4C8K A;  4AT7 A;  8ICN A;  1UEU A;  4EBJ A;  2NRZ A;  8ICP A;  2KN7 A;  5CP2 A;  3M9M B;  4J9Q A;  3T5J A;  2Q0Z X;  1NK7 A;  1MQ3 A;  1NK0 A;  3JYY A;  2H5X A;  3OVB A;  4QWA A;  4AT8 B;  4YP3 A;  7ICH A;  1S97 A;  3ISC A;  4RQ6 A;  1JX4 A;  4BXO B;  1BPX A;  4B9U A;  1BPB A;  1FA0 A;  1ZQJ A;  4DL5 A;  2ZUC A;  4E0D A;  1NK8 A;  2ZH9 A;  2KZM A;  7ICT A;  3K75 D;  3TAR A;  4MF8 A;  5HRF A;  4NLZ A;  3HWT A;  4QZ8 A;  1BGX T;  4O3N A;  4UBB A;  2ATL A;  1XSL A;  3PW5 A;  3TAN A;  2BQ3 A;  5J0U A;  3HPO A;  2UVU A;  4RWO A;  4XQ7 A;  4PHE A;  2W8K A;  3PW7 A;  4PHP A;  3GII A;  5J2I A;  1S77 D;  1NZP A;  4NLN A;  3AU2 A;  4DLG A;  1T3N A;  8ICA A;  5HRK A;  4TQR A;  1JAJ A;  2C22 A;  4DSL A;  4PH5 A;  5DG9 A;  2PFO A;  4F2R A;  4J9M A;  4RQ8 A;  4X0A A;  3MR5 A;  3MGI A;  4KLE A;  2BCU A;  7ICR A;  4QWC A;  4S3N A;  5J2C A;  3RB4 A;  2JEI A;  4DSE A;  5KFZ A;  3AQN A;  4UB3 A;  4Q44 A;  4RZR A;  5DB6 A;  4KLQ A;  3FYH A;  5J2H A;  1SL2 A;  3H40 A;  3H4B A;  5KFT A;  5J2G A;  7ICP A;  2PBE A;  7ICS A;  5DLG A;  5J2K A;  3HX0 A;  1ZQS A;  4NY8 A;  4WC4 A;  5KFR A;  4O3O A;  4B9T A;  4JV2 A;  9ICU A;  4IQT A;  1WCN A;  4I2J A;  2W9C A;  2XGP A;  3EW9 A;  9ICK A;  4WC6 A;  4Q43 A;  1NKB A;  3ZDC A;  4C8L A;  1R8B A;  1QSS A;  3C18 A;  1S10 A;  5F9N A;  2VAN A;  3AU6 A;  5KG0 A;  1JN3 A;  5J0P A;  1DK3 A;  4I2E A;  1PX5 A;  4ECR A;  1KNY A;  1VJ7 A;  2M2T A;  3RB0 A;  4O5C A;  3HW8 A;  1L3V A;  4KLI A;  3GIK A;  4ECU A;  7ICM A;  4AT8 A;  3QEB Z;  3H8J A;  3ETL A;  1BVS A;  3OJS A;  2KZZ A;  3EPI A;  9ICR A;  1B22 A;  1ZQB A;  5KG7 A;  1JMS A;  3RH5 A;  1D8L A;  4QW8 A;  4KIT B;  1ZQT A;  3PO5 A;  9ICA A;  1YLQ A;  8ICQ A;  2NRT A;  3JPP A;  4KLS A;  4KN4 A;  3MAB A;  4YG2 A;  1MIW A;  1V9P A;  3ISB A;  2GWS A;  4WC7 A;  1LV5 A;  5KG1 A;  4EBC A;  4RQ2 A;  3M8S A;  4I2F A;  1WOT A;  1N56 A;  1ZQR A;  2PI4 A;  1Z00 B;  2DPJ A;  4ED8 A;  1A77 A;  3PX0 A;  1HJP A;  1QSL A;  4MFA A;  3V7K A;  2AJQ A;  2ZH1 A;  3OGU A;  3TFR A;  3HP6 A;  5KFD A;  2AQ0 A;  2MAX A;  4ED3 A;  1NK4 A;  1H38 A;  3H37 A;  4GC6 A;  4FS1 A;  3NGD A;  1SKW A;  4B9V A;  4QZA A;  1N48 A;  4IQV A;  2KTQ A;  4WC5 A;  2DR5 A;  2XY7 A;  1XS9 D;  3RJF A;  1Y88 A;  1ZQW A;  3TQ1 A;  1S0O A;  7ICL A;  3UXP A;  3MFH A;  3PVX A;  3H39 A;  3JPS A;  2XY6 A;  3Q8P B;  4DF4 A;  3ZDE A;  1ZYQ A;  4YFK A;  1RYR A;  4WBY A;  5KFY A;  4JV1 A;  2DFL A;  4XRH A;  5HP4 A;  5CR0 A;  3UXO A;  3RH6 A;  2FMP A;  4WBZ A;  5TZV A;  4IR9 A;  5KFU A;  3SV4 A;  5KFW A;  2V4R A;  2ASL A;  1ZQK A;  4JWN A;  5KFB A;  1SKS A;  3AQK A;  5KFH A;  4F4X A;  3RBE A;  1RXV A;  9ICF A;  7ICV A;  1RPL A;  4FHP A;  4QZG A;  8ICV A;  2W9B B;  2PXI A;  3B0Y A;  3BJY A;  3C2K A;  1NOM A;  4K4I A;  5KG4 A;  1ZQL A;  4M9L A;  4I2D A;  3GV7 B;  1L3U A;  3RR8 A;  2I9G A;  3KHR A;  1IXR A;  4I2I A;  4IR1 A;  2DVI A;  4I2A A;  5J0R A;  4DL2 A;  1ZQO A;  3ZDA A;  4KTQ A;  9ICP A;  2ZH5 A;  8ICG A;  3V72 A;  4DO9 A;  3TFS A;  2HHX A;  3G6Y A;  4F5N A;  4G3I A;  3LK9 A;  4EBE A;  2AQ4 A;  5J29 A;  3E2E A;  3K4G A;  4JK1 A;  4PGY A;  3OHB A;  5L1L A;  4YMO A;  4YR0 A;  3SI8 A;  2AGO A;  2BCV A;  4RWP A;  8ICE A;  4FHX A;  3HT3 A;  5DGB A;  2IHN A;  1Z00 A;  4ED6 A;  4F4W A;  4YR3 A;  1K1S A;  1Z3E B;  2ZJ5 A;  4J9P A;  1L3T A;  2ZH4 A;  4P2H A;  4Z6F A;  5HRG A;  1JQR A;  5DDY A;  1R89 A;  5KT2 A;  3KHG A;  5KFC A;  1ZQC A;  3OSN A;  3GQC A;  4K4H A;  4NLG A;  2XY5 A;  5DEC A;  1ZQA A;  4R8U B;  4X0B A;  3GIJ A;  1KDH A;  4UAZ A;  3MR3 A;  2NRW A;  1X9S A;  1T7P A;  5L1K A;  4I27 A;  4RWN A;  2BPC A;  3PR4 A;  4MFF A;  2HHV A;  5J0Y A;  5CJ7 A;  4QW9 A;  3B0X A;  4EYH B;  2ZH6 A;  1CEZ A;  4PGQ A;  2ASD A;  7ICN A;  2XGQ A;  2PI5 A;  4EBD A;  8ICW A;  3WFO A;  2C2D A;  5KFX A;  4M9J A;  3MDC A;  1NK9 A;  1QLN A;  4NKT A;  3BDP A;  4M9G A;  1MQ2 A;  1UET A;  4RQ7 A;  4GXI A;  5DED A;  4ATB B;  4X4V A;  4UQG A;  9ICS A;  3M9N B;  4NLK A;  4FBT A;  1DOQ A;  3RAX A;  2AU0 A;  1U4B A;  1X9M A;  2HVH A;  2FPK A;  4J9S A;  5IIM A;  1NKE A;  3C2M A;  3C21 A;  1ARO P;  3RBD A;  2W9B A;  1LB2 B;  1HUZ A;  2UVW A;  1ZQF A;  1PZN A;  9ICW A;  4ECZ A;  4KN7 A;  3HIY A;  3FDS A;  3LWM A;  3T5L A;  3OHA A;  1Q78 A;  3C66 A;  1ZJM A;  3OVS A;  2PFP A;  4QZF A;  3RJJ A;  7ICO A;  3PY8 A;  4FH3 A;  3AUO A;  4M6W B;  4F3O A;  1RYS A;  8ICJ A;  4RNO A;  5KFK A;  4RPZ A;  2ISO A;  1S0N A;  3RJK A;  2HHQ A;  3JPO A;  4IQW A;  3EPG A;  4B9L A;  4J9L A;  2ZTD A;  1ZQN A;  2Y1I A;  1KLN A;  3MDA A;  1COO A;  2VA2 A;  4O9M A;  1EXN A;  3T5H A;  1TAU A;  4UAW A;  1F5A A;  2DRA A;  2ID1 A;  1KEJ A;  2ZUD A;  5KG6 A;  4J9O A;  5KFQ A;  4CCH A;  4O5K A;  3GIL A;  1NK5 A;  3PNC A;  4RNM A;  1BPY A;  5KFE A;  4RT2 A;  4UB1 A;  5KFG A;  5KFN A;  2KZ3 A;  2ZHA A;  3QZ7 A;  1U48 A;  5DG7 A;  2PFN A;  9ICV A;  3Q8Q B;  1TFW A;  4QZH A;  2WTF A;  2RDI A;  8ICL A;  4MEX A;  3AQL A;  2C2E A;  2UVV A;  2M2W A;  1DGS A;  4XA5 A;  4YN4 A;  3N97 B;  4P4O A;  4R8U A;  3KHL A;  3BQ2 A;  2W9A A;  9ICJ A;  4EZ6 A;  4TUQ A;  4F5Q A;  3RJE A;  2HVI A;  3WFP A;  4WC3 A;  5J2D A;  9ICQ A;  2KFN A;  8ICC A;  2HHS A;  1BPD A;  4LZG A;  4J9R A;  3MR6 A;  5HNK A;  3QEA Z;  4QZI A;  4M9N A;  1KFD A;  3GIM A;  5IIN A;  4KLU A;  4NXZ A;  4Q8E A;  1XC9 A;  4DL6 A;  4LT6 A;  3ZDB A;  2ZHB A;  4RQ1 A;  3EZ5 A;  4AT9 B;  4ECW A;  4EBK A;  7ICK A;  4ATB A;  4MEY A;  4ED0 A;  3H3A A;  4KLD A;  3LQC B;  2M9N A;  2AGQ A;  4BWM A;  4DSF A;  4F92 B;  3GFK B;  4Z6C A;  2XC9 A;  9ICL A;  1C7Y A;  4UD5 A;  5DB7 A;  3WFQ E;  4NKU A;  5KG2 A;  2W9M A;  4DF8 A;  1UT8 A;  3RTV A;  4R63 A;  4F5O A;  2R8J A;  4KLF A;  4M6W A;  2R8I A;  2R8K A;  5DQG A;  2M2U A;  1TV9 A;  5J2A A;  1KFS A;  2ZTC A;  1Q79 A;  1R8A A;  4XUS A;  4TUR A;  4X4O A;  9ICM A;  3T5K A;  4XQ8 A;  3JPQ A;  5EOZ A;  4MFC A;  4LZD A;  1MC8 A;  5DDM A;  2P6U A;  4GXK A;  8ICB A;  3C5F A;  3WFR E;  4RPY A;  2BE3 A;  2V4Q A;  5KT5 A;  1X9W A;  1ZQP A;  9ICI A;  2HHP A;  3ZD8 A;  4X4P A;  3L9D A;  3M9O B;  1ZQZ A;  4ED2 A;  3RH4 A;  2ZH7 A;  5EWG A;  2JZB B;  4O3P A;  4M47 A;  2UVR A;  2HHU A;  2BGW A;  3NTU A;  2KFZ A;  1ZQU A;  5IIJ A;  4O3S A;  5IIK A;  2JEJ A;  4I2H A;  3HJ4 A;  1UT5 A;  3Q8K A;  2BCS A;  4F4K A;  4F5R A;  4I2C A;  5HRH A;  3OVA A;  1U9L A;  7ICU A;  2AGP A;  4DL3 A;  2MUT B;  2XO7 A;  5DB8 A;  4BDP A;  2JEF A;  3HJ1 A;  1U45 A;  5HRB A;  5HR9 A;  4ECY A;  1TFR A;  4DL4 A;  3KTQ A;  5KFV A;  1D9F A;  4DFK A;  8ICX A;  1JXL A;  1T8E A;  1U49 A;  5F9L A;  4DQS A;  8ICR A;  4DS5 A;  4ECS A;  3PV8 A;  4DQR A;  4AT9 A;  5J0X A;  2ZH2 A;  5F2V O;  4RU9 A;  4RQ0 A;  4UD4 A;  3JZ0 A;  1SZP A;  5J2J A;  1NO5 A;  5KFI A;  1KRP A;  4KLM A;  1X2I A;  3OSP A;  1TK5 A;  2IHM A;  4YMM A;  5BOL A;  1ZET A;  4RUC A;  4DOA A;  3UQ0 A;  1ZJN A;  3WFS C;  4F4Z A;  3OUY A;  1SL0 A;  2HHW A;  1DK2 A;  4F4Y A;  3BQ1 A;  3V7L A;  5KFM A;  5HC9 A;  5D49 A;  4IQU A;  4DSJ A;  1R8C A;  4E8F A;  2VA8 A;  4RUA A;  4ED1 A;  5KTQ A;  3RR7 A;  4J9N A;  4YXM A;  4Z6E A;  4YQW A;  1RZT A;  1NKC A;  4KLJ A;  4QZC A;  1VFG A;  9ICE A;  1MIY A;  4FHY A;  1ZQY A;  1ZQV A;  3PW2 A;  2IBK A;  5DBA A;  4FS2 A;  3PX6 A;  5BOM A;  4YD1 A;  8ICM A;  4Q45 A;  4EYI B;  4ECQ A;  3BQ0 A;  4J9K A;  4DOB A;  2BQR A;  4IRC A;  5DBC A;  1UEV A;  4PGX A;  3GV8 B;  1UA0 A;  5J0T A;  3M8R A;  3IHQ B;  4I2G A;  7ICE A;  2JZB A;  5DG8 A;  9ICX A;  1KFT A;  2FPM A;  4QZB A;  4O0I A;  1XO1 A;  3V6H A;  3TAP A;  7ICJ A;  2FMS A;  8ICI A;  2RDJ A;  5L1J A;  4DS4 A;  2F1J A;  3SYZ A;  4X4S A;  4P4M A;  1KSP A;  5KFJ A;  4ED7 A;  1U47 A;  5DBB A;  2R8G A;  2B21 A;  5J2B A;  2ZJA A;  4ECX A;  2MUT A;  4E80 A;  5J0Q A;  3H8S A;  1XWL A;  1TK0 A;  3EYZ A;  3G6X A;  2DR9 A;  2LYH A;  3PW0 A;  9ICO A;  3V6J A;  2W8L A;  3TAQ A;  4X5V A;  1D8Y A;  2HW3 A;  2I1Q A;  4IRD A;  1TKD A;  4KLH A;  4DQQ A;  4B9N A;  4QZD A;  1B43 A;  4RPX A;  3RAQ A;  8ICT A;  4IG8 A;  4DSI A;  5CWR A;  5HHH A;  2R8H A;  1ZQD A;  4O3R A;  4KMU A;  4JUZ A;  5IIO A;  3UPS A;  5KFO A;  1ZQE A;  2NRK A;  1IM4 A;  3Q8L A;  3LDA A;  2FLL A;  1ZQI A;  5KFL A;  4R64 A;  4DL7 A;  4DLE A;  4BGD A;  2FPL A;  4UBC A;  2A1J B;  4F5P A;  9ICG A;  4JWM A;  5DQH A;  2DRB A;  2Q66 A;  5C5J A;  3Q8R B;  2ISP A;  3UXN A;  3AQM A;  4X4N A;  4E7X A;  7ICI A;  4Q8F A;  4C8N A;  4YXJ A;  4QZE A;  4LVS A;  4UB2 A;  4PPX A;  4C8M A;  2F1I A;  3PR5 B;  2FLN A;  4RQ3 A;  5KT3 A;  1ZQG A;  1KTQ A;  5J2F A;  5KT4 A;  3N4M B;  1K1Q A;  4P4P A;  4TUP A;  4FHV A;  1CUK A;  4FHW A;  2DPI A;  2BR0 A;  2OWO A;  4YVZ A;  4UB5 A;  3PX4 A;  3QE9 Y;  1JXE A;  3SV3 A;  4JV0 A;  4IRK A;  4KLT A;  1ZQX A;  4QWB A;  3JPN A;  4KLG A;  4K4G A;  1S0V A;  2ZH3 A;  2FLP A;  1NJY A;  3LWL A;  8ICZ A;  2O1P A;  3C1Z A;  5HML A;  2J6T A;  2RFF A;  2IA6 A;  3C23 A;  4M2Y A;  8ICK A;  3OUY B;  1TVA A;  3GDX A;  3RB6 A;  2JEG A;  4M04 A;  1XU4 A;  2ZUB A;  4UAY A;  2M2V A;  5CA7 A;  3ISD A;  4RT3 A;  3PW4 A;  9ICH A;  2BKE A;  2ALZ A;  1OU5 A;  4NM1 A;  4Z6D A;  5KG5 A;  4ZH4 A;  5DQI A;  5HHI A;  4KLL A;  3PML A;  4WC0 A;  4EP7 A;  7ICF A;  4QWD A;  9ICC A;  1TK8 A;  4O5E A;  4ELU A;  3Q8S B;  4BXO A;  1ZQQ A;  4KLO A;  3MBY A;  1ZQH A;  1S76 D;  3RRH A;  4DWI A;  2BHN A;  1XSP A;  4I28 A;  4R66 A;  1RXW A;  1HUO A;  4R65 A;  8ICU A;  2DR7 A;  4BWJ A;  2P6R A;  5III A;  4GC7 A;  3EWA A;  2XCA A;  1V4A A;  4FH5 A;  2ZH8 A;  3H8W A;  2PFQ A;  4I29 A;  4O3Q A;  3H7I A;  1A76 A;  5L1I A;  2BCQ A;  5IIL A;  3Q8M A;  4DQP A;  4X4Q A;  3KHH A;  4ECT A;  3ORY A;  3V7J A;  4FO6 A;  3V6K A;  1ZQM A;  1BPE A;  5CHG A;  4PHA A;  5DB9 A;  4DEZ A;  2A1J A;  3MFI A;  5D4B A;  3IM1 A;  4EZ9 A;  5EWE A;  3MGH A;  2NRV A;  3C5G A;  7ICQ A;  4DFJ A;  2BPG A;  4F2S A;  5CB1 A;  5J0W A;  3C1Y A;  1UA1 A;  4ELV A;  5J2E A;  4DFP A;  1JIH A;  4NM2 A;  4F8R A;  5KFP A;  3T3F A;  4F91 B;  3RB3 A;  2BPF A;  4YMN A;  1D9D A;  4ECV A;  4M5D A;  4AT7 B;  2BQU A;  1L5U A;  4RWQ A;  3OV7 A;  2DR8 A;  1S0M A;  3UPQ A;  4F50 A;  2P66 A;  7ICG A;  3NYB A;  2ZTE A; 
#chains in the Genus database with same CATH topology
 4LEV A;  4WQL A;  3AL0 B;  4EEY A;  5HRI A;  1MSW D;  1PK1 A;  5DKW A;  4WC1 A;  4WC2 A;  4OO1 J;  3RJI A;  1L3S A;  2W3R A;  4DOC A;  1BNO A;  4M9H A;  5KL1 B;  3QZ8 A;  2NRX A;  5KFA A;  1TAQ A;  4RNN A;  4GXJ A;  1SL1 A;  1SV4 A;  3I28 A;  3BQT A;  3SAG A;  4WCW A;  3BS5 A;  2HCF A;  8ICF A;  3DV9 A;  3HJE A;  4YD2 A;  3NVV A;  4RQ4 A;  1COK A;  2GH1 A;  4F72 A;  5KNI A;  1FO4 A;  5HMM A;  3SD7 A;  1XSN A;  8ICS A;  5ALN A;  2C28 A;  3ZDD A;  8ICP A;  2W55 A;  4NLB A;  3ONN A;  2Q0Z X;  5ALK A;  3F2B A;  3OVB A;  4YP3 A;  1S97 A;  4EX6 A;  4BXO B;  1BPX A;  1ZQJ A;  2ZUC A;  3N7R C;  1NK8 A;  2ZH9 A;  2JR5 A;  2HN2 A;  4MF8 A;  5HRF A;  1BGX T;  1ZOL A;  2ATL A;  3M6Z A;  3TAD C;  3E58 A;  2UVU A;  1NZP A;  4OJL A;  5CFU A;  3NRZ A;  4PH5 A;  5DG9 A;  3AQE A;  2DQN B;  4P0P B;  5J2C A;  3F2D A;  3MGV A;  3H4B A;  5J2K A;  1ZD4 A;  4B9T A;  4JV2 A;  2W9C A;  4Q43 A;  1NKB A;  1QSS A;  2WF6 A;  5KG0 A;  5GTH U;  5ALU A;  1GO3 F;  4ECR A;  2M2T A;  4O5C A;  4CRX A;  2HI0 A;  5C0Y A;  7ICM A;  3GU3 A;  1RDF A;  4ICA A;  5ALV A;  1BVS A;  2KZZ A;  3R9K A;  3EPI A;  1B22 A;  3CK6 A;  1QCK A;  1JMS A;  1ZQT A;  9ICA A;  4KIT B;  1YLQ A;  2B51 A;  2MU2 A;  2NRT A;  3JPP A;  4FZL A;  1MIW A;  1V9P A;  1RG6 A;  4I2F A;  4NXX A;  4U7C A;  1X6J A;  3HP6 A;  3IDW A;  2CRX A;  3H37 A;  3PSI A;  3NGD A;  4B9V A;  2KTQ A;  2DR5 A;  1XS9 D;  2KSO A;  3L5K A;  7ICL A;  3PVX A;  5AK6 A;  4UAV A;  2XY6 A;  2AH5 A;  3ZDE A;  2PMZ C;  3KZX A;  4DF4 A;  3I1Y A;  5ALH A;  2EAM A;  4JV1 A;  1V38 A;  2FMP A;  1JRP A;  5JRT A;  5TZV A;  5KFU A;  3SV4 A;  5KFW A;  2ASL A;  2KJ5 A;  7ICV A;  4QZG A;  4KX3 A;  2W9B B;  2OHF A;  3B0Y A;  1NOM A;  2KK0 A;  4K4I A;  1ZQL A;  3K7D A;  2DVI A;  1JRO A;  4I2A A;  4DL2 A;  4KTQ A;  9ICP A;  3TFS A;  3UMC A;  4U6P A;  4EBE A;  3K4G A;  5AKK A;  4O6A A;  4YMO A;  2AGO A;  3IRU A;  8ICE A;  2KJ9 A;  2KIC A;  4YR3 A;  2ZJ5 A;  2ZH4 A;  5HRG A;  4NLG A;  2IUB A;  4Y2X A;  3OSN A;  2XY5 A;  2BBH A;  4X0B A;  1WWV A;  3H0R B;  3GIJ A;  1KDH A;  4I27 A;  2BPC A;  3PR4 A;  4MFF A;  4OAH A;  5CJ7 A;  5B5E U;  5AIA A;  4PGQ A;  5AKJ A;  4EBD A;  2ESE A;  1SGG A;  4M9J A;  3SEI A;  1MQ2 A;  4UQG A;  9ICS A;  3M9N B;  1RQN A;  2AU0 A;  2ZIU A;  3C2M A;  3C21 A;  2UVW A;  1NI3 A;  3OVS A;  3T5L A;  3C66 A;  5A0L A;  1ZJM A;  2KV2 A;  4FH3 A;  3AUO A;  4F3O A;  4RNO A;  1RM6 C;  4RPZ A;  1S0N A;  2Y9U A;  2KSO B;  2XIC A;  3EPG A;  4B9L A;  1COO A;  1SWW A;  1N63 A;  3HKZ F;  2DRA A;  2ZUD A;  2G08 A;  4FZN A;  4J9O A;  2FDR A;  2KIV A;  5KFG A;  1U48 A;  2CXY A;  3Q8Q B;  8ICL A;  3AQL A;  2UVV A;  1DGS A;  3AQM A;  3BQ2 A;  3WFP A;  9ICJ A;  5AI0 A;  9ICQ A;  2RLT A;  4J9R A;  3GIM A;  1PK3 A;  4LT6 A;  3KZI U;  1OUQ A;  3ZDB A;  3D6J A;  4RQ1 A;  4AT9 B;  4KM5 A;  1L7O A;  4ATB A;  2ES6 A;  3LQC B;  4DSF A;  4F92 B;  4UB8 U;  2K4P A;  2KHQ A;  4UD5 A;  3WFQ E;  4NKU A;  1UT8 A;  4KLF A;  4M6W A;  4C80 A;  1Q79 A;  3OTQ A;  1TV9 A;  5J2A A;  4X4O A;  9ICM A;  3UM9 A;  3T5K A;  4MFC A;  4LZD A;  4O69 A;  1X9W A;  9ICI A;  4X4P A;  2H3V A;  1ZQZ A;  5F3X B;  3SAF A;  4M47 A;  4O3S A;  2JEJ A;  4US8 A;  2WF5 A;  1UT5 A;  3D2Q A;  4IS7 A;  4F4K A;  2MRL A;  3OVA A;  4NJ8 A;  4DL3 A;  3HJ1 A;  5HRB A;  5KFV A;  1D9F A;  2BZF A;  8ICX A;  1T8E A;  1U49 A;  4DQS A;  3QNM A;  4ECS A;  5F2V O;  2FCL A;  5J2J A;  3CRX A;  4JLZ A;  5JTI A;  2VJ5 A;  5BOL A;  3DEE A;  4RUC A;  5AM1 A;  4OJ6 A;  4DSJ A;  4E8F A;  2VA8 A;  4PJ0 U;  3QU9 A;  1L8L A;  4J9N A;  4Z6E A;  1RZT A;  1NKC A;  1C20 A;  2IBK A;  4K8V A;  4FS2 A;  2W11 A;  4NLC A;  4Q45 A;  5AK5 A;  2K4I A;  1L6N A;  3WK5 A;  4IRC A;  1OW5 A;  4PGX A;  4QNL A;  5J0T A;  9ICX A;  4PL1 A;  5D61 A;  4C4S A;  1XO1 A;  2AHO B;  3F2C A;  4DS4 A;  5AKZ A;  1KSP A;  4ED7 A;  2B21 A;  4Y2J A;  2OYY A;  5J0Q A;  2OCE A;  1OXJ A;  3V6J A;  3TAQ A;  2B56 A;  3D2N A;  5KL8 B;  3E0F A;  5ALD A;  4QZD A;  3QX7 A;  5HHH A;  5CWR A;  2R8H A;  5KFO A;  1ZQE A;  2NRK A;  1S5L U;  3LDA A;  1N62 A;  5KFL A;  4DL7 A;  5E79 U;  3AMZ A;  4DLE A;  5AIC A;  3SAH A;  9ICG A;  1A0P A;  5DQH A;  2Q66 A;  5C5J A;  2ISP A;  4X4N A;  4E7X A;  3NVO A;  7ICI A;  5KAF U;  3PR5 B;  3NAS A;  2FLN A;  3C29 A;  1T94 A;  1ZQG A;  4Y2Q A;  2EZY A;  5KT4 A;  1K1Q A;  2IHO A;  1CUK A;  3ICX A;  1S0V A;  2LKY A;  2BBJ A;  3LWL A;  4PZN A;  2O1P A;  3C1Z A;  2DWQ A;  3F5E A;  1P7D A;  2IA6 A;  3N7S C;  2KIW A;  4LJX A;  3GDX A;  3RB6 A;  4M04 A;  1XU4 A;  2E8P A;  2ZUB A;  4DCC A;  4UAY A;  4NM1 A;  3QU2 A;  5HHI A;  1FIQ A;  4QWD A;  1ZQQ A;  3HIL A;  2LHT A;  1O03 A;  3RRH A;  1XSP A;  5CRX A;  2DR7 A;  1RXW A;  2K8A A;  1SV0 C;  5D62 A;  2XCA A;  4USA A;  1V4A A;  4FH5 A;  1YZ6 A;  2AXT U;  1PVR A;  5IIL A;  3Q8M A;  2H3Q A;  4Y2R A;  4FO6 A;  1MA7 A;  5DB9 A;  5D4B A;  2A1J A;  3IM1 A;  3QUC A;  4DFJ A;  3C1Y A;  1VDV A;  1UA1 A;  4ELV A;  5J2E A;  7ICP A;  4KLD A;  4F8R A;  5KFP A;  3RB3 A;  4F91 B;  1D9D A;  4ECV A;  5AKG A;  4F50 A;  4OCZ A;  2DKZ A;  3RJH A;  4FBU A;  4ELT A;  2Y1J A;  2C2R A;  4TQS A;  4B9S A;  2O5A A;  4TUS A;  4DQI A;  1B0X A;  4RQN A;  5ALJ A;  4DFM A;  4CF4 A;  4P0Q A;  1LVH A;  5L9X A;  5KFF A;  4QWE A;  1NJZ A;  1TFY A;  4IL6 U;  5HRD A;  3WKB A;  1Q8K A;  2VA3 A;  2FMQ A;  1T4G A;  5HRL A;  2JXJ A;  3ER9 B;  5BPC A;  3UQ2 A;  5DLF A;  2P35 A;  2IMW P;  2H3I A;  3A0B U;  5JUM A;  4MF2 A;  4NXV A;  2E5S A;  8ICO A;  4C7Y A;  1QSY A;  4K9B A;  3JPT A;  1NK6 A;  1MIV A;  3GV5 B;  1WCL A;  2EH9 A;  9ICN A;  1NZB A;  2YTU A;  1S9F A;  2V9W A;  1SKR A;  2GA9 D;  3JPR A;  2ODG A;  2L5Y A;  4B9M A;  3ZD9 A;  4K99 A;  8ICN A;  3I76 A;  2NYV A;  4CE6 A;  4EBJ A;  5CP2 A;  3M9M B;  3T5J A;  4WQK A;  2H5X A;  4AT8 B;  2Y0S C;  3ISC A;  1JX4 A;  2HBM A;  1BPB A;  1FA0 A;  5B3P A;  4DL5 A;  4E0D A;  1VLB A;  2KZM A;  4C7Z A;  3SQI A;  2E1F A;  2FE9 A;  3K75 D;  2A3V A;  3QUQ A;  4QZ8 A;  3HPO A;  5ALT A;  4XQ7 A;  2W8K A;  2B0C A;  3AU2 A;  5HRK A;  5G5G A;  4QIW F;  2PFO A;  3MR5 A;  1SIJ A;  4QWC A;  4S3N A;  1J2N A;  4DSE A;  2ZG6 A;  1J97 A;  2KKV A;  4Q44 A;  5ALG A;  2WAQ C;  1SL2 A;  1Q46 A;  4Y2T A;  5KFT A;  7ICS A;  3HX0 A;  4NY8 A;  4WC4 A;  5KFR A;  3LVV A;  4IQT A;  1DRG A;  4I2J A;  4P0Q B;  9ICK A;  2HBK A;  3ZDC A;  2DBY A;  2VAN A;  1ZRM A;  1JN3 A;  1DK3 A;  1PX5 A;  1WG8 A;  4NL9 A;  4KLI A;  2KG5 A;  4RQM A;  3OJS A;  2VJ4 A;  3PO5 A;  3RH5 A;  4QW8 A;  2JV3 A;  4J03 A;  4KN4 A;  4YG2 A;  2GWS A;  5KG1 A;  1N56 A;  4EEN A;  1ZQR A;  2PI4 A;  1HJP A;  4MFA A;  5KFD A;  2MAX A;  1NK4 A;  2HDO A;  2LPE A;  1SKW A;  3FM9 A;  4P0P A;  4IQV A;  3K1Z A;  3RJF A;  1ZQW A;  3TQ1 A;  3H39 A;  2NO4 A;  5AM0 A;  1ZYQ A;  5L1M A;  1ZD3 A;  5HP4 A;  3RH6 A;  5ALO A;  4WBZ A;  4Y2V A;  4JWN A;  3FAH A;  4NXU A;  3AQK A;  5KFH A;  2CPR A;  4UW9 A;  4C4R A;  1RPL A;  3BJY A;  3C2K A;  4OJ5 A;  1L7P A;  1IIP A;  2YMP A;  4I2I A;  2ZH5 A;  4CF5 A;  2HHX A;  3G6Y A;  1RQL A;  5ALL A;  3LYS A;  5J29 A;  3E2E A;  4JK1 A;  2BCV A;  5L1L A;  4RWP A;  4FHX A;  3HT3 A;  5DGB A;  2DL0 A;  4F4W A;  4J9P A;  1PVQ A;  4Z6F A;  1ZQA A;  2YMM A;  4R8U B;  2VKQ A;  4Y2S A;  2NRW A;  3MR3 A;  5L1K A;  1VJ5 A;  3B0X A;  2RP5 A;  5AHX A;  2E1E A;  1CEZ A;  4N7R A;  2PI5 A;  2C2D A;  3MDC A;  4NKT A;  1QLN A;  5DED A;  3BDP A;  3LVW A;  5J8Y A;  5CFS A;  1DOQ A;  1U4B A;  2EZZ A;  2G0A A;  4J9S A;  3WKA A;  2W9B A;  1ZQF A;  4KN7 A;  3HIY A;  1Q78 A;  4LEW A;  4QZF A;  1RYS A;  5KFK A;  4UAU A;  3M1Y A;  3SEN A;  2IOH A;  1EXN A;  3T5H A;  5GTI U;  3RFA A;  3KKA A;  2HMX A;  1X9X A;  5KFE A;  4RT2 A;  5KFN A;  2PFN A;  5DG7 A;  9ICV A;  4Y2U A;  4MEX A;  1UQV A;  2PMZ F;  2W9A A;  4EZ6 A;  4F5Q A;  3RJE A;  4WC3 A;  1N5W A;  1JAL A;  2G09 A;  5J2D A;  1Q3V A;  2KFN A;  1BPD A;  3J81 j;  5HNK A;  3QEA Z;  4Q8E A;  5IIN A;  2W7O A;  2XID A;  2ZHB A;  3EZ5 A;  2KHV A;  4ACO A;  4ED0 A;  4Z6C A;  2F2A B;  5DB7 A;  4K9A A;  3QYP A;  2DF4 B;  5KG2 A;  3RTV A;  1QQ7 A;  1KFS A;  1R8A A;  2ZTC A;  4B6J A;  4XUS A;  4TUR A;  4XQ8 A;  5EOZ A;  3SMV A;  1PUZ A;  1MC8 A;  1YT3 A;  4GXK A;  3C5F A;  3WFR E;  4CGZ A;  1ZQP A;  2EDU A;  3HRD D;  5ALR A;  4ED2 A;  3RH4 A;  1UHU A;  2JZB B;  3NTU A;  1ZQU A;  5IIJ A;  2KE7 A;  5IIK A;  2LM1 A;  4I2H A;  3Q8K A;  2BCS A;  3L4P A;  1WYG A;  5HRH A;  1U9L A;  7ICU A;  4HX0 A;  2AGP A;  4ECY A;  4DL4 A;  2F8K A;  5F9L A;  8ICR A;  2ZH2 A;  4DQR A;  4AT9 A;  4RQ0 A;  5KFI A;  2KEY A;  3UMB A;  2IHM A;  1SZH A;  1ZET A;  4AYB C;  4F4Z A;  3OUY A;  2HHW A;  3BQ1 A;  5D49 A;  4RUA A;  4YXM A;  5ALY A;  4KLJ A;  4EV6 A;  1VFG A;  2WF9 A;  1MIY A;  4FHY A;  2KNJ A;  3PW2 A;  3ER8 C;  5ALM A;  8ICM A;  4YD1 A;  3QU7 A;  5AKY A;  4DOB A;  2BQR A;  5DBC A;  1IG6 A;  2G06 A;  2FPM A;  4QZB A;  3V6H A;  7ICJ A;  8ICI A;  4NXW A;  5EE9 A;  3SYZ A;  5DBB A;  5J2B A;  2ZJA A;  3H8S A;  3BZC A;  3GZF A;  2LYH A;  9ICO A;  5AK4 A;  2FJ6 A;  2HW3 A;  1TKD A;  5AKI A;  4DQQ A;  1B43 A;  4RPX A;  1ZQD A;  2JGA A;  4O3R A;  4KMU A;  1X40 A;  4JUZ A;  3ZI4 A;  2F77 X;  2YY6 A;  2JRZ A;  4MKP A;  4BGD A;  2FPL A;  2M0N A;  4F5P A;  1URJ A;  4JWM A;  4AP9 A;  2G5H B;  5AKL A;  3QUT A;  5EE3 A;  4YXJ A;  2A19 A;  3MC1 A;  4UB5 A;  3PX4 A;  3QE9 Y;  3SV3 A;  4JV0 A;  4K4G A;  1NJY A;  1SWV A;  8ICZ A;  2RHF A;  5ALS A;  8ICK A;  3OUY B;  3CYM A;  1FFU A;  5CA7 A;  4RT3 A;  3PW4 A;  1OU5 A;  5KG5 A;  4ZH4 A;  5DQI A;  3AM9 A;  2W3S A;  4WC0 A;  7ICF A;  9ICC A;  1TK8 A;  3Q8S B;  1S76 D;  4KLO A;  4I28 A;  2BHN A;  4R65 A;  4BWJ A;  2P6R A;  4FO1 A;  3H8W A;  4O3Q A;  3H7I A;  5L1I A;  3M7D A;  3KHH A;  3AEV A;  1BPE A;  3HKZ C;  4DEZ A;  3QU4 A;  5AI4 A;  5EWE A;  3MGH A;  2NRV A;  5J0W A;  4DFP A;  5ALQ A;  4AT7 B;  3UPQ A;  4O68 A;  2ZTE A;  4UAS A;  1O08 A;  2Y9T A;  4FFD A;  3THV A;  3H4D A;  2BCR A;  3H38 A;  2BDP A;  4X4R A;  2ASJ A;  3RJG A;  4Y2P A;  2D6F C;  4YCX A;  4I2B A;  4X4U A;  2ZIV B;  5AI5 A;  8ICY A;  3TI0 A;  4RQ5 A;  1UCV A;  5H2F U;  5ALZ A;  1NJX A;  2ZJ8 A;  9ICT A;  1BPZ A;  2XVT A;  2EAO A;  2EAP A;  3PMN A;  5J0O A;  2XCP A;  4BJQ A;  4F93 B;  1QTM A;  1ZRN A;  2KP7 A;  5AI9 A;  3IG5 A;  2E3T A;  4X4T A;  2HHT A;  5AI6 A;  4DSK A;  4EX7 A;  1UEU A;  2NRZ A;  2YX8 A;  4J9Q A;  3JYY A;  1M6Y A;  1MQ3 A;  1Z4O A;  1NK0 A;  4QWA A;  7ICH A;  3F5A A;  3TAR A;  2W03 A;  3HWT A;  3OWG A;  4UBB A;  2VIX A;  2BQ3 A;  1X6I A;  3PW7 A;  4KX5 A;  1S77 D;  4NLN A;  4DLG A;  8ICA A;  1JUD A;  1JAJ A;  2C22 A;  3VC8 A;  4X0A A;  3MGI A;  2E8O A;  4O3M A;  7ICR A;  3UMG A;  2JEI A;  2DUY A;  1F0M A;  2JH1 A;  5KFZ A;  3AQN A;  4UB3 A;  5CHE A;  3WKE A;  2Z7J A;  5J2H A;  2PBE A;  4F71 A;  3H40 A;  5DLG A;  2ZIX A;  3IG8 A;  2JMG A;  4O3O A;  1WCN A;  2XGP A;  3EW9 A;  4C8L A;  3C18 A;  3AU6 A;  1IV8 A;  4I0U A;  3RB0 A;  3HW8 A;  1L3V A;  3GIK A;  4ECU A;  4AT8 A;  5EE0 A;  2MA1 A;  3QEB Z;  3H8J A;  3ETL A;  1L7N A;  4K98 A;  9ICR A;  3UPS A;  1D8L A;  2LM4 A;  1N5X A;  2F44 A;  8ICQ A;  3OPX A;  2HOQ A;  1LV5 A;  4EBC A;  4RQ2 A;  2YB4 A;  1WOT A;  2OM6 A;  1Z00 B;  2W04 A;  2DPJ A;  1TE2 A;  1QSL A;  2ZH1 A;  2AJQ A;  2AQ0 A;  1H38 A;  2LYB A;  4EEK A;  4FS1 A;  4WC5 A;  1N48 A;  2XY7 A;  4OAF A;  4CNQ A;  1Y88 A;  3K1R B;  4G9B A;  3MFH A;  3JPS A;  3PST A;  3Q8P B;  2QAR B;  2W54 A;  4YFK A;  3NKU A;  4OJP A;  2DFL A;  2LI6 A;  3UXO A;  3AN1 A;  3QU5 A;  4IR9 A;  5KAI U;  1ZQK A;  1HEK A;  5KFB A;  1SKS A;  3RBE A;  1RXV A;  1L7M A;  2RQ5 A;  2Y0S F;  1N2X A;  2H3Z A;  8ICV A;  2PXI A;  2DKX A;  1N60 A;  4M9L A;  4I2D A;  3GV7 B;  1L3U A;  2I9G A;  2LBO A;  4IR1 A;  1ZQ1 C;  5J0R A;  1KBU A;  3V72 A;  4DO9 A;  5ALP A;  4F5N A;  5AK3 A;  4K96 A;  1DXS A;  3SI8 A;  4OAI Z;  2IHN A;  3NUQ A;  2WB1 F;  4NL9 C;  2ZIX B;  1K1S A;  1L3T A;  1WWU A;  2XI9 A;  5KT2 A;  3KHG A;  5KFC A;  1AQ6 A;  2ZIW B;  3AQF A;  2WAQ F;  4UAZ A;  1T7P A;  1S8O A;  1UPH A;  1A6S A;  4RWN A;  3QUB A;  2HHV A;  2EZX A;  4QW9 A;  2JHD A;  2PKE A;  2K89 A;  2ASD A;  8ICW A;  2XGQ A;  4Y2Y A;  1F44 A;  5ALX A;  1KL9 A;  1UET A;  4GXI A;  4X4V A;  4FBT A;  3RAX A;  2HVH A;  2FPK A;  3RBD A;  1HUZ A;  1ARO P;  2GLE A;  3ED5 A;  2KKP A;  3C28 A;  9ICW A;  2N1R A;  2WF7 A;  4ECZ A;  3FDS A;  2KOB A;  4OD0 A;  2PFP A;  2K8B B;  1WUD A;  2ISO A;  3RJK A;  4IQW A;  2K8C B;  4J9L A;  2ZTD A;  1TAU A;  3MDA A;  3NRW A;  4UAW A;  1F5A A;  2ID1 A;  4WJ3 B;  5KG6 A;  4O5K A;  3GIL A;  1NK5 A;  4UB1 A;  2ZHA A;  3QZ7 A;  3TKA A;  2W43 A;  4QZH A;  2GO7 A;  5FP0 A;  2C2E A;  2M2W A;  1J2M A;  4XA5 A;  1MN8 A;  4P4O A;  4R8U A;  3KHL A;  4K97 A;  4TUQ A;  2HVI A;  4KMO B;  1FFV A;  2CN1 A;  8ICC A;  2HBL A;  4LZG A;  4M9N A;  1KFD A;  4NXZ A;  2Q4T A;  1XC9 A;  2QB0 B;  1XO0 A;  2ZXI A;  4MEY A;  2HBJ A;  2AGQ A;  3IP4 B;  3GFK B;  9ICL A;  3RF9 A;  2B6G A;  2K4H A;  4R63 A;  4F5O A;  2R8J A;  2R8I A;  2R8K A;  5DQG A;  3O0F A;  1N61 A;  3JPQ A;  5B3Q A;  5J8Y C;  5DDM A;  2P6U A;  8ICB A;  2BE3 A;  2KVS A;  4EED A;  2YML A;  2YB1 A;  2BGW A;  2KFZ A;  5HR6 A;  3H8M A;  3HJ4 A;  4FE3 A;  4FZM A;  2MUT B;  2XO7 A;  5DB8 A;  4BDP A;  2JEF A;  3EF2 A;  5HR9 A;  2OH2 A;  3KKA C;  4DFK A;  1JXL A;  4DS5 A;  3PV8 A;  2YN4 A;  4RU9 A;  1CRX A;  3NVZ A;  4JB3 A;  4KLM A;  3OSP A;  1TK5 A;  4YMM A;  4DOA A;  1ZJN A;  2H3F A;  4C4T A;  2WF8 A;  2E8M A;  1DK2 A;  5HC9 A;  4JMU A;  4IQU A;  2D3D A;  4ED1 A;  5KTQ A;  5EE1 A;  4YQW A;  1QQ6 A;  5AM4 A;  4QZC A;  9ICE A;  3PX6 A;  1UEV A;  4I2G A;  3GV8 B;  1JQR A;  7ICE A;  1KFT A;  2JZB A;  2ZXH A;  4O0I A;  4IC9 A;  2RDJ A;  2IOF A;  2F1J A;  5KFJ A;  4ECX A;  1YZ7 A;  1XWL A;  3EYZ A;  3G6X A;  3PW0 A;  4QJF B;  4IRD A;  3NVW A;  1LKY A;  8ICT A;  1T3Q A;  3WK6 A;  3WK9 A;  4C0Z A;  4US9 A;  3H0L B;  3Q8L A;  2FLL A;  2DGZ A;  1SB3 C;  4UBC A;  2KVC A;  2DRB A;  2MSN A;  2YQE A;  4NXT A;  3UXN A;  4Q8F A;  4C8N A;  4QZE A;  4LVS A;  4C8M A;  4RQ3 A;  5KT3 A;  2QKQ A;  3PHZ A;  5ALI A;  2E8N A;  3N4M B;  4FHW A;  2DPI A;  2BR0 A;  4YVZ A;  2RFF A;  4KLT A;  4IRK A;  1ZQX A;  3JPN A;  4KLG A;  1PK1 B;  2WHE A;  2FLP A;  2W7P A;  5HML A;  2J6T A;  3C23 A;  4M2Y A;  4WH5 A;  4UAR A;  5JU5 A;  2JEG A;  2F3N A;  2BKE A;  2ALZ A;  3IV6 A;  4KLL A;  3PML A;  4HAI A;  2HN1 A;  1FEZ A;  4O5E A;  4ELU A;  3MBY A;  1KQQ A;  4AYB F;  4DWI A;  3M6K A;  3BS7 A;  1KN5 A;  3BS5 B;  1HUO A;  2HSZ A;  3WU2 U;  4GC7 A;  1K5O A;  3EWA A;  3N7P D;  2PFQ A;  4I29 A;  2BCQ A;  2A1A A;  1GPJ A;  4DQP A;  4ECT A;  3ORY A;  3B9J A;  1ZQM A;  4LEY A;  1ECW A;  3MFI A;  5CHG A;  1V85 A;  7ICQ A;  2BPG A;  4GIB A;  5CB1 A;  3TAD A;  1JIH A;  4YMN A;  4M5D A;  1L5U A;  1S0M A;  3NYB A;  7ICG A;  7ICK A;  1ZQI A;  2KJ8 A;  5D46 A;  2J6S A;  1X42 A;  5J0S A;  1LKY B;  3MR2 A;  4UB4 A;  1NNL A;  3ALR A;  2RRD A;  5KFS A;  5KG3 A;  2HOI A;  4PHD A;  2OXO A;  3SZ2 A;  1NJW A;  3C2L A;  4DFD A;  4QZ9 A;  2I6X A;  4C8O A;  2OEH A;  5EWF A;  3PO4 A;  4M0A A;  2F1H A;  5AKX A;  2J6U A;  8ICH A;  9ICB A;  5KT6 A;  3RRG A;  5HRE A;  5G5H A;  4YR2 A;  1BNP A;  4HYK A;  3G6V A;  5DGA A;  3BQ7 A;  3OJU A;  2W9C B;  4GLX A;  5KT7 A;  4C8K A;  4AT7 A;  3L3F X;  2KN7 A;  1NK7 A;  4RWO A;  1V97 A;  4RQ6 A;  4B9U A;  4XJE A;  1JI7 A;  2G5I B;  7ICT A;  4LEZ A;  4NLZ A;  4O3N A;  1XSL A;  3PW5 A;  3TAN A;  5J0U A;  4PHE A;  4PHP A;  3GII A;  5J2I A;  1T3N A;  4TQR A;  4DSL A;  4EEB A;  2ZIV A;  4F2R A;  4J9M A;  4RQ8 A;  4KLE A;  2BCU A;  1ZD5 A;  3RB4 A;  2R18 A;  1KKX A;  5AM2 A;  4RZR A;  2FI1 A;  5DB6 A;  2EAN A;  4KLQ A;  3FYH A;  2D8C A;  3CNH A;  1L8O A;  3NWI A;  5J2G A;  1Z1V A;  4UAT A;  4ZOH C;  1ZQS A;  2EWR A;  9ICU A;  1PVP A;  4WC6 A;  1R8B A;  1S10 A;  5AM5 A;  5F9N A;  5J0P A;  1VJ7 A;  4I2E A;  1KNY A;  4NWI A;  2HOF A;  3NS1 A;  1ZQB A;  5KG7 A;  3U26 A;  3NVY A;  3FC4 A;  4KLS A;  3MAB A;  3ISB A;  3DDH A;  4WC7 A;  3M8S A;  4ED8 A;  1A77 A;  3PX0 A;  5ALW A;  3V7K A;  3OGU A;  3TFR A;  4ED3 A;  4GC6 A;  4QZA A;  3EUB 2;  1SXD A;  1S0O A;  3UXP A;  5AKE A;  1RYR A;  4WBY A;  5KFY A;  4BUG A;  4XRH A;  3PSF A;  5CR0 A;  3H0M B;  1Z4N A;  2V4R A;  3IN5 A;  5B66 U;  1SXE A;  4F4X A;  9ICF A;  2ZIU B;  4FHP A;  5KG4 A;  3RR8 A;  3KHR A;  1IXR A;  1ZQO A;  3ZDA A;  4JLX A;  4GFJ A;  8ICG A;  4G3I A;  3LK9 A;  4PL2 A;  3ETR A;  2AQ4 A;  4PGY A;  3OHB A;  4YR0 A;  5CFT A;  1Z00 A;  4ED6 A;  3CP8 A;  1Z3E B;  2EQY A;  4P2H A;  1R89 A;  5DDY A;  2F8L A;  1ZQC A;  4K4H A;  3GQC A;  3WK4 A;  5DEC A;  1X9S A;  5CEH A;  2QAR A;  5J0Y A;  4EYH B;  2ZH6 A;  3BZK A;  7ICN A;  3WFO A;  5KFX A;  1NK9 A;  4M9G A;  4ATB B;  4RQ7 A;  4NLK A;  4BX9 C;  1X9M A;  1NKE A;  5IIM A;  1LB2 B;  4PZO A;  1PZN A;  3LWM A;  3OHA A;  3RJJ A;  7ICO A;  3PY8 A;  3KBB A;  2K60 A;  4M6W B;  8ICJ A;  2HHQ A;  3WK8 A;  3JPO A;  1D8B A;  1KLN A;  1ZQN A;  4O9M A;  2Y1I A;  4FHV A;  2VA2 A;  2QB1 A;  1KEJ A;  5KFQ A;  4CCH A;  3PNC A;  3CW2 C;  4RNM A;  1BPY A;  2KZ3 A;  3N28 A;  1TFW A;  2WTF A;  2RDI A;  4YN4 A;  3S6J A;  3VCB A;  3N97 B;  2ZIW A;  1KW4 A;  4EGW A;  1Z19 A;  2HHS A;  3MR6 A;  4QZI A;  2B4V A;  4KLU A;  4DL6 A;  3SR6 A;  4ECW A;  2GOL A;  4EBK A;  5TIS U;  3H3A A;  2M9N A;  2JH7 A;  4BWM A;  1TAM A;  2XC9 A;  3PZP A;  1C7Y A;  3KFU F;  2W9M A;  4DF8 A;  2M2U A;  4CDG A;  2BDU A;  2LYA A;  5ALF A;  1QH9 A;  5K4L A;  4RPY A;  2V4Q A;  5KT5 A;  2HHP A;  3ZD8 A;  3L9D A;  3M9O B;  2O6K A;  2I5H A;  2ZH7 A;  5EWG A;  4O3P A;  2UVR A;  2HHU A;  4F5R A;  4I2C A;  5AIB A;  1U45 A;  3WKC A;  1TFR A;  3KTQ A;  3D2S A;  1ED1 A;  2QB0 A;  4EEL A;  2F76 X;  5J0X A;  4UD4 A;  3JZ0 A;  1SZP A;  2IOF K;  2WFA A;  1KRP A;  2KD1 A;  1X2I A;  2KMD A;  4MHV A;  3UQ0 A;  3WFS C;  1SL0 A;  2QLT A;  4F4Y A;  3T79 A;  3V7L A;  5KFM A;  1R8C A;  3RR7 A;  5AI8 A;  3PSP A;  1ZQY A;  1ZQV A;  5DBA A;  5BOM A;  1ZD2 P;  5AM3 A;  2NO5 A;  3BQ0 A;  4EYI B;  4ECQ A;  4J9K A;  4OJO A;  5HR7 A;  1X66 A;  1UA0 A;  3M8R A;  1NO5 A;  3IHQ B;  5DG8 A;  3JCF A;  3TAP A;  1HIW A;  2FMS A;  1SV0 A;  5L1J A;  4KB6 A;  3A0H U;  4X4S A;  4P4M A;  1U47 A;  2R8G A;  1B4F A;  2MUT A;  4WOY A;  4E80 A;  1TK0 A;  5D63 A;  2DR9 A;  3WK7 A;  2W8L A;  4X5V A;  1D8Y A;  2G07 A;  2I1Q A;  5AKH A;  2K4E A;  4KLH A;  4B9N A;  3RAQ A;  4IG8 A;  4DSI A;  5ALE A;  5IIO A;  1IM4 A;  4R64 A;  2A1J B;  3KD3 A;  3Q8R B;  4UB6 U;  2WB1 C;  4UB2 A;  4PPX A;  2YMQ A;  2F1I A;  1Z1B A;  1KTQ A;  5J2F A;  2GAF D;  4P4P A;  4TUP A;  3F53 A;  3WKD A;  2OWO A;  3TAC B;  1JXE A;  4QWB A;  1XNS A;  1DGJ A;  2ZH3 A;  1TVA A;  2M2V A;  5JTG A;  3ISD A;  3ERC C;  1CI4 A;  9ICH A;  3QXG A;  4Z6D A;  4EP7 A;  4BXO A;  1ZQH A;  1RYU A;  4A8E A;  4QIW C;  8ICU A;  4R66 A;  4NV0 A;  1QQ5 A;  1ZXI A;  5III A;  2ZH8 A;  4X4Q A;  1A76 A;  5T14 A;  3KOO A;  3V7J A;  3V6K A;  4PHA A;  2LMR A;  2NV3 A;  4EZ9 A;  1F5S A;  3C5G A;  4O67 A;  4F2S A;  4OAG A;  3MCR A;  4NM2 A;  3T3F A;  2BPF A;  4CF3 A;  2BQU A;  4RWQ A;  3OV7 A;  2DR8 A;  2P66 A;  1Q3U A; 
#chains in the Genus database with same CATH homology
 5D46 A;  2J6S A;  3RJH A;  4ELT A;  2Y1J A;  4EEY A;  4FBU A;  3THV A;  3H4D A;  2C2R A;  2BCR A;  3H38 A;  2BDP A;  4TQS A;  5J0S A;  4B9S A;  5HRI A;  4TUS A;  4DQI A;  1MSW D;  2O5A A;  4DFM A;  3MR2 A;  5DKW A;  4UB4 A;  5L9X A;  4WC1 A;  5KFF A;  4QWE A;  1NJZ A;  4WC2 A;  2ASJ A;  4X4R A;  1TFY A;  3RJI A;  3RJG A;  5KFS A;  1L3S A;  5KG3 A;  5HRD A;  4DOC A;  4M9H A;  1BNO A;  3QZ8 A;  2VA3 A;  4YCX A;  2FMQ A;  4I2B A;  2NRX A;  1T4G A;  5KFA A;  4PHD A;  1TAQ A;  4RNN A;  4GXJ A;  3SZ2 A;  1NJW A;  1SL1 A;  5HRL A;  4X4U A;  5BPC A;  3C2L A;  3UQ2 A;  5DLF A;  8ICY A;  3TI0 A;  4QZ9 A;  4RQ5 A;  2IMW P;  5JUM A;  4C8O A;  1NJX A;  3BQT A;  2ZJ8 A;  4MF2 A;  5EWF A;  4WCW A;  3PO4 A;  4M0A A;  9ICT A;  2F1H A;  8ICH A;  2J6U A;  1BPZ A;  8ICO A;  9ICB A;  5KT6 A;  8ICF A;  1QSY A;  3PMN A;  5J0O A;  4YD2 A;  2XCP A;  4F93 B;  3JPT A;  1NK6 A;  3RRG A;  5HRE A;  1MIV A;  4YR2 A;  1QTM A;  4HYK A;  1BNP A;  3GV5 B;  1WCL A;  4RQ4 A;  2KP7 A;  3G6V A;  9ICN A;  5DGA A;  3OJU A;  1S9F A;  5HMM A;  2W9C B;  4GLX A;  2V9W A;  1XSN A;  1SKR A;  5KT7 A;  2HHT A;  4X4T A;  3JPR A;  8ICS A;  4DSK A;  2C28 A;  4B9M A;  3ZDD A;  3ZD9 A;  4C8K A;  4AT7 A;  8ICN A;  1UEU A;  4EBJ A;  2NRZ A;  8ICP A;  2KN7 A;  5CP2 A;  3M9M B;  4J9Q A;  3T5J A;  2Q0Z X;  1NK7 A;  1MQ3 A;  1NK0 A;  3JYY A;  2H5X A;  3OVB A;  4QWA A;  4AT8 B;  4YP3 A;  7ICH A;  1S97 A;  3ISC A;  4RQ6 A;  1JX4 A;  4BXO B;  1BPX A;  4B9U A;  1BPB A;  1FA0 A;  1ZQJ A;  4DL5 A;  2ZUC A;  4E0D A;  1NK8 A;  2ZH9 A;  2KZM A;  7ICT A;  3K75 D;  3TAR A;  4MF8 A;  5HRF A;  4NLZ A;  3HWT A;  4QZ8 A;  1BGX T;  4O3N A;  4UBB A;  2ATL A;  1XSL A;  3PW5 A;  3TAN A;  2BQ3 A;  5J0U A;  3HPO A;  2UVU A;  4RWO A;  4XQ7 A;  4PHE A;  2W8K A;  3PW7 A;  4PHP A;  3GII A;  5J2I A;  1S77 D;  1NZP A;  4NLN A;  3AU2 A;  4DLG A;  1T3N A;  8ICA A;  5HRK A;  4TQR A;  1JAJ A;  2C22 A;  4DSL A;  4PH5 A;  5DG9 A;  2PFO A;  4F2R A;  4J9M A;  4RQ8 A;  4X0A A;  3MR5 A;  3MGI A;  4KLE A;  2BCU A;  7ICR A;  4QWC A;  4S3N A;  5J2C A;  3RB4 A;  2JEI A;  4DSE A;  5KFZ A;  3AQN A;  4UB3 A;  4Q44 A;  4RZR A;  5DB6 A;  4KLQ A;  3FYH A;  5J2H A;  1SL2 A;  3H40 A;  3H4B A;  5KFT A;  5J2G A;  7ICP A;  2PBE A;  7ICS A;  5DLG A;  5J2K A;  3HX0 A;  1ZQS A;  4NY8 A;  4WC4 A;  5KFR A;  4O3O A;  4B9T A;  4JV2 A;  9ICU A;  4IQT A;  1WCN A;  4I2J A;  2W9C A;  2XGP A;  3EW9 A;  9ICK A;  4WC6 A;  4Q43 A;  1NKB A;  3ZDC A;  4C8L A;  1R8B A;  1QSS A;  3C18 A;  1S10 A;  5F9N A;  2VAN A;  3AU6 A;  5KG0 A;  1JN3 A;  5J0P A;  1DK3 A;  4I2E A;  1PX5 A;  4ECR A;  1KNY A;  1VJ7 A;  2M2T A;  3RB0 A;  4O5C A;  3HW8 A;  1L3V A;  4KLI A;  3GIK A;  4ECU A;  7ICM A;  4AT8 A;  3QEB Z;  3H8J A;  3ETL A;  1BVS A;  3OJS A;  2KZZ A;  3EPI A;  9ICR A;  1B22 A;  1ZQB A;  5KG7 A;  1JMS A;  3RH5 A;  1D8L A;  4QW8 A;  4KIT B;  1ZQT A;  3PO5 A;  9ICA A;  1YLQ A;  8ICQ A;  2NRT A;  3JPP A;  4KLS A;  4KN4 A;  3MAB A;  4YG2 A;  1MIW A;  1V9P A;  3ISB A;  2GWS A;  4WC7 A;  1LV5 A;  5KG1 A;  4EBC A;  4RQ2 A;  3M8S A;  4I2F A;  1WOT A;  1N56 A;  1ZQR A;  2PI4 A;  1Z00 B;  2DPJ A;  4ED8 A;  1A77 A;  3PX0 A;  1HJP A;  1QSL A;  4MFA A;  3V7K A;  2AJQ A;  2ZH1 A;  3OGU A;  3TFR A;  3HP6 A;  5KFD A;  2AQ0 A;  2MAX A;  4ED3 A;  1NK4 A;  1H38 A;  3H37 A;  4GC6 A;  4FS1 A;  3NGD A;  1SKW A;  4B9V A;  4QZA A;  1N48 A;  4IQV A;  2KTQ A;  4WC5 A;  2DR5 A;  2XY7 A;  1XS9 D;  3RJF A;  1Y88 A;  1ZQW A;  3TQ1 A;  1S0O A;  7ICL A;  3UXP A;  3MFH A;  3PVX A;  3H39 A;  3JPS A;  2XY6 A;  3Q8P B;  4DF4 A;  3ZDE A;  1ZYQ A;  4YFK A;  1RYR A;  4WBY A;  5KFY A;  4JV1 A;  2DFL A;  4XRH A;  5HP4 A;  5CR0 A;  3UXO A;  3RH6 A;  2FMP A;  4WBZ A;  5TZV A;  4IR9 A;  5KFU A;  3SV4 A;  5KFW A;  2V4R A;  2ASL A;  1ZQK A;  4JWN A;  5KFB A;  1SKS A;  3AQK A;  5KFH A;  4F4X A;  3RBE A;  1RXV A;  9ICF A;  7ICV A;  1RPL A;  4FHP A;  4QZG A;  8ICV A;  2W9B B;  2PXI A;  3B0Y A;  3BJY A;  3C2K A;  1NOM A;  4K4I A;  5KG4 A;  1ZQL A;  4M9L A;  4I2D A;  3GV7 B;  1L3U A;  3RR8 A;  2I9G A;  3KHR A;  1IXR A;  4I2I A;  4IR1 A;  2DVI A;  4I2A A;  5J0R A;  4DL2 A;  1ZQO A;  3ZDA A;  4KTQ A;  9ICP A;  2ZH5 A;  8ICG A;  3V72 A;  4DO9 A;  3TFS A;  2HHX A;  3G6Y A;  4F5N A;  4G3I A;  3LK9 A;  4EBE A;  2AQ4 A;  5J29 A;  3E2E A;  3K4G A;  4JK1 A;  4PGY A;  3OHB A;  5L1L A;  4YMO A;  4YR0 A;  3SI8 A;  2AGO A;  2BCV A;  4RWP A;  8ICE A;  4FHX A;  3HT3 A;  5DGB A;  2IHN A;  1Z00 A;  4ED6 A;  4F4W A;  4YR3 A;  1K1S A;  1Z3E B;  2ZJ5 A;  4J9P A;  1L3T A;  2ZH4 A;  4P2H A;  4Z6F A;  5HRG A;  1JQR A;  5DDY A;  1R89 A;  5KT2 A;  3KHG A;  5KFC A;  1ZQC A;  3OSN A;  3GQC A;  4K4H A;  4NLG A;  2XY5 A;  5DEC A;  1ZQA A;  4R8U B;  4X0B A;  3GIJ A;  1KDH A;  4UAZ A;  3MR3 A;  2NRW A;  1X9S A;  1T7P A;  5L1K A;  4I27 A;  4RWN A;  2BPC A;  3PR4 A;  4MFF A;  2HHV A;  5J0Y A;  5CJ7 A;  4QW9 A;  3B0X A;  4EYH B;  2ZH6 A;  1CEZ A;  4PGQ A;  2ASD A;  7ICN A;  2XGQ A;  2PI5 A;  4EBD A;  8ICW A;  3WFO A;  2C2D A;  5KFX A;  4M9J A;  3MDC A;  1NK9 A;  1QLN A;  4NKT A;  3BDP A;  4M9G A;  1MQ2 A;  1UET A;  4RQ7 A;  4GXI A;  5DED A;  4ATB B;  4X4V A;  4UQG A;  9ICS A;  3M9N B;  4NLK A;  4FBT A;  1DOQ A;  3RAX A;  2AU0 A;  1U4B A;  1X9M A;  2HVH A;  2FPK A;  4J9S A;  5IIM A;  1NKE A;  3C2M A;  3C21 A;  1ARO P;  3RBD A;  2W9B A;  1LB2 B;  1HUZ A;  2UVW A;  1ZQF A;  1PZN A;  9ICW A;  4ECZ A;  4KN7 A;  3HIY A;  3FDS A;  3LWM A;  3T5L A;  3OHA A;  1Q78 A;  3C66 A;  1ZJM A;  3OVS A;  2PFP A;  4QZF A;  3RJJ A;  7ICO A;  3PY8 A;  4FH3 A;  3AUO A;  4M6W B;  4F3O A;  1RYS A;  8ICJ A;  4RNO A;  5KFK A;  4RPZ A;  2ISO A;  1S0N A;  3RJK A;  2HHQ A;  3JPO A;  4IQW A;  3EPG A;  4B9L A;  4J9L A;  2ZTD A;  1ZQN A;  2Y1I A;  1KLN A;  3MDA A;  1COO A;  2VA2 A;  4O9M A;  1EXN A;  3T5H A;  1TAU A;  4UAW A;  1F5A A;  2DRA A;  2ID1 A;  1KEJ A;  2ZUD A;  5KG6 A;  4J9O A;  5KFQ A;  4CCH A;  4O5K A;  3GIL A;  1NK5 A;  3PNC A;  4RNM A;  1BPY A;  5KFE A;  4RT2 A;  4UB1 A;  5KFG A;  5KFN A;  2KZ3 A;  2ZHA A;  3QZ7 A;  1U48 A;  5DG7 A;  2PFN A;  9ICV A;  3Q8Q B;  1TFW A;  4QZH A;  2WTF A;  2RDI A;  8ICL A;  4MEX A;  3AQL A;  2C2E A;  2UVV A;  2M2W A;  1DGS A;  4XA5 A;  4YN4 A;  3N97 B;  4P4O A;  4R8U A;  3KHL A;  3BQ2 A;  2W9A A;  9ICJ A;  4EZ6 A;  4TUQ A;  4F5Q A;  3RJE A;  2HVI A;  3WFP A;  4WC3 A;  5J2D A;  9ICQ A;  2KFN A;  8ICC A;  2HHS A;  1BPD A;  4LZG A;  4J9R A;  3MR6 A;  5HNK A;  3QEA Z;  4QZI A;  4M9N A;  1KFD A;  3GIM A;  5IIN A;  4KLU A;  4NXZ A;  4Q8E A;  1XC9 A;  4DL6 A;  4LT6 A;  3ZDB A;  2ZHB A;  4RQ1 A;  3EZ5 A;  4AT9 B;  4ECW A;  4EBK A;  7ICK A;  4ATB A;  4MEY A;  4ED0 A;  3H3A A;  4KLD A;  3LQC B;  2M9N A;  2AGQ A;  4BWM A;  4DSF A;  4F92 B;  3GFK B;  4Z6C A;  2XC9 A;  9ICL A;  1C7Y A;  4UD5 A;  5DB7 A;  3WFQ E;  4NKU A;  5KG2 A;  2W9M A;  4DF8 A;  1UT8 A;  3RTV A;  4R63 A;  4F5O A;  2R8J A;  4KLF A;  4M6W A;  2R8I A;  2R8K A;  5DQG A;  2M2U A;  1TV9 A;  5J2A A;  1KFS A;  2ZTC A;  1Q79 A;  1R8A A;  4XUS A;  4TUR A;  4X4O A;  9ICM A;  3T5K A;  4XQ8 A;  3JPQ A;  5EOZ A;  4MFC A;  4LZD A;  1MC8 A;  5DDM A;  2P6U A;  4GXK A;  8ICB A;  3C5F A;  3WFR E;  4RPY A;  2BE3 A;  2V4Q A;  5KT5 A;  1X9W A;  1ZQP A;  9ICI A;  2HHP A;  3ZD8 A;  4X4P A;  3L9D A;  3M9O B;  1ZQZ A;  4ED2 A;  3RH4 A;  2ZH7 A;  5EWG A;  2JZB B;  4O3P A;  4M47 A;  2UVR A;  2HHU A;  2BGW A;  3NTU A;  2KFZ A;  1ZQU A;  5IIJ A;  4O3S A;  5IIK A;  2JEJ A;  4I2H A;  3HJ4 A;  1UT5 A;  3Q8K A;  2BCS A;  4F4K A;  4F5R A;  4I2C A;  5HRH A;  3OVA A;  1U9L A;  7ICU A;  2AGP A;  4DL3 A;  2MUT B;  2XO7 A;  5DB8 A;  4BDP A;  2JEF A;  3HJ1 A;  1U45 A;  5HRB A;  5HR9 A;  4ECY A;  1TFR A;  4DL4 A;  3KTQ A;  5KFV A;  1D9F A;  4DFK A;  8ICX A;  1JXL A;  1T8E A;  1U49 A;  5F9L A;  4DQS A;  8ICR A;  4DS5 A;  4ECS A;  3PV8 A;  4DQR A;  4AT9 A;  5J0X A;  2ZH2 A;  5F2V O;  4RU9 A;  4RQ0 A;  4UD4 A;  3JZ0 A;  1SZP A;  5J2J A;  1NO5 A;  5KFI A;  1KRP A;  4KLM A;  1X2I A;  3OSP A;  1TK5 A;  2IHM A;  4YMM A;  5BOL A;  1ZET A;  4RUC A;  4DOA A;  3UQ0 A;  1ZJN A;  3WFS C;  4F4Z A;  3OUY A;  1SL0 A;  2HHW A;  1DK2 A;  4F4Y A;  3BQ1 A;  3V7L A;  5KFM A;  5HC9 A;  5D49 A;  4IQU A;  4DSJ A;  1R8C A;  4E8F A;  2VA8 A;  4RUA A;  4ED1 A;  5KTQ A;  3RR7 A;  4J9N A;  4YXM A;  4Z6E A;  4YQW A;  1RZT A;  1NKC A;  4KLJ A;  4QZC A;  1VFG A;  9ICE A;  1MIY A;  4FHY A;  1ZQY A;  1ZQV A;  3PW2 A;  2IBK A;  5DBA A;  4FS2 A;  3PX6 A;  5BOM A;  4YD1 A;  8ICM A;  4Q45 A;  4EYI B;  4ECQ A;  3BQ0 A;  4J9K A;  4DOB A;  2BQR A;  4IRC A;  5DBC A;  1UEV A;  4PGX A;  3GV8 B;  1UA0 A;  5J0T A;  3M8R A;  3IHQ B;  4I2G A;  7ICE A;  2JZB A;  5DG8 A;  9ICX A;  1KFT A;  2FPM A;  4QZB A;  4O0I A;  1XO1 A;  3V6H A;  3TAP A;  7ICJ A;  2FMS A;  8ICI A;  2RDJ A;  5L1J A;  4DS4 A;  2F1J A;  3SYZ A;  4X4S A;  4P4M A;  1KSP A;  5KFJ A;  4ED7 A;  1U47 A;  5DBB A;  2R8G A;  2B21 A;  5J2B A;  2ZJA A;  4ECX A;  2MUT A;  4E80 A;  5J0Q A;  3H8S A;  1XWL A;  1TK0 A;  3EYZ A;  3G6X A;  2DR9 A;  2LYH A;  3PW0 A;  9ICO A;  3V6J A;  2W8L A;  3TAQ A;  4X5V A;  1D8Y A;  2HW3 A;  2I1Q A;  4IRD A;  1TKD A;  4KLH A;  4DQQ A;  4B9N A;  4QZD A;  1B43 A;  4RPX A;  3RAQ A;  8ICT A;  4IG8 A;  4DSI A;  5CWR A;  5HHH A;  2R8H A;  1ZQD A;  4O3R A;  4KMU A;  4JUZ A;  5IIO A;  3UPS A;  5KFO A;  1ZQE A;  2NRK A;  1IM4 A;  3Q8L A;  3LDA A;  2FLL A;  1ZQI A;  5KFL A;  4R64 A;  4DL7 A;  4DLE A;  4BGD A;  2FPL A;  4UBC A;  2A1J B;  4F5P A;  9ICG A;  4JWM A;  5DQH A;  2DRB A;  2Q66 A;  5C5J A;  3Q8R B;  2ISP A;  3UXN A;  3AQM A;  4X4N A;  4E7X A;  7ICI A;  4Q8F A;  4C8N A;  4YXJ A;  4QZE A;  4LVS A;  4UB2 A;  4PPX A;  4C8M A;  2F1I A;  3PR5 B;  2FLN A;  4RQ3 A;  5KT3 A;  1ZQG A;  1KTQ A;  5J2F A;  5KT4 A;  3N4M B;  1K1Q A;  4P4P A;  4TUP A;  4FHV A;  1CUK A;  4FHW A;  2DPI A;  2BR0 A;  2OWO A;  4YVZ A;  4UB5 A;  3PX4 A;  3QE9 Y;  1JXE A;  3SV3 A;  4JV0 A;  4IRK A;  4KLT A;  1ZQX A;  4QWB A;  3JPN A;  4KLG A;  4K4G A;  1S0V A;  2ZH3 A;  2FLP A;  1NJY A;  3LWL A;  8ICZ A;  2O1P A;  3C1Z A;  5HML A;  2J6T A;  2RFF A;  2IA6 A;  3C23 A;  4M2Y A;  8ICK A;  3OUY B;  1TVA A;  3GDX A;  3RB6 A;  2JEG A;  4M04 A;  1XU4 A;  2ZUB A;  4UAY A;  2M2V A;  5CA7 A;  3ISD A;  4RT3 A;  3PW4 A;  9ICH A;  2BKE A;  2ALZ A;  1OU5 A;  4NM1 A;  4Z6D A;  5KG5 A;  4ZH4 A;  5DQI A;  5HHI A;  4KLL A;  3PML A;  4WC0 A;  4EP7 A;  7ICF A;  4QWD A;  9ICC A;  1TK8 A;  4O5E A;  4ELU A;  3Q8S B;  4BXO A;  1ZQQ A;  4KLO A;  3MBY A;  1ZQH A;  1S76 D;  3RRH A;  4DWI A;  2BHN A;  1XSP A;  4I28 A;  4R66 A;  1RXW A;  1HUO A;  4R65 A;  8ICU A;  2DR7 A;  4BWJ A;  2P6R A;  5III A;  4GC7 A;  3EWA A;  2XCA A;  1V4A A;  4FH5 A;  2ZH8 A;  3H8W A;  2PFQ A;  4I29 A;  4O3Q A;  3H7I A;  1A76 A;  5L1I A;  2BCQ A;  5IIL A;  3Q8M A;  4DQP A;  4X4Q A;  3KHH A;  4ECT A;  3ORY A;  3V7J A;  4FO6 A;  3V6K A;  1ZQM A;  1BPE A;  5CHG A;  4PHA A;  5DB9 A;  4DEZ A;  2A1J A;  3MFI A;  5D4B A;  3IM1 A;  4EZ9 A;  5EWE A;  3MGH A;  2NRV A;  3C5G A;  7ICQ A;  4DFJ A;  2BPG A;  4F2S A;  5CB1 A;  5J0W A;  3C1Y A;  1UA1 A;  4ELV A;  5J2E A;  4DFP A;  1JIH A;  4NM2 A;  4F8R A;  5KFP A;  3T3F A;  4F91 B;  3RB3 A;  2BPF A;  4YMN A;  1D9D A;  4ECV A;  4M5D A;  4AT7 B;  2BQU A;  1L5U A;  4RWQ A;  3OV7 A;  2DR8 A;  1S0M A;  3UPQ A;  4F50 A;  2P66 A;  7ICG A;  3NYB A;  2ZTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...