4UB6O

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 54
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4ub6O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4ub6O02
3JCUO 3WU2O 5B5EO 4IL6O 4UB8O 3A0BO 5KAFO 2AXTO 5GTHO 5G3AA 5G38A 4UB6O 5G39A 5KAIO 4PJ0O 5B66O 5GTIO 5E79O 1S5LO 5TISO 3KZIO 5H2FO 3A0HO
chains in the Genus database with same CATH superfamily
3DA3A 1OSMA 2MHLA 2XE2A 3JCUO 4O49A 4D5UA 4KR4A 3AA6A 4AUIA 2WJQA 5B5EO 1ORMA 4N58A 4GCSA 4PR7A 4AYDC 4UB8O 4KR8A 4E1SA 2W81C 4GHBA 4FT6A 1GFOA 3AA0A 3AA1B 2K0LA 1YS5A 2QTKA 1ZHTA 4GF4A 4AKMA 4FZNA 5DL7A 4C69X 2J1NA 2ODJA 2XTRA 2X27X 3PORA 5G38A 2M06A 4GCPA 2R8AA 3HW9A 5PRNA 2R88A 2MNHA 3KVDD 3T24A 3VY8X 2YPVA 5AFUK 3K19A 2ERVA 3NSGA 3LK2A 3O0EA 5GTIO 4O4XA 5E79O 4F4BA 5T5FA 3QRCA 3VE2A 3NJTA 2ZLDA 1G90A 2F1TA 4FRXA 4D65A 5H2FO 3A0HO 3A2SX 2KDYA 3T20A 3AAEA 4LSFA 6PRNA 1HXXA 3AAAB 3WU2O 5GV0A 8PRNA 3HOLA 4LSEA 3UU2A 1GFQA 4O4UA 4O3ZA 4AZLA 3SZVA 3VE1A 4FUVA 4N75A 3BRZA 4FZMA 3SYBA 4FZLA 2AXTO 4FMSA 3PGUA 3PQUA 3JTYA 2KC0A 2WJRA 3PGSA 3V8UA 4C4VA 5DL5A 3DA4A 4CTDA 5IYUA 3AA7B 1E54A 3SYSA 4RLCA 4UB6O 5G39A 4AYID 4LSHA 3C5OA 2Y7SA 5KAIO 4FOZA 5JDPA 4N59A 3DWOX 3POQA 4N74A 3AA6B 3WI5A 1OPFA 3BS0A 3SY9A 4D64A 2IWWA 2KZ7A 4AKRA 3LK3B 4BUMX 3AA0B 2M07A 5EE2A 3SZDA 1BH3A 2XE1A 4G76A 2KXPB 5ADXL 3GP6A 3UPGA 5G26A 2X9KA 1Q9GA 3A0BO 4PUXA 7PRNA 1H6S1 2IWVA 2N2LA 3QRAA 3AAAA 4FSPA 1IZNB 4K3BA 1HXTA 1QJPA 2PRNA 3VZUX 5D5DA 5GTHO 1GFPA 2F1CX 4XNLA 2R4PA 1BXWA 2FGRA 5G3AA 2ZFGA 3LK2B 1ZHZA 3AA1A 4AYMC 2W80C 1ZHXA 3G7GA 3VZTX 4PJ0O 1ZHWA 5B66O 4AYEC 4RJXA 3FYXA 1T16A 2LHFA 2XMXA 3AA7A 4QQ1A 1S5LO 2Y0LA 3DWNA 5AFUL 2J4UP 3TZGA 3WI4A 5TISO 4B61A 5DL6A 2XE5A 2JQYA 2OMFA 2GE4A 1Q9FA 1PRNA 2N2MA 4Z3TA 5ADXK 3SY7A 2Y0HA 1GFNA 4FESA 3LK41 4O3YA 2Y2XA 3UAQA 4IL6O 3LK3A 1GFMA 3VZWX 4GCQA 4C4VB 4C00A 2O4VA 2R4NA 3PF1A 3PGRA 2XTQA 4O3WA 4RLBA 5KAFO 2PORA 2R4LA 4JCHA 4RJWA 4FQEA 2KXPA 2WVPA 3LK42 4JFBA 2YNKA 3VY9X 3POXA 4O3XB 1HXUA 1BT9A 1IZNA 1QJ8A 4G75A 4RL9A 1P4TA 1MM5A 2K4TA 3EMNX 3POUA 5FVNA 4AFKA 1T1LA 4XNKA 2KZ7B 3DZMA 4KRAA 4AKRB 3PRNA 1QJ9A 3HWBA 2FGQX 5DL8A 3BRYA 4AYNA 1MM4A 1PHOA 1THQA 2R4OA 2XG6A 3RBHA 1ZHYA 2XE3A 1MPFA 2LFUA 2Y0KA 2JMMA 2R89A 3AAEB 4FSOA 4LSIA 3HOEA 3PQSA 4FRTA 2F1VA 4E1TA 3KZIO 4K3CA 3T0SA 4U9CA
chains in the Genus database with same CATH topology
3JCUO 3WU2O 5B5EO 4IL6O 4UB8O 3A0BO 5KAFO 2AXTO 5GTHO 5G3AA 5G38A 4UB6O 5G39A 5KAIO 4PJ0O 5B66O 5GTIO 5E79O 1S5LO 5TISO 3KZIO 5H2FO 3A0HO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU O;  3WU2 O;  5B5E O;  4IL6 O;  4UB8 O;  3A0B O;  5KAF O;  2AXT O;  5GTH O;  5G3A A;  5G38 A;  4UB6 O;  5G39 A;  5KAI O;  4PJ0 O;  5B66 O;  5GTI O;  5E79 O;  1S5L O;  5TIS O;  3KZI O;  5H2F O;  3A0H O; 
#chains in the Genus database with same CATH topology
 3DA3 A;  1OSM A;  2MHL A;  2XE2 A;  3JCU O;  4O49 A;  4D5U A;  4KR4 A;  3AA6 A;  4AUI A;  2WJQ A;  5B5E O;  1ORM A;  4N58 A;  4GCS A;  4PR7 A;  4AYD C;  4UB8 O;  4KR8 A;  4E1S A;  2W81 C;  4GHB A;  4FT6 A;  1GFO A;  3AA0 A;  3AA1 B;  2K0L A;  1YS5 A;  2QTK A;  1ZHT A;  4GF4 A;  4AKM A;  4FZN A;  5DL7 A;  4C69 X;  2J1N A;  2ODJ A;  2XTR A;  2X27 X;  3POR A;  5G38 A;  2M06 A;  4GCP A;  2R8A A;  3HW9 A;  5PRN A;  2R88 A;  2MNH A;  3KVD D;  3T24 A;  3VY8 X;  2YPV A;  5AFU K;  3K19 A;  2ERV A;  3NSG A;  3LK2 A;  3O0E A;  5GTI O;  4O4X A;  5E79 O;  4F4B A;  5T5F A;  3QRC A;  3VE2 A;  3NJT A;  2ZLD A;  1G90 A;  2F1T A;  4FRX A;  4D65 A;  5H2F O;  3A0H O;  3A2S X;  2KDY A;  3T20 A;  3AAE A;  4LSF A;  6PRN A;  1HXX A;  3AAA B;  3WU2 O;  5GV0 A;  8PRN A;  3HOL A;  4LSE A;  3UU2 A;  1GFQ A;  4O4U A;  4O3Z A;  4AZL A;  3SZV A;  3VE1 A;  4FUV A;  4N75 A;  3BRZ A;  4FZM A;  3SYB A;  4FZL A;  2AXT O;  4FMS A;  3PGU A;  3PQU A;  3JTY A;  2KC0 A;  2WJR A;  3PGS A;  3V8U A;  4C4V A;  5DL5 A;  3DA4 A;  4CTD A;  5IYU A;  3AA7 B;  1E54 A;  3SYS A;  4RLC A;  4UB6 O;  5G39 A;  4AYI D;  4LSH A;  3C5O A;  2Y7S A;  5KAI O;  4FOZ A;  5JDP A;  4N59 A;  3DWO X;  3POQ A;  4N74 A;  3AA6 B;  3WI5 A;  1OPF A;  3BS0 A;  3SY9 A;  4D64 A;  2IWW A;  2KZ7 A;  4AKR A;  3LK3 B;  4BUM X;  3AA0 B;  2M07 A;  5EE2 A;  3SZD A;  1BH3 A;  2XE1 A;  4G76 A;  2KXP B;  5ADX L;  3GP6 A;  3UPG A;  5G26 A;  2X9K A;  1Q9G A;  3A0B O;  4PUX A;  7PRN A;  1H6S 1;  2IWV A;  2N2L A;  3QRA A;  3AAA A;  4FSP A;  1IZN B;  4K3B A;  1HXT A;  1QJP A;  2PRN A;  3VZU X;  5D5D A;  5GTH O;  1GFP A;  2F1C X;  4XNL A;  2R4P A;  1BXW A;  2FGR A;  5G3A A;  2ZFG A;  3LK2 B;  1ZHZ A;  3AA1 A;  4AYM C;  2W80 C;  1ZHX A;  3G7G A;  3VZT X;  4PJ0 O;  1ZHW A;  5B66 O;  4AYE C;  4RJX A;  3FYX A;  1T16 A;  2LHF A;  2XMX A;  3AA7 A;  4QQ1 A;  1S5L O;  2Y0L A;  3DWN A;  5AFU L;  2J4U P;  3TZG A;  3WI4 A;  5TIS O;  4B61 A;  5DL6 A;  2XE5 A;  2JQY A;  2OMF A;  2GE4 A;  1Q9F A;  1PRN A;  2N2M A;  4Z3T A;  5ADX K;  3SY7 A;  2Y0H A;  1GFN A;  4FES A;  3LK4 1;  4O3Y A;  2Y2X A;  3UAQ A;  4IL6 O;  3LK3 A;  1GFM A;  3VZW X;  4GCQ A;  4C4V B;  4C00 A;  2O4V A;  2R4N A;  3PF1 A;  3PGR A;  2XTQ A;  4O3W A;  4RLB A;  5KAF O;  2POR A;  2R4L A;  4JCH A;  4RJW A;  4FQE A;  2KXP A;  2WVP A;  3LK4 2;  4JFB A;  2YNK A;  3VY9 X;  3POX A;  4O3X B;  1HXU A;  1BT9 A;  1IZN A;  1QJ8 A;  4G75 A;  4RL9 A;  1P4T A;  1MM5 A;  2K4T A;  3EMN X;  3POU A;  5FVN A;  4AFK A;  1T1L A;  4XNK A;  2KZ7 B;  3DZM A;  4KRA A;  4AKR B;  3PRN A;  1QJ9 A;  3HWB A;  2FGQ X;  5DL8 A;  3BRY A;  4AYN A;  1MM4 A;  1PHO A;  1THQ A;  2R4O A;  2XG6 A;  3RBH A;  1ZHY A;  2XE3 A;  1MPF A;  2LFU A;  2Y0K A;  2JMM A;  2R89 A;  3AAE B;  4FSO A;  4LSI A;  3HOE A;  3PQS A;  4FRT A;  2F1V A;  4E1T A;  3KZI O;  4K3C A;  3T0S A;  4U9C A; 
#chains in the Genus database with same CATH homology
 3JCU O;  3WU2 O;  5B5E O;  4IL6 O;  4UB8 O;  3A0B O;  5KAF O;  2AXT O;  5GTH O;  5G3A A;  5G38 A;  4UB6 O;  5G39 A;  5KAI O;  4PJ0 O;  5B66 O;  5GTI O;  5E79 O;  1S5L O;  5TIS O;  3KZI O;  5H2F O;  3A0H O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...