4UB6O

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 54
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4ub6O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4ub6O02
4UB8O 5KAIO 5KAFO 5G38A 5G39A 3WU2O 4PJ0O 4UB6O 5TISO 5B66O 2AXTO 3KZIO 5H2FO 5G3AA 3A0BO 5GTHO 3A0HO 1S5LO 3JCUO 5B5EO 5E79O 5GTIO 4IL6O
chains in the Genus database with same CATH superfamily
2FGRA 1ZHYA 4FSPA 4F4BA 2Y0HA 3AA6A 2ZLDA 4RJXA 3T24A 2IWWA 3BS0A 2PRNA 2Y7SA 4AYDC 5G26A 1H6S1 2ZFGA 3AAEA 2XG6A 4GCPA 4XNLA 2GE4A 4UB6O 5DL5A 3V8UA 2KXPB 3LK3A 5DL7A 3VZUX 5JDPA 3VY8X 2AXTO 2F1TA 1PHOA 2F1VA 2FGQX 2XTQA 3LK41 3PQSA 4O49A 5PRNA 1P4TA 4KR8A 3SZVA 3QRCA 3PQUA 1BT9A 2R88A 1ZHZA 3DWNA 1YS5A 3TZGA 4C69X 8PRNA 5GTHO 4RL9A 3VE2A 5T5FA 3T0SA 3A0HO 4N74A 4XNKA 1G90A 4AUIA 2LHFA 3VE1A 4CTDA 1GFQA 5E79O 3PRNA 4FRXA 4LSHA 3WI5A 5GV0A 1GFMA 4FZNA 4D65A 3PGUA 3K19A 5DL6A 2ODJA 4AZLA 5AFUL 2KZ7A 3DA3A 2R4LA 3AAAA 4O4UA 5ADXL 4PUXA 2XMXA 4N59A 3VZWX 4AFKA 1E54A 3DWOX 2F1CX 4PJ0O 2KXPA 3LK3B 3SZDA 4RLBA 4K3BA 2XE3A 5TISO 4E1SA 1OPFA 2R8AA 3HOEA 4GF4A 3KZIO 2X27X 3LK2A 4AKRA 2XE2A 4O3ZA 3LK42 5EE2A 5H2FO 2WJQA 3HOLA 4B61A 4GCSA 3JTYA 1Q9GA 2R4OA 3BRZA 4N58A 4O4XA 4AKRB 4LSFA 4AYNA 3T20A 3KVDD 1QJPA 3NJTA 2XE1A 2ERVA 2N2MA 4FUVA 4LSIA 4AYEC 4N75A 4AYID 2K0LA 3QRAA 1PRNA 3UPGA 3JCUO 3HW9A 3PGRA 2Y0KA 2XE5A 4D5UA 4FT6A 1QJ9A 3AA7A 5GTIO 4FQEA 2KZ7B 5IYUA 2JMMA 3FYXA 4KRAA 2K4TA 3RBHA 1MM4A 3DA4A 3AA7B 3AA1B 2IWVA 3POUA 1GFOA 5G38A 5G39A 3UAQA 4QQ1A 3VY9X 3POQA 3VZTX 3WU2O 1THQA 3UU2A 2J1NA 4FOZA 2QTKA 2M07A 2OMFA 3LK2B 5B66O 4BUMX 2XTRA 4O3WA 2M06A 2KDYA 3DZMA 2YPVA 3SYSA 1HXTA 5G3AA 2YNKA 4FZLA 4C00A 4LSEA 4RJWA 1HXUA 2R4NA 2R89A 5FVNA 3NSGA 3AAEB 1MM5A 1S5LO 1ZHXA 1T1LA 3GP6A 2PORA 4FZMA 4C4VB 4Z3TA 1IZNB 6PRNA 3G7GA 2Y0LA 1QJ8A 2LFUA 4IL6O 4E1TA 3PGSA 5DL8A 2MNHA 3AA6B 1GFPA 4AYMC 2Y2XA 1ZHWA 3HWBA 2R4PA 4FESA 1ORMA 4FMSA 4GHBA 2WVPA 4GCQA 4O3YA 4UB8O 5KAFO 1MPFA 5KAIO 3AA0B 3POXA 4RLCA 3SYBA 4O3XB 4JCHA 3O0EA 2JQYA 4K3CA 4JFBA 3SY9A 4KR4A 5ADXK 3WI4A 3A2SX 4G76A 2KC0A 4FSOA 3AA1A 3SY7A 1IZNA 4FRTA 4C4VA 1T16A 3PORA 2N2LA 3A0BO 1ZHTA 1BXWA 4G75A 4D64A 7PRNA 2X9KA 3AAAB 4PR7A 4U9CA 1GFNA 3C5OA 1HXXA 1OSMA 4AKMA 5AFUK 2W80C 5B5EO 2MHLA 3AA0A 2W81C 1Q9FA 3PF1A 1BH3A 3EMNX 2WJRA 2O4VA 3BRYA 5D5DA 2J4UP
chains in the Genus database with same CATH topology
4UB8O 5KAIO 5KAFO 5G38A 5G39A 3WU2O 4PJ0O 4UB6O 5TISO 5B66O 2AXTO 3KZIO 5H2FO 5G3AA 3A0BO 5GTHO 3A0HO 1S5LO 3JCUO 5B5EO 5E79O 5GTIO 4IL6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 O;  5KAI O;  5KAF O;  5G38 A;  5G39 A;  3WU2 O;  4PJ0 O;  4UB6 O;  5TIS O;  5B66 O;  2AXT O;  3KZI O;  5H2F O;  5G3A A;  3A0B O;  5GTH O;  3A0H O;  1S5L O;  3JCU O;  5B5E O;  5E79 O;  5GTI O;  4IL6 O; 
#chains in the Genus database with same CATH topology
 2FGR A;  1ZHY A;  4FSP A;  4F4B A;  2Y0H A;  3AA6 A;  2ZLD A;  4RJX A;  3T24 A;  2IWW A;  3BS0 A;  2PRN A;  2Y7S A;  4AYD C;  5G26 A;  1H6S 1;  2ZFG A;  3AAE A;  2XG6 A;  4GCP A;  4XNL A;  2GE4 A;  4UB6 O;  5DL5 A;  3V8U A;  2KXP B;  3LK3 A;  5DL7 A;  3VZU X;  5JDP A;  3VY8 X;  2AXT O;  2F1T A;  1PHO A;  2F1V A;  2FGQ X;  2XTQ A;  3LK4 1;  3PQS A;  4O49 A;  5PRN A;  1P4T A;  4KR8 A;  3SZV A;  3QRC A;  3PQU A;  1BT9 A;  2R88 A;  1ZHZ A;  3DWN A;  1YS5 A;  3TZG A;  4C69 X;  8PRN A;  5GTH O;  4RL9 A;  3VE2 A;  5T5F A;  3T0S A;  3A0H O;  4N74 A;  4XNK A;  1G90 A;  4AUI A;  2LHF A;  3VE1 A;  4CTD A;  1GFQ A;  5E79 O;  3PRN A;  4FRX A;  4LSH A;  3WI5 A;  5GV0 A;  1GFM A;  4FZN A;  4D65 A;  3PGU A;  3K19 A;  5DL6 A;  2ODJ A;  4AZL A;  5AFU L;  2KZ7 A;  3DA3 A;  2R4L A;  3AAA A;  4O4U A;  5ADX L;  4PUX A;  2XMX A;  4N59 A;  3VZW X;  4AFK A;  1E54 A;  3DWO X;  2F1C X;  4PJ0 O;  2KXP A;  3LK3 B;  3SZD A;  4RLB A;  4K3B A;  2XE3 A;  5TIS O;  4E1S A;  1OPF A;  2R8A A;  3HOE A;  4GF4 A;  3KZI O;  2X27 X;  3LK2 A;  4AKR A;  2XE2 A;  4O3Z A;  3LK4 2;  5EE2 A;  5H2F O;  2WJQ A;  3HOL A;  4B61 A;  4GCS A;  3JTY A;  1Q9G A;  2R4O A;  3BRZ A;  4N58 A;  4O4X A;  4AKR B;  4LSF A;  4AYN A;  3T20 A;  3KVD D;  1QJP A;  3NJT A;  2XE1 A;  2ERV A;  2N2M A;  4FUV A;  4LSI A;  4AYE C;  4N75 A;  4AYI D;  2K0L A;  3QRA A;  1PRN A;  3UPG A;  3JCU O;  3HW9 A;  3PGR A;  2Y0K A;  2XE5 A;  4D5U A;  4FT6 A;  1QJ9 A;  3AA7 A;  5GTI O;  4FQE A;  2KZ7 B;  5IYU A;  2JMM A;  3FYX A;  4KRA A;  2K4T A;  3RBH A;  1MM4 A;  3DA4 A;  3AA7 B;  3AA1 B;  2IWV A;  3POU A;  1GFO A;  5G38 A;  5G39 A;  3UAQ A;  4QQ1 A;  3VY9 X;  3POQ A;  3VZT X;  3WU2 O;  1THQ A;  3UU2 A;  2J1N A;  4FOZ A;  2QTK A;  2M07 A;  2OMF A;  3LK2 B;  5B66 O;  4BUM X;  2XTR A;  4O3W A;  2M06 A;  2KDY A;  3DZM A;  2YPV A;  3SYS A;  1HXT A;  5G3A A;  2YNK A;  4FZL A;  4C00 A;  4LSE A;  4RJW A;  1HXU A;  2R4N A;  2R89 A;  5FVN A;  3NSG A;  3AAE B;  1MM5 A;  1S5L O;  1ZHX A;  1T1L A;  3GP6 A;  2POR A;  4FZM A;  4C4V B;  4Z3T A;  1IZN B;  6PRN A;  3G7G A;  2Y0L A;  1QJ8 A;  2LFU A;  4IL6 O;  4E1T A;  3PGS A;  5DL8 A;  2MNH A;  3AA6 B;  1GFP A;  4AYM C;  2Y2X A;  1ZHW A;  3HWB A;  2R4P A;  4FES A;  1ORM A;  4FMS A;  4GHB A;  2WVP A;  4GCQ A;  4O3Y A;  4UB8 O;  5KAF O;  1MPF A;  5KAI O;  3AA0 B;  3POX A;  4RLC A;  3SYB A;  4O3X B;  4JCH A;  3O0E A;  2JQY A;  4K3C A;  4JFB A;  3SY9 A;  4KR4 A;  5ADX K;  3WI4 A;  3A2S X;  4G76 A;  2KC0 A;  4FSO A;  3AA1 A;  3SY7 A;  1IZN A;  4FRT A;  4C4V A;  1T16 A;  3POR A;  2N2L A;  3A0B O;  1ZHT A;  1BXW A;  4G75 A;  4D64 A;  7PRN A;  2X9K A;  3AAA B;  4PR7 A;  4U9C A;  1GFN A;  3C5O A;  1HXX A;  1OSM A;  4AKM A;  5AFU K;  2W80 C;  5B5E O;  2MHL A;  3AA0 A;  2W81 C;  1Q9F A;  3PF1 A;  1BH3 A;  3EMN X;  2WJR A;  2O4V A;  3BRY A;  5D5D A;  2J4U P; 
#chains in the Genus database with same CATH homology
 4UB8 O;  5KAI O;  5KAF O;  5G38 A;  5G39 A;  3WU2 O;  4PJ0 O;  4UB6 O;  5TIS O;  5B66 O;  2AXT O;  3KZI O;  5H2F O;  5G3A A;  3A0B O;  5GTH O;  3A0H O;  1S5L O;  3JCU O;  5B5E O;  5E79 O;  5GTI O;  4IL6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...