4UB6O

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 54
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4ub6O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4ub6O02
2AXTO 3KZIO 3A0HO 5G3AA 5H2FO 5KAFO 3JCUO 5G39A 4PJ0O 5G38A 3WU2O 1S5LO 5TISO 5KAIO 5GTIO 5B66O 5GTHO 4UB8O 4UB6O 3A0BO 5E79O 5B5EO 4IL6O
chains in the Genus database with same CATH superfamily
4K3CA 4LSIA 2LFUA 3AAEA 4FRTA 2KXPA 3T0SA 3WI4A 3UU2A 3VZTX 2LHFA 3POQA 2XMXA 4O3ZA 4D5UA 5KAFO 2PORA 3HW9A 3G7GA 4PJ0O 5JDPA 2X27X 4PR7A 3SZDA 5G38A 2XE3A 4AYDC 3RBHA 1MM4A 2FGRA 2KXPB 3SY9A 2IWVA 3T24A 4C4VA 1ZHYA 5B66O 3DWNA 1YS5A 3DA3A 4AYEC 5PRNA 3O0EA 4AUIA 2R8AA 2OMFA 2GE4A 2XTRA 3A0BO 3PGSA 3PF1A 2M06A 2Y7SA 1GFQA 3HOEA 4FZNA 4FZMA 4O3WA 4FQEA 3A2SX 4XNKA 4FSPA 4BUMX 2ZFGA 5G26A 2JMMA 3AA1B 3PQUA 1GFNA 1S5LO 3PGRA 4IL6O 5T5FA 2M07A 3TZGA 3QRAA 2AXTO 2QTKA 4RL9A 3KZIO 3POUA 4AYNA 3LK3B 3VZUX 3PORA 4FT6A 2X9KA 1ZHTA 3C5OA 1Q9GA 1QJ9A 2YPVA 5G3AA 1Q9FA 1BXWA 3AAAA 5H2FO 5ADXL 3JCUO 4GCSA 5G39A 2W80C 2XE5A 1HXXA 8PRNA 5IYUA 4O4UA 3V8UA 1GFPA 3SYBA 1PHOA 1ORMA 3UAQA 4N58A 4N75A 4G75A 3WU2O 4O49A 2PRNA 3VE1A 5EE2A 2KZ7B 4RJWA 2K4TA 3BS0A 1GFMA 4KR8A 1PRNA 4LSHA 4QQ1A 5GTIO 3SYSA 4F4BA 3DZMA 5DL8A 5ADXK 1MM5A 1OPFA 3VE2A 1QJ8A 4C69X 1MPFA 2ERVA 3AA6A 2R4NA 2Y0KA 3BRZA 4N59A 1HXTA 1IZNB 2F1TA 3NJTA 4U9CA 2W81C 4FOZA 4AYMC 3AAAB 4AYID 4GCPA 4AKMA 2KZ7A 4RLBA 3WI5A 4FUVA 1GFOA 5GV0A 4GHBA 3SZVA 4FMSA 4KR4A 4AKRB 1BH3A 3PQSA 3QRCA 3HOLA 1ZHWA 2XE1A 2MNHA 3AA0A 3SY7A 4KRAA 3DWOX 5FVNA 3LK2B 3LK2A 2R88A 4E1TA 3VY8X 2Y0HA 4FZLA 3DA4A 1QJPA 3EMNX 3HWBA 6PRNA 3T20A 4FRXA 4GCQA 1P4TA 2Y2XA 4JCHA 2WJRA 3AA7A 4O4XA 4UB6O 4AZLA 4CTDA 2ZLDA 4N74A 3AA1A 2KDYA 2XG6A 3BRYA 4FESA 4FSOA 2J4UP 5E79O 4AFKA 2R4OA 4O3YA 1HXUA 3AA6B 2O4VA 1T1LA 5AFUL 4AKRA 3PGUA 2JQYA 3KVDD 1H6S1 2N2LA 4LSFA 2YNKA 2Y0LA 3POXA 5AFUK 3A0HO 3PRNA 4XNLA 4O3XB 1G90A 4D65A 2J1NA 3AAEB 2F1VA 1BT9A 4GF4A 4B61A 2MHLA 2R4PA 3AA0B 2K0LA 1ZHZA 3NSGA 3AA7B 2XTQA 1T16A 4K3BA 2N2MA 3K19A 3FYXA 3VZWX 4G76A 2IWWA 5TISO 2WJQA 3JTYA 1ZHXA 4D64A 3LK42 5KAIO 3GP6A 2KC0A 2R89A 4JFBA 4PUXA 5D5DA 1THQA 3LK3A 2F1CX 4UB8O 5DL7A 4C4VB 5GTHO 1IZNA 2XE2A 2WVPA 4RLCA 7PRNA 3UPGA 1OSMA 2ODJA 4Z3TA 5B5EO 2FGQX 3LK41 1E54A 4RJXA 2R4LA 4E1SA 4LSEA 5DL5A 3VY9X 5DL6A 4C00A
chains in the Genus database with same CATH topology
2AXTO 3KZIO 3A0HO 5G3AA 5H2FO 5KAFO 3JCUO 5G39A 4PJ0O 5G38A 3WU2O 1S5LO 5TISO 5KAIO 5GTIO 5B66O 5GTHO 4UB8O 4UB6O 3A0BO 5E79O 5B5EO 4IL6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT O;  3KZI O;  3A0H O;  5G3A A;  5H2F O;  5KAF O;  3JCU O;  5G39 A;  4PJ0 O;  5G38 A;  3WU2 O;  1S5L O;  5TIS O;  5KAI O;  5GTI O;  5B66 O;  5GTH O;  4UB8 O;  4UB6 O;  3A0B O;  5E79 O;  5B5E O;  4IL6 O; 
#chains in the Genus database with same CATH topology
 4K3C A;  4LSI A;  2LFU A;  3AAE A;  4FRT A;  2KXP A;  3T0S A;  3WI4 A;  3UU2 A;  3VZT X;  2LHF A;  3POQ A;  2XMX A;  4O3Z A;  4D5U A;  5KAF O;  2POR A;  3HW9 A;  3G7G A;  4PJ0 O;  5JDP A;  2X27 X;  4PR7 A;  3SZD A;  5G38 A;  2XE3 A;  4AYD C;  3RBH A;  1MM4 A;  2FGR A;  2KXP B;  3SY9 A;  2IWV A;  3T24 A;  4C4V A;  1ZHY A;  5B66 O;  3DWN A;  1YS5 A;  3DA3 A;  4AYE C;  5PRN A;  3O0E A;  4AUI A;  2R8A A;  2OMF A;  2GE4 A;  2XTR A;  3A0B O;  3PGS A;  3PF1 A;  2M06 A;  2Y7S A;  1GFQ A;  3HOE A;  4FZN A;  4FZM A;  4O3W A;  4FQE A;  3A2S X;  4XNK A;  4FSP A;  4BUM X;  2ZFG A;  5G26 A;  2JMM A;  3AA1 B;  3PQU A;  1GFN A;  1S5L O;  3PGR A;  4IL6 O;  5T5F A;  2M07 A;  3TZG A;  3QRA A;  2AXT O;  2QTK A;  4RL9 A;  3KZI O;  3POU A;  4AYN A;  3LK3 B;  3VZU X;  3POR A;  4FT6 A;  2X9K A;  1ZHT A;  3C5O A;  1Q9G A;  1QJ9 A;  2YPV A;  5G3A A;  1Q9F A;  1BXW A;  3AAA A;  5H2F O;  5ADX L;  3JCU O;  4GCS A;  5G39 A;  2W80 C;  2XE5 A;  1HXX A;  8PRN A;  5IYU A;  4O4U A;  3V8U A;  1GFP A;  3SYB A;  1PHO A;  1ORM A;  3UAQ A;  4N58 A;  4N75 A;  4G75 A;  3WU2 O;  4O49 A;  2PRN A;  3VE1 A;  5EE2 A;  2KZ7 B;  4RJW A;  2K4T A;  3BS0 A;  1GFM A;  4KR8 A;  1PRN A;  4LSH A;  4QQ1 A;  5GTI O;  3SYS A;  4F4B A;  3DZM A;  5DL8 A;  5ADX K;  1MM5 A;  1OPF A;  3VE2 A;  1QJ8 A;  4C69 X;  1MPF A;  2ERV A;  3AA6 A;  2R4N A;  2Y0K A;  3BRZ A;  4N59 A;  1HXT A;  1IZN B;  2F1T A;  3NJT A;  4U9C A;  2W81 C;  4FOZ A;  4AYM C;  3AAA B;  4AYI D;  4GCP A;  4AKM A;  2KZ7 A;  4RLB A;  3WI5 A;  4FUV A;  1GFO A;  5GV0 A;  4GHB A;  3SZV A;  4FMS A;  4KR4 A;  4AKR B;  1BH3 A;  3PQS A;  3QRC A;  3HOL A;  1ZHW A;  2XE1 A;  2MNH A;  3AA0 A;  3SY7 A;  4KRA A;  3DWO X;  5FVN A;  3LK2 B;  3LK2 A;  2R88 A;  4E1T A;  3VY8 X;  2Y0H A;  4FZL A;  3DA4 A;  1QJP A;  3EMN X;  3HWB A;  6PRN A;  3T20 A;  4FRX A;  4GCQ A;  1P4T A;  2Y2X A;  4JCH A;  2WJR A;  3AA7 A;  4O4X A;  4UB6 O;  4AZL A;  4CTD A;  2ZLD A;  4N74 A;  3AA1 A;  2KDY A;  2XG6 A;  3BRY A;  4FES A;  4FSO A;  2J4U P;  5E79 O;  4AFK A;  2R4O A;  4O3Y A;  1HXU A;  3AA6 B;  2O4V A;  1T1L A;  5AFU L;  4AKR A;  3PGU A;  2JQY A;  3KVD D;  1H6S 1;  2N2L A;  4LSF A;  2YNK A;  2Y0L A;  3POX A;  5AFU K;  3A0H O;  3PRN A;  4XNL A;  4O3X B;  1G90 A;  4D65 A;  2J1N A;  3AAE B;  2F1V A;  1BT9 A;  4GF4 A;  4B61 A;  2MHL A;  2R4P A;  3AA0 B;  2K0L A;  1ZHZ A;  3NSG A;  3AA7 B;  2XTQ A;  1T16 A;  4K3B A;  2N2M A;  3K19 A;  3FYX A;  3VZW X;  4G76 A;  2IWW A;  5TIS O;  2WJQ A;  3JTY A;  1ZHX A;  4D64 A;  3LK4 2;  5KAI O;  3GP6 A;  2KC0 A;  2R89 A;  4JFB A;  4PUX A;  5D5D A;  1THQ A;  3LK3 A;  2F1C X;  4UB8 O;  5DL7 A;  4C4V B;  5GTH O;  1IZN A;  2XE2 A;  2WVP A;  4RLC A;  7PRN A;  3UPG A;  1OSM A;  2ODJ A;  4Z3T A;  5B5E O;  2FGQ X;  3LK4 1;  1E54 A;  4RJX A;  2R4L A;  4E1S A;  4LSE A;  5DL5 A;  3VY9 X;  5DL6 A;  4C00 A; 
#chains in the Genus database with same CATH homology
 2AXT O;  3KZI O;  3A0H O;  5G3A A;  5H2F O;  5KAF O;  3JCU O;  5G39 A;  4PJ0 O;  5G38 A;  3WU2 O;  1S5L O;  5TIS O;  5KAI O;  5GTI O;  5B66 O;  5GTH O;  4UB8 O;  4UB6 O;  3A0B O;  5E79 O;  5B5E O;  4IL6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...