4UBGA

Resting state of rat cysteine dioxygenase c93g variant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHGFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title The Cys-Tyr Cross-Link of Cysteine Dioxygenase Changes the Optimal pH of the Reaction without a Structural Change.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 57
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ubgA00
3BCWA 3U0ZA 3IDCB 5FDBA 1O3RA 3N4MA 3I59B 2Y0OA 3E97A 1X8MA 4D7TA 1X8EA 3KGLA 4QXKA 3U10A 1J3RA 1CAXA 2V09A 3ST7A 4FBFA 4LA3A 4Z07A 4HSJA 3TNQA 1ZVFA 3PNAA 4LUKA 2P17A 1RL3A 4META 4ZU7A 1Y9QA 2BNOA 1XE8A 3E6BA 5FPXA 3ES4A 3UKVA 3FJSA 5J48A 3H3UA 4KWJA 2WC2A 1J3QA 2CV6A 3RNSA 1H1MA 4F8AA 2PHLA 4N9HA 3RYPA 4MGZE 5JSRA 2ETEA 5JR7B 2F4PA 3SHRA 4YNIA 2K9ZA 1O3SA 1ZZBA 3HQXA 1ZRFA 2Z2SB 4WBBA 3E6CC 4Q0UA 3GBFA 5FPZA 3H1MA 5C6CA 2BGCA 3BU7A 5KHGA 3BB6A 4N9IA 4IEXA 4FAHA 4Q0SA 4TLFA 2XLFA 1QY4A 4BIFA 4HMZA 2MHFA 1IPKA 2GC0A 2XL9A 1UW8A 3IBMA 1ZRDA 4YSFA 5F1RA 4XFFA 4AQ6A 3IDBB 5EFUA 4AXOA 1CAUA 3H3ZA 3KMHA 4R8HA 1Q3EA 2GZWA 3LA7A 3I54A 3RPQA 1OD5A 5FCCA 2BEOA 3EHKA 1UCXA 1DZRA 1FI2A 1Q43A 4I0AA 3TNPB 1J58A 4X6QB 2IXKA 2XKPA 3CLPA 4MGYE 4UBGA 2PA7A 3OF1A 1DGRA 4K8FA 3I59A 4Q29A 1ZZ8A 2PAEA 4P9GA 3MDPA 1O3TA 4JTOA 3O14A 3JZVA 4J1WA 5CU1A 3FX3A 3LAGA 4IEUA 4QM9A 4AVCA 4FAGA 2ET1A 4QMAA 4XF0A 3CL1A 4GULA 1O5LA 3FHIB 2B8MA 3USSA 5I8TA 1O7FA 2Z69A 4X6RB 1DGWA 4XFHA 1NE6A 4HN1A 1NZCA 5HI0A 5I8YA 1IPJA 1ZREA 4CYDA 2H0VA 5I0SA 3H50A 1NXMA 4IESA 4LUMA 1QWRA 4MGKE 4MUVA 2QNKA 1UIJA 4A2UA 3DL3A 1FT9A 2KXLA 1ZZ9A 4XEZA 4JVAA 4KWKA 1NE4A 3PVBB 1RUOA 1EP0A 4MX3A 5FQ0B 1PMIA 1VP6A 3M70A 5JSPA 1LB2A 2XLAA 1EPZA 5E16A 5I0UA 3UKNA 3KSCA 4XF4A 4XFCA 1GQGA 4AVAA 5LRSA 1WA4A 3S7IA 5I0RA 2XLGA 3EJKA 3KGZA 1V70A 4KU7A 3M3IA 4QM8A 3RDIA 3DKWA 2PTMA 2BYVE 2XL7A 3NJZA 3H7YA 4MH0E 4L2NA 5I0TA 1YHFA 2UY9A 1CAWB 2UYBA 4XFIA 3CJXA 3MYXA 4ORFA 4BHPA 3FZ3A 2IXCA 3EBRA 3UKTA 4H7LA 3HIFA 2VQAA 1XRUA 4E2SA 1U12A 4JV4A 2OZJA 3BALA 5FLHA 4YRDA 5KHIA 1JUHA 4XFAA 4BH9A 3U11A 4LLOA 3E5UA 3SCFA 4PIXA 4XFGA 2D5FA 1YFXA 4KL1A 4B29A 4I02A 1OI6A 1J59A 3OTFA 5KBFA 4IEQA 4QGLA 3B02A 4DINB 2K0GA 1XE7A 2XHKA 4ZU4A 2D93A 3RYRA 4ZU5A 4J1XA 1YLLA 1Y3TA 2OPKA 2B5HA 2IXIA 2ZKLA 1RGSA 1PM7A 4E2QA 3NKTA 4MZUA 5BUVA 3OD0A 1SEFA 5FLIA 4HZFA 4LA2A 1CAXB 2VECA 2EA7A 2WFPA 4PIYA 1TQ5A 2GU9A 1LR5A 3VHRA 5LEKA 2QVSB 1RC6A 3NW4A 3CF6E 2OA2A 4XF9A 4I0BA 4IEPA 3H9AA 5I8SA 4KWLA 3SXWA 3CEWA 2Q30A 2XKOA 5E1RA 1H1IA 2EVXA 5KHJA 3FE5A 3NVCA 4MV2A 4YYOA 1ZX5A 4Q0QA 1WGPA 4O9EA 2Q4SA 1O5UA 1ZRRA 4LTAA 1GQHA 5C8WA 5CADA 4HBNA 4HVRA 2N7GA 3NSTA 4XETA 2DCTA 2CAUA 2PFWA 3HT2A 4QGNA 4UXAA 4O9GA 3LOIA 4HSLA 4IEWA 3SMHA 4EWEA 1OFNA 4JTNA 1ZRCA 2PAMA 3ZDSA 4KU8A 1DZTA 2OZ6A 2VPVA 2B9UA 4IERA 3H1WA 4D7SA 4I09A 5I93A 4XFBA 1VJ2A 5BPXA 1LKNA 4AQ2A 3QACA 1I5ZA 2GAUA 1CAUB 4L11A 3D82A 2MPFA 2GC2A 4BYYA 2EAAA 5LRRA 5J7MA 4ONUA 1UPIA 3RZZA 1NYWA 2MNGA 4I2OA 1RTVA 1YUDA 5KHHA 2UY8A 4QGMA 3D0JA 3ES1A 3E5XA 1CAVB 4Q0PA 2XGXA 5BY5A 1QXJA 3OCPA 2QDRA 3LWCA 3H7JA 4HVOA 4OLLA 4R52A 1J1LA 1X82A 3ETQA 1G6NA 3IWZA 3GYDA 4OFGA 5JSOA 2HJIA 1I6XA 3KCCA 2FQPA 4EWDA 4IEVA 3WW1A 3NL1A 4MGIE 1Q5OA 2CAVA 2ZCWA 3G7DA 4YARA 5EZWA 2GH2A 5J3UA 1YWKA 1VR3A 2H6CA 1RUNA 5JAXA 2C0ZA 2QCSB 3DV8A 3LA3A 1YFUA 3H1YA 2GC3A 2IXLA 4NVPA 3DN7A 2HKXA 3S0MA 2IXJA 1CGPA 2D40A 1ZZ6A 3SCGA 3QOPA 4EROA 3H8UA 3OGJA 3FWEA 2IXHA 4PJYA 3FFQA 1SFNA 1LRHA 3S7EA 2BNNA 1O3QA 2I45A 2E9QA 1O4TA 3HT1A 2UYAA 3EQEA 3SCHA 2PAKA 5LEJA 4XF1A 3LA2A 2ET7A 4IEYA 5FLJA 5I91A 4LEJA 5FQ0A 3ELNA 1EY2A 4XF3A 2IC1A 5BXXA 3CO2A 2H6BA 4HLTA 4LULA 3ACLA 3PLQA 4FT8A 2O8QA 4I3PA 4IEZA 2PHDA 2CGPA 3WW3A 2PYTA 1SQ4A 1EYBA 3MPBA 2PQQA 4IEOA 3LZZA 4UBHA 1CAVA 1UD1A 4PIZA 2Q0AA 2Q1ZB 4EWAA 5AVPA 4HN0A 3BPZA 1L3JA 3EO6A 1CX4A 1CAWA 5CVRA 1X7NA 1UIKA 2OYZA 5JCTA 3C3VA 3E5QA 4EV0A 2QJVA 4RD7A 3D0SA 1QXRA 1OMIA 1HW5A 1J3PA 2D5HA 1ZZ7A 3WW2A 3WW4A 5BV6A 5K8SA 3RYKA 2FMYA 4QX5A 4WZCA 4F7ZA 1FXZA 4Q0VA 3I7DA 4HVQA 1YFYA 1ZNPA 2GC1A 4AVBA 1ZZCA 4I01A 3R6SA 3IIAA 1WLTA 1YFWA 3ROUA 5KHKA 2O1QA 3E6DA 4WVZA 2BNMA 2ATFA 3MZHA 5D1IA 3L2HA 4IETA 5T3NA 4Z82A 4E2GA
chains in the Genus database with same CATH superfamily
4IE0A 3O12A 3BCWA 3U0ZA 2VXJA 3ZPOA 3ZFGC 3T0AA 3VN4A 4NIGA 1YRZA 2HWC3 2F4LA 1C5HA 2Y0OA 2Z42A 1X8MA 3E97A 5BNNA 1GWKA 1RHI1 1ST8A 1TME3 1X8EA 3KGLA 3AMPA 5CKMA 4TSVA 5FPLA 4IUGA 4FPEA 2GNDA 4D6QA 5GM0A 4UF0A 2FCTA 4Z07A 4O7XA 3A0KA 4BK5A 4I30A 4OI0A 1PNGA 1H1AA 4LUKA 2AREA 4NO4A 1RL3A 1AX1A 4ZU7A 1UMZA 3SEPA 5F7UA 1XE8A 2VBPA 2WLPA 3BOWA 4YGBA 2Q8DA 5DPNA 1H2KA 4H7MA 3AZVA 3WOGA 3O1RA 1UX6A 3ZSKA 5DAPA 3VBRB 2PLV3 2WS93 4KWJA 1UN1A 3FMGA 1J3QA 4CDXB 4G9SB 4N9HA 3WEZA 4CEYA 1S0DA 4GALA 5A3PA 2ETEA 5JR7B 4ISQA 4AI0A 1CIWA 2FDHA 3GBWA 3NKGA 2J1SA 4Z2AA 5FZ7A 3VZJA 1RUI2 4CXXA 4Q0UA 1JYIA 3KVBA 4QPIA 5IAXA 1W6PA 2HWE1 4GMP1 4LE4A 5A32B 3GBFA 4UW6A 3QBQA 4NIAA 5A6ZA 1PVC3 4IGQA 1YCIA 2RS32 4HKWA 4LBQB 5T55A 4Q27A 2IUWA 3CBNA 1W39A 5A3UA 1JYWA 5FZOB 3BIEA 2DYCA 2VJXA 4XUTA 5CYYA 4QXBA 1N3OA 1RJ7A 1RHI3 4FFIA 2ZGRA 2XLFA 1GUIA 1QY4A 3I2IA 4XIKA 1UYYA 2LUWA 5FZ3A 3BN6A 5IK4A 4OVEA 1ULFA 1UW8A 3U4SA 4R4XA 2VUCA 4Y24A 2GNBA 5E8AA 5FZ8A 3WINE 2A71A 2C1FA 2ZGQA 3ZFFB 5K4LA 4D0QA 3IDBB 1WBFA 3BU0A 1CAUA 2AR6A 4LQRA 3VD4A 2EXHA 4XMIA 5CKQA 1RUG1 3LPGA 4R8HA 1Q56A 1TEIA 4CDQC 3AP9A 2P2KA 3LA7A 4R9AA 5FYBA 3VBHB 3I54A 3P1IA 5F2SA 1KDKA 2GNMA 5FY7A 3BTYA 5FCCA 2VMDA 1YQ6A 3EYPA 3EHKA 3TRSB 2BOIA 3TN93 1NZIA 1HXS2 1PO21 1PK6A 5DMYA 1PNFA 3OF1A 4RGGA 2HH9A 5FZEA 4GMP3 3RZGA 3B5LB 1Q8SA 4P9GA 3MDPA 2VD7A 2IVJA 2RM22 2VUAA 4JTOA 1CPNA 5EXOA 5C9AB 5IVVA 3PDQA 4IEUA 1FOD2 3FHQA 5FXXA 2YFUA 5DAQA 4LHSA 4XF0A 3CL1A 4OUSA 1BKZA 5B2GB 4WM7A 5FFOC 4CCEA 1SLLA 2WNVC 3GJBA 4QHBA 3VBFB 3VBUA 3VB9A 4OHZA 2WIIB 4BXSV 4NRPA 3USSA 4EJRA 4NHMA 5DAWA 1O7FA 4IV3A 2XJUA 4JGZC 4X6RB 4CUGA 1UXZA 4K3UA 4YFWA 4Z2WA 5KC6A 1VBB1 1CJDA 2YHJA 3OGGA 5FY8A 2WZR1 1NCRA 2A6WA 1QDOA 3OEBA 4YGCA 2WT1A 5GLWA 3ZFGB 5HI0A 2EXJA 5BNPC 4I0WB 1RUG3 2HWB2 2ZBJA 2ZHLA 4XTPA 4XOGA 3VL8A 3AKTA 2LTNA 2H0VA 2LROA 5H9RA 3LD8A 2RMU3 1UY4A 4JDOA 1C57A 1VRBA 2X53S 3MLLA 3VKMA 5FMOL 4FXKB 4UFHA 3WF1A 1ZA4A 2XJSA 5A7WA 4Q8LA 5K7PA 1MQTA 3B9IA 3AL6A 1UIJA 4URAA 1PO23 4AQSA 3JCIA 3VHPA 1SBFA 1O91A 4AYUA 3KF3A 2JJ6A 3ZYIB 2QQVA 4YM1A 3ZSJA 2SBAA 1RUF1 1NE4A 4O65A 2WWJA 2EIGA 4RR3C 1GZ9A 2IWGB 4MX3A 1KQRA 2QQJA 1XSQA 3M70A 3KT7A 3WY6A 1EPZA 3Q8BA 3MW2A 4C0BA 5DQ0A 3D4KA 1LCLA 4GH4A 5FPAA 2B7YA 1UYZA 1F4AA 2R1DA 3NV2A 5FYYA 5FPBA 5LRSA 5JZGA 1S0GA 1OQ1A 4GMP0 5LB6A 3VLBB 4D6RA 2XJRA 2ZACA 3KGZA 3KV6A 3BUCA 3WNLA 4QM8A 4LO7A 4N43C 2BV4A 3OOXA 1HB1A 3ZXAC 1MPXA 1LOFC 2JECA 2MEV2 1VBB3 3KD4A 1H8TC 3TEZA 4MO3M 1XNDA 1O6UA 2RS51 2WZR3 2Y33A 3I3DA 2YBSA 3VD3A 3N35A 5JIAA 4LKFA 5C4WA 4GJYA 1UY2A 3POBA 1AR93 2UYBA 3W5NA 3LCPA 4FQZA 3P6BA 4Y5TA 1KFUL 1REEA 3FZ3A 5L7OC 4E4ZA 3WNKA 2BGPA 2YMZA 3POIA 3FHAA 3KM5A 3MLKA 2JDUA 3GZAA 3OJBA 1U12A 4JV4A 4MVTA 1LAJA 2FD8A 2WDBA 3R4UA 1B09A 3BALA 3D5OA 5FLHA 1WZXA 4Z8BA 3PU3A 5FJHA 5KHIA 3MIGA 1JUHA 3HQUA 1L7LA 1PO13 4CDQB 3M2MA 3RI9A 1XU1A 5H9PA 5AC91 3CZJA 3LSEA 4XFGA 2C9KA 2D5FA 2NLRA 2P3IA 3WHTA 1GMMA 1H2LA 4B29A 1CD3G 3RVHA 4RS5C 1XBFA 1JU3A 4Q26A 1ALYA 3N9QA 5L9RA 1QJY2 4JKLA 4IEQA 4P9YA 2R041 2Z5WA 3T1MA 3BI3A 4QGLA 3T2TA 3B02A 3ZXJA 1O8SA 1E5SA 1U5XA 2BOJA 2YROA 2XVGA 1MZ5A 2XHKA 5LA9A 1AJOA 3FLRA 2XJTA 4Q4W3 4ZPIA 5F6KA 1LU2A 2D93A 2DTYA 4LHKA 4ZU5A 2RS53 4J1XA 5FPUA 3VKNA 4QQOA 4BQ2A 1C1LA 4FOQA 4INDA 3M3EA 1ZYBA 1RGSA 2ZKLA 4LITA 3VDDC 1PM7A 4E2QA 2XUMA 1RMU3 5BUVA 1MS5A 2WNVB 3Q8EA 2BW8A 3WR0A 1I1EA 4JQRA 2ZJCA 2WFPA 3THTA 3GXUA 3VHRA 1K5MC 1YI9A 4RGAA 2X05A 2DCYA 5C5TA 3VUOA 4R4ZA 4N7UA 2Y6JA 4JGZB 3NW4A 1OLRA 2HWF1 4LHNA 4I0BA 1S0IA 2IVIB 2J1UA 4AF9A 4AI2A 5JI7A 4WM8C 4NRMA 5FWEA 5BNPB 5A6YA 1Z7S1 2CYFA 1RUD1 2WZEA 2R7EB 1H1IA 1Y4WA 3K2OA 2BWCA 1ZX5A 3OG2A 1W8UA 3TEXA 2VMHA 2ZXQA 4DOUA 2A6VA 2ZTNA 4FO9A 1BBT1 2D6NA 2HYXA 1O5UA 1YNAA 1ZRRA 3AVRA 1GQHA 3ZFEA 2HEYF 5FZ1A 5CADA 4HBNA 4U2AA 2R043 1AL0G 2WNOA 2DCTA 4XETA 3AZYA 1UU5A 2VQUA 3UGHA 3VBRA 2DCJA 4DO0A 2PFWA 4CDXA 3N9PA 3GZTB 4CXYA 5FYIA 1CWPA 1ND3C 2VQTA 3B9CA 3B94A 3KWVA 4NIIA 4E9KA 2VZSA 1WCQA 1RUH1 4OI4A 4O9GA 3V64A 4A6OA 1PMHX 2BFUS 1OPMA 3NAPC 3K4AA 3PJQA 4AI3A 3H8RA 2DCZA 4HSLA 1EUUA 4EWEA 1V6MA 2P3JA 3RZJA 3WP6A 1IS6A 2VPVA 3ZKYA 1PGSA 4FPJA 5A32A 3I3BA 2B9UA 4NAOA 3BIWE 3BVCA 4XABA 1LHWA 1GOHA 3MICA 4N43B 3FUQA 1FMD1 3HJRA 4QPIC 4XCAA 3WQ7A 1M06G 5HCBA 5I93A 4AVVA 4XC9A 1RUI3 1H8TB 2HWF3 3QACA 4QX0A 4LO8A 3D82A 4FXGB 1BK0A 2GC2A 4BYYA 3LSDA 5IT6A 1NX9A 2ZX3A 4QAWA 1T2XA 1Z7S3 2RS33 4E8DA 1UPIA 1DQ2A 1HDKA 4A44A 2E32A 4CRQA 2WN3A 3AL5A 1UAIA 1BXHA 2PHRA 4Y22B 5DUUA 3JQXA 3ZFFA 5J1XA 5KHHA 4TZDA 2VMGA 1AR82 2UY8A 1HLCA 1EUTA 3B3QE 1XJAA 3LDBA 1GANA 3GF6A 3K4ZA 3N9OA 3OCPA 5EWSA 4A3XA 1C8M2 3WNXA 4W6XA 5C3SA 3VBHA 3H7JA 1UZYA 3JD71 4OLLA 5DUXA 1VMHA 2JDAA 2NM1A 3AMMA 3OPTA 3VGIA 2G1MA 1HRI1 4W50A 1RUH3 3ETQA 4CUCA 4AFAA 1DLLA 1JMUB 3FBMA 3N9MA 3SC7X 5JSOA 1ZRIA 1RITA 3GYDA 4P5YA 5JIUA 1Q8QA 4LKDA 1DF0A 4X8NA 2ZAAA 4RS5B 1UL9A 4AZZA 4CUBA 1I6XA 4DXTA 4MXWB 3AYDA 4H2AA 2EIDA 3U14A 2FQPA 3WLUA 3NNGA 4XDOA 3WQBA 4R9DA 2VMFA 4S2HA 5T5PA 5C9AA 4Q4Y1 4COUA 4MGIE 1Q5OA 4AFBA 4PLMA 4QHZA 1FMD3 2ZCWA 4KH9A 4XBLA 2QQIA 3NJVA 1VR3A 2R062 3F2ZA 1RXFA 4M0NA 5LY2A 4DEVA 1AYM1 1W8WA 2QCSB 1WMFA 4AQTA 2VZPA 3VBFA 2C4XA 3VDDB 3NNMA 1FOD3 5JXJA 4XURA 5FOJB 3O1VA 1B35C 3AYCA 3J26N 4LE3A 3DN7A 2HKXA 3JXSA 5F5QA 5FP8A 5LA1A 3ZLIA 4FVVA 4GAZA 1K5MB 4M3CA 1D2SA 2QQUA 4BDVB 5F3CA 1CONA 1ZZ6A 3ZFGA 4AGGA 4JRAA 3VZKA 4AFDA 1H4GA 3RZKA 2C26A 3OGJA 2SLIA 2W3JA 4BJ0A 1EV13 4JRLA 2DF7A 2IFWA 1LRHA 1NCRC 4WM8B 2HWD3 3S7EA 4IDZA 1O3QA 4A41A 4DS0A 1BK1A 3CDZB 4S2FA 3HEIA 3EQEA 3UK9A 4YW4A 2PAKA 1HRI3 1W2AX 3AKSA 3LIGA 2HWB3 3TEWA 4XDQA 3VDBA 4XF1A 5A7PA 2QZ2A 3ZR6A 3OBTA 4TTGA 1J83A 2Z79A 5FLJA 5HPOA 4FI9A 5I91A 2ZMNA 5KR7A 4B7KA 3VBSC 4G4FA 1ULOA 1D4M1 2ERFA 4Y33A 4HKOA 5EJZB 3C7FA 4XF3A 2VMEA 1N3PA 3JBG2 1ND3B 5IFTA 1VRH2 3ACLA 1OQDA 4GXLA 1KJLA 4COWA 1JYNA 3FFZA 4IEZA 1V6OA 2O8QA 3SH3A 3NAPB 2K46A 4AHXA 1HQNA 4YW7A 1AYN2 4GB32 3N7JA 4XAAA 2YDEA 1EYBA 2DVAA 3MPBA 2PQQA 4IEOA 5KXCA 4UBHA 2O14A 1IS3A 1XB9A 1Z78A 2Q1ZB 2AEZA 2VNGA 4QPIB 5AVPA 4YW1A 2C9AA 2B39A 5DZFA 1L3JA 5DAVA 3L9JT 2IFRA 1V6LA 1YQ8A 4JC1A 1R092 4CCJA 4Q4X1 1BMV1 2W94A 4K9SA 3C3VA 2Y6FA 5F5IA 4W65A 1QF3A 1OA2A 3QH6A 3WVJA 3TAYA 3AP6A 1SBDA 5HXVA 3RMXA 1JYCA 2FDIA 3D0SA 4XQDA 4NHKA 2A3YA 1N3QA 1F4HA 4IE4A 4QWNA 4LBKA 1J3PA 1R082 5CB7A 3WW4A 2ZEZA 3MFCA 3RSJA 4F7ZA 1LEMA 4JQTA 3WQ0A 4Q0VA 2VW2A 4P9IA 4ASKA 1GOGA 4CDQA 4AVBA 1O59A 3IIAA 3FUOA 2XJQA 1WLTA 2VZUA 3MIEA 4QB6A 5FMCA 5FY1A 4CSWA 3ROUA 4B1LA 3PIGA 4GJZA 1OSGA 3FBYA 3O1UA 5L9VA 4WVZA 2BNMA 4NJ4A 1WA6X 2NMOA 5D1IA 3ZXFA 4CPBA 5FMDA 3L2HA 4IE7A 4AG4A 3U4XA 3ABZA 5GZEA 5A80A 4QXCA 4Z82A 3T1LA 3ZMOA 3IMMA 3WD5A 2KR2A 4OI1A 4DUWA 2CNAA 5FZIA 3QCWA 1G9AA 4D7TA 3NMBA 1S2BA 1DIWA 3HD8B 3C2UA 3MO4A 2OQ7A 1RVF1 2WNVA 4Q4X3 2WSUA 5C71A 3IDAA 1W8FA 3ST7A 4AVTA 4BQ3A 1GZTA 1EAH2 1W3VA 4OHVA 2AYHA 5AFEA 2C5DA 3K75B 4QXHA 3TNQA 1B35B 1ZVFA 2NZ9A 1MS3A 4JGZA 1US2A 2P17A 1MZEA 3MF9A 4META 5FZCA 1Y9QA 1SDWA 2RJLA 1W0PA 4LKEA 4XDPA 4OHXA 3Q8FA 1V6IA 4YW5A 3E6BA 1H2MA 5BNPA 5FPXA 1HRV2 4JKKA 4JHZA 4FFFA 1NCRB 4EN8B 2J1TA 2D6LX 5FZFA 3K4DA 3WG1A 4M4PA 1H1MA 1PGW1 1UY3A 2PHLA 3RYPA 3LIHA 1PHMA 1AL23 3POWA 4UFLA 3SHRA 4YNIA 1DHKB 1F5JA 1IG3A 1SCSA 3DCQA 5FZ0A 4AHYA 1N1SA 3LPFA 1QQP2 5A3NA 2VCAA 1CJPA 1VB2A 3VBSB 1I5PA 2ES3A 4RR3A 4EN7B 2JIGA 1C8NA 3I2HA 3JB8A 3DKQA 5C6CA 4OMCA 5FY4A 5IUQA 3RWNA 4OMDA 2P5BA 2VVFA 1IKPA 4YW6A 4UFKA 5KHGA 2VMIA 4N9IA 3UL2A 3T2OA 4IEXA 1JOJA 5J37A 4FAHA 4FQ4A 2HEVF 2DFBA 4Q0SA 4TLFA 4XJ8A 1RVF3 2WWSA 1GSLA 4GH4B 4BIFA 1POV3 3J7HA 2JDNA 5FY9A 4IXLA 1IPKA 4BQ1A 2W1UA 3OGRA 4LHLA 5CBLA 4N43A 1OF3A 4XJWA 1ZRDA 2BDRA 4YSFA 5F1RA 1MS0A 1LOFA 1KGYA 1WMDA 2R071 1CPMA 3PVEA 4K8RB 1H8TA 2A5ZA 3PMEA 1DU3D 1U5IA 4AFCA 2CWMA 2JEMA 1R1A2 4QDRA 4A4AA 1ASJ2 2A3WA 4HL0A 4B7EA 1QJU1 4NWWA 1QJX1 3WF0A 4IE5A 4CP9B 5IVJA 1VBC2 5ERLA 5FP3A 3RPQA 4FOVA 4Y22A 2AGSA 5L7OA 5I8TA 4XQWA 4LBLA 1DZRA 4DFSA 5JLVA 2W2IA 2W87A 1NLQA 3TNPB 2XBO2 2WQ4A 2EXIA 4N90A 1WCUA 1HKDA 2EIBA 4J6GA 1DGRA 1OOPC 1VBA2 1VAKA 4KI5M 2PAEA 5BNOC 3URFA 5JPNB 2HWC1 2BU9A 2VOXA 4DUXA 1ACCA 1Z0HA 2A6YA 3LAGA 4QKDA 3TEYA 4FAGA 2XMLA 4FSJA 5DN2A 4E27A 4GULA 3A0NA 1O5LA 4RS5A 1LECA 2VH9A 4ZXEA 1AR72 3I2FA 4N53C 4MXWA 4Y20B 2W1SA 2VXRA 3PUSA 3TOJA 4XJ9A 3GZUC 1RYYA 3H42B 4KWUA 3VKLA 1F35A 3RS6A 1NXD1 1QH7A 3GJAA 4U36A 5F3EA 1VAVA 2JDZA 2L9LA 5G05L 2JKBA 4QKBA 1W6MA 2VTXA 2R073 1F8VA 4QPGC 3MI8A 4HN1A 1NZCA 2PLV1 3PURA 2WS91 4AWDA 2F17A 1IPJA 5I8YA 3V0BB 3AKQA 2IZWA 3VDDA 5HCHA 2ARBA 3OUJA 5D8AC 2WLQA 2B46X 1E5IA 1QJX3 1UMHA 2ZX1A 5I0SA 3AYAA 3H50A 2NQYA 2R063 3HBKA 5GKAC 4LUMA 3RRDA 1K5MA 4N7IA 5IVYA 3ZYBA 2E26A 4MGKE 3PUHA 5C3OA 4XPVA 3NRUA 3WG2A 1FT9A 1HN1A 2E7TA 2OUJA 2KXLA 1D2QA 4K1ZA 4XEZA 3OD4A 3OPZA 4Y1VA 3VKFC 4WM8A 1V9U2 1QNWA 2JWPA 3T30A 4BWOA 1MS4A 1RUOA 3ZN6A 1DBNA 1VP6A 5JSPA 1UMIA 4J25A 5ISLA 4QPYA 1ZM1A 3UKNA 4ZZ8A 4XF4A 5GZDA 1A8DA 1TE1B 1ENQA 2ZGKA 2ZGSA 2CDOA 1OD3A 4NUBA 4AVAA 1OKOA 3LE0A 1WA4A 2V5YA 4DY5A 3S7IA 1QOOA 5KC5A 2XLGA 4OYUA 2BPA2 1V70A 4XCBA 3M3IA 2YPJA 4L9BA 1HJFA 5F6LB 1RUE2 1IQDC 3RDIA 2YZ4A 2J42A 5AC93 3ZFEB 3I2KA 4AE2A 1Y43B 4FPYA 4MH0E 1ND3A 2WAAA 3UV9A 5FR3A 1C4RA 2QQMA 5A1LA 5I0TA 1DLCA 5A3TA 1E5RA 3NAPA 4JKMA 3D6EA 1W9TA 2VG9A 2XVLA 2ZHKA 3MIDA 2JXAA 4LPLA 3A4UA 4NPRA 1MZ6A 2RDQA 3TN91 3CJXA 3MYXA 4FPFA 5DZGA 4NIHA 4V1PA 1VRH3 1JYXA 5GLZA 1SBEA 2V4VA 1DQ1A 1XQNA 1XU2A 2ADDA 5JOWA 3CU7A 3UKTA 2XJVA 3HQRA 4H7LA 5LA0A 3KB5A 4ZY9A 3THPA 3I2GA 1UQXA 2AC1A 3IIIA 3AFKA 3LEGA 2Q5TA 4ZONA 2V4AA 2VZ1A 4XFAA 3WP4A 2BZDA 4LLOA 2OUHA 4WVMB 3VHNA 3SCFA 3WT3A 1VMJA 4P9WA 5LK5A 3T3YA 4ASLA 4QQLA 3KHCA 4PIXA 1WW4A 2D7FA 1YFXA 1UZVA 2W47A 2WQ8A 1QMJA 3ZDVA 1R093 4I02A 1OI6A 3WG3A 2JB4A 1RJ8A 3TWIA 3MV01 2YBPA 2AEYA 4GIQA 4XJZA 1S55A 5EP9A 2RJ2A 3MEPA 2A75A 1OOPB 4GWNA 4UW4A 5BNOB 3ZYRA 4C91A 2VZRA 2XWBB 2DVFA 1W03A 4ZU4A 1I3HA 4ATFA 3GGLA 1D4VB 2UWBA 2OPKA 4L8QA 2RMU1 2B5HA 2XOMA 1PMJX 4ET7A 3O1MA 1BBT2 5DDJ2 1J1TA 3HN1A 3NKTA 3VV1A 1JBCA 4AW7A 4F83A 1SEFA 2BJSA 2QQNA 5FLIA 2JG9C 4OQ9A 3WP5A 3O0VA 4LA2A 5J36A 2VECA 3ETPA 5H9SA 5LW9A 4GWMA 4PIYA 1TQ5A 2ZKNA 1LR5A 1JU4A 1WLDA 2YUEA 5LEKA 3CIHA 2OVUA 1K12A 2OA2A 1UX7A 4XF9A 1BHGA 1RUC1 2ZEWA 3JQWA 3LF7A 3Q9OA 4JDNA 2WO2A 4QPGB 4MGTA 2R16A 5C8CC 5I8SA 3AZXA 5CNAA 4KWLA 3CEWA 4MHRA 5CKNA 2TBVA 1VBE2 2A70A 5D8AB 5I0DA 1G9BA 3AMQA 3GM8A 3FE5A 3NVCA 2W08A 1BCXA 3HBZA 4Q0QA 3QH7A 5J98B 1B35A 2QE3A 4P9JA 5FIXA 3ZM8A 2Q4SA 4UFMA 2OKXA 2VVEA 4LTAA 4HVRA 2N7GA 3NSTA 2WKKA 1DFQA 4PDWC 4M3CB 5L73A 1JS9A 1YXWA 2Q1FA 1H6YA 3DUIA 3PL0A 3ZXKA 1KDMA 4BZ4A 2QUOA 3HT2A 1L7RA 4NRQA 1F31A 3O7OA 4UXAA 5LBBA 1BEV2 1AR91 3SH5A 1HRV3 1N1TA 2P3YA 3LDRA 4JZRA 5FK7A 4HG6B 1X50A 2W95A 1LOAA 1WLWA 3UJQA 4IEWA 4UOJA 1YIFA 4JTNA 4RA0A 4FP3A 2XJPA 2FZ2A 2PAMA 1C28A 4KU8A 5FBZA 1LULA 1VE0A 2C6SA 1HN0A 2LALA 3VBSA 3I4IA 2E53A 4D3WA 1S0JA 5J09A 3KV4A 2FCVA 4HK9A 1G8WA 4I09A 5BNQA 5GZGA 1CZTA 3JD72 1ULEA 4SBVA 5KXDA 4XFBA 5BPXA 1QQP3 1RUC3 2NPIA 3J8F1 3LEMA 4X8PA 1ZBE2 1PO11 2R0FA 4L11A 1OLME 4GKXA 3ME2A 5LRRA 4BQXA 4P08A 4RHV2 5J7MA 4QX7A 5IVCA 1APNA 4ONUA 5A3OA 2OW4A 1JYVA 4PF5A 1F5FA 4K21A 3RG0A 2WBKA 4CDUC 3RQ0A 1PIV1 5F32A 2JENA 4CUAA 5JDBA 4I2OA 4AFMA 2VQ0A 5KWRA 1YUDA 1ZA7A 3VBOC 3DYPA 2ZABA 2WQZC 5DXDA 1TMF2 3A7QA 1NY72 3UESA 4YZ5A 1RXGA 5FBJA 3E5XA 2B4KA 4Q0PA 4Q4W1 2RR11 1HV0A 2XGXA 1NT0A 5BY5A 4CE8A 4PBOA 2QQOA 1QJEA 3LWCA 3RJRA 1C5IA 2RJKA 4HVOA 4CP9A 3T0BA 1J1LA 4QX8A 4XZPA 5FYVA 4ZKTB 1RMU1 3CKHA 5F3GA 4Y1UA 2WYSA 5IW0A 2BERA 3U1XA 1E5HA 1QH6A 1SCRA 1T6GC 1VBC3 3HNYM 4ARXA 2D6MA 2GP5A 2ZA9A 4P14A 4GKYA 4EWDA 1AR61 3WF3A 2CL2A 1ONAA 2XBO3 4HKLA 1WCDJ 3WW1A 4OI2A 1QJZA 3J7NA 4K40A 3POGA 5EZWA 2GH2A 1MEC2 2VZQA 3FLPA 3ENRA 3AK0A 3J8F3 4AEMA 2H6CA 2WFF2 5FUPA 2CSGA 3LDKA 1N47A 3MW3A 4BU2A 2R6QA 2YU2A 1ZBA2 1UF2C 3LA3A 4Y20A 5IVEA 1GP5A 4LIUA 5FYTA 5A3WA 1AX2A 5FXWA 1WUVA 2V5DA 2TNFA 1X9TA 4JCKA 2JG9B 4KNCA 1DYKA 1BVVA 1PIV3 4NVPA 1SACA 1WKYA 4B3NA 2PXJA 3WDWA 2EICA 4QKFA 3MGUA 1QIQA 5JMCA 5A7NA 1CGPA 2D40A 5GLTA 3POJA 2Y34A 1VBD2 3ZYFA 4WVWA 4Y4RA 3H8UA 3V0BA 2IXHA 4PJYA 4BQWA 1T6BX 2RR13 2VTXJ 5C8CB 1YQ2A 2XXZA 5APAA 2BNNA 1GICA 3PU8A 1SFPA 2KD7A 1WCKA 2XHNA 1REDA 1IKQA 1OA3A 4LO4B 1W6OB 1Y9MA 4EZ4A 1W9YA 3U78A 5G04L 3LKJA 1DG6A 4AI8A 1XNTA 2RS13 1W2OA 1JW6A 4XZUG 1AR63 2DUOA 3ACIA 1RUI1 1UYPA 5FZHA 1TZOA 1EY2A 2Y38A 5LBCA 1PZ8A 3WSOA 2IC1A 5BXXA 1R64A 4JGYC 1IPSA 1IHMA 5A7OA 3OY8B 1OBNA 3T2QA 2RS31 3H3LA 3JB4C 3RMYA 4TLGA 1ODNA 4LBNA 5L36A 1M4WA 2R30A 4I3PA 4DQAA 3ILNA 1AVBA 1OF4A 2PHDA 2Q1MA 4FPGA 4CU6A 5LY1A 2PYTA 3N7MA 1SQ4A 4KGQA 4XJUA 3WDVA 1JTZX 4CA9A 5ACA2 5CFDC 3IAPA 1CAVA 4P9LA 3ZKUA 2AENA 2Q0AA 1V6KA 2JE7A 4HN0A 1LODA 2G9FA 4NWVA 3VD7A 4YZ1A 4RR3B 4XMAA 5HCAA 3EO6A 1Y9GA 1CX4A 3LQCA 5CVRA 4FTBA 3ZVXA 4D7YA 5F5CA 2OYZA 1LHNA 5JCTA 5L19A 1CVNA 2BFUL 5FOBB 2ZX4A 4CDUB 4QX2A 3MV11 3AVSA 4RD7A 4PF1A 3LEIA 4BPZA 1MZFA 3VBOB 1W6NA 1H30A 1HXS1 3WW2A 2VOWA 1HB2A 3CMGA 4H55A 1DQ0A 3B69A 1FPN2 4QX5A 3RYKA 4BA6A 4ZZ5A 5EIYB 2V72A 4Y5Z0 2BBAA 1YFYA 2GC1A 2WYFA 4NHXA 1ZZCA 4WVMA 5A7SA 3WV6A 2E31A 1JZ5A 2YC0A 2G9ZA 5A1AA 4QQ2A 2RM21 4PT6A 1HV1A 1FOD1 2JDHA 3NQHA 5KHKA 4AR2A 1GNHA 3E6DA 1H2NA 3ZXEA 1N1VA 5L7OB 4RFRB 3TBDA 4AGRA 3MZHA 3SKJE 4BLIA 1OOPA 4IETA 5BNOA 3SCGA 3V0AB 3OBRA 2QQLA 4XILA 2OX0A 5M0TA 1PGL2 1UO9A 2FDJA 3ZYHA 3ZSEA 3IDCB 2DVGA 1EV11 1NQJA 5FDBA 2PHXA 3N4MA 5FXVA 2HWD1 3NJYA 5FPVA 4Q4V2 2EIEA 4YG0A 3UETA 1COV2 3ZYJB 3B93A 1WMXA 4AEJA 4GD4A 3EMRA 2GH8A 2WZPP 3U10A 4MXVA 4UWDA 4WVVA 1J3RA 2HWB1 4N53A 4FBFA 5DZEA 1H4HA 1UKRA 3KQ4B 1MR5A 2BP6A 3GNEA 5FZLA 5JXIA 3W20A 5FP4A 4XQ4A 3PNAA 1PM4A 4XBQA 5GJ6A 3ZN5A 4DXRA 4QPGA 1QDCA 4OUMA 5E89A 1HXS3 2YB7A 3IDEA 1W6MB 3RJ2X 5D8AA 3ES4A 4ITCA 3FJSA 3UKVA 3IMNA 5A33B 5CFCC 3H3UA 4KG0A 3NV3A 2CV6A 4F8AA 4WV8A 2RM23 1A3KA 4Z92B 1AXKA 2FDKA 1TNRA 4MGZE 4PQ9A 5KXEA 5JSRA 2WWUA 1Q8PA 2ZMLA 3MW4A 1RINA 1VBE3 2K9ZA 3HR9A 1O3SA 4NHLA 3HQXA 3NV1A 5LK7B 4H3WA 1WW7A 3IPVA 2JX9A 5IK5A 4QX3A 3OUIA 1WMEA 1DGWX 1QEXA 1XYPA 4DUVA 1RUJ2 2VCBA 4SLIA 3H1MA 5KXBA 4QT6A 2BGCA 2FBEA 2VNVA 4RL7A 4AK3A 5T52A 3BU7A 4BB3A 4JGYB 1PX4A 3BB6A 2MEV1 4BCUA 1UXXX 3AJYA 3A22A 3ZN6B 2HBTA 4DB5A 3O1TA 1OVSA 1SFYA 5TSWA 2X8KA 3KT1A 4LK6A 3AP7A 3PTYA 3AP5A 3PJYA 5LA2A 3EXUA 3I8TA 3N3HA 3PHMA 1F2NA 3AC0A 4B4QA 3WDYA 4CU9A 5CFDB 3WNPA 1YYNA 5A1FA 4RGKA 4XUPA 2YPDA 4XFFA 3S6PA 2DVBA 1TME2 2JG8C 3GCWA 3GZEA 1BVP1 4B4PA 1NUKA 3POEA 5CG8A 3U75A 1NA1C 3NNLA 2X5IC 5A6XA 2VNOA 4ES9A 1W8ZA 3WUDA 1ND2C 2GZWA 2LM3A 3WP3A 4BQ4A 1GZWB 3KCXA 3POSA 1OD5A 4BK4A 2BEOA 1UCXA 4CXWA 2VL4A 1Q43A 4I0AA 3PMSA 4EQVA 2EF6A 1J58A 4X6QB 3HNMA 2XKPA 4UBGA 1UZZA 3PUQA 3LGRA 2GN7A 2PA7A 4MLOA 3CJIC 5JVVA 1R1ZA 3VZOA 1QJY1 2W91A 1ZZ8A 1Y7BA 3I59A 4Q29A 3OYWB 1SMVA 3JZVA 3ZIWA 3FX3A 3KHBA 3WX5A 4ATEA 5T54A 4UW5A 3SEEA 4AVCA 2MEV3 4HT1T 2VAUA 1A78A 5FMBA 4CCMA 2VU9A 1OLQA 3RFRA 3FHIB 1G9DA 2B8MA 4W8JA 1MACA 1PVC2 2DURA 3KF5A 3LOBA 5FZBA 5GLVA 1G9FA 2UU8A 1X33A 4Y4YA 4QDSA 1RHI2 3T4HB 3J7LA 4S2DA 3ZX7A 1VPHA 1A6CA 1IGOA 1ZREA 2BVBA 1N1YA 2D3RA 2A1XA 1GZCA 4CDWC 3WCRA 4Q2FA 3PUAA 2JG9A 1AL21 1NOVA 4BXFA 1NXMA 3FC0A 2E63A 2X10A 5GZFA 1QWRA 4MUVA 3RZLA 2QNKA 1KITA 4A2UA 3VZNA 5FWJA 3DL3A 2G19A 3ZXDA 1ZZ9A 5JXHA 4JVAA 3Q8AA 4KWKA 4NPLA 5C8CA 4FTEA 3PVBB 1QJY3 5JI9A 2W92A 2F6BA 4EN9B 1EP0A 1VMFA 1PMIA 2XLAA 2ZGUA 5E16A 4EYUA 5CFCB 1BQPA 3ZR5A 4JDMA 4YLZA 2ILMA 4IE6A 1W6OA 4URTA 1POV1 1W99A 2Y64A 4XFCA 2ID4A 2D6OX 4M01A 2XUEA 1E57A 2B45X 1JODA 1OHFA 2HWE2 5FO9B 2VVDA 5B4XA 3EJKA 1V6NA 5IAVA 2E51A 1JHNA 4RFT0 3TN92 5JOZA 4EN6B 4PDWA 4YVSC 1LOGA 3LFIA 5FP9A 2PTMA 3ZPYA 2XVKA 2BYVE 3ATGA 2XL7A 3OY8A 3H7YA 3OB8A 2VE1A 2BBVA 5IFPA 1SLAA 3MUZ1 4DPNA 2OPWA 3I3QA 2PN5A 5HV0A 1YHFA 2UY9A 5IVFA 1QHDA 1JOPA 2EAKA 4E4HA 1Q8VA 5FKBA 3CHXA 4KBZA 2O0OA 3POYA 4BHPA 4FFHA 5JUVA 3A21A 2IXCA 1XNCA 4LJHA 4D8MA 1AX0A 1DQ6A 4HOOA 2VQAA 3K77A 1U5YA 1VLNA 2VULA 1RUG2 4NPMA 2TEPA 2JG8B 2YU1A 4K6BA 1W90A 1OH4A 1AR81 4Y1ZA 2XQXA 4YRDA 1Q8OA 2E33A 1NA1B 4G3YC 4XTMA 4QHOA 2FDFA 1OFSA 4ZS3A 3MHZA 3U11A 3M1HA 2C24A 3E5UA 4I3GA 1ND2B 1CQ9A 3E1F1 5FZ9A 4CDUA 4QDQA 2Y6GA 1PO22 2VC9A 3DYOA 3ILFA 3J7MA 3OBAA 4XAEA 3S5QA 5HXMA 2FMDA 3VBOA 2WINB 3MPPG 4W6WA 1J59A 1SPPA 1WD4A 3OTFA 5FZ4A 3MBWA 4D6SA 3CQOA 2EXKA 4UFIA 5KBFA 2ZGLA 2WT0A 1VIWB 4AEDC 3H0OA 5JOYA 5FJKA 3BTAA 3CJIB 3T4VA 1U0AA 3AZWA 3K3NA 4MHUA 1ENSA 4BLJA 4H14A 4CEWC 3T0DA 3QLQA 3N36A 4OHWA 3RYRA 1YLLA 2XONA 1FPN3 2HBUA 2GDFA 2GMPA 3AKRA 2R061 4QD2A 3BYWA 4MZUA 4UW3A 4XUOA 4AI9A 1GYKA 4XXAA 5FO8B 4CTEA 5FRAA 1CAXB 1CN1A 2BTVC 3MIHA 3V0AA 2NN8A 1VBB2 1AUYA 2GU9A 1ULCA 4ZS2A 3MIBA 5LATA 2QVSB 5C70A 1RC6A 1JZ7A 2WZR2 3SH4A 4YVWC 1YJLA 4QQHA 5FY5A 3PVOA 3B00A 1MVEA 2DBIA 2TUNA 1W8OA 4L92A 3H9AA 4CP0A 1AR83 3MUY1 2EVXA 4LO6B 3ZSMA 2WNEA 1OT5A 2VBDA 1UWWA 4GQ7A 1AZDA 1C8M3 5DABA 4XXPA 4CDWB 4CCKA 1OURA 5KHJA 3R4SA 2A3XA 2AZ5A 2CGNA 4HXCA 5AFBA 4YWAA 5IWFA 3ASIA 1FV2A 3AB0A 3GBGA 5J96B 1GBGA 1RUF2 1QXPA 2W1QA 4LORA 3J9SA 4RQPC 3UJOA 1DCSA 4YZ4A 1PO12 3EB7A 2VBBA 1NAEA 2P1BA 2CAUA 5A33A 4L0PA 2ZZQA 1ULDA 2W5FA 2VMCA 3U07A 1PVXA 4ES8A 1DP0A 1POV0 1ENRA 2YXSA 4QGNA 3UGFA 3HMYA 3U37A 3AMNA 3P3PA 3VDCA 4AAXA 3JBG1 4MSVA 4XYXA 5FZ6A 1VRH1 1IS5A 1D7PM 1ZRCA 2E7AA 2VOKA 4EZHA 2ZEXA 4QU2A 2OZ6A 3FLTA 1LENA 4NR1A 2ZHMA 4DMIA 4Q4W2 5CIRA 4YG3A 4V2VA 5K0UC 4IERA 2VTFA 3H1WA 4AHWA 2RS52 4A7KA 3QD6A 1GR3A 4JGYA 4KBBA 1VJ2A 4C8DA 3TB0A 1L7QA 3F95A 4DY3A 1DDLA 1I5ZA 2GAUA 1X36A 3ORJA 1I9RA 2EAAA 1U5ZA 2NMNA 1FNYA 3RZZA 3SKVA 1NYWA 1R091 5CFDA 2MNGA 4C1WA 2WNUC 2ARXA 3DECA 1F9KA 1YQCA 3X29B 3RWKX 4XIOA 5FZMA 3HN3A 4QGMA 3SISA 4OQ8A 3WZ1A 3ES1A 2D97A 3HPNA 4LOTA 1CAVB 5F9TA 5HV4A 3T08A 5SV8A 1R081 1NQDA 2QDRA 1GZWA 3N9LA 1EPWA 4R52A 4BIOA 3K3OA 2Y6KA 1A8MA 2FHRA 1PZ7A 2RG4A 4YZ3A 3TYJA 3SITA 2Q8OA 1BLZA 3PTRB 2WRAA 2CU5A 3DF0A 3JBG3 2QTWB 4LBMA 4A6SA 4OFGA 3IWZA 4QX1A 4YFZA 1NLRA 2R042 2ZGTA 2HJIA 3IT8A 1US3A 2GNTA 1BYHA 1D0HA 4UYBA 1GQPA 2ZOEB 3OYWA 1AYN3 4GB33 4AEDB 1OA4A 4IEVA 4GWIA 1HJGA 4DNYA 3NL1A 4M0HA 1W6NB 3O1SA 2CAVA 4N8MA 2DTWA 4YARA 2WT2A 2ZHNA 5J3UA 5BYNA 2UURA 4CEWB 2E6VA 3OBZA 2E7QA 1W28A 2YBKA 1KJRA 2OIIA 5JAXA 1NCQC 4E8CA 3H8OA 1FYUA 2C0ZA 1G9CA 1FAYA 3AMHA 1YFUA 2X29A 4PHZA 2WR9A 1YJKA 2QKDA 3VHOA 1GP4A 4MADA 5JOXA 1JOBA 2XB6C 3VZMA 1YI7A 2IXLA 1W8HA 4ARYA 5LZ6A 1REFA 2XDVA 2WABA 5C3RA 5EJ1B 1MVQA 5LWBA 2IXJA 1EAH1 2HWF2 2O8OA 4IL7A 4LR4A 4MOAA 5K9YA 3KLSA 4YVWB 2WO1A 5FZAA 4IGPA 3W5MA 4EROA 5EPAA 2JDYA 1Z7S2 2YGMA 1RUD2 3FWEA 3RGBA 1S4CA 3FFQA 1R083 2ZGPA 2A73B 3KV5A 1ULPA 1HRV1 2I45A 2E9QA 1O4TA 4ISRA 1S1AA 3IM0A 1LTEA 4XHBA 3C7EA 4N53B 2UWCA 3LA2A 4IEYA 3INAA 2UWAA 3DXUA 2D6KA 2YFZA 4YW3A 3C7GA 2JE9A 4LEJA 4L99A 4RQPB 2W46A 4IQPA 3S5AA 5GLUA 4OZOA 3UGGA 4RSUA 4D94A 1QQP1 1LU1A 3ELNA 3JU9A 3OUHA 4Y5SA 3H8XA 1D0GA 4K20A 5CFCA 1RUH2 2YC4A 2ORZA 1AF9A 4YM2A 4XW3A 3I3EA 5D21A 2W9XA 4C90A 4F3JA 4QKNA 2H6BA 4HLTA 4LULA 1A34A 4A7YA 1XC6A 3PLQA 5LBEA 2XPJA 4DXSA 2V73A 1UOBA 4NN0A 3C7HA 5FYCA 5EYYA 2CGPA 3WW3A 2VW1A 1XOYA 4LK7A 1FMD2 3OSDA 3NO8A 1TVGA 1EAH3 4FPCA 5K0UB 4CCOA 3IPVB 1WD3A 2HWE3 4EWAA 2VZVA 3DEMA 4IGOA 1CZVA 2PMWB 3WHUA 4Q5OA 1UOJA 3POFA 3D3AA 4CZSA 3NNFA 4YGDA 2WJSA 2YY1A 1GFF2 1X7NA 1UIKA 1VAMA 1R1A1 1ASJ1 3BODA 4LNVA 2QQPA 1WWYA 3HOBA 3E5QA 3S30A 4EV0A 4NMIA 2BWAA 4BM8A 2Y8KA 1VBC1 2P37A 2ZGMA 3N7LA 2WNUB 5F3IA 5FKCA 4W4ZA 1K45A 4M3CE 1QXRA 1HW5A 1EV12 2JG8A 3R05A 1NLSA 2I07B 2XBO1 4NE9A 5H9QA 2HWD2 2W0XA 1QU0A 3KCYA 1NA1A 1W3XA 2W1WA 5BV6A 2DBNA 2X5IA 5K8SA 1FXZA 3JUUA 1O4ZA 1OXCA 3I7DA 1HX6A 2VW0A 1ZNPA 4Y1XA 4HVQA 1XXNA 2LS6A 1ND2A 1VBA1 1HRI2 1HQWA 3D8CA 3NV4A 5FYHA 2ZGNA 1YIPA 1CR7A 1IG0A 2JICA 5A70A 3AXEA 2I2SA 5FY0A 1H0BA 1WBLA 5FMOS 2YGLA 2O1QA 3KQRA 4DIQA 1KXGA 1STMA 3P5BA 2OT7A 3ZN4A 1ENXA 1O4YA 4CU7A 4P5HA 1LOBA 4LBQD 4KQ7A 2J22A 3AFGA 4JAAA 1AR71 4Q4Y2 3CJIA 3ZO0B 3PIJA 3SQOA 5T3NA 3UNPA 3R6SA 4E2GA 1AXZA 5EJ3A 1GP6A 4V2WA 5IJRA 1AYM2 4PLNA 3WF2A 1O3RA 3I59B 3NWKA 4BQ5A 2NP0A 3THCA 5DG1A 2W39A 1FNZA 2RDSA 4QXKA 1NCQB 5F2WA 3WNOA 3MLJA 1QGLA 3AJZA 1R1A3 1ASJ3 1OH3A 1UOGA 1CAXA 1H8VA 2DU0A 2V09A 1J84A 1W04A 5CA6A 1PX3A 2H0BA 4LA3A 2R32A 2WAOA 4HSJA 2G4IA 3BGAA 3ON7A 2AACA 1W2UA 2RS11 1W2TA 5T5JA 2DCKA 3W21A 1MS1A 2BNOA 4LXLA 3ZXLA 2HLEA 4NIDA 3DGTA 1NKGA 2D44A 4UI9L 2B9VA 4P00B 4BISA 3GHNA 5J48A 4CDWA 4OUEA 1VBA3 1V9U1 3ECQA 2WC2A 4XBNA 3RNSA 1UU4A 1ODMA 3BTXA 3ZMNA 1QNYA 5EV7A 2JKXA 1OPOA 1V6JA 2F4PA 3DPRC 1ZZBA 1D4M2 3USUB 3ACGA 1ZRFA 1F15A 1XSRA 2Z2SB 4WBBA 3E6CC 1AR73 4UT5A 5DG2A 3VKOA 5FPZA 3WF4A 3OGVA 2ADEA 2FDGA 1RUF3 3L2YA 4COYA 1V0AA 4OULA 1RUE1 3MF6A 2CTVA 1DGLA 3BTZA 3AKPA 4RN5A 4CU8A 3IKWA 4UAPA 2QDNA 5ANNA 4C0HA 3M7AA 2WO3A 1LGCA 2BGOA 4Y26A 4COVA 5ABJC 4PI2A 1K5JA 2EALA 2FZ1A 2Y6LA 4PQQA 1LHVA 3ALQA 4HMZA 1WW5A 2MHFA 2GC0A 2XL9A 3O1PA 3ACFA 2R1BA 2GN3A 2JIJA 3IBMA 4RYDA 5DUVA 4YVSA 5CISA 2NYYA 2BUKA 1VALA 2QFEA 3VD5A 1JXNA 4MGSA 4AQ6A 5EFUA 4AXOA 4PDWB 5CZKA 2Q8CA 1URXA 2D98A 3H3ZA 1BMV2 2P4EA 4Q4X2 3WXPA 3KMHA 1DZQA 1LOCA 1POQA 1SLBA 4IV1C 2ZMKA 1Q3EA 2XG3A 4AGVA 1V9U3 5CEHA 3CZUA 4CCNA 1UY0A 4FOYA 4GWJA 2CHHA 1FI2A 1UZWA 2IXKA 2PHFA 2PHTA 1OUXA 2YYOA 3B7MA 3CLPA 4MGYE 5LCWL 5FV3A 1GNZA 2FCUA 2VCMA 2XR4A 5FREA 4K8FA 2VZOA 3W58A 5FZGA 2RDNA 1O3TA 3SNMA 5CU1A 3O14A 4J1WA 3I49A 3I2OA 5F5AA 1TNFA 3APBA 3WUCA 1RUE3 4QM9A 1AL22 1W6QB 3KV9A 3NJXA 2ET1A 3B01A 4CCLA 5BNNC 4QMAA 2DV9A 2QQKA 4GA9A 2PELA 1NG0A 4A45A 3WG4A 5DDJ1 1JZ3A 1QKQA 4AEDA 2JDMA 2VZ3A 2Z69A 4O61A 1GU3A 1DGWA 3R0RA 1SPPB 1O8PA 4A7ZA 4FCAA 1DQ5A 1H9WA 4HPKB 4QU1A 2J1EA 4B1MA 4CEWA 1S0EA 2ZGOA 4XFHA 3GDBA 4Z1VA 1NE6A 3UT0A 5A6QA 1YEWA 4XUNA 1RVF2 3WQ1A 4FFGA 5ANQA 5IK7A 4CYDA 4FPLA 2J1AA 1CX1A 3O0XA 3DYMA 1LOEA 1YQ5A 4GZ9A 4D69A 5FYMA 1G7YA 4LOSA 2W68A 1WW6A 4UFJA 1VBE1 4CEYC 4IESA 1DYOA 4NOTA 4BE3A 5FK8A 4M3CF 1UNBA 2JD9A 4YVWA 3IAQA 1JYTA 4P9XA 4OCTA 1S0BA 4XUQA 4R9CA 5IK8A 3S57A 3RZMA 4LBQA 1BZWA 4LKSA 4KGGA 1S0CA 2J1RA 3R4DB 5FZOA 5FQ0B 2A6XA 1PGW2 1LB2A 2VUJA 1SLCA 1JZ4A 4MYEA 1IQAA 5I0UA 3KSCA 3WDUA 1RUD3 4QB2A 1GQGA 3ZXGA 4CPBD 2RDRA 1BEV1 1UYXA 5DAXA 3DPRB 3HWJA 2W52A 5I0RA 2YC2A 3ACHA 4RQPA 1BBT3 4PCRA 1MS8A 5DDJ3 4KU7A 2ORXA 3DKWA 2RVAA 2JE8A 3KT4A 5IHRA 3NJZA 1HB4A 4L2NA 1KRIA 2Y6HA 1V00A 4OHYA 5JXGA 5GALA 1ZBE1 2A6ZA 1CAWB 2QQWA 5ABJB 1QOTA 3N7KA 4XFIA 5F37A 1KS5A 2GP3A 3N9NA 4RHV1 1XPWA 4AI1A 2P34A 5A3LA 4ORFA 3M8LA 2ZX2A 5T5OA 2R072 3EBRA 5CAZA 2VZTA 4Y1YA 3K51A 5K0UA 5EQUA 1XNAA 3HIFA 3VD9A 1XRUA 1PK6C 4K1YA 4E2SA 4XVHA 2OZJA 4AHZA 2ARCA 4JX0A 2ZEYA 4P02B 3MIFA 1JZ8A 3HAGA 1QJU2 3J4UH 4ZXKA 3WNMA 1TMF1 5EHDA 1NY71 1QJX2 2P6HA 4QPWA 4HFSA 2CGOA 1DGRN 4FPOB 4BH9A 4IV1B 4FTSA 1PZ9A 5E88A 1CESA 3WDXA 5FYUA 1CZSA 3ZYPA 5C7GA 2WNUA 4KL1A 3V56A 4XACA 4WM7C 3VDAA 2JD4A 5HBAA 1KD7A 1BEV3 5B4NA 5C3PA 4COZA 4M4RA 3VBUC 2VNRA 1UU6A 2HWC2 2Z4FA 1GOFA 3P3NA 4DINB 2K0GA 3KVAA 4IV3C 4DRRA 5FYZA 1XE7A 2OS2A 2RV9A 3VZLA 4CVUA 4W6YA 1KFXL 1XYOA 3LFMA 3PUIA 3O1OA 1OLMA 4DEQA 1Y3TA 3JD73 3LEKA 1MEC1 2IXIA 4HK8A 4LLFA 3ZOIA 5BNNB 5F39A 2PHWA 1ZBE3 2WFF1 3OD0A 3Q8CA 2DU1A 4HZFA 4PBPA 1ZBA1 2WUHA 4RHV3 1ULGA 2EA7A 5AC92 2LRPA 4UF0B 3W59A 4ZHNA 4AAPA 1MQTC 2WL1A 3RI8A 1GWLA 4FPKA 4M00A 5T5LA 3CF6E 2PLV2 4S2GA 2WS92 5AVAA 3WNNA 3W9AA 4Q4Y3 1IZ3A 1UOFA 3AZZA 4IEPA 1W06A 1AHSA 5C33A 1NCQA 3AXDA 1G86A 1TMF3 1VBD1 4JHTA 3SXWA 1SG3A 2J7MA 2Q30A 2XKOA 5E1RA 1AYM3 2JDPA 4YM0A 5GZCA 3G6JB 4YYOA 4MV2A 4GH4C 4B4RA 1LHUA 1WGPA 3LB9A 3PVNA 5FP7A 1SZBA 4CEYB 4O9EA 3AYEA 4BOWA 1LEDA 1LESA 3HNBM 5JZGC 4AEKA 4LO5B 5C8WA 4NHYA 2DFCA 1W6PB 4LMFA 3GALA 1C1FA 3K46A 4CCDA 1XE0A 1W0NA 2ENRA 1S2EA 1W9SA 3DXTA 3ITQA 1GV9A 4B8EA 1YO8A 1W9FA 2KM2A 2OQ6A 1MEC3 2ZZJA 4YW2A 1RB8G 2GSYA 2AUYA 3LOIA 5A7QA 5C4WC 3SMHA 3USUA 1OFNA 2WFF3 3ZDSA 1DZTA 1ZBA3 3RZHA 5IVBA 3T09A 3I3MA 4CP2A 2XWJB 2YV8A 1JZ2A 2YG0A 5ACA1 4QQPA 4D7SA 3K48A 2A7AA 1GNYA 4FP2A 1D4M3 4E4SA 2ARAA 5FTTC 1LKNA 2KA3A 5DUWA 4AQ2A 1TG7A 2CWSA 1CAUB 2CDPA 5JPMB 2MPFA 2I74A 1VBD3 1JH5A 3GCXA 5FXZA 1DYPA 2QZ3A 2HEWF 1WLCA 4XE9A 2BVVA 2DWRA 3V65A 4ASMB 4YM3A 3ILRA 1SHWB 4TWTA 2DVDA 3BKZA 3BPSA 1JUIA 2VOTA 1GLHA 2VM9A 3FL7A 4R9BA 2WA3A 1RTVA 5CG9A 1SLIA 1QOSA 4K7JA 4Y3OA 4XJAA 2K2SA 1PK6B 3A23A 3D0JA 3MFAA 3I2JA 2OXBA 2JB8A 1QXJA 4IW3A 4LBOA 4YG6A 1JHJA 3AX4A 3I2DA 4YGEA 3HVDA 1FPN1 3KZ4C 3FN9A 4YPJA 5FZDA 3KS7A 1DQ4A 1KS4A 3ZSLA 3BOPA 1QJFA 1XYNA 4BMEA 1X82A 1LJ7A 2DUPA 2X09A 1G6NA 5C5UA 2P6CA 4NAMA 3C7OA 3WCSA 4WM7B 1C3HA 3IZOA 3KCCA 3M3CA 3VBUB 1W8TA 2B42B 3C8XA 1W9WA 1JZ6A 4IV3B 5ACA3 1OVPA 2Y60A 3G7DA 1PGL1 1K42A 2RMU2 1P8JA 1W6QA 2LW8A 1YWKA 3O0WA 2X5IB 1KEXA 4KG8A 4AOCA 1RUNA 3ZYGA 4L97A 1C8M1 3DV8A 4XHXA 2R0HA 2VCCA 1GWMA 4Q4V1 4AL9A 5JWPA 1COV1 2AH2A 2RE9A 3H1YA 3UYJA 5A3MA 2VGDA 4A3ZA 4HONA 2GC3A 4EE2A 2ZPXA 1UKGA 5JMOA 2R49A 2GMMA 4A42A 5FUIA 2VOVA 3S0MA 3IN9A 4HPKA 5A7WB 3T2PA 1RUC2 1MQTB 4YZ2A 4CCCA 1FV3A 3M3OA 3ZFEC 3QOPA 4DZGA 1LGBA 2D3PA 1UPSA 1K3IA 2DUQA 5IATA 1SFNA 2VUDA 1IOAA 2ZS6B 3VBRC 5E6HA 1FATA 3M4FA 1HIXA 4CDXC 1OQEA 1W2NA 1H9PA 4WZFA 4DRVA 3HT1A 2WSVA 2UYAA 4NROA 4BQYA 4MG2A 3SCHA 5LEJA 3O5SA 1W05A 5FO7B 2JDKA 5FAXA 4EN0A 3I97A 5SV5A 5FYSA 3AP4A 2ET7A 2GMEA 2WZ8A 3OPWA 5JZGB 5FZKA 1LGNA 1LHOA 1H6XA 1XNBA 2D6PA 2RHPA 2XH6A 1OUSA 3OGSA 5HCFA 5FQ0A 1S0FA 5F8PA 4FOWA 4Q8KA 1RUJ1 1AR92 3CO2A 2BQPA 2BRTA 3GHMA 1VB4A 3NNJA 2VR4A 3AM2A 1XNKA 1X9PA 4FT8A 4HANA 4TYSA 3DPRA 4HETA 5L9BA 3CNAA 3VL9A 4Q4V3 2WN2A 2HYKA 1COV3 1UY1A 5C4WB 5FUNA 2WO7A 5T50A 2CY6A 4E4DX 3LZZA 1MS9A 2GALA 3ZFFC 2PHUA 1RIRA 1AJKA 1UD1A 3J8F2 4PIZA 4LT5A 3WDTA 4AVSA 4FPHA 3BPZA 1WCSA 1GKBA 4TN7A 2Q8EA 1TME1 4LBJA 1CAWA 1AXYA 2ZX0A 3ZIXA 5ABJA 4PI0A 2DDUA 4BMBA 3VBHC 2Y0IA 1HQLA 4MGQA 1PIV2 2VO5A 4OZXA 4QB1A 3THDA 1W0OA 4PLOA 2QJVA 4CP1A 1BJQA 1LNSA 2D43A 3M3QA 1JI6A 1OC1A 1AYN1 1OMIA 4LIVA 4GB31 2RR12 5D2AA 2VY0A 2D5HA 1CIYA 1FX5A 1ZZ7A 4YVSB 4Q1RA 2ZAHA 1HB3A 1IS4A 2FMYA 2D3SA 4WZCA 2Y26A 1SLTA 2G9GA 2XQRA 5C9AC 4IV1A 1YC61 5LASA 4I01A 1RMU2 1RUJ3 4Q1PA 3SLIA 5EYXA 1QJU3 1YFWA 4DXZA 5C3QA 2J1VA 2PQSA 4C1XA 4KMQA 2RS12 3OEAA 4TXWA 1S2KA 3VBFC 2QBXA 5JR2A 2P3KA 1W8NA 1JN2P 1OKQA 1SDDB 3IB3A 1AR62 2ATFA 2WA4A 5IYYA 1UZ0A 1PVC1 5LBFA
chains in the Genus database with same CATH topology
3O12A 3BCWA 3U0ZA 3ZFGC 3VN4A 1YRZA 2HWC3 1C5HA 2Y0OA 2Z42A 1X8MA 3E97A 5BNNA 1RHI1 1TME3 1X8EA 3KGLA 3AMPA 4TSVA 4FPEA 2GNDA 5GM0A 4Z07A 3A0KA 4OI0A 4I30A 1PNGA 1H1AA 4LUKA 2AREA 4NO4A 1RL3A 1AX1A 4ZU7A 1UMZA 1XE8A 2WLPA 3BOWA 4YGBA 1H2KA 4H7MA 3AZVA 3WOGA 1UX6A 3ZSKA 3VBRB 2PLV3 2WS93 4KWJA 1UN1A 3FMGA 1J3QA 4CDXB 4G9SB 4N9HA 4CEYA 1S0DA 4GALA 2ETEA 5JR7B 4ISQA 4AI0A 1CIWA 3GBWA 3NKGA 3VZJA 1RUI2 1JYIA 4Q0UA 4QPIA 1W6PA 2HWE1 4GMP1 4LE4A 5A32B 3GBFA 4UW6A 3QBQA 1PVC3 1YCIA 2RS32 4HKWA 4LBQB 5T55A 4Q27A 1W39A 2DYCA 1N3OA 1RJ7A 1RHI3 2ZGRA 2XLFA 1QY4A 4XIKA 2LUWA 5IK4A 4OVEA 1ULFA 1UW8A 4R4XA 4Y24A 2GNBA 5E8AA 3WINE 2A71A 2C1FA 2ZGQA 3ZFFB 3IDBB 1WBFA 1CAUA 2AR6A 2EXHA 4XMIA 1RUG1 4R8HA 1Q56A 1TEIA 4CDQC 3AP9A 2P2KA 3LA7A 4R9AA 3VBHB 3I54A 1KDKA 2GNMA 5FCCA 3EHKA 3TRSB 3TN93 1HXS2 1PO21 1PK6A 1PNFA 3OF1A 4RGGA 4GMP3 3B5LB 1Q8SA 4P9GA 3MDPA 5EXOA 2RM22 4JTOA 2VUAA 1CPNA 5C9AB 4IEUA 1FOD2 4XF0A 3CL1A 4OUSA 1BKZA 5B2GB 4WM7A 5FFOC 1SLLA 2WNVC 4QHBA 3VBFB 3VBUA 4OHZA 2WIIB 3USSA 4EJRA 4NHMA 1O7FA 4IV3A 2XJUA 4JGZC 4X6RB 4Z2WA 4YFWA 4K3UA 5KC6A 1VBB1 1CJDA 2YHJA 3OGGA 2WZR1 1NCRA 2A6WA 1QDOA 4YGCA 5GLWA 2WT1A 3ZFGB 5HI0A 2EXJA 5BNPC 4I0WB 1RUG3 2HWB2 2ZBJA 2ZHLA 4XTPA 4XOGA 3VL8A 3AKTA 2LTNA 2H0VA 5H9RA 2RMU3 4JDOA 1C57A 2X53S 3MLLA 3VKMA 5FMOL 4FXKB 1ZA4A 2XJSA 5K7PA 4Q8LA 1MQTA 3B9IA 1UIJA 1PO23 4AQSA 3JCIA 3VHPA 1SBFA 1O91A 4AYUA 2JJ6A 3ZYIB 4YM1A 3ZSJA 2SBAA 1RUF1 1NE4A 2EIGA 4RR3C 1GZ9A 2IWGB 4MX3A 1KQRA 3M70A 3KT7A 3WY6A 1EPZA 3MW2A 4C0BA 3D4KA 1LCLA 4GH4A 2B7YA 2R1DA 3NV2A 5LRSA 5JZGA 1S0GA 1OQ1A 4GMP0 3VLBB 2XJRA 2ZACA 3KGZA 4QM8A 4LO7A 4N43C 3ZXAC 1LOFC 2JECA 2MEV2 1VBB3 3KD4A 1H8TC 1XNDA 2RS51 2WZR3 3N35A 5JIAA 5C4WA 1AR93 2UYBA 3LCPA 4FQZA 1KFUL 1REEA 3FZ3A 5L7OC 4E4ZA 2YMZA 3KM5A 3MLKA 3GZAA 3OJBA 1U12A 4JV4A 4MVTA 3R4UA 1B09A 3BALA 3D5OA 5FLHA 4Z8BA 5KHIA 3MIGA 1JUHA 1PO13 4CDQB 3M2MA 3RI9A 1XU1A 5H9PA 3LSEA 4XFGA 2D5FA 2NLRA 2P3IA 3WHTA 1H2LA 4B29A 1CD3G 4RS5C 4Q26A 1ALYA 1QJY2 4IEQA 4P9YA 2R041 2Z5WA 3T1MA 4QGLA 3T2TA 3B02A 3ZXJA 1U5XA 2YROA 2XVGA 1MZ5A 2XHKA 1AJOA 3FLRA 2XJTA 4Q4W3 5F6KA 1LU2A 2D93A 2DTYA 4LHKA 4ZU5A 2RS53 4J1XA 3VKNA 4QQOA 1C1LA 4FOQA 4INDA 3M3EA 1ZYBA 1RGSA 2ZKLA 3VDDC 1PM7A 4E2QA 2XUMA 1RMU3 5BUVA 1MS5A 2WNVB 2BW8A 3WR0A 1I1EA 4JQRA 2ZJCA 2WFPA 3THTA 3VHRA 1K5MC 1YI9A 4RGAA 2DCYA 3VUOA 4R4ZA 4N7UA 4JGZB 3NW4A 1OLRA 2HWF1 4LHNA 4I0BA 1S0IA 4AF9A 4AI2A 5JI7A 4WM8C 5BNPB 1Z7S1 2CYFA 1RUD1 1H1IA 2BWCA 1ZX5A 2VMHA 4DOUA 2A6VA 2ZTNA 4FO9A 1BBT1 2D6NA 1O5UA 1YNAA 1ZRRA 1GQHA 3ZFEA 2HEYF 5CADA 4HBNA 4U2AA 2R043 1AL0G 4XETA 2DCTA 3AZYA 1UU5A 3VBRA 2DCJA 2PFWA 4CDXA 3GZTB 1ND3C 3B9CA 3B94A 4E9KA 1RUH1 4OI4A 4O9GA 3V64A 2BFUS 3NAPC 1OPMA 3PJQA 4AI3A 2DCZA 4HSLA 4EWEA 1V6MA 2P3JA 3WP6A 1IS6A 2VPVA 1PGSA 4FPJA 5A32A 2B9UA 3BIWE 1LHWA 4N43B 3MICA 3FUQA 1FMD1 4QPIC 3WQ7A 1M06G 5HCBA 5I93A 4AVVA 1RUI3 1H8TB 2HWF3 3QACA 4LO8A 3D82A 4FXGB 2GC2A 4BYYA 5IT6A 3LSDA 2ZX3A 1Z7S3 2RS33 1UPIA 1DQ2A 1HDKA 4CRQA 1UAIA 1BXHA 2PHRA 4Y22B 5DUUA 3JQXA 3ZFFA 5KHHA 4TZDA 2VMGA 1AR82 2UY8A 1HLCA 3B3QE 1GANA 3GF6A 3OCPA 5EWSA 4A3XA 1C8M2 3WNXA 4W6XA 3VBHA 3H7JA 1UZYA 3JD71 4OLLA 5DUXA 2NM1A 3AMMA 3VGIA 1HRI1 1RUH3 3ETQA 4AFAA 1DLLA 3FBMA 5JSOA 3GYDA 1RITA 5JIUA 1Q8QA 4X8NA 1DF0A 2ZAAA 4RS5B 1UL9A 1I6XA 4MXWB 3AYDA 2FQPA 3WLUA 4R9DA 4S2HA 5T5PA 5C9AA 4Q4Y1 4COUA 4MGIE 1Q5OA 4AFBA 4PLMA 1FMD3 2ZCWA 4KH9A 4XBLA 1VR3A 2R062 4M0NA 1AYM1 2QCSB 1WMFA 4AQTA 3VDDB 3VBFA 1FOD3 5FOJB 1B35C 3AYCA 3J26N 4LE3A 3DN7A 2HKXA 5F5QA 4FVVA 1K5MB 4M3CA 1D2SA 1CONA 1ZZ6A 3ZFGA 4AGGA 4JRAA 3VZKA 4AFDA 1H4GA 3OGJA 2SLIA 1EV13 4JRLA 2DF7A 2IFWA 1LRHA 1NCRC 4WM8B 2HWD3 3S7EA 1O3QA 4DS0A 1BK1A 4S2FA 3EQEA 3UK9A 4YW4A 2PAKA 1HRI3 3AKSA 2HWB3 4XDQA 4XF1A 2QZ2A 3OBTA 2Z79A 5FLJA 5I91A 2ZMNA 4B7KA 3VBSC 4G4FA 1D4M1 2ERFA 4HKOA 4XF3A 1N3PA 3JBG2 1ND3B 1VRH2 3ACLA 1OQDA 4GXLA 1KJLA 4COWA 3FFZA 4IEZA 1V6OA 2O8QA 3SH3A 3NAPB 4AHXA 1HQNA 1AYN2 4GB32 3N7JA 2YDEA 1EYBA 2DVAA 3MPBA 2PQQA 4IEOA 5KXCA 4UBHA 1IS3A 1Z78A 2Q1ZB 2VNGA 4QPIB 5AVPA 4YW1A 2C9AA 2B39A 5DZFA 1L3JA 3L9JT 2IFRA 1V6LA 4JC1A 1R092 1BMV1 4Q4X1 4K9SA 3C3VA 4W65A 1QF3A 1OA2A 3QH6A 3WVJA 3TAYA 3AP6A 1SBDA 5HXVA 3RMXA 1JYCA 3D0SA 4XQDA 4NHKA 2A3YA 1N3QA 4LBKA 1J3PA 1R082 5CB7A 3WW4A 3MFCA 3RSJA 4F7ZA 1LEMA 3WQ0A 4Q0VA 2VW2A 4P9IA 4CDQA 4AVBA 3IIAA 3FUOA 2XJQA 1WLTA 3MIEA 3ROUA 1OSGA 3FBYA 4WVZA 2BNMA 2NMOA 5D1IA 3ZXFA 3L2HA 4AG4A 3U4XA 5GZEA 3T1LA 4Z82A 3ZMOA 3WD5A 4OI1A 2CNAA 3QCWA 1G9AA 4D7TA 1S2BA 1DIWA 3HD8B 3C2UA 1RVF1 2WNVA 4Q4X3 2WSUA 4AVTA 3ST7A 1EAH2 4OHVA 2AYHA 5AFEA 2C5DA 3TNQA 1B35B 1ZVFA 2NZ9A 1MS3A 4JGZA 2P17A 1MZEA 3MF9A 4META 1Y9QA 1SDWA 2RJLA 1W0PA 4OHXA 4YW5A 1V6IA 3E6BA 1H2MA 5BNPA 5FPXA 1HRV2 4EN8B 1NCRB 2D6LX 3WG1A 1H1MA 1PGW1 2PHLA 3RYPA 1PHMA 1AL23 3POWA 3SHRA 4YNIA 1DHKB 1F5JA 1SCSA 4AHYA 1N1SA 1QQP2 1CJPA 1VB2A 3VBSB 2ES3A 4RR3A 4EN7B 5C6CA 1C8NA 3JB8A 5IUQA 3RWNA 2VVFA 1IKPA 5KHGA 2VMIA 4N9IA 3UL2A 5J37A 4IEXA 1JOJA 4FAHA 4FQ4A 2HEVF 2DFBA 4Q0SA 4TLFA 4XJ8A 1RVF3 2WWSA 1GSLA 4GH4B 4BIFA 1POV3 4IXLA 1IPKA 4BQ1A 4LHLA 5CBLA 4N43A 4XJWA 1ZRDA 4YSFA 5F1RA 1MS0A 1LOFA 1WMDA 3PVEA 2R071 1CPMA 1H8TA 2A5ZA 3PMEA 1DU3D 1U5IA 4AFCA 2CWMA 2JEMA 1R1A2 1ASJ2 2A3WA 4HL0A 4B7EA 1QJU1 4NWWA 1QJX1 1VBC2 3RPQA 4FOVA 4Y22A 2AGSA 5L7OA 4XQWA 4LBLA 1DZRA 4DFSA 5JLVA 3TNPB 2XBO2 2WQ4A 2EXIA 4N90A 1HKDA 4J6GA 1DGRA 1OOPC 1VBA2 1VAKA 5BNOC 2PAEA 5JPNB 3URFA 2HWC1 2VOXA 1Z0HA 2A6YA 3LAGA 4FAGA 4FSJA 4E27A 4GULA 3A0NA 1O5LA 4RS5A 1LECA 2VH9A 1AR72 4N53C 4Y20B 4MXWA 2VXRA 3TOJA 4XJ9A 3GZUC 5I8TA 3VKLA 3RS6A 5AC91 1NXD1 1QH7A 4U36A 1VAVA 2JDZA 2JKBA 1W6MA 2R073 1F8VA 4QPGC 3MI8A 4HN1A 1NZCA 2PLV1 4AWDA 2WS91 5I8YA 1IPJA 3V0BB 3AKQA 2IZWA 3VDDA 2ARBA 5D8AC 2WLQA 2B46X 1QJX3 2ZX1A 5I0SA 3AYAA 3H50A 2NQYA 2R063 5GKAC 4LUMA 3RRDA 1K5MA 4N7IA 4MGKE 4XPVA 3WG2A 1FT9A 2OUJA 2E7TA 2KXLA 1D2QA 4K1ZA 4XEZA 3OD4A 3OPZA 4Y1VA 3VKFC 4WM8A 1V9U2 1QNWA 4BWOA 1RUOA 1MS4A 3ZN6A 1DBNA 1VP6A 5JSPA 4QPYA 1ZM1A 3UKNA 4XF4A 5GZDA 1A8DA 1TE1B 1ENQA 2ZGKA 2ZGSA 4AVAA 1WA4A 2V5YA 4DY5A 3S7IA 1QOOA 5KC5A 2XLGA 2BPA2 1V70A 3M3IA 2YPJA 4L9BA 5F6LB 5AC93 1RUE2 3RDIA 2YZ4A 3ZFEB 4AE2A 1Y43B 4FPYA 4MH0E 1ND3A 3UV9A 1C4RA 5I0TA 3NAPA 3D6EA 2VG9A 2XVLA 3MIDA 2ZHKA 4NPRA 2JXAA 3A4UA 1MZ6A 3TN91 3CJXA 3MYXA 4FPFA 5DZGA 4V1PA 1VRH3 5GLZA 1SBEA 1DQ1A 1XQNA 1XU2A 5JOWA 3CU7A 3UKTA 2XJVA 4H7LA 3KB5A 3THPA 3AFKA 2Q5TA 4XFAA 3WP4A 4LLOA 2OUHA 4WVMB 3VHNA 3SCFA 3WT3A 4P9WA 5LK5A 4ASLA 4QQLA 4PIXA 1WW4A 2D7FA 1YFXA 1QMJA 1R093 4I02A 1OI6A 3WG3A 1RJ8A 3TWIA 4GIQA 4XJZA 1S55A 3MEPA 2A75A 1OOPB 4GWNA 4UW4A 5BNOB 3ZYRA 4C91A 2XWBB 2DVFA 4ZU4A 1I3HA 4ATFA 1D4VB 2UWBA 2OPKA 4L8QA 2RMU1 2B5HA 1BBT2 5DDJ2 1J1TA 3HN1A 3NKTA 3VV1A 1JBCA 4AW7A 4F83A 1SEFA 3WP5A 5FLIA 2JG9C 5J36A 3O0VA 4LA2A 2VECA 5H9SA 4GWMA 4PIYA 1TQ5A 2ZKNA 1LR5A 1WLDA 2YUEA 5LEKA 2OVUA 2OA2A 3UJOA 4XF9A 1RUC1 3JQWA 3Q9OA 4JDNA 4QPGB 2R16A 5C8CC 5I8SA 3AZXA 5CNAA 4KWLA 3CEWA 2TBVA 1VBE2 2A70A 5D8AB 1G9BA 3AMQA 3FE5A 3NVCA 2W08A 1BCXA 3HBZA 4Q0QA 3QH7A 5J98B 1B35A 2QE3A 4P9JA 2Q4SA 2VVEA 4LTAA 4HVRA 2N7GA 3NSTA 2WKKA 1DFQA 4PDWC 4M3CB 5L73A 1YXWA 3ZXKA 3DUIA 1KDMA 4BZ4A 2QUOA 3HT2A 1F31A 3O7OA 4UXAA 1BEV2 1AR91 3SH5A 1HRV3 1N1TA 1X50A 1LOAA 1WLWA 3UJQA 4IEWA 1YIFA 4JTNA 4RA0A 4FP3A 2XJPA 2FZ2A 2PAMA 1C28A 4KU8A 5FBZA 1LULA 2LALA 3VBSA 3I4IA 2E53A 4D3WA 1S0JA 5J09A 4HK9A 1G8WA 4I09A 5BNQA 5GZGA 3JD72 4SBVA 1ULEA 5KXDA 4XFBA 5BPXA 1QQP3 1RUC3 2NPIA 3J8F1 4X8PA 1ZBE2 1PO11 2R0FA 4L11A 4GKXA 3ME2A 5LRRA 4RHV2 5J7MA 1APNA 4ONUA 2OW4A 4PF5A 1F5FA 4K21A 3RG0A 4CDUC 3RQ0A 1PIV1 2JENA 5JDBA 4I2OA 4AFMA 2VQ0A 5KWRA 1YUDA 3VBOC 2ZABA 2WQZC 5DXDA 1TMF2 4YZ5A 1NY72 3E5XA 4Q0PA 4Q4W1 2RR11 1HV0A 2XGXA 5BY5A 4PBOA 3LWCA 3RJRA 1C5IA 2RJKA 4HVOA 1J1LA 4XZPA 4ZKTB 1RMU1 4Y1UA 1QH6A 1SCRA 1T6GC 1VBC3 2D6MA 2ZA9A 4P14A 4GKYA 4EWDA 1AR61 2CL2A 1ONAA 2XBO3 4HKLA 1WCDJ 3WW1A 4OI2A 1QJZA 4K40A 5EZWA 2GH2A 1MEC2 3FLPA 3ENRA 3AK0A 3J8F3 4AEMA 2H6CA 2WFF2 1N47A 3MW3A 2R6QA 1ZBA2 1UF2C 3LA3A 4Y20A 1AX2A 1WUVA 2TNFA 4JCKA 4KNCA 2JG9B 1DYKA 1BVVA 1PIV3 4NVPA 1SACA 4B3NA 3WDWA 3MGUA 5JMCA 1CGPA 2D40A 5GLTA 1VBD2 4WVWA 3H8UA 3V0BA 2IXHA 4PJYA 2RR13 5C8CB 2BNNA 1GICA 1WCKA 1REDA 1IKQA 1OA3A 4LO4B 1W6OB 3LKJA 1DG6A 4AI8A 2RS13 1JW6A 1AR63 2DUOA 1RUI1 2Y38A 1EY2A 1PZ8A 2IC1A 5BXXA 4JGYC 1IHMA 3OY8B 2RS31 3RMYA 3JB4C 4LBNA 5L36A 1M4WA 2R30A 4I3PA 4DQAA 3ILNA 1AVBA 2Q1MA 2PHDA 4FPGA 2PYTA 3N7MA 1SQ4A 4KGQA 4XJUA 3WDVA 1JTZX 5ACA2 5CFDC 1CAVA 4P9LA 2AENA 2Q0AA 1V6KA 2JE7A 4HN0A 1LODA 2G9FA 4NWVA 4YZ1A 5HCAA 4RR3B 4XMAA 3EO6A 1CX4A 5CVRA 4FTBA 3ZVXA 4D7YA 2OYZA 1LHNA 5JCTA 5L19A 1CVNA 2BFUL 5FOBB 2ZX4A 4CDUB 4RD7A 4BPZA 1MZFA 3VBOB 1W6NA 1H30A 1HXS1 2VOWA 3RYKA 4H55A 1DQ0A 3B69A 1FPN2 4QX5A 4BA6A 4Y5Z0 1YFYA 2GC1A 4WVMA 1ZZCA 3WV6A 2YC0A 4QQ2A 2RM21 1HV1A 1FOD1 5KHKA 1GNHA 3E6DA 1H2NA 3ZXEA 1N1VA 5L7OB 3TBDA 4AGRA 3MZHA 4BLIA 1OOPA 4IETA 5BNOA 3SCGA 3V0AB 3OBRA 4XILA 1PGL2 3ZSEA 3IDCB 2DVGA 1EV11 1NQJA 5FDBA 2PHXA 3N4MA 2HWD1 4Q4V2 4YG0A 3ZYJB 1COV2 3B93A 4AEJA 2WZPP 2GH8A 3U10A 4MXVA 4WVVA 1J3RA 2HWB1 4N53A 4FBFA 5DZEA 1H4HA 1UKRA 1MR5A 3GNEA 4XQ4A 3PNAA 4XBQA 5GJ6A 3ZN5A 4QPGA 1QDCA 4OUMA 5E89A 1HXS3 3IDEA 1W6MB 3RJ2X 5D8AA 3ES4A 4ITCA 3FJSA 3UKVA 3IMNA 5A33B 5CFCC 3H3UA 4KG0A 3NV3A 2CV6A 4F8AA 4WV8A 2RM23 1A3KA 4Z92B 1AXKA 1TNRA 4MGZE 4PQ9A 5KXEA 5JSRA 2ZMLA 1Q8PA 3MW4A 1RINA 1VBE3 2K9ZA 3HR9A 1O3SA 4NHLA 3HQXA 3NV1A 5LK7B 4H3WA 1WW7A 3IPVA 2JX9A 5IK5A 1WMEA 1DGWX 1XYPA 1RUJ2 4SLIA 3H1MA 5KXBA 4QT6A 2BGCA 2FBEA 4RL7A 4AK3A 5T52A 3BU7A 4JGYB 3BB6A 2MEV1 4BCUA 3AJYA 3ZN6B 4DB5A 1SFYA 5TSWA 2X8KA 3KT1A 3AP7A 3PTYA 3AP5A 3PJYA 3EXUA 3I8TA 3N3HA 3PHMA 1F2NA 4B4QA 3WDYA 5CFDB 1YYNA 4XFFA 3S6PA 2DVBA 1TME2 2JG8C 1BVP1 4B4PA 5CG8A 1NA1C 2X5IC 2VNOA 4ES9A 3WUDA 1ND2C 2GZWA 2LM3A 3WP3A 1GZWB 3KCXA 3POSA 1OD5A 2BEOA 1UCXA 1Q43A 4I0AA 3PMSA 2EF6A 1J58A 4X6QB 2XKPA 4UBGA 1UZZA 3LGRA 2GN7A 2PA7A 4MLOA 3CJIC 5JVVA 1R1ZA 3VZOA 1QJY1 3I59A 1ZZ8A 1Y7BA 4Q29A 3OYWB 1SMVA 3JZVA 3ZIWA 3FX3A 3WX5A 4ATEA 5T54A 4UW5A 4AVCA 2MEV3